1NWWA

Limonene-1,2-epoxide hydrolase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
145
structure length
145
Chain Sequence
b'IEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSIDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNLSILGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Structure of Rhodococcus erythropolis limonene-1,2-epoxide hydrolase reveals a novel active site
pubmed doi rcsb
molecule tags Hydrolase
total genus 44
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1nwwA00
1Q42A 4IIAA 1OGZA 5AIGA 5EVHA 3GRDA 3D9RA 3HZPA 3ECFA 4XB5A 2XRXB 2I9WA 1VZZA 3DXOA 4HM4B 1UUVB 1QMAA 4XDVA 2YFIB 7STDA 5D81A 3K0ZA 3F8HA 2JQ5A 1DMMA 2Z76A 2GEYA 5D83A 4HM5B 1OUNA 4OVMA 1NWWA 6STDA 3EHCA 3LZAA 1O7GB 3A76A 2Z77A 3S5CA 1Q40A 4PEJA 2F86B 5DRVA 4L7KA 2XR8B 4LMIA 3JUNA 2PZVA 1STDA 3SOYA 3JUMA 1U5OA 3OWUA 3G8ZA 3NXJA 3F7SA 1O7NB 1OCVA 3F7XA 1QJGA 5AIFA 4XBTA 2XSOB 1JKGB 5D82A 3ER7A 1O7MB 3EBTA 1UUWB 3BB9A 4R9KA 2Z7AA 4LGQA 3KSPA 4HM8B 3SOAA 1JN5B 5IERA 3OX9A 4XBYA 1W00A 3CPOA 4N3VA 4KVHA 3HK4A 5IF6A 4Q53A 5IG3A 3EC9A 1ISKA 2XSHB 3KZTA 1K41A 1GS3A 4XM4A 3HX8A 2IMJA 3B4PA 3RGAA 2BMOB 4I4KA 5AEUB 4STDA 1JKGA 3OV4A 1SJWA 3EN8A 4L8PA 3EF8A 3FH1A 5BVBA 1OHSA 3MKIA 2W2CA 4H3UA 4CDLA 3STDA 1GY6A 1OGXA 3B8LA 4R1KA 3K7CA 1CQSA 3NV0B 5AIIA 3G0KA 5AEWB 2RGQA 3MG2A 2CKFB 1OPYA 1OF5B 3GZYB 1WQLB 4HM6B 3OWSA 1JB4A 1GYBA 3GZBA 3Q90A 3I0YA 3CU3A 2INXA 1TUHA 5BXQA 4WYKB 4LEHA 2GBXB 3BLZA 1EA2A 2HMKB 3NBRA 3EQQB 4FCMA 3EX9A 1E97A 1OHPA 2RCDA 2B24B 4ORLA 3DZLA 2QGUA 1ULIB 3JUPA 2BMQB 5JPUA 3H51A 3ROBA 3B4OA 2GEXA 3EN1B 1HKXA 3M8CA 5KP1A 1E3VA 4RZMA 3WMDA 3VSYA 1OF5A 5IG5A 4X2OA 1C7HA 3JUQA 4XDWA 1OHOA 1JB5A 4R9LA 1TP6A 3GZXB 4OUQA 2STDA 1S5AA 3JUOA 3EBYA 3FGYA 5CK6A 5DREA 3F40A 1W6YA 5KP4A 2BMRB 1GY7A 5CF2A 1ZX2A 3LYGA 1ASKA 3MHEA 1OH0A 1O7HB 3UJMA 4FCJA 4WWUC 4XBXA 2OWPA 5IG0A 4HM1B 3T8NA 3NHXA 5CLKA 4HZ9B 4J9AA 1GY5A 2K54A 5KP3A 3MG3A 1Z1SA 1Q40B 3MYTA 5TGNA 2B1XB 5AI1A 5IEPA 2F98A 1JN5A 2CHCA 5STDA 1O7PB 1ULJB 1W02A 5CXOA 3FKAA 3KKGA 4HVNA 2GXFA 2UX0A 3MSOA 1DMQA 5IENA 4X2HA 5AIHA 2R4IA 3SEDA 3NM2A 3FF0A 1DMNA 3MG1A 1NDOB 4U13A 2GBWB 3FSDA 3GZRA 2A15A 3FZWA 3KE7A 3H3HA 5CF1A 3FF2A 1O7WB 1E3RA 3F14A 3OXAA 4L8OA 5HGRA 3DM8A 3T8UA 2HMJB 2YFJB 1AR0A 3F9SA 2HMMB 3UNLA 3F8XA 3CNXA 3NV0A 4MJDA 5G2GA 3NUVA 3IPTA 4HM3B 4HZBB 1JB2A 8CHOA 3VGNA 4WP5A 3FLJA 1BUQA 4WYKA 1W01A 3E99A 2QIYA 3RGRA 3DUKA 5JPPA 4J8TA 4HJLB 1IDPA 4HM0B 1EG9B 2F99A 4HKVB 5IG4A 1ZO2A 3OWYA 2HMNB 3B7CA 4HM2B 1A2KA 3DMCA 3GWRA 1NU3A 2HMOB 4GB5A 2YFLB 2HMLB 2BNGA 5IEOA 4K1UA 4K1VA 2RFRA 4HM7B 3EJVA 5FW5A 3G16A 3CNMA
chains in the Genus database with same CATH superfamily
1Q42A 4IIAA 1OGZA 1BRKA 1A67A 5AIGA 5EVHA 3RDEA 2D42A 1I2GA 1LOWA 1BSBA 3WOFB 3GRDA 1BUJA 3EE1A 4BL2A 1K9M4 2CFGA 4JRFA 1SQWA 3D9RA 2CH9A 3ECFA 3HZPA 3LTDA 3N9HA 4XB5A 2BO9B 2XRXB 1EQKA 1IV9A 2I9WA 2KF5A 3BNCA 2KF6A 1T3BA 1JBTA 1TIJA 2RNTA 3CD63 1VZZA 4BTWA 1HYFA 1RCKA 1WNHA 1RRHA 1BAOA 3DXOA 4HM4B 1HZ1A 1UUVB 4RBNA 1C54A 1K734 1QMAA 4XDVA 2F5MA 1VQN3 2QA43 2YFIB 2FNQA 5M18A 2WGOA 7STDA 5D81A 1LNHA 3F8HA 3K0ZA 3PXMA 4N6LA 4TX4A 2JQ5A 1GOYA 3SXXA 1DMMA 2Z76A 3AMOA 2GEYA 2MC8A 5D83A 4HM5B 3RNTA 4HBRA 1IYYA 2W04A 1KWIA 1GD4A 1NWWA 1OUNA 4OVMA 6STDA 3EHCA 1FW7A 3LZAA 1YJN3 1BSCA 1UDII 1TFKA 1MWTA 1O7GB 1KSIA 1RLSA 2ZA4A 3A76A 1SPUA 2BHMA 2Z77A 3S5CA 1FGMA 5BU4A 3S28A 2ZDJA 1Q40A 1IV7A 2BU4A 2GU1A 1YGWA 3GSPA 4PEJA 2F86B 4ZM8A 2IUKA 5DRVA 1JRQA 1RNBA 2FXTA 2SARA 4L7KA 2ZL8A 2XR8B 4CPKA 4EBGA 1V74A 4LMIA 3JUNA 2PZVA 4EW5A 3U1WA 3FG1A 4AKYA 1B2SA 3G713 1STDA 2UGIA 3JUMA 3SOYA 1VQO3 1U5OA 3X40A 3OWUA 3G8ZA 1ZGXA 1JNQA 3OW22 1RMSA 3GAXA 3NXJA 2P05A 1LOXA 3HI7A 3K63A 3WR2A 3CCS3 3F7SA 1O7NB 1OCVA 2W56B 4HAAA 1RTUA 2QEX3 3D79A 3F7XA 1QJGA 1Y4KA 3BNEA 3KIIA 4MEIA 1RGLA 3CCE3 1EEJA 1DE3A 5BIRA 1V57A 5AIFA 4XBTA 1IK3A 2XSOB 1MGWA 1JKGB 5D82A 5M1AA 1RGFA 3ER7A 3KN4A 1I2FA 4NPBA 1O7MB 3EBTA 2M7OA 1MWUA 3CCJ3 1RGAA 1UUWB 2ZHXB 3BB9A 4R9KA 3CCQ3 2Z7AA 4LGQA 3D5IA 3KSPA 4I5QA 4HM8B 3LMLA 2O3OA 3SOAA 2H0IA 1JN5B 5IERA 3OX9A 1PU4A 1RGHA 9RNTA 1US1A 4XBYA 1W00A 1N9EA 1UUGB 3AGNA 3CPOA 3LH4A 4N3VA 1X1UA 4IPBA 4KVHA 1YIJ3 1I2EA 4G1MB 1M1XB 1JBRA 5RNTA 3HK4A 3DGOA 3CC73 1Q7HA 5IF6A 4Q53A 3VF1A 5LC7A 5LC6A 