1NWWA

Limonene-1,2-epoxide hydrolase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
145
structure length
145
Chain Sequence
IEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSIDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNLSILGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Rhodococcus erythropolis limonene-1,2-epoxide hydrolase reveals a novel active site
pubmed doi rcsb
molecule keywords Limonene-1,2-epoxide hydrolase
molecule tags Hydrolase
total genus 44
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1nwwA00
4IIAA 3ROBA 5KP1A 2RFRA 5AIGA 3MG3A 3GRDA 3FZWA 3S5CA 2XR8B 3BB9A 3OWSA 3CNMA 1DMNA 3EBYA 3EN8A 1Q40B 4X2OA 1E3VA 3NV0B 1EG9B 1NWWA 2GEYA 3NUVA 3LYGA 3JUOA 3EX9A 4HM8B 2F99A 5AIFA 3B8LA 3LZAA 4FCMA 3CU3A 2F98A 5IF6A 5JPUA 4HM3B 3IPTA 2QGUA 4HZ9B 1UUWB 4H3UA 5D81A 3VGNA 3FKAA 1VZZA 3F9SA 3MG2A 5KP4A 1JKGA 4LGQA 5DREA 4HM1B 3SOYA 1ISKA 5KP3A 4Q53A 1OPYA 4XDVA 1W00A 3T8NA 1ASKA 3MG1A 3DXOA 3MKIA 3FF2A 1TP6A 3SEDA 3DMCA 1EA2A 4OUQA 4N3VA 3ECFA 1GYBA 1GS3A 3H51A 1QJGA 4CDLA 2B24B 2GBWB 3EF8A 3GZYB 3F7XA 5CXOA 1BUQA 1K41A 1ULJB 4J8TA 3K7CA 4R9LA 5AIIA 3NV0A 3B7CA 3F40A 3KKGA 3A76A 5TGNA 3FLJA 1OGZA 5AIHA 1OCVA 3G8ZA 2GEXA 2OWPA 2HMMB 2CHCA 5IEPA 1E3RA 4XBYA 3EQQB 3I0YA 3BLZA 3KE7A 2RCDA 2F86B 3F8XA 2R4IA 2YFIB 3KSPA 1W01A 1O7NB 4MJDA 4XBTA 2Z7AA 2IMJA 3OWUA 2HMJB 1GY7A 4XB5A 2Z77A 2CKFB 3GWRA 4R1KA 2INXA 3GZXB 4K1UA 3UJMA 3FF0A 2GXFA 2QIYA 3E99A 4XM4A 1WQLB 2BMOB 3OXAA 3EBTA 3WMDA 3H3HA 1OHOA 2GBXB 3CNXA 3JUMA 4OVMA 2UX0A 5D82A 5JPPA 5G2GA 5EVHA 1JN5A 1O7WB 2HMKB 3HZPA 3GZBA 1GY5A 3FH1A 3JUPA 1CQSA 4HZBB 4ORLA 4RZMA 3B4PA 7STDA 2BMQB 4L8PA 1E97A 2I9WA 3OWYA 4XDWA 5IENA 5CK6A 1IDPA 4L8OA 1STDA 1JN5B 3EHCA 3MHEA 4WYKA 1O7PB 2YFLB 1JB4A 1GY6A 3OV4A 3K0ZA 1ZO2A 5HGRA 1A2KA 2B1XB 3HX8A 3UNLA 5FW5A 2XRXB 2JQ5A 5DRVA 3EJVA 5CF2A 2HMOB 4XBXA 2K54A 4WYKB 5AEUB 4HJLB 4WP5A 1TUHA 3OX9A 3T8UA 2YFJB 4HM5B 5IG4A 2BMRB 5AEWB 1DMMA 4R9KA 3RGAA 3RGRA 4L7KA 3NBRA 1AR0A 1QMAA 3D9RA 5STDA 1JB5A 1DMQA 3CPOA 4HM2B 8CHOA 5CF1A 1OF5A 3FGYA 3NXJA 2PZVA 3GZRA 4U13A 1UUVB 5BXQA 2XSOB 5IEOA 3DUKA 3HK4A 1ULIB 4HKVB 1O7GB 3FSDA 1HKXA 2RGQA 3G16A 2HMLB 1OF5B 5CLKA 4STDA 5D83A 4HVNA 5AI1A 1O7HB 5IG3A 4I4KA 4FCJA 1SJWA 3JUQA 3SOAA 5BVBA 3EC9A 4HM7B 5IERA 4WWUC 2A15A 3MYTA 3MSOA 1S5AA 1C7HA 1ZX2A 3M8CA 6STDA 4KVHA 2XSHB 3F14A 1OH0A 1W02A 3Q90A 3KZTA 1Z1SA 3ER7A 1U5OA 3F7SA 3G0KA 5IG0A 1OHPA 3B4OA 3DM8A 1O7MB 1JKGB 2W2CA 1Q42A 4LEHA 4GB5A 2Z76A 2BNGA 2STDA 1NU3A 4PEJA 1OGXA 4J9AA 3NHXA 1JB2A 5IG5A 3NM2A 1OUNA 4HM0B 1Q40A 4X2HA 3DZLA 3EN1B 1NDOB 3VSYA 4K1VA 4LMIA 4HM4B 3F8HA 4HM6B 2HMNB 1W6YA 3STDA 3JUNA 1OHSA
chains in the Genus database with same CATH superfamily
4IT7A 3PXMA 1MGRA 4IIAA 3ALAA 3ROBA 5KP1A 1MWRA 3MPHA 4RNYA 3WA3A 3I553 2RFRA 1PYLA 5AIGA 3MG3A 1I8VA 3S27A 2W9QA 3GRDA 4BTYA 1FGTA 1MGWA 3FZWA 3S5CA 2XR8B 1T2HA 2XH9A 1M904 3BB9A 3OWSA 3CNMA 1DMNA 1BAOA 3EBYA 3CCU3 3EN8A 1D6YA 1Q40B 3N54B 4X2OA 1E3VA 1JJ22 1B2MA 2CFLA 3NV0B 1YVBI 1EG9B 2C4BA 1LXEA 2IUKA 1NWWA 2LQVA 2BHMA 3OW22 2GEYA 1N9EA 2XFTA 2WGQA 4EBGA 1MWSA 4IPBA 4FMDA 1TRPA 2W0QA 3PCSA 1VQ53 1F8NA 3NUVA 3LYGA 1HU9A 3JUOA 1K9M4 3EX9A 2P05A 4HM8B 2BT3A 4EYCA 2F99A 5EEOA 3X41A 1GD4A 1RDSA 4BL3A 5AIFA 3B8LA 1V74A 2Y74A 3LZAA 4FCMA 3CU3A 1BNGA 2F98A 1NB5I 3BNEA 2WOHA 2CG0A 3SYUA 1RMSA 1RCLA 1FYSA 5IF6A 2W56A 2CIUA 5JPUA 4HM3B 3IPTA 2QGUA 4HZ9B 4O8SA 7GSPA 1LVNA 4ILFA 3FCSB 1UUWB 4H3UA 5D81A 1M9GA 3UL6A 1UCKA 4I5QA 3VGNA 3FKAA 4JRFA 1DE3A 1BRSA 4O02B 3S28A 1VZZA 3CCS3 1BSAA 4ZM8A 3DY5A 1VQ93 1GOUA 2P09A 1B27A 4KT3B 3F9SA 1I3FA 3MG2A 5KP4A 1BUJA 2MF7A 1V58A 3KFQC 1DVCA 4N6NB 1BRNL 1JKGA 1JBTA 2RSXA 4LGQA 5DREA 1RGKA 4HM1B 3SOYA 3NBBA 1JBRA 2L4VA 1ISKA 1S723 1QVF2 5LC7A 5KP3A 4Q53A 3CCE3 2P38A 3T0UA 5M19A 1OPYA 1NJI4 4XDVA 1W00A 1W5ZA 1BSEA 1WMPA 3T8NA 1ASKA 3MG1A 2W56B 1R4CA 3AGNA 3SX1A 3DXOA 3MKIA 2KF6A 3TDGA 3FF2A 1RJOA 1TP6A 2KF4A 3SEDA 3DMCA 1EA2A 2C10A 2H0GA 1JV2B 3DGNA 4OUQA 2GSPA 5EQLA 4G1MB 2WOFA 4CJNA 1VQ43 1FUSA 3JVCA 1BGSA 2ML5A 4O3VA 4N3VA 3ECFA 1LQMB 1PU4A 1GYBA 1G02A 2RNTA 1GS3A 3H51A 1NO3A 1QJGA 2CX1A 3IJEB 2BU4A 3L0RA 4CDLA 1NB3I 3CCV3 3RNTA 4MMYB 1OACA 1RGCA 2B24B 1HYFA 2GBWB 1IQ8A 5ELUA 3WDGB 1A2PA 1ROAA 5IW9A 3BNDA 3EF8A 2W04A 4WHAA 