1NXMA

The high resolution structures of rmlc from streptococcus suis
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
194
structure length
194
Chain Sequence
NFFGKTLAARPVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGTWVDLREGETFGNTYQTVIDASKSIFVPRGVANGFQVLSDFVAYSYLVNDYWALELKPKYAFVNYADPSLDIKWENLEEAEVSEADENHPFLKDVKPLRKEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
publication title High-Resolution Structures of RmlC from Streptococcus suis in Complex with Substrate Analogs Locate the Active Site of This Class of Enzyme
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Isomerase
total genus 54
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nxmA00
3SCFA 3RNSA 4IEUA 4L2NA 3G7DA 1PM7A 2H0VA 3TNPB 3MZHA 2XLGA 4JTNA 3UKNA 5I0SA 2GAUA 4XF4A 2B9UA 2PAEA 4MUVA 5I93A 2UYAA 4LULA 2Z2SB 1CGPA 2N7GA 2VPVA 4UXAA 1XRUA 4JVAA 1NYWA 1QXJA 3MYXA 3LZZA 3FWEA 3LOIA 3USSA 2XKOA 2XL7A 2XKPA 5BUVA 1LB2A 3SCHA 4YSFA 1VP6A 2ETEA 5JAXA 1FI2A 2H6BA 1J3RA 4O9EA 3S0MA 4X6RB 4AVBA 5BY5A 2QNKA 1ZRCA 2IXJA 1Y9QA 4WVZA 1OD5A 4META 5FCCA 2XL9A 4I3PA 3ROUA 3RZZA 4OLLA 2EVXA 2GC3A 4HLTA 1X82A 3IDBB 4NVPA 2F4PA 2PYTA 3TNQA 1O5UA 4PIZA 3EHKA 4HVRA 5I8SA 1OI6A 5LRRA 2GC2A 2OYZA 4QM9A 3EBRA 4FBFA 1CAXB 4UBGA 3LA7A 1V70A 1YLLA 5I0UA 4HBNA 2BNMA 2OZJA 2E9QA 3NJZA 3IIAA 4Z82A 3D0SA 1CAXA 3WW4A 3QACA 1EP0A 3M3IA 5F1RA 3NSTA 3NL1A 1Q3EA 2GC0A 2Q1ZB 5T3NA 2HKXA 4HVQA 1RGSA 3ACLA 5HI0A 3DN7A 4J1WA 3CO2A 1J1LA 4QXKA 2ZKLA 1ZRDA 3PVBB 4LEJA 4MH0E 5FQ0B 5FLIA 4FAGA 1TQ5A 5I91A 3FE5A 1RUNA 1GQHA 1UW8A 5FQ0A 2HJIA 3OD0A 3S7EA 1QY4A 3CJXA 3OTFA 3L2HA 3UKVA 3WW2A 1WLTA 3PLQA 2ET1A 3S7IA 5E16A 1Q43A 2KXLA 1YUDA 5D1IA 1EY2A 3U10A 4XFHA 2ATFA 2QDRA 4HMZA 3DL3A 5J7MA 4QGLA 3SCGA 4AQ6A 4Q0QA 4Q29A 1H1MA 2D40A 2MHFA 3E5UA 4TLFA 4IEVA 4QX5A 5LEJA 3BALA 5CU1A 1OFNA 1QWRA 4E2GA 2MNGA 1H1IA 2QCSB 2K9ZA 3HIFA 4I02A 1CAUB 