1S723 3LOYA 2CWTA 5IG3A 3EC9A 1RCLA 1IVWA 1RSNA 1I3IA 3PS8A 1AVKA 3LT9A 1AY7A 1ISKA 2XSHB 3KZTA 3V99A 1K41A 2KF4A 5ELJA 3WHOA 1GS3A 1FZUA 2W0QA 3I563 3SVAA 4O2HA 1BRHA 4XM4A 3D3LA 1GMRA 1VQ53 4FMBA 3HX8A 2IMJA 1BU4A 1FUWA 1BRJA 3B4PA 2WOHA 3RGAA 2BMOB 2AADA 4I4KA 3CCV3 1VQ83 1B21A 1FUTA 1BNSA 1TRPA 3TDGA 5AEUB 1IVXA 1R4YA 4HOHA 3Q3FA 1NNVA 3DGNA 1JKGA 4STDA 3OV4A 1SJWA 2KCDA 4QWTA 3EN8A 1TTOA 2RSXA 4L8PA 4KT3B 1A90A 2CFLA 1LRAA 1RGGA 1STFI 3EF8A 3FH1A 3HIGA 5G1LA 5BVBA 2Z6BA 1OHSA 1YNVX 1WMOA 3BNBA 3MKIA 3V92A 1BRGA 5M19A 1N9JA 5AYRB 3ZFZA 1AV4A 3UL5A 2W2CA 2KAAA 3KCHA 3NQYA 4H3UA 4CDLA 1WMPA 3CC23 2HOHA 3ZG0A 3STDA 1BSAA 1FGTA 1GY6A 2OOVA 1W6GA 2CFDA 3DH2A 4CJNA 8RNTA 1OGXA 1LVNA 3B8LA 3QK9A 4GL6A 4R1KA 3K7CA 1CQSA 1VQK3 1LOYA 3NV0B 5AIIA 4CCVA 3G0KA 5AEWB 2RGQA 3MG2A 2CKFB 1OPYA 4OK0A 1OF5B 4LYLB 3GZYB 1YI23 3EB8A 1WQLB 2XGLA 2K0MA 4HM6B 3KFQC 3CCU3 1T2IA 5AYSC 3OWSA 1DETA 4HYZA 1JB4A 1IT8A 2CC3A 1GYBA 1CH0A 5GSPA 3DGMA 2XFSA 3GZBA 3Q90A 1SARA 1PFPA 2CWVA 2MF7A 3I0YA 1B3SA 3CU3A 3S29A 3K5TA 1UCLA 1YJ93 2INXA 1JZDA 1TUHA 3LXUX 5BXQA 3PYJA 4WYKB 1RJOA 2KF3A 4BTYA 2H0HA 1TFOA 4LEHA 2GBXB 1VQ43 3MPHA 1CYVA 1A2PA 3BLZA 4MMZB 4N6V0 2XFTA 1EA2A 2HMKB 1BSDA 3NBRA 5ELUA 1VQ73 2IYJA 3IJEB 3EQQB 3NBBA 4FCMA 3EX9A 1E97A 1QVF2 4FMAA 1L5GB 5HOHA 2BIRA 1OHPA 2RCDA 2H0GA 3FG4A 1HU9A 2B24B 3S27A 1BRIA 3LTCA 4N6NB 4ORLA 3UB1A 4KFEA 4RNYA 1ROAA 1BNIA 1B20A 3DZLA 2QGUA 1ULIB 3JUPA 1VQL3 5A0OB 1N8R4 4N6UA 4BIRA 2OCTA 1QALA 1DVCA 2BMQB 1GSPA 5JPUA 3H51A 3ROBA 3B4OA 1QVG2 2IUJA 2GEXA 1OACA 3EN1B 1HKXA 1K8A4 1EUIC 2W6JH 2W9PA 3AHSA 3CCL3 4R4KA 3M8CA 4O02B 2CG1A 5KP1A 1LNIA 1VQQA 1UGHI 1BOXA 1E3VA 2OOVC 4RZMA 3WMDA 3VSYA 1IQYA 1KD14 1G02A 2LQVA 1RN7A 1OF5A 5I97A 1JBSA 3KSED 1QAFA 2XF3A 1RN4A 5IG5A 1NB5I 1FGOA 3IMAB 4X2OA 1C7HA 1B2UA 1G0TA 2E2UA 3JUQA 4XDWA 1OHOA 2IA7A 1LQMB 1JB5A 1SIHA 1I0XA 4R9LA 1TP6A 2WOFA 4WHAA 1WMNA 1BNEA 3GZXB 2O9UX 1IQXA 1R4CA 4OUQA 1G96A 1BANA 2STDA 4FCZA 1YJW3 1S5AA 1CEWI 2SBLA 3EBYA 3FGYA 3JUOA 1NO3A 2OTL3 1PYLA 1N8QA 1JV2B 3X3XA 3X3ZA 1X1XA 1I0VA 2CX0A 1T5YA 2AAEA 4KZ1A 5CK6A 1CYUA 1W2ZA 5DREA 3FG3A 5G1KA 3F40A 1W6YA 3HIIA 5KP4A 2BMRB 3PCSA 1TRQA 1GY7A 5CF2A 1BIRA 1ZX2A 3D4AA 1D6UA 3K9MC 2P38A 4GSPA 1W4NA 3LYGA 4FMCA 3LTBA 1ASKA 1UCJA 2CW9A 2W56A 3CC43 3SYUA 4MMYB 3Q1CA 3MHEA 3A5EA 1OH0A 2BT3A 1W6CA 6RNTA 1KC84 2WO0A 1O7HB 4O8SA 4J5KA 3UJMA 3AMOB 2KRTA 4FCJA 3WDGB 5EEOA 1RRLA 4GHOA 2XEPA 4WWUC 4XBXA 2OWPA 1U8CB 2C4BA 3PZWA 5IG0A 1NJI4 3J7Yd 3NX0A 1TJDA 4HM1B 3T8NA 3NHXA 4BU4A 1UGIA 3QRDA 2PNCA 1RNTA 1MWSA 1FUSA 4H61A 4J5GA 2YX9A 3CPW2 1BGSA 5CLKA 4HZ9B 1UCIA 4J9AA 2Q07A 1GY5A 2F5WA 2K54A 1B2ZA 5KP3A 3DGLA 3MG3A 4DKIA 1Z1SA 1W5ZA 3WA3A 1Q40B 4AEQA 3MYTA 5TGNA 1X1WA 2B1XB 5AI1A 4EC6A 1MNLA 1Q9EA 5IEPA 3I553 3G6E3 1Q824 3X3YA 1YVSA 2F98A 3PCRA 2Y74A 1JN5A 1EKMA 2CHCA 2CWUA 3CME3 5STDA 2K3DA 2GSPA 1A2VA 4N6OB 4MMXB 1O7PB 3NQZA 1M1K4 2CG0A 1ULJB 2CX1A 1W02A 5CXOA 4EXRA 1D6YA 3AHWA 3FKAA 1I3FA 1FYSA 2KXGA 3U97A 3KKGA 2XGNA 1SIIA 1BRSA 3DY5A 4HVNA 1VQ93 1IT7A 3FCSB 2GXFA 2UX0A 2W03A 3MSOA 1T2HA 4NHFA 4N6TA 5JBSA 3G4S3 2FGTA 1DMQA 1FGQA 3T0UA 5IENA 2RBIA 1LOVA 4X2HA 3CMA3 3D5GA 1BNFA 4LSOA 2GU3A 1B2XA 1YVBI 1UI8A 3CXC2 5AIHA 2R4IA 1NB3I 3SEDA 4KFDA 1RKYA 3NM2A 3FF0A 1DMNA 3MG1A 4BTXA 1NDOB 1YHQ3 4U13A 1B27A 4NREA 1TU5A 3SLUA 7GSPA 1Q7Y4 1VQ63 2GBWB 2JDIH 4O3VA 1RHLA 1UCKA 3FSDA 1I70A 3GZRA 2A15A 2P0MA 3FZWA 1DYUA 1BSEA 3CCM3 1D6ZA 4K90B 1WTHA 3WOEB 3WA2X 3KE7A 4IT7A 4BL3A 3H3HA 1PY3A 5CF1A 1J2BA 3FF2A 4JF8A 1O7WB 1E3RA 3F14A 5EQLA 3OXAA 3UL6A 2CIUA 4L8OA 1ROVA 2CFWA 1FA3A 4WFOA 1RGKA 3BNDA 5HGRA 2WGQA 1W2B2 5IW9A 2E2TA 3DM8A 3AGOA 1GD3A 3T8UA 1V58A 4RNZA 1UI7A 2HMJB 2YFJB 4K61A 1AR0A 1JJ22 5FGOA 3F9SA 1IU7A 2Y73A 1RGCA 2HMMB 1GOVA 3UNLA 3F8XA 7RNTA 1BRNL 2P0XA 1MWRA 1RGEA 1GMQA 1LXEA 3CNXA 3NV0A 2F4YA 2OQEA 3ZG5A 4MJDA 1Q864 2XH9A 5G2GA 2ML6A 3JVCA 3NUVA 1B2MA 2CFKA 3IPTA 4HM3B 1DVDA 4HZBB 4N6MA 1IQ8A 1JB2A 8CHOA 2E2VA 1FGRA 3V98A 3HOHA 1RN1A 1MOLA 3VGNA 1VQM3 1KQS2 2L1SA 4WP5A 1GOUA 4FMDA 1AQZA 3FLJA 1YGEA 1M9GA 4WYKA 1BUQA 1W01A 3N54B 4AKZA 3E99A 3LT8A 1I8VA 6GSPA 1MGRA 2QIYA 2W9QA 2C10A 3RGRA 4ILFA 1K28A 3DUKA 1GMPA 3DGYA 5JPPA 2UUGC 1ZS7A 1BNRA 2D1WA 4J8TA 4HJLB 1IVVA 1IDPA 1W7CA 4HM0B 1IVUA 3NBJA 3MWZA 1EG9B 1N5HA 3SX1A 3L0RA 3WODG 2F99A 2V1LA 4HKVB 3X42A 1BVIA 5IG4A 1QAKA 1F8NA 2OTJ3 3LTAA 4LZIA 1X1YA 1Q814 1ZO2A 3ALAA 3OWYA 1RDSA 2IY2A 3URPA 3PGBA 1AVLA 4EV5A 3BU4A 4FR9A 2HMNB 3N8BA 1YIT3 3NM7A 1BNJA 3B7CA 4HM2B 1M904 1BNGA 3X41A 1A2KA 1JZOA 3S67A 3DMCA 3GWRA 1NU3A 2HMOB 2L4VA 1LQGC 4GB5A 4KFFA 2YFLB 2HMLB 2R41A 1N5PA 4EV2A 3CCR3 3O8YA 2J8XB 2BNGA 5IEOA 4EYCA 4RNTA 4K1UA 3Q2PA 4K1VA 2RFRA 4HM7B 2LYXA 2OQEC 3EJVA 4R80A 5FW5A 2P09A 1VQP3 2F56A 1UW1A 3BIRA 2C11A 2CK3H 3G16A 3CNMA 2ML5A