2OQEA 1VQ73 3GZYB 1I70A 3F7XA 1RGFA 3K9MC 5CXOA 4GL6A 3HOHA 4R4KA 1BUQA 5G1LA 3LT8A 1K41A 1ULJB 1W2ZA 1TFKA 2H0HA 1KSIA 1JZDA 3K7CA 4J8TA 4JF8A 4R9LA 1Q7HA 5AIIA 4DKIA 3NV0A 3B7CA 2L1SA 1GOVA 3LTCA 3F40A 6GSPA 3KKGA 3U97A 1G0TA 1LRAA 3A76A 1A67A 1U8CB 1YHQ3 5TGNA 3FLJA 1OGZA 5AIHA 1OCVA 1RN4A 3IMAB 4KZ1A 4BL2A 4FMAA 1W2B2 4GHOA 3CME3 1MNLA 1B3SA 1STFI 1MOLA 1GMPA 3RDEA 3BU4A 2O3OA 2SARA 3X42A 4N6V0 3PCRA 3G8ZA 3V98A 1N5PA 2CFKA 1JZOA 3D5GA 1EKMA 4FMCA 5RNTA 1RTUA 2GEXA 2J8XB 4J5GA 2OWPA 1NNVA 3D5IA 1TJDA 4EV2A 1ROVA 2HMMB 2CHCA 3URPA 3X3ZA 5IEPA 3LTDA 1E3RA 1YJ93 1CYUA 4XBYA 3EQQB 2QA43 3I0YA 3BLZA 3KE7A 3KSED 4HOHA 1FA3A 2RCDA 1SIIA 4MMXB 9RNTA 2F86B 4H61A 2W9PA 1MWUA 3F8XA 2R4IA 2YFIB 2O9UX 1LOVA 3KSPA 2KF5A 1GOYA 1UCJA 1W01A 1O7NB 4MJDA 3LT9A 1WNHA 4XBTA 2Z7AA 3LXUX 1G96A 3NBRA 5I97A 2GU1A 1C54A 2IMJA 3OWUA 2HMJB 1KQS2 1GY7A 2AAEA 1YI23 1B20A 1I3IA 2Z77A 4XB5A 3EB8A 1BOXA 2CKFB 1HZ1A 1BANA 1FGMA 1QAKA 1VQQA 3WODG 2F56A 1TRQA 3GWRA 1RLSA 4R1KA 1BIRA 4EV5A 2GU3A 3DGMA 1RCKA 2CWVA 2INXA 3GZXB 5ELJA 4K1UA 2K3DA 1BRIA 4LYLB 3FF0A 3UJMA 1QVG2 2F5MA 2GXFA 2QIYA 5AYSC 1W6CA 3E99A 3HIIA 1X1WA 1VQL3 1RGGA 2KRTA 2E2VA 2E2UA 1WQLB 1BSDA 2BMOB 4XM4A 3OXAA 3EBTA 3WMDA 1DVDA 2M7OA 3H3HA 1AQZA 1K28A 1CEWI 2UGIA 1UW1A 1DETA 5M1AA 1OHOA 3UL5A 2CC3A 2GBXB 3CNXA 3JUMA 3N8BA 4KFFA 1T3BA 2Y73A 4OVMA 2UX0A 5D82A 1QAFA 1UCIA 5JPPA 1IYYA 3D3LA 2WGOA 2KXGA 1SIHA 5G2GA 4BTXA 3S29A 7RNTA 2XFSA 4RBNA 3NM7A 3NQYA 4AKYA 1BSCA 2CH9A 3EE1A 1W6GA 1YGWA 1B2XA 1GMQA 3ZG0A 1FGQA 5EVHA 1JN5A 3LTAA 1O7WB 2HMKB 3HZPA 3GZBA 1VQM3 5G1KA 1J2BA 1GY5A 3BIRA 2ZDJA 3FH1A 3CCM3 1M1K4 3D79A 2KF3A 1US1A 4MMZB 3WR2A 2SBLA 3X3XA 4N6UA 3JUPA 5GSPA 1CQSA 2MC8A 1YGEA 1EEJA 3HIGA 4HZBB 4ORLA 4QWTA 3VF1A 4GSPA 1UGHI 3CD63 4RZMA 2FGTA 3B4PA 3NX0A 1SQWA 3SLUA 7STDA 2BMQB 4N6LA 2W03A 4L8PA 1E97A 2I9WA 1B21A 1BVIA 3OWYA 4XDWA 2IUJA 1LNHA 2P0XA 1LOWA 5IENA 1I2GA 5CK6A 4N6MA 1VQ83 1WMOA 1IDPA 4L8OA 2CFGA 2ML6A 4HYZA 1UUGB 1STDA 1JN5B 1BNJA 1KD14 1SPUA 3EHCA 3MHEA 2FNQA 1VQO3 1M1XB 4N6TA 4MEIA 4WYKA 3S67A 1O7PB 1RKYA 2YFLB 1JB4A 3LOYA 1UGIA 3D4AA 1MWTA 3V99A 5JBSA 2XGNA 1GY6A 3A5EA 1WTHA 2BO9B 1FW7A 3PYJA 3KCHA 4BTWA 3OV4A 3K0ZA 1ZO2A 3ZG5A 1R4YA 4N6OB 4NREA 2Q07A 1IT8A 1N9JA 1VQP3 1BRJA 1BNFA 1T5YA 2RBIA 4AEQA 5HGRA 2CWTA 1LQGC 1A2KA 1RGEA 2B1XB 3HX8A 3DH2A 1BRGA 3UNLA 1RNTA 2XRXB 2JQ5A 5DRVA 5FW5A 1BNEA 2FXTA 3EJVA 1YJW3 1BRKA 2ZL8A 4KFDA 3WA2X 1IVVA 5CF2A 2HMOB 3O8YA 4XBXA 2C11A 3CCR3 1RHLA 1QALA 2K54A 3AHSA 4WYKB 5AEUB 3DGYA 4HJLB 1PFPA 4WP5A 3CCJ3 1TUHA 3OX9A 3K5TA 3G6E3 1TTOA 3T8UA 2JDIH 1Q864 2LYXA 3J7Yd 2YFJB 1A90A 4RNTA 3Q3FA 4LSOA 4HM5B 3ZFZA 1LOYA 5IG4A 1Q814 3AMOA 2BMRB 4J5KA 2E2TA 4O2HA 5AEWB 3CPW2 1KWIA 2OOVC 1DMMA 1RGLA 1UCLA 3WHOA 4R9KA 3RGAA 3RGRA 2AADA 3BNBA 4L7KA 3Q2PA 2HOHA 1AR0A 1IU7A 1QMAA 2KAAA 2XEPA 3D9RA 3DGLA 1FUTA 1W4NA 3HI7A 5STDA 1JB5A 4BIRA 1DYUA 1B2ZA 2CG1A 4R80A 1DMQA 4EXRA 2ZA4A 3CPOA 4HM2B 8CHOA 1CH0A 4FMBA 1IQXA 2CW9A 1PY3A 5AYRB 3CC43 1RGHA 4NHFA 4K61A 4FR9A 1BSBA 5CF1A 4KFEA 1FZUA 2Z6BA 2XGLA 1GMRA 1V57A 3GSPA 3NQZA 1OF5A 1YIJ3 4TX4A 2F5WA 3FGYA 3NXJA 2CX0A 3FG3A 2PZVA 3G713 3CCQ3 3GZRA 3AMOB 4U13A 1B2UA 1TU5A 3I563 1I0VA 1UUVB 5HOHA 5BXQA 2XSOB 1TFOA 5IEOA 1EUIC 3DUKA 1JBSA 3HK4A 1ULIB 5LC6A 3CMA3 3QK9A 4HKVB 1O7GB 4K90B 3FSDA 1B2SA 5A0OB 1HKXA 1K734 3QRDA 3MWZA 2RGQA 1N8R4 1EQKA 4NPBA 1UI7A 1LNIA 1IV9A 3G16A 2HMLB 1UDII 1WMNA 1I2EA 3LH4A 1OF5B 5CLKA 4STDA 1T2IA 5D83A 1BNSA 4HAAA 3N9HA 4BU4A 1AV4A 1YVSA 4HVNA 5BIRA 6RNTA 5M18A 5AI1A 1O7HB 3LTBA 1N8QA 4I4KA 5IG3A 1YIT3 4FCJA 3WOEB 1SJWA 3JUQA 4AKZA 1D6UA 1Y4KA 3SOAA 3WOFB 1AY7A 1Q824 3X3YA 1JNQA 3PS8A 5BVBA 4FCZA 3EC9A 4HM7B 5IERA 1IK3A 1RRHA 4WWUC 1RSNA 2A15A 3G4S3 2KCDA 3MYTA 2OTL3 1BRHA 3MSOA 1YJN3 4CPKA 1D6ZA 1X1XA 2CFDA 1S5AA 1C7HA 1ZX2A 1SARA 2H0IA 2OCTA 1L5GB 3BNCA 3AHWA 3M8CA 6STDA 1VQK3 1RGAA 4KVHA 1FGOA 2XSHB 3CC73 3F14A 1OH0A 1W02A 4OK0A 3CCL3 1IQYA 3Q90A 2R41A 4CCVA 5FGOA 3KZTA 1N5HA 1Z1SA 4EW5A 8RNTA 3SXXA 1IV7A 1RN1A 2ZHXB 3FG4A 3ER7A 1IVUA 2WO0A 2OTJ3 1X1UA 3KN4A 1U5OA 3F7SA 3G0KA 3SVAA 5IG0A 3GAXA 1OHPA 1Q7Y4 1IVWA 1FGRA 3B4OA 1AVKA 1UI8A 2BIRA 2UUGC 3DM8A 1K8A4 1O7MB 1CYVA 1JKGB 1I0XA 2IY2A 2W2CA 1A2VA 1Q42A 4LEHA 2D42A 4GB5A 2Z76A 3UB1A 3PGBA 2BNGA 2STDA 1NU3A 4HBRA 4PEJA 2XF3A 1OGXA 2V1LA 1ZS7A 1KC84 4J9AA 1JRQA 1X1YA 1GD3A 1ZGXA 2PNCA 3LMLA 1Q9EA 1JB2A 2YX9A 2P0MA 3NHXA 1IVXA 3AGOA 3CC23 5IG5A 2IA7A 3X40A 4WFOA 1VQN3 1BNRA 1W7CA 3DGOA 2K0MA 3U1WA 3NM2A 4EC6A 1OUNA 4HM0B 4LZIA 1Q40A 1BNIA 2IYJA 2OQEC 2F4YA 1RRLA 3V92A 1VQ63 1TIJA 2CFWA 4X2HA 1IT7A 3Q1CA 2CWUA 3DZLA 3EN1B 1NDOB 3K63A 3KIIA 3VSYA 1FUWA 3PZWA 1GSPA 2D1WA 3FG1A 4K1VA 1YNVX 1LOXA 4HM4B 1AVLA 1RN7A 4LMIA 2OOVA 2QEX3 1RNBA 4RNZA 3F8HA 4HM6B 3NBJA 1I2FA 2HMNB 1BU4A 1W6YA 3STDA 3CXC2 5BU4A 2CK3H 3JUNA 1OHSA 2W6JH