1WGPA 4ZU4A 3FZ3A 4HN1A 4AQ2A 5JSOA 2CV6A 3O14A 4Q0UA 3H3ZA 1CAUA 4ZU7A 1FXZA 2ET7A 4I2OA 4MGZE 5JCTA 1J3PA 3OF1A 1EPZA 4MX3A 2Y0OA 4YRDA 3BCWA 4F8AA 3FX3A 5C6CA 2VQAA 4BH9A 5I0TA 4I0BA 4LTAA 4XF3A 3ETQA 1FT9A 1UCXA 4QMAA 3E5XA 1YFYA 3H7JA 3KCCA 1J58A 3FFQA 2DCTA 3CF6E 1RTVA 2PHDA 1OMIA 1ZVFA 3KGLA 1YFXA 1LRHA 3NVCA 5BV6A 5KHIA 4HVOA 4EWDA 4XFAA 1ZRFA 1NXMA 5KHGA 2WFPA 4YYOA 1RL3A 1SFNA 3KSCA 2Z69A 2P17A 2VECA 1ZREA 3E5QA 4MZUA 1UIKA 3I7DA 1EYBA 4L11A 3PNAA 3EO6A 2OA2A 1X7NA 3FHIB 4IEXA 3SHRA 2XHKA 3E97A 4IEQA 4KWKA 1Q5OA 5I8YA 5CVRA 4XFGA 1CAWB 3KGZA 1DZRA 4IETA 4MV2A 5JSPA 3CLPA 4MGKE 5K8SA 1CAWA 5FDBA 3CEWA 4XETA 3E6DA 4X6QB 4EWAA 1ZX5A 2C0ZA 2IXHA 1CX4A 3HT2A 4KL1A 4KWLA 5E1RA 3WW3A 4D7SA 4HSLA 4IERA 4EROA 3N4MA 5JSRA 2GC1A 2UY9A 1IPKA 2I45A 1UIJA 2O8QA 5JR7B 2B8MA 5J48A 4MGIE 5BXXA 4I0AA 2QVSB 3H1MA 4KU8A 4LA3A 2D5HA 1ZZ9A 5FPZA 1HW5A 3U0ZA 5KHHA 1ZZCA 3LA2A 4XFFA 4KWJA 3I54A 2PTMA 2BNNA 3NKTA 1O4TA 2FMYA 4UBHA 3RYRA 3BU7A 3IDCB 2EAAA 1UD1A 3FJSA 4N9IA 4FAHA 2CAUA 3LAGA 3WW1A 4Q0VA 1GQGA 4LA2A 3ZDSA 4IEZA 4AXOA 2PAMA 2IXIA 4ONUA 3M70A 1O7FA 4WBBA 2K0GA 3MPBA 3EQEA 4XFIA 5CADA 2OZ6A 4XFBA 4AVCA 3DV8A 3C3VA 4EWEA 2PQQA 4YNIA 3SXWA 1WA4A 2EA7A 4IEWA 4J1XA 5FPXA 1SEFA 2GU9A 3E6BA 1NE4A 4QM8A 4QGNA 4LLOA 1YFWA 4XEZA 3R6SA 4I01A 4R8HA 1O3SA 2IC1A 3UKTA 2B5HA 5I8TA 4IEOA 5KHKA 3RDIA 1RC6A 4YARA 3RPQA 5KBFA 4DINB 2GH2A 1ZRRA 4Z07A 2D93A 4Q0PA 4GULA 3I59B 4PIYA 3ES4A 4BYYA 4KU7A 5I0RA 3SMHA 3MDPA 2PAKA 5J3UA 3I59A 5AVPA 5EZWA 3IBMA 4A2UA 5FLHA 4BHPA 2BEOA 3ST7A 1J3QA 4PJYA 4XF0A 2CAVA 3DKWA 4IEPA 5C8WA 4H7LA 1I6XA 2BNOA 1DZTA 3H50A 3VHRA 1Y3TA 1JUHA 4K8FA 3BB6A 4ORFA 1DGWA 2IXCA 1XE8A 3H1YA 1X8MA 3GYDA 3H3UA 4F7ZA 3D0JA 5LRSA 3NW4A 1UPIA 1U12A 1SQ4A 1YFUA 5FLJA 2UY8A 2BYVE 4XF9A 4JTOA 2WC2A 4R52A 4WZCA 3ES1A 2O1QA 2GZWA 4N9HA 3CL1A 3U11A 4PIXA 1DGRA 1ZNPA 4CYDA 4LUKA 1O3TA 2H6CA 3RYPA 