chains in the Genus database with same CATH topology
1Q42A 4IIAA 1OGZA 1A67A 5AIGA 5EVHA 3RDEA 2D42A 3WOFB 3GRDA 3EE1A 1K9M4 2CFGA 4JRFA 1SQWA 3D9RA 2CH9A 3ECFA 3HZPA 3LTDA 3N9HA 4XB5A 2BO9B 2XRXB 1EQKA 1IV9A 2I9WA 3BNCA 1TIJA 3CD63 1VZZA 4BTWA 1WNHA 1RRHA 3DXOA 4HM4B 1UUVB 4RBNA 1K734 1QMAA 4XDVA 1VQN3 2QA43 2YFIB 2FNQA 2WGOA 7STDA 5D81A 1LNHA 3F8HA 3K0ZA 3PXMA 4N6LA 4TX4A 2JQ5A 3SXXA 1DMMA 2Z76A 3AMOA 2GEYA 2MC8A 5D83A 4HM5B 4HBRA 2W04A 1KWIA 1GD4A 1NWWA 1OUNA 4OVMA 6STDA 3EHCA 3LZAA 1YJN3 1TFKA 1O7GB 1KSIA 3A76A 1SPUA 2BHMA 2Z77A 3S5CA 1FGMA 3S28A 2ZDJA 1Q40A 1IV7A 2GU1A 4PEJA 4ZM8A 2F86B 2IUKA 5DRVA 1JRQA 2FXTA 4L7KA 2ZL8A 2XR8B 4EBGA 1V74A 4LMIA 3JUNA 2PZVA 3U1WA 3FG1A 4AKYA 3G713 1VQO3 1STDA 3JUMA 3SOYA 1U5OA 3X40A 3OWUA 3G8ZA 1JNQA 3OW22 3GAXA 3NXJA 2P05A 1LOXA 3HI7A 3K63A 3CCS3 3F7SA 1O7NB 1OCVA 2W56B 2QEX3 3F7XA 1QJGA 1Y4KA 3BNEA 3KIIA 4MEIA 3CCE3 5AIFA 4XBTA 1IK3A 2XSOB 1JKGB 5D82A 3ER7A 3KN4A 1O7MB 3EBTA 2M7OA 3CCJ3 1UUWB 3BB9A 4R9KA 3CCQ3 2Z7AA 4LGQA 3KSPA 4HM8B 3LMLA 2O3OA 3SOAA 1PU4A 1JN5B 5IERA 3OX9A 1US1A 4XBYA 1W00A 1N9EA 3CPOA 4N3VA 3LH4A 4IPBA 4KVHA 1YIJ3 4G1MB 1M1XB 3HK4A 3DGOA 3CC73 5IF6A 4Q53A 3VF1A 5LC7A 5LC6A 1S723 3LOYA 2CWTA 5IG3A 3EC9A 1IVWA 3PS8A 1AVKA 3LT9A 1ISKA 2XSHB 3KZTA 3V99A 1K41A 5ELJA 1GS3A 3I563 2W0QA 3SVAA 4O2HA 4XM4A 3D3LA 1VQ53 4FMBA 3HX8A 2IMJA 1FUWA 3B4PA 2WOHA 3RGAA 2BMOB 4I4KA 3CCV3 1VQ83 3TDGA 5AEUB 1IVXA 4STDA 3DGNA 1JKGA 3OV4A 1SJWA 2KCDA 4QWTA 3EN8A 4L8PA 2RSXA 1A90A 2CFLA 3HIGA 1STFI 3EF8A 3FH1A 5BVBA 2Z6BA 1OHSA 1WMOA 3BNBA 3MKIA 3V92A 1N9JA 5AYRB 1AV4A 3UL5A 2W2CA 3NQYA 4H3UA 4CDLA 1WMPA 3CC23 3STDA 1FGTA 1GY6A 2OOVA 1W6GA 2CFDA 1OGXA 1LVNA 3B8LA 3QK9A 4GL6A 4R1KA 3K7CA 1CQSA 1VQK3 3NV0B 5AIIA 4CCVA 3G0KA 5AEWB 2RGQA 3MG2A 2CKFB 1OPYA 4OK0A 1OF5B 3GZYB 1YI23 3EB8A 1WQLB 2XGLA 2K0MA 4HM6B 3KFQC 3CCU3 5AYSC 3OWSA 4HYZA 1IT8A 1JB4A 2CC3A 1GYBA 3DGMA 2XFSA 3GZBA 3Q90A 1PFPA 2CWVA 2MF7A 3I0YA 3S29A 3CU3A 1YJ93 3K5TA 2INXA 1TUHA 3LXUX 5BXQA 3PYJA 4WYKB 1RJOA 4BTYA 1TFOA 4LEHA 2GBXB 1VQ43 3MPHA 1CYVA 3BLZA 4MMZB 4N6V0 2XFTA 1EA2A 2HMKB 3NBRA 5ELUA 1VQ73 3IJEB 3EQQB 3NBBA 4FCMA 3EX9A 1E97A 1QVF2 4FMAA 1L5GB 1OHPA 2RCDA 3FG4A 1HU9A 2B24B 3S27A 3LTCA 4N6NB 4ORLA 3UB1A 4KFEA 4RNYA 1ROAA 3DZLA 2QGUA 1ULIB 3JUPA 1VQL3 5A0OB 1N8R4 4N6UA 2OCTA 1QALA 1DVCA 2BMQB 5JPUA 3H51A 3ROBA 3B4OA 1QVG2 2IUJA 2GEXA 1OACA 3EN1B 1HKXA 1K8A4 2W9PA 2W6JH 3CCL3 4R4KA 3M8CA 4O02B 2CG1A 5KP1A 1E3VA 2OOVC 4RZMA 3WMDA 3VSYA 1IQYA 1KD14 2LQVA 1RN7A 1OF5A 5I97A 3KSED 1QAFA 2XF3A 5IG5A 1NB5I 1FGOA 3IMAB 4X2OA 1C7HA 2E2UA 3JUQA 4XDWA 1OHOA 2IA7A 1SIHA 1JB5A 4R9LA 1TP6A 2WOFA 4WHAA 1WMNA 3GZXB 2O9UX 1IQXA 1R4CA 4OUQA 1G96A 2STDA 4FCZA 1YJW3 1S5AA 1CEWI 2SBLA 3EBYA 3FGYA 3JUOA 1NO3A 2OTL3 1N8QA 1JV2B 3X3XA 3X3ZA 5CK6A 1T5YA 4KZ1A 1CYUA 1W2ZA 5DREA 3FG3A 3F40A 1W6YA 3HIIA 5KP4A 2BMRB 3PCSA 1GY7A 5CF2A 1ZX2A 1D6UA 3K9MC 2P38A 3CC43 1W4NA 3LYGA 4FMCA 3LTBA 1ASKA 2CW9A 2W56A 4MMYB 3Q1CA 3MHEA 1OH0A 2BT3A 1W6CA 1KC84 2WO0A 1O7HB 4O8SA 3UJMA 3AMOB 2KRTA 4FCJA 3WDGB 5EEOA 1RRLA 2XEPA 4WWUC 4XBXA 2OWPA 1U8CB 3PZWA 5IG0A 1NJI4 3J7Yd 3NX0A 4HM1B 3T8NA 3NHXA 3QRDA 2PNCA 4H61A 2YX9A 3CPW2 5CLKA 4HZ9B 4J9AA 2Q07A 1GY5A 2K54A 5KP3A 3DGLA 3MG3A 1Z1SA 1W5ZA 3WA3A 1Q40B 4AEQA 3MYTA 5TGNA 2B1XB 5AI1A 4EC6A 1MNLA 5IEPA 3I553 3G6E3 1Q824 3X3YA 2F98A 3PCRA 2Y74A 1JN5A 1EKMA 2CHCA 2CWUA 3CME3 5STDA 1A2VA 4N6OB 4MMXB 1O7PB 3NQZA 1M1K4 2CG0A 1ULJB 1W02A 5CXOA 4EXRA 1D6YA 3FKAA 2KXGA 3U97A 3KKGA 2XGNA 1SIIA 3DY5A 4HVNA 1VQ93 1IT7A 3FCSB 2GXFA 2UX0A 2W03A 3MSOA 4NHFA 4N6TA 5JBSA 3G4S3 2FGTA 1DMQA 1FGQA 3T0UA 5IENA 4X2HA 3CMA3 4LSOA 2GU3A 1YVBI 1UI8A 3CXC2 5AIHA 2R4IA 1NB3I 3SEDA 4KFDA 1RKYA 3NM2A 3FF0A 1DMNA 3MG1A 4BTXA 1NDOB 1YHQ3 4U13A 4NREA 