chains in the Genus database with same CATH topology
4IT7A 3PXMA 4IIAA 3ALAA 3ROBA 5KP1A 3MPHA 4RNYA 3WA3A 3I553 2RFRA 5AIGA 3MG3A 3S27A 2W9QA 3GRDA 4BTYA 1FGTA 3FZWA 3S5CA 2XR8B 2XH9A 1M904 3BB9A 3OWSA 3CNMA 1DMNA 3EBYA 3CCU3 3EN8A 1D6YA 1Q40B 3N54B 4X2OA 1E3VA 1JJ22 2CFLA 3NV0B 1YVBI 1EG9B 1LXEA 2IUKA 1NWWA 2LQVA 2BHMA 3OW22 2GEYA 1N9EA 2XFTA 2WGQA 4EBGA 4IPBA 4FMDA 3PCSA 2W0QA 1VQ53 1F8NA 3NUVA 3LYGA 1HU9A 3JUOA 1K9M4 3EX9A 2P05A 4HM8B 2BT3A 4EYCA 2F99A 5EEOA 3X41A 1GD4A 5AIFA 3B8LA 1V74A 2Y74A 3LZAA 4FCMA 3CU3A 2F98A 1NB5I 3BNEA 2WOHA 2CG0A 5IF6A 2W56A 2CIUA 5JPUA 4HM3B 3IPTA 2QGUA 4HZ9B 4O8SA 1LVNA 3FCSB 1UUWB 4H3UA 5D81A 1M9GA 3UL6A 3VGNA 3FKAA 4JRFA 4O02B 3S28A 1VZZA 3CCS3 4ZM8A 3DY5A 1VQ93 2P09A 3F9SA 3MG2A 5KP4A 2MF7A 3KFQC 4N6NB 1DVCA 1JKGA 2RSXA 4LGQA 5DREA 4HM1B 3SOYA 3NBBA 2L4VA 1ISKA 1S723 1QVF2 5LC7A 5KP3A 4Q53A 3CCE3 2P38A 3T0UA 1NJI4 1OPYA 4XDVA 1W00A 1W5ZA 1WMPA 3T8NA 1ASKA 3MG1A 2W56B 1R4CA 3SX1A 3DXOA 3MKIA 3TDGA 3FF2A 1RJOA 1TP6A 3SEDA 3DMCA 1EA2A 2C10A 3DGNA 1JV2B 4OUQA 5EQLA 4G1MB 2WOFA 1VQ43 4O3VA 3JVCA 2ML5A 4N3VA 3ECFA 1PU4A 1GYBA 1GS3A 3H51A 1NO3A 1QJGA 3IJEB 3L0RA 4CDLA 1NB3I 3CCV3 4MMYB 1OACA 2B24B 2GBWB 1IQ8A 5ELUA 3WDGB 1ROAA 5IW9A 3BNDA 3EF8A 2W04A 4WHAA 2OQEA 1VQ73 3GZYB 3F7XA 5CXOA 3K9MC 4GL6A 4R4KA 1BUQA 3LT8A 1K41A 1ULJB 1W2ZA 1TFKA 1KSIA 4J8TA 3K7CA 4R9LA 4JF8A 5AIIA 3NV0A 3B7CA 3LTCA 3F40A 3KKGA 3U97A 3A76A 1A67A 1U8CB 1YHQ3 5TGNA 3FLJA 1OGZA 5AIHA 1OCVA 3IMAB 4KZ1A 4FMAA 1W2B2 3CME3 1MNLA 1STFI 1MOLA 3RDEA 2O3OA 3X42A 4N6V0 3PCRA 3G8ZA 3V98A 1N5PA 2CFKA 1EKMA 4FMCA 2GEXA 2OWPA 4EV2A 1ROVA 2HMMB 2CHCA 3X3ZA 5IEPA 3LTDA 1E3RA 1YJ93 1CYUA 4XBYA 3EQQB 2QA43 3I0YA 3BLZA 3KE7A 3KSED 1FA3A 2RCDA 1SIIA 4MMXB 2F86B 4H61A 2W9PA 3F8XA 2R4IA 2YFIB 2O9UX 3KSPA 1W01A 1O7NB 4MJDA 3LT9A 1WNHA 4XBTA 2Z7AA 3LXUX 1G96A 5I97A 2GU1A 2IMJA 3OWUA 2HMJB 1KQS2 1GY7A 1YI23 4XB5A 2Z77A 3EB8A 2CKFB 1FGMA 1QAKA 3WODG 3GWRA 4R1KA 4EV5A 2GU3A 3DGMA 2INXA 2CWVA 3GZXB 5ELJA 4K1UA 3UJMA 3FF0A 1QVG2 2GXFA 2QIYA 5AYSC 1W6CA 3E99A 3HIIA 1VQL3 2KRTA 2E2VA 2E2UA 1WQLB 4XM4A 2BMOB 3OXAA 3EBTA 3WMDA 1DVDA 2M7OA 3H3HA 1K28A 1CEWI 1UW1A 1OHOA 3UL5A 2CC3A 2GBXB 3CNXA 3JUMA 3N8BA 4KFFA 2Y73A 4OVMA 2UX0A 5D82A 1QAFA 5JPPA 3D3LA 2WGOA 2KXGA 1SIHA 5G2GA 4BTXA 3S29A 2XFSA 4RBNA 3NM7A 3NQYA 4AKYA 3EE1A 2CH9A 1W6GA 1FGQA 5EVHA 1JN5A 3LTAA 1O7WB 2HMKB 3HZPA 3GZBA 1VQM3 1J2BA 1GY5A 3FH1A 2ZDJA 3CCM3 1M1K4 1US1A 4MMZB 2SBLA 3X3XA 4N6UA 3JUPA 1CQSA 2MC8A 1YGEA 3HIGA 4HZBB 4ORLA 4QWTA 3VF1A 3CD63 4RZMA 2FGTA 3B4PA 3NX0A 1SQWA 3SLUA 7STDA 2BMQB 4N6LA 2W03A 4L8PA 1E97A 2I9WA 3OWYA 4XDWA 2IUJA 1LNHA 2P0XA 5IENA 5CK6A 1VQ83 4N6MA 1WMOA 1IDPA 4L8OA 2CFGA 2ML6A 4HYZA 1STDA 1JN5B 1KD14 1SPUA 3EHCA 3MHEA 2FNQA 1VQO3 1M1XB 4N6TA 4MEIA 4WYKA 3S67A 1O7PB 1RKYA 2YFLB 1JB4A 3LOYA 5JBSA 3V99A 2XGNA 1GY6A 1WTHA 2BO9B 3PYJA 4BTWA 3OV4A 3K0ZA 1ZO2A 4N6OB 4NREA 2Q07A 1IT8A 1N9JA 1VQP3 1T5YA 4AEQA 5HGRA 2CWTA 1A2KA 2B1XB 3HX8A 3UNLA 2XRXB 5DRVA 2JQ5A 5FW5A 2FXTA 3EJVA 1YJW3 2ZL8A 4KFDA 3WA2X 1IVVA 5CF2A 2HMOB 3O8YA 4XBXA 2C11A 3CCR3 2K54A 1QALA 4WYKB 5AEUB 4HJLB 1PFPA 4WP5A 3CCJ3 1TUHA 3OX9A 3K5TA 3G6E3 3T8UA 2JDIH 1Q864 2LYXA 3J7Yd 2YFJB 1A90A 4LSOA 4HM5B 5IG4A 1Q814 3AMOA 2BMRB 4O2HA 2E2TA 3CPW2 5AEWB 1KWIA 2OOVC 1DMMA 4R9KA 3RGAA 3RGRA 3BNBA 4L7KA 3Q2PA 3NBRA 1AR0A 1IU7A 1QMAA 3D9RA 2XEPA 3DGLA 3HI7A 5STDA 1W4NA 1JB5A 1DYUA 2CG1A 4R80A 1DMQA 4EXRA 3CPOA 4HM2B 8CHOA 4FMBA 1IQXA 2CW9A 5AYRB 3CC43 4NHFA 4K61A 4FR9A 5CF1A 4KFEA 2Z6BA 2XGLA 3NQZA 1OF5A 1YIJ3 4TX4A 3FGYA 3NXJA 3FG3A 2PZVA 3G713 3CCQ3 3GZRA 3AMOB 4U13A 1TU5A 3I563 1UUVB 5BXQA 2XSOB 1TFOA 5IEOA 3DUKA 3HK4A 1ULIB 5LC6A 3CMA3 3QK9A 4HKVB 1O7GB 4K90B 3FSDA 5A0OB 1HKXA 1K734 3QRDA 3MWZA 