2Q0AA 2V09A 4I09A 1ZZ6A 1O5LA 1VR3A 4Q0SA 4XF1A 3D82A 2BGCA 3QOPA 3JZVA 4BIFA 1L3JA 3H8UA 2FQPA 3H7YA 1CAVB 2PFWA 1XE7A 1I5ZA 2PHLA 1NZCA 1PMIA 3H1WA 1VJ2A 5BPXA 3EJKA 5LEKA 5EFUA 4HZFA 1CAVA 4IESA 4E2SA 4O9GA 5KHJA 1G6NA 2XLAA 4FT8A 3GBFA 2MPFA 1X8EA 1LR5A 1ZZ7A 1O3RA 2OPKA 4RD7A 3KMHA 4E2QA 1YHFA 4ZU5A 1QXRA 2D5FA 3BPZA 4QGMA 3LA3A 2Q4SA 2CGPA 4HSJA 1ZZ8A 3HQXA 2ZCWA 1LKNA 2IXLA 3E6CC 1J59A 4XFCA 2QJVA 1IPJA 1NE6A 3OCPA 4AVAA 4B29A 2PA7A 4D7TA 3OGJA 2XLFA 4EV0A 1O3QA 4LUMA 3ELNA 4OFGA 4IEYA 2Q30A 4JV4A 2UYBA 2IXKA 3HT1A 3IWZA 3H9AA 4MGYE 1RUOA 1ZZBA 1YWKA 3RYKA 3LWCA 4HN0A 2XGXA 4P9GA 3B02A
chains in the Genus database with same CATH superfamily
1VPHA 3MW3A 4XZPA 3K3NA 5T5LA 3RNSA 5KXDA 3TN92 2W0XA 5G04L 3V0AB 1LOFA 1UN1A 2JEMA 3J8F3 4LIUA 3UKNA 2SLIA 3NAPB 2GAUA 4CDWC 3HPNA 1OXCA 5FYHA 3FN9A 2UYAA 4AHXA 4CEYC 4LULA 4UAPA 3PDQA 2WLPA 4ES9A 3O1OA 1CGPA 3UL2A 4LR4A 2N7GA 1RUE2 5IAVA 4B4QA 3ZSLA 2D3RA 2OUJA 3OGSA 4UXAA 1BBT2 2ZGLA 3J7MA 3DYMA 3NNGA 1GOHA 3ZXGA 3LZZA 1F8VA 3RWKX 4UFMA 5HCFA 4UFIA 3WX5A 3HD8B 3BTAA 1MVEA 4LBQD 4P9XA 5FYCA 4AQSA 1LB2A 2QE3A 4BA6A 4B3NA 2XQRA 5LWBA 2ETEA 2D44A 1HJFA 1RINA 1QDOA 1FI2A 5FZEA 1WLDA 1HQWA 2VBDA 5FPBA 2E51A 1VE0A 1DYKA 2VNOA 4K40A 3S0MA 3OGVA 3PU3A 1HN1A 1ULPA 1QF3A 3LB9A 3OUHA 4YM1A 3MIHA 3TOJA 2VOTA 1ZRCA 3ZFFC 3Q8BA 2HWF3 1WMXA 1N1TA 5CZKA 2JIJA 4JRLA 4I3PA 4JHTA 1UY1A 1LESA 3HBKA 2WZR2 1N1VA 1ZYBA 5A33B 5LCWL 2EVXA 4BK4A 5ANNA 3A0NA 1RUJ2 2QQJA 5FZ0A 1XSRA 4C0HA 1LOCA 1G9CA 2OS2A 1EV13 2F4PA 4N43B 2GMEA 2YZ4A 3AKTA 4AFMA 3OBZA 3LEMA 5I8SA 1ZBE2 1KRIA 4DNYA 4FTBA 2VMHA 1OT5A 3Q8AA 5K0UA 4XQWA 1IS6A 3EBRA 1MQTA 1CAXB 1DGRN 2WUHA 3M8LA 4NHYA 4NMIA 3LEKA 4Q26A 4UBGA 4A44A 2J22A 5FRAA 4EE2A 5I0UA 2QQPA 1HRV2 1UF2C 2OVUA 2BNMA 1D2SA 1IS4A 2J1EA 2OZJA 3IIAA 3M1HA 4WVVA 4Y5Z0 3AFKA 3CJIA 3DYPA 4DXRA 1B35B 1EP0A 1UYYA 3QACA 5FY0A 3WQ7A 1FNYA 2ZJCA 