1TU5A 3SLUA 1Q7Y4 1VQ63 2GBWB 2JDIH 4O3VA 3FSDA 3GZRA 2A15A 2P0MA 3FZWA 1DYUA 3CCM3 1D6ZA 4K90B 1WTHA 3WOEB 3WA2X 3KE7A 4IT7A 3H3HA 5CF1A 1J2BA 3FF2A 4JF8A 1O7WB 1E3RA 3F14A 5EQLA 3OXAA 3UL6A 2CIUA 4L8OA 1ROVA 2CFWA 1FA3A 4WFOA 3BNDA 5HGRA 2WGQA 1W2B2 5IW9A 2E2TA 3DM8A 3T8UA 1GD3A 4RNZA 1UI7A 2HMJB 2YFJB 4K61A 1AR0A 1JJ22 5FGOA 3F9SA 1IU7A 2Y73A 2HMMB 3UNLA 3F8XA 2P0XA 3CNXA 3NV0A 1LXEA 2OQEA 4MJDA 1Q864 2XH9A 5G2GA 2ML6A 3JVCA 3NUVA 1DVDA 2CFKA 3IPTA 4HM3B 4HZBB 4N6MA 1IQ8A 1JB2A 8CHOA 2E2VA 1FGRA 3V98A 1MOLA 3VGNA 1VQM3 1KQS2 4WP5A 4FMDA 3FLJA 1YGEA 1M9GA 4WYKA 1BUQA 1W01A 3N54B 4AKZA 3E99A 3LT8A 2QIYA 2W9QA 2C10A 3RGRA 1K28A 3DUKA 5JPPA 2D1WA 4J8TA 4HJLB 1IVVA 1IDPA 1W7CA 4HM0B 1IVUA 3NBJA 3MWZA 1EG9B 1N5HA 3SX1A 3L0RA 3WODG 2F99A 2V1LA 4HKVB 3X42A 5IG4A 1QAKA 1F8NA 2OTJ3 3LTAA 4LZIA 1Q814 1ZO2A 3ALAA 3OWYA 3PGBA 1AVLA 4EV5A 1YIT3 4FR9A 2HMNB 3N8BA 3NM7A 3B7CA 1M904 4HM2B 3X41A 1A2KA 3S67A 3DMCA 3GWRA 1NU3A 2HMOB 2L4VA 4GB5A 4KFFA 2YFLB 2HMLB 4EV2A 1N5PA 3CCR3 3O8YA 2BNGA 5IEOA 4EYCA 4K1UA 3Q2PA 4K1VA 2RFRA 4HM7B 2LYXA 2OQEC 3EJVA 4R80A 5FW5A 2P09A 1VQP3 1UW1A 2C11A 2CK3H 3G16A 3CNMA 2ML5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q42 A;  4IIA A;  1OGZ A;  5AIG A;  5EVH A;  3GRD A;  3D9R A;  3HZP A;  3ECF A;  4XB5 A;  2XRX B;  2I9W A;  1VZZ A;  3DXO A;  4HM4 B;  1UUV B;  1QMA A;  4XDV A;  2YFI B;  7STD A;  5D81 A;  3K0Z A;  3F8H A;  2JQ5 A;  1DMM A;  2Z76 A;  2GEY A;  5D83 A;  4HM5 B;  1OUN A;  4OVM A;  1NWW A;  6STD A;  3EHC A;  3LZA A;  1O7G B;  3A76 A;  2Z77 A;  3S5C A;  1Q40 A;  4PEJ A;  2F86 B;  5DRV A;  4L7K A;  2XR8 B;  4LMI A;  3JUN A;  2PZV A;  1STD A;  3SOY A;  3JUM A;  1U5O A;  3OWU A;  3G8Z A;  3NXJ A;  3F7S A;  1O7N B;  1OCV A;  3F7X A;  1QJG A;  5AIF A;  4XBT A;  2XSO B;  1JKG B;  5D82 A;  3ER7 A;  1O7M B;  3EBT A;  1UUW B;  3BB9 A;  4R9K A;  2Z7A A;  4LGQ A;  3KSP A;  4HM8 B;  3SOA A;  1JN5 B;  5IER A;  3OX9 A;  4XBY A;  1W00 A;  3CPO A;  4N3V A;  4KVH A;  3HK4 A;  5IF6 A;  4Q53 A;  5IG3 A;  3EC9 A;  1ISK A;  2XSH B;  3KZT A;  1K41 A;  1GS3 A;  4XM4 A;  3HX8 A;  2IMJ A;  3B4P A;  3RGA A;  2BMO B;  4I4K A;  5AEU B;  4STD A;  1JKG A;  3OV4 A;  1SJW A;  3EN8 A;  4L8P A;  3EF8 A;  3FH1 A;  5BVB A;  1OHS A;  3MKI A;  2W2C A;  4H3U A;  4CDL A;  3STD A;  1GY6 A;  1OGX A;  3B8L A;  4R1K A;  3K7C A;  1CQS A;  3NV0 B;  5AII A;  3G0K A;  5AEW B;  2RGQ A;  3MG2 A;  2CKF B;  1OPY A;  1OF5 B;  3GZY B;  1WQL B;  4HM6 B;  3OWS A;  1JB4 A;  1GYB A;  3GZB A;  3Q90 A;  3I0Y A;  3CU3 A;  2INX A;  1TUH A;  5BXQ A;  4WYK B;  4LEH A;  2GBX B;  3BLZ A;  1EA2 A;  2HMK B;  3NBR A;  3EQQ B;  4FCM A;  3EX9 A;  1E97 A;  1OHP A;  2RCD A;  2B24 B;  4ORL A;  3DZL A;  2QGU A;  1ULI B;  3JUP A;  2BMQ B;  5JPU A;  3H51 A;  3ROB A;  3B4O A;  2GEX A;  3EN1 B;  1HKX A;  3M8C A;  5KP1 A;  1E3V A;  4RZM A;  3WMD A;  3VSY A;  1OF5 A;  5IG5 A;  4X2O A;  1C7H A;  3JUQ A;  4XDW A;  1OHO A;  1JB5 A;  4R9L A;  1TP6 A;  3GZX B;  4OUQ A;  2STD A;  1S5A A;  3JUO A;  3EBY A;  3FGY A;  5CK6 A;  5DRE A;  3F40 A;  1W6Y A;  5KP4 A;  2BMR B;  1GY7 A;  5CF2 A;  1ZX2 A;  3LYG A;  1ASK A;  3MHE A;  1OH0 A;  1O7H B;  3UJM A;  4FCJ A;  4WWU C;  4XBX A;  2OWP A;  5IG0 A;  4HM1 B;  3T8N A;  3NHX A;  5CLK A;  4HZ9 B;  4J9A A;  1GY5 A;  2K54 A;  5KP3 A;  3MG3 A;  1Z1S A;  1Q40 B;  3MYT A;  5TGN A;  2B1X B;  5AI1 A;  5IEP A;  2F98 A;  1JN5 A;  2CHC A;  5STD A;  1O7P B;  1ULJ B;  1W02 A;  5CXO A;  3FKA A;  3KKG A;  4HVN A;  2GXF A;  2UX0 A;  3MSO A;  1DMQ A;  5IEN A;  4X2H A;  5AIH A;  2R4I A;  3SED A;  3NM2 A;  3FF0 A;  1DMN A;  3MG1 A;  1NDO B;  4U13 A;  2GBW B;  3FSD A;  3GZR A;  2A15 A;  3FZW A;  3KE7 A;  3H3H A;  5CF1 A;  3FF2 A;  1O7W B;  1E3R A;  3F14 A;  3OXA A;  4L8O A;  5HGR A;  3DM8 A;  3T8U A;  2HMJ B;  2YFJ B;  1AR0 A;  3F9S A;  2HMM B;  3UNL A;  3F8X A;  3CNX A;  3NV0 A;  4MJD A;  5G2G A;  3NUV A;  3IPT A;  4HM3 B;  4HZB B;  1JB2 A;  8CHO A;  3VGN A;  4WP5 A;  3FLJ A;  1BUQ A;  4WYK A;  1W01 A;  3E99 A;  2QIY A;  3RGR A;  3DUK A;  5JPP A;  4J8T A;  4HJL B;  1IDP A;  4HM0 B;  1EG9 B;  2F99 A;  4HKV B;  5IG4 A;  1ZO2 A;  3OWY A;  2HMN B;  3B7C A;  4HM2 B;  1A2K A;  3DMC A;  3GWR A;  1NU3 A;  2HMO B;  4GB5 A;  2YFL B;  2HML B;  2BNG A;  5IEO A;  4K1U A;  4K1V A;  2RFR A;  4HM7 B;  3EJV A;  5FW5 A;  3G16 A;  3CNM A; 