2RGQA 1N8R4 1EQKA 1UI7A 3G16A 1IV9A 2HMLB 1WMNA 3LH4A 1OF5B 5CLKA 4STDA 5D83A 3N9HA 1AV4A 4HVNA 5AI1A 1O7HB 3LTBA 1N8QA 4I4KA 5IG3A 1YIT3 4FCJA 3WOEB 1SJWA 3JUQA 4AKZA 1D6UA 1Y4KA 3SOAA 3WOFB 1Q824 3X3YA 1JNQA 3PS8A 5BVBA 4FCZA 3EC9A 4HM7B 5IERA 1IK3A 1RRHA 4WWUC 2A15A 3G4S3 2KCDA 3MYTA 2OTL3 3MSOA 1YJN3 1D6ZA 2CFDA 1S5AA 1C7HA 1ZX2A 2OCTA 1L5GB 3BNCA 3M8CA 6STDA 1VQK3 4KVHA 1FGOA 2XSHB 3CC73 3F14A 1OH0A 1W02A 4OK0A 3CCL3 1IQYA 3Q90A 4CCVA 5FGOA 3KZTA 1N5HA 1Z1SA 3SXXA 1IV7A 3FG4A 3ER7A 1IVUA 2WO0A 2OTJ3 3KN4A 1U5OA 3F7SA 3G0KA 3SVAA 5IG0A 3GAXA 1OHPA 1Q7Y4 1IVWA 1FGRA 3B4OA 1AVKA 1UI8A 1K8A4 3DM8A 1O7MB 1CYVA 1JKGB 2W2CA 1A2VA 1Q42A 4LEHA 2D42A 4GB5A 2Z76A 3UB1A 3PGBA 2STDA 2BNGA 1NU3A 4HBRA 4PEJA 2XF3A 1OGXA 2V1LA 1KC84 4J9AA 1JRQA 1GD3A 3LMLA 2PNCA 3NHXA 2YX9A 1JB2A 2P0MA 1IVXA 3CC23 5IG5A 2IA7A 3X40A 4WFOA 1VQN3 1W7CA 3DGOA 2K0MA 3U1WA 3NM2A 4EC6A 1OUNA 4HM0B 4LZIA 1Q40A 1VQ63 2OQEC 1RRLA 3V92A 1TIJA 2CFWA 4X2HA 1IT7A 3Q1CA 2CWUA 3DZLA 3EN1B 1NDOB 3K63A 3KIIA 3VSYA 1FUWA 3PZWA 4K1VA 2D1WA 3FG1A 1LOXA 4HM4B 1AVLA 1RN7A 4LMIA 2OOVA 2QEX3 4RNZA 3F8HA 4HM6B 3NBJA 2HMNB 1W6YA 3STDA 3CXC2 2CK3H 3JUNA 1OHSA 2W6JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IIA A;  3ROB A;  5KP1 A;  2RFR A;  5AIG A;  3MG3 A;  3GRD A;  3FZW A;  3S5C A;  2XR8 B;  3BB9 A;  3OWS A;  3CNM A;  1DMN A;  3EBY A;  3EN8 A;  1Q40 B;  4X2O A;  1E3V A;  3NV0 B;  1EG9 B;  1NWW A;  2GEY A;  3NUV A;  3LYG A;  3JUO A;  3EX9 A;  4HM8 B;  2F99 A;  5AIF A;  3B8L A;  3LZA A;  4FCM A;  3CU3 A;  2F98 A;  5IF6 A;  5JPU A;  4HM3 B;  3IPT A;  2QGU A;  4HZ9 B;  1UUW B;  4H3U A;  5D81 A;  3VGN A;  3FKA A;  1VZZ A;  3F9S A;  3MG2 A;  5KP4 A;  1JKG A;  4LGQ A;  5DRE A;  4HM1 B;  3SOY A;  1ISK A;  5KP3 A;  4Q53 A;  1OPY A;  4XDV A;  1W00 A;  3T8N A;  1ASK A;  3MG1 A;  3DXO A;  3MKI A;  3FF2 A;  1TP6 A;  3SED A;  3DMC A;  1EA2 A;  4OUQ A;  4N3V A;  3ECF A;  1GYB A;  1GS3 A;  3H51 A;  1QJG A;  4CDL A;  2B24 B;  2GBW B;  3EF8 A;  3GZY B;  3F7X A;  5CXO A;  1BUQ A;  1K41 A;  1ULJ B;  4J8T A;  3K7C A;  4R9L A;  5AII A;  3NV0 A;  3B7C A;  3F40 A;  3KKG A;  3A76 A;  5TGN A;  3FLJ A;  1OGZ A;  5AIH A;  1OCV A;  3G8Z A;  2GEX A;  2OWP A;  2HMM B;  2CHC A;  5IEP A;  1E3R A;  4XBY A;  3EQQ B;  3I0Y A;  3BLZ A;  3KE7 A;  2RCD A;  2F86 B;  3F8X A;  2R4I A;  2YFI B;  3KSP A;  1W01 A;  1O7N B;  4MJD A;  4XBT A;  2Z7A A;  2IMJ A;  3OWU A;  2HMJ B;  1GY7 A;  4XB5 A;  2Z77 A;  2CKF B;  3GWR A;  4R1K A;  2INX A;  3GZX B;  4K1U A;  3UJM A;  3FF0 A;  2GXF A;  2QIY A;  3E99 A;  4XM4 A;  1WQL B;  2BMO B;  3OXA A;  3EBT A;  3WMD A;  3H3H A;  1OHO A;  2GBX B;  3CNX A;  3JUM A;  4OVM A;  2UX0 A;  5D82 A;  5JPP A;  5G2G A;  5EVH A;  1JN5 A;  1O7W B;  2HMK B;  3HZP A;  3GZB A;  1GY5 A;  3FH1 A;  3JUP A;  1CQS A;  4HZB B;  4ORL A;  4RZM A;  3B4P A;  7STD A;  2BMQ B;  4L8P A;  1E97 A;  2I9W A;  3OWY A;  4XDW A;  5IEN A;  5CK6 A;  1IDP A;  4L8O A;  1STD A;  1JN5 B;  3EHC A;  3MHE A;  4WYK A;  1O7P B;  2YFL B;  1JB4 A;  1GY6 A;  3OV4 A;  3K0Z A;  1ZO2 A;  5HGR A;  1A2K A;  2B1X B;  3HX8 A;  3UNL A;  5FW5 A;  2XRX B;  2JQ5 A;  5DRV A;  3EJV A;  5CF2 A;  2HMO B;  4XBX A;  2K54 A;  4WYK B;  5AEU B;  4HJL B;  4WP5 A;  1TUH A;  3OX9 A;  3T8U A;  2YFJ B;  4HM5 B;  5IG4 A;  2BMR B;  5AEW B;  1DMM A;  4R9K A;  3RGA A;  3RGR A;  4L7K A;  3NBR A;  1AR0 A;  1QMA A;  3D9R A;  5STD A;  1JB5 A;  1DMQ A;  3CPO A;  4HM2 B;  8CHO A;  5CF1 A;  1OF5 A;  3FGY A;  3NXJ A;  2PZV A;  3GZR A;  4U13 A;  1UUV B;  5BXQ A;  2XSO B;  5IEO A;  3DUK A;  3HK4 A;  1ULI B;  4HKV B;  1O7G B;  3FSD A;  1HKX A;  2RGQ A;  3G16 A;  2HML B;  1OF5 B;  5CLK A;  4STD A;  5D83 A;  4HVN A;  5AI1 A;  1O7H B;  5IG3 A;  4I4K A;  4FCJ A;  1SJW A;  3JUQ A;  3SOA A;  5BVB A;  3EC9 A;  4HM7 B;  5IER A;  4WWU C;  2A15 A;  3MYT A;  3MSO A;  1S5A A;  1C7H A;  1ZX2 A;  3M8C A;  6STD A;  4KVH A;  2XSH B;  3F14 A;  1OH0 A;  1W02 A;  3Q90 A;  3KZT A;  1Z1S A;  3ER7 A;  1U5O A;  3F7S A;  3G0K A;  5IG0 A;  1OHP A;  3B4O A;  3DM8 A;  1O7M B;  1JKG B;  2W2C A;  1Q42 A;  4LEH A;  4GB5 A;  2Z76 A;  2BNG A;  2STD A;  1NU3 A;  4PEJ A;  1OGX A;  4J9A A;  3NHX A;  1JB2 A;  5IG5 A;  3NM2 A;  1OUN A;  4HM0 B;  1Q40 A;  4X2H A;  3DZL A;  3EN1 B;  1NDO B;  3VSY A;  4K1V A;  4LMI A;  4HM4 B;  3F8H A;  4HM6 B;  2HMN B;  1W6Y A;  3STD A;  3JUN A;  1OHS A; 
#chains in the Genus database with same CATH topology
 4IT7 A;  3PXM A;  1MGR A;  4IIA A;  3ALA A;  3ROB A;  5KP1 A;  1MWR A;  3MPH A;  4RNY A;  3WA3 A;  3I55 3;  2RFR A;  1PYL A;  5AIG A;  3MG3 A;  1I8V A;  3S27 A;  2W9Q A;  3GRD A;  4BTY A;  1FGT A;  1MGW A;  3FZW A;  3S5C A;  2XR8 B;  1T2H A;  2XH9 A;  1M90 4;  3BB9 A;  3OWS A;  3CNM A;  1DMN A;  1BAO A;  3EBY A;  3CCU 3;  3EN8 A;  1D6Y A;  1Q40 B;  3N54 B;  4X2O A;  1E3V A;  1JJ2 2;  1B2M A;  2CFL A;  3NV0 B;  1YVB I;  1EG9 B;  2C4B A;  1LXE A;  2IUK A;  1NWW A;  2LQV A;  2BHM A;  3OW2 2;  2GEY A;  1N9E A;  2XFT A;  2WGQ A;  4EBG A;  1MWS A;  4IPB A;  4FMD A;  1TRP A;  2W0Q A;  3PCS A;  1VQ5 3;  1F8N A;  3NUV A;  3LYG A;  1HU9 A;  3JUO A;  1K9M 4;  3EX9 A;  2P05 A;  4HM8 B;  2BT3 A;  4EYC A;  2F99 A;  5EEO A;  3X41 A;  1GD4 A;  1RDS A;  4BL3 A;  5AIF A;  3B8L A;  1V74 A;  2Y74 A;  3LZA A;  4FCM A;  3CU3 A;  1BNG A;  2F98 A;  1NB5 I;  3BNE A;  2WOH A;  2CG0 A;  3SYU A;  1RMS A;  1RCL A;  1FYS A;  5IF6 A;  2W56 A;  2CIU A;  5JPU A;  4HM3 B;  3IPT A;  2QGU A;  4HZ9 B;  4O8S A;  7GSP A;  1LVN A;  4ILF A;  3FCS B;  1UUW B;  4H3U A;  5D81 A;  1M9G A;  3UL6 A;  1UCK A;  4I5Q A;  3VGN A;  3FKA A;  4JRF A;  1DE3 A;  1BRS A;  4O02 B;  3S28 A;  1VZZ A;  3CCS 3;  1BSA A;  4ZM8 A;  3DY5 A;  1VQ9 3;  1GOU A;  2P09 A;  1B27 A;  4KT3 B;  3F9S A;  1I3F A;  3MG2 A;  5KP4 A;  1BUJ A;  2MF7 A;  1V58 A;  3KFQ C;  1DVC A;  4N6N B;  1BRN L;  1JKG A;  1JBT A;  2RSX A;  4LGQ A;  5DRE A;  1RGK A;  4HM1 B;  3SOY A;  3NBB A;  1JBR A;  2L4V A;  1ISK A;  1S72 3;  1QVF 2;  5LC7 A;  5KP3 A;  4Q53 A;  3CCE 3;  2P38 A;  3T0U A;  5M19 A;  1OPY A;  1NJI 4;  4XDV A;  1W00 A;  1W5Z A;  1BSE A;  1WMP A;  3T8N A;  1ASK A;  3MG1 A;  2W56 B;  1R4C A;  3AGN A;  3SX1 A;  3DXO A;  3MKI A;  2KF6 A;  3TDG A;  3FF2 A;  1RJO A;  1TP6 A;  2KF4 A;  3SED A;  3DMC A;  1EA2 A;  2C10 A;  2H0G A;  1JV2 B;  3DGN A;  4OUQ A;  2GSP A;  5EQL A;  4G1M B;  2WOF A;  4CJN A;  1VQ4 3;  1FUS A;  3JVC A;  1BGS A;  2ML5 A;  4O3V A;  4N3V A;  3ECF A;  1LQM B;  1PU4 A;  1GYB A;  1G02 A;  2RNT A;  1GS3 A;  3H51 A;  1NO3 A;  1QJG A;  2CX1 A;  3IJE B;  2BU4 A;  3L0R A;  4CDL A;  1NB3 I;  3CCV 3;  3RNT A;  4MMY B;  1OAC A;  1RGC A;  2B24 B;  1HYF A;  2GBW B;  1IQ8 A;  5ELU A;  3WDG B;  1A2P A;  1ROA A;  5IW9 A;  3BND A;  3EF8 A;  2W04 A;  4WHA A;  2OQE A;  1VQ7 3;  3GZY B;  1I70 A;  3F7X A;  1RGF A;  3K9M C;  5CXO A;  4GL6 A;  3HOH A;  4R4K A;  1BUQ A;  5G1L A;  3LT8 A;  1K41 A;  1ULJ B;  1W2Z A;  1TFK A;  2H0H A;  1KSI A;  1JZD A;  3K7C A;  4J8T A;  4JF8 A;  4R9L A;  1Q7H A;  5AII A;  4DKI A;  3NV0 A;  3B7C A;  2L1S A;  1GOV A;  3LTC A;  3F40 A;  6GSP A;  3KKG A;  3U97 A;  1G0T A;  1LRA A;  3A76 A;  1A67 A;  1U8C B;  1YHQ 3;  5TGN A;  3FLJ A;  1OGZ A;  5AIH A;  1OCV A;  1RN4 A;  3IMA B;  4KZ1 A;  4BL2 A;  4FMA A;  1W2B 2;  4GHO A;  3CME 3;  1MNL A;  1B3S A;  1STF I;  1MOL A;  1GMP A;  3RDE A;  3BU4 A;  2O3O A;  2SAR A;  3X42 A;  4N6V 0;  3PCR A;  3G8Z A;  3V98 A;  1N5P A;  2CFK A;  1JZO A;  3D5G A;  1EKM A;  4FMC A;  5RNT A;  1RTU A;  2GEX A;  2J8X B;  4J5G A;  2OWP A;  1NNV A;  3D5I A;  1TJD A;  4EV2 A;  1ROV A;  2HMM B;  2CHC A;  3URP A;  3X3Z A;  5IEP A;  3LTD A;  1E3R A;  1YJ9 3;  1CYU A;  4XBY A;  3EQQ B;  2QA4 3;  3I0Y A;  3BLZ A;  3KE7 A;  3KSE D;  4HOH A;  1FA3 A;  2RCD A;  1SII A;  4MMX B;  9RNT A;  2F86 B;  4H61 A;  2W9P A;  1MWU A;  3F8X A;  2R4I A;  2YFI B;  2O9U X;  1LOV A;  3KSP A;  2KF5 A;  1GOY A;  1UCJ A;  1W01 A;  1O7N B;  4MJD A;  3LT9 A;  1WNH A;  4XBT A;  2Z7A A;  3LXU X;  1G96 A;  3NBR A;  5I97 A;  2GU1 A;  1C54 A;  2IMJ A;  3OWU A;  2HMJ B;  1KQS 2;  1GY7 A;  2AAE A;  1YI2 3;  1B20 A;  1I3I A;  2Z77 A;  4XB5 A;  3EB8 A;  1BOX A;  2CKF B;  1HZ1 A;  1BAN A;  1FGM A;  1QAK A;  1VQQ A;  3WOD G;  2F56 A;  1TRQ A;  3GWR A;  1RLS A;  4R1K A;  1BIR A;  4EV5 A;  2GU3 A;  3DGM A;  1RCK A;  2CWV A;  2INX A;  3GZX B;  5ELJ A;  4K1U A;  2K3D A;  1BRI A;  4LYL B;  3FF0 A;  3UJM A;  1QVG 2;  2F5M A;  2GXF A;  2QIY A;  5AYS C;  1W6C A;  3E99 A;  3HII A;  1X1W A;  1VQL 3;  1RGG A;  2KRT A;  2E2V A;  2E2U A;  1WQL B;  1BSD A;  