#chains in the Genus database with same CATH topology
 1Q42 A;  4IIA A;  1OGZ A;  1BRK A;  1A67 A;  5AIG A;  5EVH A;  3RDE A;  2D42 A;  1I2G A;  1LOW A;  1BSB A;  3WOF B;  3GRD A;  1BUJ A;  3EE1 A;  4BL2 A;  1K9M 4;  2CFG A;  4JRF A;  1SQW A;  3D9R A;  2CH9 A;  3ECF A;  3HZP A;  3LTD A;  3N9H A;  4XB5 A;  2BO9 B;  2XRX B;  1EQK A;  1IV9 A;  2I9W A;  2KF5 A;  3BNC A;  2KF6 A;  1T3B A;  1JBT A;  1TIJ A;  2RNT A;  3CD6 3;  1VZZ A;  4BTW A;  1HYF A;  1RCK A;  1WNH A;  1RRH A;  1BAO A;  3DXO A;  4HM4 B;  1HZ1 A;  1UUV B;  4RBN A;  1C54 A;  1K73 4;  1QMA A;  4XDV A;  2F5M A;  1VQN 3;  2QA4 3;  2YFI B;  2FNQ A;  5M18 A;  2WGO A;  7STD A;  5D81 A;  1LNH A;  3F8H A;  3K0Z A;  3PXM A;  4N6L A;  4TX4 A;  2JQ5 A;  1GOY A;  3SXX A;  1DMM A;  2Z76 A;  3AMO A;  2GEY A;  2MC8 A;  5D83 A;  4HM5 B;  3RNT A;  4HBR A;  1IYY A;  2W04 A;  1KWI A;  1GD4 A;  1NWW A;  1OUN A;  4OVM A;  6STD A;  3EHC A;  1FW7 A;  3LZA A;  1YJN 3;  1BSC A;  1UDI I;  1TFK A;  1MWT A;  1O7G B;  1KSI A;  1RLS A;  2ZA4 A;  3A76 A;  1SPU A;  2BHM A;  2Z77 A;  3S5C A;  1FGM A;  5BU4 A;  3S28 A;  2ZDJ A;  1Q40 A;  1IV7 A;  2BU4 A;  2GU1 A;  1YGW A;  3GSP A;  4PEJ A;  2F86 B;  4ZM8 A;  2IUK A;  5DRV A;  1JRQ A;  1RNB A;  2FXT A;  2SAR A;  4L7K A;  2ZL8 A;  2XR8 B;  4CPK A;  4EBG A;  1V74 A;  4LMI A;  3JUN A;  2PZV A;  4EW5 A;  3U1W A;  3FG1 A;  4AKY A;  1B2S A;  3G71 3;  1STD A;  2UGI A;  3JUM A;  3SOY A;  1VQO 3;  1U5O A;  3X40 A;  3OWU A;  3G8Z A;  1ZGX A;  1JNQ A;  3OW2 2;  1RMS A;  3GAX A;  3NXJ A;  2P05 A;  1LOX A;  3HI7 A;  3K63 A;  3WR2 A;  3CCS 3;  3F7S A;  1O7N B;  1OCV A;  2W56 B;  4HAA A;  1RTU A;  2QEX 3;  3D79 A;  3F7X A;  1QJG A;  1Y4K A;  3BNE A;  3KII A;  4MEI A;  1RGL A;  3CCE 3;  1EEJ A;  1DE3 A;  5BIR A;  1V57 A;  5AIF A;  4XBT A;  1IK3 A;  2XSO B;  1MGW A;  1JKG B;  5D82 A;  5M1A A;  1RGF A;  3ER7 A;  3KN4 A;  1I2F A;  4NPB A;  1O7M B;  3EBT A;  2M7O A;  1MWU A;  3CCJ 3;  1RGA A;  1UUW B;  2ZHX B;  3BB9 A;  4R9K A;  3CCQ 3;  2Z7A A;  4LGQ A;  3D5I A;  3KSP A;  4I5Q A;  4HM8 B;  3LML A;  2O3O A;  3SOA A;  2H0I A;  1JN5 B;  5IER A;  3OX9 A;  1PU4 A;  1RGH A;  9RNT A;  1US1 A;  4XBY A;  1W00 A;  1N9E A;  1UUG B;  3AGN A;  3CPO A;  3LH4 A;  4N3V A;  1X1U A;  4IPB A;  4KVH A;  1YIJ 3;  1I2E A;  4G1M B;  1M1X B;  1JBR A;  5RNT A;  3HK4 A;  3DGO A;  3CC7 3;  1Q7H A;  5IF6 A;  4Q53 A;  3VF1 A;  5LC7 A;  5LC6 A;  1S72 3;  3LOY A;  2CWT A;  5IG3 A;  3EC9 A;  1RCL A;  1IVW A;  1RSN A;  1I3I A;  3PS8 A;  1AVK A;  3LT9 A;  1AY7 A;  1ISK A;  2XSH B;  3KZT A;  3V99 A;  1K41 A;  2KF4 A;  5ELJ A;  3WHO A;  1GS3 A;  1FZU A;  2W0Q A;  3I56 3;  3SVA A;  4O2H A;  1BRH A;  4XM4 A;  3D3L A;  1GMR A;  1VQ5 3;  4FMB A;  3HX8 A;  2IMJ A;  1BU4 A;  1FUW A;  1BRJ A;  3B4P A;  2WOH A;  3RGA A;  2BMO B;  2AAD A;  4I4K A;  3CCV 3;  1VQ8 3;  1B21 A;  1FUT A;  1BNS A;  1TRP A;  3TDG A;  5AEU B;  1IVX A;  1R4Y A;  4HOH A;  3Q3F A;  1NNV A;  3DGN A;  1JKG A;  4STD A;  3OV4 A;  1SJW A;  2KCD A;  4QWT A;  3EN8 A;  1TTO A;  2RSX A;  4L8P A;  4KT3 B;  1A90 A;  2CFL A;  1LRA A;  1RGG A;  1STF I;  3EF8 A;  3FH1 A;  3HIG A;  5G1L A;  5BVB A;  2Z6B A;  1OHS A;  1YNV X;  1WMO A;  3BNB A;  3MKI A;  3V92 A;  1BRG A;  5M19 A;  1N9J A;  5AYR B;  3ZFZ A;  1AV4 A;  3UL5 A;  2W2C A;  2KAA A;  3KCH A;  3NQY A;  4H3U A;  4CDL A;  1WMP A;  3CC2 3;  2HOH A;  3ZG0 A;  3STD A;  1BSA A;  1FGT A;  1GY6 A;  2OOV A;  1W6G A;  2CFD A;  3DH2 A;  4CJN A;  8RNT A;  1OGX A;  1LVN A;  3B8L A;  3QK9 A;  4GL6 A;  4R1K A;  3K7C A;  1CQS A;  1VQK 3;  1LOY A;  3NV0 B;  5AII A;  4CCV A;  3G0K A;  5AEW B;  2RGQ A;  3MG2 A;  2CKF B;  1OPY A;  4OK0 A;  1OF5 B;  4LYL B;  3GZY B;  1YI2 3;  3EB8 A;  1WQL B;  2XGL A;  2K0M A;  4HM6 B;  3KFQ C;  3CCU 3;  1T2I A;  5AYS C;  3OWS A;  1DET A;  4HYZ A;  1JB4 A;  1IT8 A;  2CC3 A;  1GYB A;  1CH0 A;  5GSP A;  3DGM A;  2XFS A;  3GZB A;  3Q90 A;  1SAR A;  1PFP A;  2CWV A;  2MF7 A;  3I0Y A;  1B3S A;  3CU3 A;  3S29 A;  3K5T A;  1UCL A;  1YJ9 3;  2INX A;  1JZD A;  1TUH A;  3LXU X;  5BXQ A;  3PYJ A;  4WYK B;  1RJO A;  2KF3 A;  4BTY A;  2H0H A;  1TFO A;  4LEH A;  2GBX B;  1VQ4 3;  3MPH A;  1CYV A;  1A2P