2BMO B;  4XM4 A;  3OXA A;  3EBT A;  3WMD A;  1DVD A;  2M7O A;  3H3H A;  1AQZ A;  1K28 A;  1CEW I;  2UGI A;  1UW1 A;  1DET A;  5M1A A;  1OHO A;  3UL5 A;  2CC3 A;  2GBX B;  3CNX A;  3JUM A;  3N8B A;  4KFF A;  1T3B A;  2Y73 A;  4OVM A;  2UX0 A;  5D82 A;  1QAF A;  1UCI A;  5JPP A;  1IYY A;  3D3L A;  2WGO A;  2KXG A;  1SIH A;  5G2G A;  4BTX A;  3S29 A;  7RNT A;  2XFS A;  4RBN A;  3NM7 A;  3NQY A;  4AKY A;  1BSC A;  2CH9 A;  3EE1 A;  1W6G A;  1YGW A;  1B2X A;  1GMQ A;  3ZG0 A;  1FGQ A;  5EVH A;  1JN5 A;  3LTA A;  1O7W B;  2HMK B;  3HZP A;  3GZB A;  1VQM 3;  5G1K A;  1J2B A;  1GY5 A;  3BIR A;  2ZDJ A;  3FH1 A;  3CCM 3;  1M1K 4;  3D79 A;  2KF3 A;  1US1 A;  4MMZ B;  3WR2 A;  2SBL A;  3X3X A;  4N6U A;  3JUP A;  5GSP A;  1CQS A;  2MC8 A;  1YGE A;  1EEJ A;  3HIG A;  4HZB B;  4ORL A;  4QWT A;  3VF1 A;  4GSP A;  1UGH I;  3CD6 3;  4RZM A;  2FGT A;  3B4P A;  3NX0 A;  1SQW A;  3SLU A;  7STD A;  2BMQ B;  4N6L A;  2W03 A;  4L8P A;  1E97 A;  2I9W A;  1B21 A;  1BVI A;  3OWY A;  4XDW A;  2IUJ A;  1LNH A;  2P0X A;  1LOW A;  5IEN A;  1I2G A;  5CK6 A;  4N6M A;  1VQ8 3;  1WMO A;  1IDP A;  4L8O A;  2CFG A;  2ML6 A;  4HYZ A;  1UUG B;  1STD A;  1JN5 B;  1BNJ A;  1KD1 4;  1SPU A;  3EHC A;  3MHE A;  2FNQ A;  1VQO 3;  1M1X B;  4N6T A;  4MEI A;  4WYK A;  3S67 A;  1O7P B;  1RKY A;  2YFL B;  1JB4 A;  3LOY A;  1UGI A;  3D4A A;  1MWT A;  3V99 A;  5JBS A;  2XGN A;  1GY6 A;  3A5E A;  1WTH A;  2BO9 B;  1FW7 A;  3PYJ A;  3KCH A;  4BTW A;  3OV4 A;  3K0Z A;  1ZO2 A;  3ZG5 A;  1R4Y A;  4N6O B;  4NRE A;  2Q07 A;  1IT8 A;  1N9J A;  1VQP 3;  1BRJ A;  1BNF A;  1T5Y A;  2RBI A;  4AEQ A;  5HGR A;  2CWT A;  1LQG C;  1A2K A;  1RGE A;  2B1X B;  3HX8 A;  3DH2 A;  1BRG A;  3UNL A;  1RNT A;  2XRX B;  2JQ5 A;  5DRV A;  5FW5 A;  1BNE A;  2FXT A;  3EJV A;  1YJW 3;  1BRK A;  2ZL8 A;  4KFD A;  3WA2 X;  1IVV A;  5CF2 A;  2HMO B;  3O8Y A;  4XBX A;  2C11 A;  3CCR 3;  1RHL A;  1QAL A;  2K54 A;  3AHS A;  4WYK B;  5AEU B;  3DGY A;  4HJL B;  1PFP A;  4WP5 A;  3CCJ 3;  1TUH A;  3OX9 A;  3K5T A;  3G6E 3;  1TTO A;  3T8U A;  2JDI H;  1Q86 4;  2LYX A;  3J7Y d;  2YFJ B;  1A90 A;  4RNT A;  3Q3F A;  4LSO A;  4HM5 B;  3ZFZ A;  1LOY A;  5IG4 A;  1Q81 4;  3AMO A;  2BMR B;  4J5K A;  2E2T A;  4O2H A;  5AEW B;  3CPW 2;  1KWI A;  2OOV C;  1DMM A;  1RGL A;  1UCL A;  3WHO A;  4R9K A;  3RGA A;  3RGR A;  2AAD A;  3BNB A;  4L7K A;  3Q2P A;  2HOH A;  1AR0 A;  1IU7 A;  1QMA A;  2KAA A;  2XEP A;  3D9R A;  3DGL A;  1FUT A;  1W4N A;  3HI7 A;  5STD A;  1JB5 A;  4BIR A;  1DYU A;  1B2Z A;  2CG1 A;  4R80 A;  1DMQ A;  4EXR A;  2ZA4 A;  3CPO A;  4HM2 B;  8CHO A;  1CH0 A;  4FMB A;  1IQX A;  2CW9 A;  1PY3 A;  5AYR B;  3CC4 3;  1RGH A;  4NHF A;  4K61 A;  4FR9 A;  1BSB A;  5CF1 A;  4KFE A;  1FZU A;  2Z6B A;  2XGL A;  1GMR A;  1V57 A;  3GSP A;  3NQZ A;  1OF5 A;  1YIJ 3;  4TX4 A;  2F5W A;  3FGY A;  3NXJ A;  2CX0 A;  3FG3 A;  2PZV A;  3G71 3;  3CCQ 3;  3GZR A;  3AMO B;  4U13 A;  1B2U A;  1TU5 A;  3I56 3;  1I0V A;  1UUV B;  5HOH A;  5BXQ A;  2XSO B;  1TFO A;  5IEO A;  1EUI C;  3DUK A;  1JBS A;  3HK4 A;  1ULI B;  5LC6 A;  3CMA 3;  3QK9 A;  4HKV B;  1O7G B;  4K90 B;  3FSD A;  1B2S A;  5A0O B;  1HKX A;  1K73 4;  3QRD A;  3MWZ A;  2RGQ A;  1N8R 4;  1EQK A;  4NPB A;  1UI7 A;  1LNI A;  1IV9 A;  3G16 A;  2HML B;  1UDI I;  1WMN A;  1I2E A;  3LH4 A;  1OF5 B;  5CLK A;  4STD A;  1T2I A;  5D83 A;  1BNS A;  4HAA A;  3N9H A;  4BU4 A;  1AV4 A;  1YVS A;  4HVN A;  5BIR A;  6RNT A;  5M18 A;  5AI1 A;  1O7H B;  3LTB A;  1N8Q A;  4I4K A;  5IG3 A;  1YIT 3;  4FCJ A;  3WOE B;  1SJW A;  3JUQ A;  4AKZ A;  1D6U A;  1Y4K A;  3SOA A;  3WOF B;  1AY7 A;  1Q82 4;  3X3Y A;  1JNQ A;  3PS8 A;  5BVB A;  4FCZ A;  3EC9 A;  4HM7 B;  5IER A;  1IK3 A;  1RRH A;  4WWU C;  1RSN A;  2A15 A;  3G4S 3;  2KCD A;  3MYT A;  2OTL 3;  1BRH A;  3MSO A;  1YJN 3;  4CPK A;  1D6Z A;  1X1X A;  2CFD A;  1S5A A;  1C7H A;  1ZX2 A;  1SAR A;  2H0I A;  2OCT A;  1L5G B;  3BNC A;  3AHW A;  3M8C A;  6STD A;  1VQK 3;  1RGA A;  4KVH A;  1FGO A;  2XSH B;  3CC7 3;  3F14 A;  1OH0 A;  1W02 A;  4OK0 A;  3CCL 3;  1IQY A;  3Q90 A;  2R41 A;  4CCV A;  5FGO A;  3KZT A;  1N5H A;  1Z1S A;  4EW5 A;  8RNT A;  3SXX A;  1IV7 A;  1RN1 A;  2ZHX B;  3FG4 A;  3ER7 A;  1IVU A;  2WO0 A;  2OTJ 3;  1X1U A;  3KN4 