A;  3BLZ A;  4MMZ B;  4N6V 0;  2XFT A;  1EA2 A;  2HMK B;  1BSD A;  3NBR A;  5ELU A;  1VQ7 3;  2IYJ A;  3IJE B;  3EQQ B;  3NBB A;  4FCM A;  3EX9 A;  1E97 A;  1QVF 2;  4FMA A;  1L5G B;  5HOH A;  2BIR A;  1OHP A;  2RCD A;  2H0G A;  3FG4 A;  1HU9 A;  2B24 B;  3S27 A;  1BRI A;  3LTC A;  4N6N B;  4ORL A;  3UB1 A;  4KFE A;  4RNY A;  1ROA A;  1BNI A;  1B20 A;  3DZL A;  2QGU A;  1ULI B;  3JUP A;  1VQL 3;  5A0O B;  1N8R 4;  4N6U A;  4BIR A;  2OCT A;  1QAL A;  1DVC A;  2BMQ B;  1GSP A;  5JPU A;  3H51 A;  3ROB A;  3B4O A;  1QVG 2;  2IUJ A;  2GEX A;  1OAC A;  3EN1 B;  1HKX A;  1K8A 4;  1EUI C;  2W6J H;  2W9P A;  3AHS A;  3CCL 3;  4R4K A;  3M8C A;  4O02 B;  2CG1 A;  5KP1 A;  1LNI A;  1VQQ A;  1UGH I;  1BOX A;  1E3V A;  2OOV C;  4RZM A;  3WMD A;  3VSY A;  1IQY A;  1KD1 4;  1G02 A;  2LQV A;  1RN7 A;  1OF5 A;  5I97 A;  1JBS A;  3KSE D;  1QAF A;  2XF3 A;  1RN4 A;  5IG5 A;  1NB5 I;  1FGO A;  3IMA B;  4X2O A;  1C7H A;  1B2U A;  1G0T A;  2E2U A;  3JUQ A;  4XDW A;  1OHO A;  2IA7 A;  1LQM B;  1JB5 A;  1SIH A;  1I0X A;  4R9L A;  1TP6 A;  2WOF A;  4WHA A;  1WMN A;  1BNE A;  3GZX B;  2O9U X;  1IQX A;  1R4C A;  4OUQ A;  1G96 A;  1BAN A;  2STD A;  4FCZ A;  1YJW 3;  1S5A A;  1CEW I;  2SBL A;  3EBY A;  3FGY A;  3JUO A;  1NO3 A;  2OTL 3;  1PYL A;  1N8Q A;  1JV2 B;  3X3X A;  3X3Z A;  1X1X A;  1I0V A;  2CX0 A;  1T5Y A;  2AAE A;  4KZ1 A;  5CK6 A;  1CYU A;  1W2Z A;  5DRE A;  3FG3 A;  5G1K A;  3F40 A;  1W6Y A;  3HII A;  5KP4 A;  2BMR B;  3PCS A;  1TRQ A;  1GY7 A;  5CF2 A;  1BIR A;  1ZX2 A;  3D4A A;  1D6U A;  3K9M C;  2P38 A;  4GSP A;  1W4N A;  3LYG A;  4FMC A;  3LTB A;  1ASK A;  1UCJ A;  2CW9 A;  2W56 A;  3CC4 3;  3SYU A;  4MMY B;  3Q1C A;  3MHE A;  3A5E A;  1OH0 A;  2BT3 A;  1W6C A;  6RNT A;  1KC8 4;  2WO0 A;  1O7H B;  4O8S A;  4J5K A;  3UJM A;  3AMO B;  2KRT A;  4FCJ A;  3WDG B;  5EEO A;  1RRL A;  4GHO A;  2XEP A;  4WWU C;  4XBX A;  2OWP A;  1U8C B;  2C4B A;  3PZW A;  5IG0 A;  1NJI 4;  3J7Y d;  3NX0 A;  1TJD A;  4HM1 B;  3T8N A;  3NHX A;  4BU4 A;  1UGI A;  3QRD A;  2PNC A;  1RNT A;  1MWS A;  1FUS A;  4H61 A;  4J5G A;  2YX9 A;  3CPW 2;  1BGS A;  5CLK A;  4HZ9 B;  1UCI A;  4J9A A;  2Q07 A;  1GY5 A;  2F5W A;  2K54 A;  1B2Z A;  5KP3 A;  3DGL A;  3MG3 A;  4DKI A;  1Z1S A;  1W5Z A;  3WA3 A;  1Q40 B;  4AEQ A;  3MYT A;  5TGN A;  1X1W A;  2B1X B;  5AI1 A;  4EC6 A;  1MNL A;  1Q9E A;  5IEP A;  3I55 3;  3G6E 3;  1Q82 4;  3X3Y A;  1YVS A;  2F98 A;  3PCR A;  2Y74 A;  1JN5 A;  1EKM A;  2CHC A;  2CWU A;  3CME 3;  5STD A;  2K3D A;  2GSP A;  1A2V A;  4N6O B;  4MMX B;  1O7P B;  3NQZ A;  1M1K 4;  2CG0 A;  1ULJ B;  2CX1 A;  1W02 A;  5CXO A;  4EXR A;  1D6Y A;  3AHW A;  3FKA A;  1I3F A;  1FYS A;  2KXG A;  3U97 A;  3KKG A;  2XGN A;  1SII A;  1BRS A;  3DY5 A;  4HVN A;  1VQ9 3;  1IT7 A;  3FCS B;  2GXF A;  2UX0 A;  2W03 A;  3MSO A;  1T2H A;  4NHF A;  4N6T A;  5JBS A;  3G4S 3;  2FGT A;  1DMQ A;  1FGQ A;  3T0U A;  5IEN A;  2RBI A;  1LOV A;  4X2H A;  3CMA 3;  3D5G A;  1BNF A;  4LSO A;  2GU3 A;  1B2X A;  1YVB I;  1UI8 A;  3CXC 2;  5AIH A;  2R4I A;  1NB3 I;  3SED A;  4KFD A;  1RKY A;  3NM2 A;  3FF0 A;  1DMN A;  3MG1 A;  4BTX A;  1NDO B;  1YHQ 3;  4U13 A;  1B27 A;  4NRE A;  1TU5 A;  3SLU A;  7GSP A;  1Q7Y 4;  1VQ6 3;  2GBW B;  2JDI H;  4O3V A;  1RHL A;  1UCK A;  3FSD A;  1I70 A;  3GZR A;  2A15 A;  2P0M A;  3FZW A;  1DYU A;  1BSE A;  3CCM 3;  1D6Z A;  4K90 B;  1WTH A;  3WOE B;  3WA2 X;  3KE7 A;  4IT7 A;  4BL3 A;  3H3H A;  1PY3 A;  5CF1 A;  1J2B A;  3FF2 A;  4JF8 A;  1O7W B;  1E3R A;  3F14 A;  5EQL A;  3OXA A;  3UL6 A;  2CIU A;  4L8O A;  1ROV A;  2CFW A;  1FA3 A;  4WFO A;  1RGK A;  3BND A;  5HGR A;  2WGQ A;  1W2B 2;  5IW9 A;  2E2T A;  3DM8 A;  3AGO A;  1GD3 A;  3T8U A;  1V58 A;  4RNZ A;  1UI7 A;  2HMJ B;  2YFJ B;  4K61 A;  1AR0 A;  1JJ2 2;  5FGO A;  3F9S A;  1IU7 A;  2Y73 A;  1RGC A;  2HMM B;  1GOV A;  3UNL A;  3F8X A;  7RNT A;  1BRN L;  2P0X A;  1MWR A;  1RGE A;  1GMQ A;  1LXE A;  3CNX A;  3NV0 A;  2F4Y A;  2OQE A;  3ZG5 A;  4MJD A;  1Q86 4;  2XH9 A;  5G2G A;  2ML6 A;  3JVC A;  3NUV A;  1B2M A;  2CFK A;  3IPT A;  4HM3 B;  1DVD A;  4HZB B;  4N6M A;  1IQ8 A;  1JB2 A;  8CHO A;  2E2V A;  1FGR A;  3V98 A;  3HOH A;  1RN1 A;  1MOL A;  3VGN A;  1VQM 3;  1KQS 2;  2L1S A;  4WP5 A;  1GOU A;  4FMD A;  1AQZ A;  3FLJ A;  1YGE A;  1M9G A;  4WYK A;  1BUQ A;  1W01 A;  3N54 B;  4AKZ A;  3E99 A;  3LT8 A;  1I8V A;  6GSP A;  1MGR A;  2QIY A;  2W9Q A;  2C10 A;  3RGR A;  4ILF A;  1K28 A;  3DUK A;  1GMP A;  3DGY A;  5JPP A;  2UUG C;  1ZS7 A;  1BNR A;  2D1W A;  4J8T A;  4HJL B;  1IVV A;  1IDP A;  1W7C A;  4HM0 B;  1IVU A;  3NBJ A;  3MWZ A;  1EG9 B;  1N5H A;  3SX1 A;  3L0R A;  3WOD G;  2F99 A;  2V1L A;  4HKV B;  3X42 A;  1BVI A;  5IG4 A;  1QAK A;  1F8N A;  2OTJ 3;  3LTA A;  4LZI A;  1X1Y A;  1Q81 4;  1ZO2 A;  3ALA A;  3OWY A;  1RDS A;  2IY2 A;  3URP A;  3PGB A;  1AVL A;  4EV5 A;  3BU4 A;  4FR9 A;  2HMN B;  3N8B A;  1YIT 3;  3NM7 A;  1BNJ A;  3B7C A;  4HM2 B;  1M90 4;  1BNG A;  3X41 A;  1A2K A;  1JZO A;  3S67 A;  3DMC A;  3GWR A;  1NU3 A;  2HMO B;  2L4V A;  1LQG C;  4GB5 A;  4KFF A;  2YFL B;  2HML B;  2R41 A;  1N5P A;  4EV2 A;  3CCR 3;  3O8Y A;  2J8X B;  2BNG A;  5IEO A;  4EYC A;  4RNT A;  4K1U A;  3Q2P A;  4K1V A;  2RFR A;  4HM7 B;  2LYX A;  2OQE C;  3EJV A;  4R80 A;  5FW5 A;  2P09 A;  1VQP 3;  2F56 A;  1UW1 A;  3BIR A;  2C11 A;  2CK3 H;  3G16 A;  3CNM A;  2ML5 A; 
#chains in the Genus database with same CATH homology
 1Q42 A;  4IIA A;  1OGZ A;  1A67 A;  5AIG A;  5EVH A;  3RDE A;  2D42 A;  3WOF B;  3GRD A;  3EE1 A;  1K9M 4;  2CFG A;  4JRF A;  1SQW A;  3D9R A;  2CH9 A;  3ECF A;  3HZP A;  3LTD A;  3N9H A;  4XB5 A;  2BO9 B;  2XRX B;  1EQK A;  1IV9 A;  2I9W A;  3BNC A;  1TIJ A;  3CD6 3;  1VZZ A;  4BTW A;  1WNH A;  1RRH A;  3DXO A;  4HM4 B;  1UUV B;  4RBN A;  1K73 4;  1QMA A;  4XDV A;  1VQN 3;  2QA4 3;  2YFI B;  2FNQ A;  2WGO A;  7STD A;  5D81 A;  1LNH A;  3F8H A;  3K0Z A;  3PXM A;  4N6L A;  4TX4 A;  2JQ5 A;  3SXX A;  1DMM A;  2Z76 A;  3AMO A;  2GEY A;  2MC8 A;  5D83 A;  4HM5 B;  4HBR A;  2W04 A;  1KWI A;  1GD4 A;  1NWW A;  1OUN A;  4OVM A;  6STD A;  3EHC A;  3LZA A;  1YJN 3;  1TFK A;  1O7G B;  1KSI A;  3A76 A;  1SPU A;  2BHM A;  2Z77 A;  3S5C A;  1FGM A;  3S28 A;  2ZDJ A;  1Q40 A;  1IV7 A;  2GU1 A;  4PEJ A;  4ZM8 A;  2F86 B;  2IUK A;  5DRV A;  1JRQ A;  2FXT A;  4L7K A;  2ZL8 A;  2XR8 B;  4EBG A;  1V74 A;  4LMI A;  3JUN A;  2PZV A;  3U1W A;  3FG1 A;  4AKY A;  3G71 3;  1VQO 3;  1STD A;  3JUM A;  3SOY A;  1U5O A;  3X40 A;  3OWU A;  3G8Z A;  1JNQ A;  3OW2 2;  3GAX A;  3NXJ A;  2P05 A;  1LOX A;  3HI7 A;  3K63 A;  3CCS 3;  3F7S A;  1O7N B;  1OCV A;  2W56 B;  2QEX 3;  3F7X A;  1QJG A;  1Y4K A;  3BNE A;  3KII A;  4MEI A;  3CCE 3;  5AIF A;  4XBT A;  1IK3 A;  2XSO B;  1JKG B;  5D82 A;  3ER7 A;  3KN4 A;  1O7M B;  3EBT A;  2M7O A;  3CCJ 3;  1UUW B;  3BB9 A;  4R9K A;  3CCQ 3;  2Z7A A;  4LGQ A;  3KSP A;  4HM8 B;  3LML A;  2O3O A;  3SOA A;  1PU4 A;  1JN5 B;  5IER A;  3OX9 A;  1US1 A;  4XBY A;  1W00 A;  1N9E A;  3CPO A;  4N3V A;  3LH4 A;  4IPB A;  4KVH A;  1YIJ 3;  4G1M B;  1M1X B;  3HK4 A;  3DGO A;  3CC7 3;  5IF6 A;  4Q53 A;  3VF1 A;  5LC7 A;  5LC6 A;  1S72 3;  3LOY A;  2CWT A;  5IG3 A;  3EC9 A;  1IVW A;  3PS8 A;  1AVK A;  3LT9 A;  1ISK A;  2XSH B;  3KZT A;  3V99 A;  1K41 A;  5ELJ A;  1GS3 A;  3I56 3;  2W0Q A;  3SVA A;  4O2H A;  4XM4 A;  3D3L A;  1VQ5 3;  4FMB A;  3HX8 A;  2IMJ A;  1FUW A;  3B4P A;  2WOH A;  3RGA A;  2BMO B;  4I4K A;  3CCV 3;  1VQ8 3;  3TDG A;  5AEU B;  1IVX A;  4STD A;  3DGN A;  1JKG A;  3OV4 A;  1SJW A;  2KCD A;  4QWT A;  3EN8 A;  4L8P A;  2RSX A;  1A90 A;  2CFL A;  3HIG A;  1STF I;  3EF8 A;  3FH1 A;  5BVB A;  2Z6B A;  1OHS A;  1WMO A;  3BNB A;  3MKI A;  3V92 A;  1N9J A;  5AYR B;  1AV4 A;  3UL5 A;  2W2C A;  3NQY A;  4H3U A;  4CDL A;  1WMP A;  3CC2 3;  3STD A;  1FGT A;  1GY6 A;  2OOV A;  1W6G A;  2CFD A;  1OGX A;  1LVN A;  3B8L A;  3QK9 A;  4GL6 A;  4R1K A;  3K7C A;  1CQS A;  1VQK 3;  3NV0 B;  5AII A;  4CCV A;  3G0K A;  5AEW B;  2RGQ A;  3MG2 A;  2CKF B;  1OPY A;  4OK0 A;  1OF5 B;  3GZY B;  1YI2 3;  3EB8 A;  1WQL B;  2XGL A;  2K0M A;  4HM6 B;  3KFQ C;  3CCU 3;  5AYS C;  3OWS A;  4HYZ A;  1IT8 A;  1JB4 A;  2CC3 A;  1GYB A;  3DGM A;  2XFS A;  3GZB A;  3Q90 A;  1PFP A;  2CWV A;  2MF7 A;  3I0Y A;  3S29 A;  3CU3 A;  1YJ9 3;  3K5T A;  2INX A;  1TUH A;  3LXU X;  5BXQ A;  3PYJ A;  4WYK B;  1RJO A;  4BTY A;  1TFO A;  4LEH A;  2GBX B;  1VQ4 3;  3MPH A;  1CYV A;  3BLZ A;  4MMZ B;  4N6V 0;  2XFT A;  1EA2 A;  2HMK B;  