A;  1U5O A;  3F7S A;  3G0K A;  3SVA A;  5IG0 A;  3GAX A;  1OHP A;  1Q7Y 4;  1IVW A;  1FGR A;  3B4O A;  1AVK A;  1UI8 A;  2BIR A;  2UUG C;  3DM8 A;  1K8A 4;  1O7M B;  1CYV A;  1JKG B;  1I0X A;  2IY2 A;  2W2C A;  1A2V A;  1Q42 A;  4LEH A;  2D42 A;  4GB5 A;  2Z76 A;  3UB1 A;  3PGB A;  2BNG A;  2STD A;  1NU3 A;  4HBR A;  4PEJ A;  2XF3 A;  1OGX A;  2V1L A;  1ZS7 A;  1KC8 4;  4J9A A;  1JRQ A;  1X1Y A;  1GD3 A;  1ZGX A;  2PNC A;  3LML A;  1Q9E A;  1JB2 A;  2YX9 A;  2P0M A;  3NHX A;  1IVX A;  3AGO A;  3CC2 3;  5IG5 A;  2IA7 A;  3X40 A;  4WFO A;  1VQN 3;  1BNR A;  1W7C A;  3DGO A;  2K0M A;  3U1W A;  3NM2 A;  4EC6 A;  1OUN A;  4HM0 B;  4LZI A;  1Q40 A;  1BNI A;  2IYJ A;  2OQE C;  2F4Y A;  1RRL A;  3V92 A;  1VQ6 3;  1TIJ A;  2CFW A;  4X2H A;  1IT7 A;  3Q1C A;  2CWU A;  3DZL A;  3EN1 B;  1NDO B;  3K63 A;  3KII A;  3VSY A;  1FUW A;  3PZW A;  1GSP A;  2D1W A;  3FG1 A;  4K1V A;  1YNV X;  1LOX A;  4HM4 B;  1AVL A;  1RN7 A;  4LMI A;  2OOV A;  2QEX 3;  1RNB A;  4RNZ A;  3F8H A;  4HM6 B;  3NBJ A;  1I2F A;  2HMN B;  1BU4 A;  1W6Y A;  3STD A;  3CXC 2;  5BU4 A;  2CK3 H;  3JUN A;  1OHS A;  2W6J H; 
#chains in the Genus database with same CATH homology
 4IT7 A;  3PXM A;  4IIA A;  3ALA A;  3ROB A;  5KP1 A;  3MPH A;  4RNY A;  3WA3 A;  3I55 3;  2RFR A;  5AIG A;  3MG3 A;  3S27 A;  2W9Q A;  3GRD A;  4BTY A;  1FGT A;  3FZW A;  3S5C A;  2XR8 B;  2XH9 A;  1M90 4;  3BB9 A;  3OWS A;  3CNM A;  1DMN A;  3EBY A;  3CCU 3;  3EN8 A;  1D6Y A;  1Q40 B;  3N54 B;  4X2O A;  1E3V A;  1JJ2 2;  2CFL A;  3NV0 B;  1YVB I;  1EG9 B;  1LXE A;  2IUK A;  1NWW A;  2LQV A;  2BHM A;  3OW2 2;  2GEY A;  1N9E A;  2XFT A;  2WGQ A;  4EBG A;  4IPB A;  4FMD A;  3PCS A;  2W0Q A;  1VQ5 3;  1F8N A;  3NUV A;  3LYG A;  1HU9 A;  3JUO A;  1K9M 4;  3EX9 A;  2P05 A;  4HM8 B;  2BT3 A;  4EYC A;  2F99 A;  5EEO A;  3X41 A;  1GD4 A;  5AIF A;  3B8L A;  1V74 A;  2Y74 A;  3LZA A;  4FCM A;  3CU3 A;  2F98 A;  1NB5 I;  3BNE A;  2WOH A;  2CG0 A;  5IF6 A;  2W56 A;  2CIU A;  5JPU A;  4HM3 B;  3IPT A;  2QGU A;  4HZ9 B;  4O8S A;  1LVN A;  3FCS B;  1UUW B;  4H3U A;  5D81 A;  1M9G A;  3UL6 A;  3VGN A;  3FKA A;  4JRF A;  4O02 B;  3S28 A;  1VZZ A;  3CCS 3;  4ZM8 A;  3DY5 A;  1VQ9 3;  2P09 A;  3F9S A;  3MG2 A;  5KP4 A;  2MF7 A;  3KFQ C;  4N6N B;  1DVC A;  1JKG A;  2RSX A;  4LGQ A;  5DRE A;  4HM1 B;  3SOY A;  3NBB A;  2L4V A;  1ISK A;  1S72 3;  1QVF 2;  5LC7 A;  5KP3 A;  4Q53 A;  3CCE 3;  2P38 A;  3T0U A;  1NJI 4;  1OPY A;  4XDV A;  1W00 A;  1W5Z A;  1WMP A;  3T8N A;  1ASK A;  3MG1 A;  2W56 B;  1R4C A;  3SX1 A;  3DXO A;  3MKI A;  3TDG A;  3FF2 A;  1RJO A;  1TP6 A;  3SED A;  3DMC A;  1EA2 A;  2C10 A;  3DGN A;  1JV2 B;  4OUQ A;  5EQL A;  4G1M B;  2WOF A;  1VQ4 3;  4O3V A;  3JVC A;  2ML5 A;  4N3V A;  3ECF A;  1PU4 A;  1GYB A;  1GS3 A;  3H51 A;  1NO3 A;  1QJG A;  3IJE B;  3L0R A;  4CDL A;  1NB3 I;  3CCV 3;  4MMY B;  1OAC A;  2B24 B;  2GBW B;  1IQ8 A;  5ELU A;  3WDG B;  1ROA A;  5IW9 A;  3BND A;  3EF8 A;  2W04 A;  4WHA A;  2OQE A;  1VQ7 3;  3GZY B;  3F7X A;  5CXO A;  3K9M C;  4GL6 A;  4R4K A;  1BUQ A;  3LT8 A;  1K41 A;  1ULJ B;  1W2Z A;  1TFK A;  1KSI A;  4J8T A;  3K7C A;  4R9L A;  4JF8 A;  5AII A;  3NV0 A;  3B7C A;  3LTC A;  3F40 A;  3KKG A;  3U97 A;  3A76 A;  1A67 A;  1U8C B;  1YHQ 3;  5TGN A;  3FLJ A;  1OGZ A;  5AIH A;  1OCV A;  3IMA B;  4KZ1 A;  4FMA A;  1W2B 2;  3CME 3;  1MNL A;  1STF I;  1MOL A;  3RDE A;  2O3O A;  3X42 A;  4N6V 0;  3PCR A;  3G8Z A;  3V98 A;  1N5P A;  2CFK A;  1EKM A;  4FMC A;  2GEX A;  2OWP A;  4EV2 A;  1ROV A;  2HMM B;  2CHC A;  3X3Z A;  5IEP A;  3LTD A;  1E3R A;  1YJ9 3;  1CYU A;  4XBY A;  3EQQ B;  2QA4 3;  3I0Y A;  3BLZ A;  3KE7 A;  3KSE D;  1FA3 A;  2RCD A;  1SII A;  4MMX B;  2F86 B;  4H61 A;  2W9P A;  3F8X A;  2R4I A;  2YFI B;  2O9U X;  3KSP A;  1W01 A;  1O7N B;  4MJD A;  3LT9 A;  1WNH A;  4XBT A;  2Z7A A;  3LXU X;  1G96 A;  5I97 A;  2GU1 A;  2IMJ A;  3OWU A;  2HMJ B;  1KQS 2;  1GY7 A;  1YI2 3;  4XB5 A;  2Z77 A;  3EB8 A;  2CKF B;  1FGM A;  1QAK A;  3WOD G;  3GWR A;  4R1K A;  4EV5 A;  2GU3 A;  3DGM A;  2INX A;  2CWV A;  3GZX B;  5ELJ A;  4K1U A;  3UJM A;  3FF0 A;  1QVG 2;  2GXF A;  2QIY A;  5AYS C;  1W6C A;  3E99 A;  3HII A;  1VQL 3;  2KRT A;  2E2V A;  2E2U A;  1WQL B;  4XM4 A;  2BMO B;  3OXA A;  3EBT A;  3WMD A;  1DVD A;  2M7O A;  3H3H A;  1K28 A;  1CEW I;  1UW1 A;  1OHO A;  3UL5 A;  2CC3 A;  2GBX B;  3CNX A;  3JUM A;  3N8B A;  4KFF A;  2Y73 A;  4OVM A;  2UX0 A;  5D82 A;  1QAF A;  5JPP A;  3D3L A;  2WGO A;  2KXG A;  1SIH A;  5G2G A;  4BTX A;  3S29 A;  2XFS A;  4RBN A;  3NM7 A;  3NQY A;  4AKY A;  3EE1 A;  2CH9 A;  1W6G A;  1FGQ A;  5EVH A;  1JN5 A;  3LTA A;  1O7W B;  2HMK B;  3HZP A;  3GZB A;  1VQM 3;  1J2B A;  1GY5 A;  3FH1 A;  2ZDJ A;  3CCM 3;  1M1K 4;  1US1 A;  4MMZ B;  2SBL A;  3X3X A;  4N6U A;  3JUP A;  1CQS A;  2MC8 A;  1YGE A;  3HIG A;  4HZB B;  4ORL A;  4QWT A;  3VF1 A;  3CD6 3;  4RZM A;  2FGT A;  3B4P A;  3NX0 A;  1SQW A;  3SLU A;  7STD A;  2BMQ B;  4N6L A;  2W03 A;  4L8P A;  1E97 A;  2I9W A;  3OWY A;  4XDW A;  2IUJ A;  1LNH A;  2P0X A;  5IEN A;  5CK6 A;  1VQ8 3;  4N6M A;  1WMO A;  1IDP A;  4L8O A;  2CFG A;  2ML6 A;  4HYZ A;  1STD A;  1JN5 B;  1KD1 4;  1SPU A;  3EHC A;  3MHE A;  2FNQ A;  1VQO 3;  1M1X B;  4N6T A;  4MEI A;  4WYK A;  3S67 A;  1O7P B;  1RKY A;  2YFL B;  1JB4 A;  3LOY A;  5JBS A;  3V99 A;  2XGN A;  1GY6 A;  1WTH A;  2BO9 B;  3PYJ A;  4BTW A;  3OV4 A;  3K0Z A;  1ZO2 A;  4N6O B;  4NRE A;  2Q07 A;  1IT8 A;  1N9J A;  1VQP 3;  1T5Y A;  4AEQ A;  5HGR A;  2CWT A;  1A2K A;  2B1X B;  3HX8 A;  3UNL A;  2XRX B;  5DRV A;  2JQ5 A;  5FW5 A;  2FXT A;  3EJV A;  1YJW 3;  2ZL8 A;  4KFD A;  3WA2 X;  1IVV A;  5CF2 A;  2HMO B;  3O8Y A;  4XBX A;  2C11 A;  3CCR 3;  2K54 A;  1QAL A;  4WYK B;  5AEU B;  4HJL B;  1PFP A;  4WP5 A;  3CCJ 3;  1TUH A;  3OX9 A;  3K5T A;  3G6E 3;  3T8U A;  2JDI H;  1Q86 4;  2LYX A;  3J7Y d;  2YFJ B;  1A90 A;  4LSO A;  4HM5 B;  5IG4 A;  1Q81 4;  3AMO A;  2BMR B;  4O2H A;  2E2T A;  3CPW 2;  5AEW B;  1KWI A;  2OOV C;  1DMM A;  4R9K A;  3RGA A;  3RGR A;  3BNB A;  4L7K A;  3Q2P A;  3NBR A;  1AR0 A;  1IU7 A;  1QMA A;  3D9R A;  2XEP A;  3DGL A;  3HI7 A;  5STD A;  1W4N A;  1JB5 A;  1DYU A;  2CG1 A;  4R80 A;  1DMQ A;  4EXR A;  3CPO A;  4HM2 B;  8CHO A;  4FMB A;  1IQX A;  2CW9 A;  5AYR B;  3CC4 3;  4NHF A;  4K61 A;  4FR9 A;  5CF1 A;  4KFE A;  2Z6B A;  2XGL A;  3NQZ A;  1OF5 A;  1YIJ 3;  4TX4 A;  3FGY A;  3NXJ A;  3FG3 A;  2PZV A;  3G71 3;  3CCQ 3;  3GZR A;  3AMO B;  4U13 A;  1TU5 A;  3I56 3;  1UUV B;  5BXQ A;  2XSO B;  1TFO A;  5IEO A;  3DUK A;  3HK4 A;  1ULI B;  5LC6 A;  3CMA 3;  3QK9 A;  4HKV B;  1O7G B;  4K90 B;  3FSD A;  5A0O B;  1HKX A;  1K73 4;  3QRD A;  3MWZ A;  2RGQ A;  1N8R 4;  1EQK A;  1UI7 A;  3G16 A;  1IV9 A;  2HML B;  1WMN A;  3LH4 A;  1OF5 B;  5CLK A;  4STD A;  5D83 A;  3N9H A;  1AV4 A;  4HVN A;  5AI1 A;  1O7H B;  3LTB A;  1N8Q A;  4I4K A;  5IG3 A;  1YIT 3;  4FCJ A;  3WOE B;  1SJW A;  3JUQ A;  4AKZ A;  1D6U A;  1Y4K A;  3SOA A;  3WOF B;  1Q82 4;  3X3Y A;  1JNQ A;  3PS8 A;  5BVB A;  4FCZ A;  3EC9 A;  4HM7 B;  5IER A;  1IK3 A;  1RRH A;  4WWU C;  2A15 A;  3G4S 3;  2KCD A;  3MYT A;  2OTL 3;  3MSO A;  1YJN 3;  1D6Z A;  2CFD A;  1S5A A;  1C7H A;  1ZX2 A;  2OCT A;  1L5G B;  3BNC A;  3M8C A;  6STD A;  1VQK 3;  4KVH A;  1FGO A;  2XSH B;  3CC7 3;  3F14 A;  1OH0 A;  1W02 A;  4OK0 A;  3CCL 3;  1IQY A;  3Q90 A;  4CCV A;  5FGO A;  3KZT A;  1N5H A;  1Z1S A;  3SXX A;  1IV7 A;  3FG4 A;  3ER7 A;  1IVU A;  2WO0 A;  2OTJ 3;  3KN4 A;  1U5O A;  3F7S A;  3G0K A;  3SVA A;  5IG0 A;  3GAX A;  1OHP A;  1Q7Y 4;  1IVW A;  1FGR A;  3B4O A;  1AVK A;  1UI8 A;  1K8A 4;  3DM8 A;  1O7M B;  1CYV A;  1JKG B;  2W2C A;  1A2V A;  1Q42 A;  4LEH A;  2D42 A;  4GB5 A;  2Z76 A;  3UB1 A;  3PGB A;  2STD A;  2BNG A;  1NU3 A;  4HBR A;  4PEJ A;  2XF3 A;  1OGX A;  2V1L A;  1KC8 4;  4J9A A;  1JRQ A;  1GD3 A;  3LML A;  2PNC A;  3NHX A;  2YX9 A;  1JB2 A;  2P0M A;  1IVX A;  3CC2 3;  5IG5 A;  2IA7 A;  3X40 A;  4WFO A;  1VQN 3;  1W7C A;  3DGO A;  2K0M A;  3U1W A;  3NM2 A;  4EC6 A;  1OUN A;  4HM0 B;  4LZI A;  1Q40 A;  1VQ6 3;  2OQE C;  1RRL A;  3V92 A;  1TIJ A;  2CFW A;  4X2H A;  1IT7 A;  3Q1C A;  2CWU A;  3DZL A;  3EN1 B;  1NDO B;  3K63 A;  3KII A;  3VSY A;  1FUW A;  3PZW A;  4K1V A;  2D1W A;  3FG1 A;  1LOX A;  4HM4 B;  1AVL A;  1RN7 A;  4LMI A;  2OOV A;  2QEX 3;  4RNZ A;  3F8H A;  4HM6 B;  3NBJ A;  2HMN B;  1W6Y A;  3STD A;  3CXC 2;  2CK3 H;  3JUN A;  1OHS A;  2W6J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...