3NBR A;  5ELU A;  1VQ7 3;  3IJE B;  3EQQ B;  3NBB A;  4FCM A;  3EX9 A;  1E97 A;  1QVF 2;  4FMA A;  1L5G B;  1OHP A;  2RCD A;  3FG4 A;  1HU9 A;  2B24 B;  3S27 A;  3LTC A;  4N6N B;  4ORL A;  3UB1 A;  4KFE A;  4RNY A;  1ROA A;  3DZL A;  2QGU A;  1ULI B;  3JUP A;  1VQL 3;  5A0O B;  1N8R 4;  4N6U A;  2OCT A;  1QAL A;  1DVC A;  2BMQ B;  5JPU A;  3H51 A;  3ROB A;  3B4O A;  1QVG 2;  2IUJ A;  2GEX A;  1OAC A;  3EN1 B;  1HKX A;  1K8A 4;  2W9P A;  2W6J H;  3CCL 3;  4R4K A;  3M8C A;  4O02 B;  2CG1 A;  5KP1 A;  1E3V A;  2OOV C;  4RZM A;  3WMD A;  3VSY A;  1IQY A;  1KD1 4;  2LQV A;  1RN7 A;  1OF5 A;  5I97 A;  3KSE D;  1QAF A;  2XF3 A;  5IG5 A;  1NB5 I;  1FGO A;  3IMA B;  4X2O A;  1C7H A;  2E2U A;  3JUQ A;  4XDW A;  1OHO A;  2IA7 A;  1SIH A;  1JB5 A;  4R9L A;  1TP6 A;  2WOF A;  4WHA A;  1WMN A;  3GZX B;  2O9U X;  1IQX A;  1R4C A;  4OUQ A;  1G96 A;  2STD A;  4FCZ A;  1YJW 3;  1S5A A;  1CEW I;  2SBL A;  3EBY A;  3FGY A;  3JUO A;  1NO3 A;  2OTL 3;  1N8Q A;  1JV2 B;  3X3X A;  3X3Z A;  5CK6 A;  1T5Y A;  4KZ1 A;  1CYU A;  1W2Z A;  5DRE A;  3FG3 A;  3F40 A;  1W6Y A;  3HII A;  5KP4 A;  2BMR B;  3PCS A;  1GY7 A;  5CF2 A;  1ZX2 A;  1D6U A;  3K9M C;  2P38 A;  3CC4 3;  1W4N A;  3LYG A;  4FMC A;  3LTB A;  1ASK A;  2CW9 A;  2W56 A;  4MMY B;  3Q1C A;  3MHE A;  1OH0 A;  2BT3 A;  1W6C A;  1KC8 4;  2WO0 A;  1O7H B;  4O8S A;  3UJM A;  3AMO B;  2KRT A;  4FCJ A;  3WDG B;  5EEO A;  1RRL A;  2XEP A;  4WWU C;  4XBX A;  2OWP A;  1U8C B;  3PZW A;  5IG0 A;  1NJI 4;  3J7Y d;  3NX0 A;  4HM1 B;  3T8N A;  3NHX A;  3QRD A;  2PNC A;  4H61 A;  2YX9 A;  3CPW 2;  5CLK A;  4HZ9 B;  4J9A A;  2Q07 A;  1GY5 A;  2K54 A;  5KP3 A;  3DGL A;  3MG3 A;  1Z1S A;  1W5Z A;  3WA3 A;  1Q40 B;  4AEQ A;  3MYT A;  5TGN A;  2B1X B;  5AI1 A;  4EC6 A;  1MNL A;  5IEP A;  3I55 3;  3G6E 3;  1Q82 4;  3X3Y A;  2F98 A;  3PCR A;  2Y74 A;  1JN5 A;  1EKM A;  2CHC A;  2CWU A;  3CME 3;  5STD A;  1A2V A;  4N6O B;  4MMX B;  1O7P B;  3NQZ A;  1M1K 4;  2CG0 A;  1ULJ B;  1W02 A;  5CXO A;  4EXR A;  1D6Y A;  3FKA A;  2KXG A;  3U97 A;  3KKG A;  2XGN A;  1SII A;  3DY5 A;  4HVN A;  1VQ9 3;  1IT7 A;  3FCS B;  2GXF A;  2UX0 A;  2W03 A;  3MSO A;  4NHF A;  4N6T A;  5JBS A;  3G4S 3;  2FGT A;  1DMQ A;  1FGQ A;  3T0U A;  5IEN A;  4X2H A;  3CMA 3;  4LSO A;  2GU3 A;  1YVB I;  1UI8 A;  3CXC 2;  5AIH A;  2R4I A;  1NB3 I;  3SED A;  4KFD A;  1RKY A;  3NM2 A;  3FF0 A;  1DMN A;  3MG1 A;  4BTX A;  1NDO B;  1YHQ 3;  4U13 A;  4NRE A;  1TU5 A;  3SLU A;  1Q7Y 4;  1VQ6 3;  2GBW B;  2JDI H;  4O3V A;  3FSD A;  3GZR A;  2A15 A;  2P0M A;  3FZW A;  1DYU A;  3CCM 3;  1D6Z A;  4K90 B;  1WTH A;  3WOE B;  3WA2 X;  3KE7 A;  4IT7 A;  3H3H A;  5CF1 A;  1J2B A;  3FF2 A;  4JF8 A;  1O7W B;  1E3R A;  3F14 A;  5EQL A;  3OXA A;  3UL6 A;  2CIU A;  4L8O A;  1ROV A;  2CFW A;  1FA3 A;  4WFO A;  3BND A;  5HGR A;  2WGQ A;  1W2B 2;  5IW9 A;  2E2T A;  3DM8 A;  3T8U A;  1GD3 A;  4RNZ A;  1UI7 A;  2HMJ B;  2YFJ B;  4K61 A;  1AR0 A;  1JJ2 2;  5FGO A;  3F9S A;  1IU7 A;  2Y73 A;  2HMM B;  3UNL A;  3F8X A;  2P0X A;  3CNX A;  3NV0 A;  1LXE A;  2OQE A;  4MJD A;  1Q86 4;  2XH9 A;  5G2G A;  2ML6 A;  3JVC A;  3NUV A;  1DVD A;  2CFK A;  3IPT A;  4HM3 B;  4HZB B;  4N6M A;  1IQ8 A;  1JB2 A;  8CHO A;  2E2V A;  1FGR A;  3V98 A;  1MOL A;  3VGN A;  1VQM 3;  1KQS 2;  4WP5 A;  4FMD A;  3FLJ A;  1YGE A;  1M9G A;  4WYK A;  1BUQ A;  1W01 A;  3N54 B;  4AKZ A;  3E99 A;  3LT8 A;  2QIY A;  2W9Q A;  2C10 A;  3RGR A;  1K28 A;  3DUK A;  5JPP A;  2D1W A;  4J8T A;  4HJL B;  1IVV A;  1IDP A;  1W7C A;  4HM0 B;  1IVU A;  3NBJ A;  3MWZ A;  1EG9 B;  1N5H A;  3SX1 A;  3L0R A;  3WOD G;  2F99 A;  2V1L A;  4HKV B;  3X42 A;  5IG4 A;  1QAK A;  1F8N A;  2OTJ 3;  3LTA A;  4LZI A;  1Q81 4;  1ZO2 A;  3ALA A;  3OWY A;  3PGB A;  1AVL A;  4EV5 A;  1YIT 3;  4FR9 A;  2HMN B;  3N8B A;  3NM7 A;  3B7C A;  1M90 4;  4HM2 B;  3X41 A;  1A2K A;  3S67 A;  3DMC A;  3GWR A;  1NU3 A;  2HMO B;  2L4V A;  4GB5 A;  4KFF A;  2YFL B;  2HML B;  4EV2 A;  1N5P A;  3CCR 3;  3O8Y A;  2BNG A;  5IEO A;  4EYC A;  4K1U A;  3Q2P A;  4K1V A;  2RFR A;  4HM7 B;  2LYX A;  2OQE C;  3EJV A;  4R80 A;  5FW5 A;  2P09 A;  1VQP 3;  1UW1 A;  2C11 A;  2CK3 H;  3G16 A;  3CNM A;  2ML5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...