4L9BA 3V65A 3NL1A 2W1SA 4GH4A 4IV1A 4HVQA 1MZ5A 4TSVA 2JDPA 4FFIA 2QQNA 3ZFGB 4EZ4A 5ACA3 4DRRA 1OSGA 1W99A 5AVAA 2FDKA 4ASMB 3WF0A 2RMU3 5DG2A 3ZYHA 2R061 4FPGA 3WG3A 4DXSA 1CX1A 2ZKLA 4C91A 4FOYA 1U5XA 1IOAA 5FLIA 4DY3A 4XUPA 4Q4X3 5BNNB 1QNWA 2XBO2 3NV1A 1RUNA 1GQHA 1KITA 2WN2A 5DPNA 5FQ0A 5FZ6A 2HJIA 4PDWC 1GSLA 2YYOA 5JWPA 1QY4A 1ZBA1 2HWE2 1F31A 4O7XA 4WVMB 1CR7A 4CCEA 3DGTA 1LHOA 4AEMA 1AYM3 1TME1 2P4EA 1ENSA 1W6QA 1QIQA 3KT1A 1GMMA 1C8NA 2XG3A 4XUQA 2BPA2 1BBT3 3WT3A 1LNSA 4LHLA 1NLRA 4CCOA 5JZGA 1Z78A 2ET1A 3S7IA 4URTA 1BK1A 1YUDA 4M3CA 1EY2A 4MHUA 1VBE2 5FY5A 4AQTA 3GJBA 1ASJ3 4IE4A 3OPTA 1VRH3 4DEVA 2RG4A 4D6RA 4DFSA 1J83A 1J1TA 4W6WA 5BNOC 4UW6A 4Q29A 5A80A 1H1MA 4YM2A 5C8CA 3U78A 3ZMNA 1PM4A 3AL6A 5B4NA 4IEVA 4QX5A 2WINB 4Y1UA 4IE6A 2I2SA 1OFNA 3AVSA 1S2BA 3S5QA 4UW4A 3HN3A 3AP4A 1PIV2 2LW8A 2WBKA 4QB6A 3T0DA 4QQPA 1US2A 3POYA 3B94A 4HN1A 4LHKA 5JI9A 5JSOA 5FYTA 5ABJB 3C7FA 3A22A 2PELA 1AXYA 1KDKA 4XMIA 2TNFA 5FO9B 1W6PA 1C8M1 4Y4RA 2ET7A 5FV3A 1A8MA 3AKPA 4CU8A 3AYEA 2WKKA 2B42B 1J3PA 3LFIA 4LLFA 1EPZA 3MLJA 3WNOA 4MX3A 4AHYA 5FO8B 2Y0OA 5GLUA 2ZX0A 3OEBA 5FYZA 3BKZA 1NLSA 1DLLA 1W8NA 1RUI1 3CBNA 3VGIA 2ZGTA 5AFBA 4Z2WA 2PQSA 5FMCA 5LBCA 4P9IA 5L19A 3FX3A 3O0XA 2ENRA 2ZGRA 3APBA 2WNUC 2UURA 4CEWA 2Q5TA 1NZIA 1G9BA 2W94A 4BH9A 1JZ8A 2A3YA 4I0BA 2HWC3 1AL0G 1RMU1 2WS91 4XF3A 5D8AB 5CA6A 4I30A 4PLMA 2AENA 3ETQA 4AEKA 5B2GB 3IAPA 4ARXA 1FT9A 1IS5A 1VRBA 1GZCA 3E5XA 1RJ8A 1YFYA 1Z7S2 4E8CA 1KS5A 2DCTA 2IFRA 3FFQA 4YW5A 4Q4Y3 1VBD2 4XJAA 3N9PA 2QQWA 5DZEA 4CDQA 1W03A 2VXRA 3JD72 1TNRA 2O0OA 4QPIB 3RJRA 2VGDA 5CFDC 4A3XA 2GH8A 1A78A 4LJHA 4HVOA 1APNA 1PVC2 4Q4W3 5HXVA 1NXMA 1K5MC 3GJAA 2WFPA 4YYOA 2AGSA 3SQOA 1Y43B 2QQUA 3A7QA 3HNMA 3V56A 4BLIA 4ET7A 3TN91 1SFNA 3ZN5A 1GLHA 4CXYA 3SITA 2YPDA 3DPRC 2VECA 4EN6B 1RXFA 1UZYA 1NCRA 2PLV3 3NJXA 3TEXA 1VBE3 4XPVA 1OUSA 3KQRA 4M3CE 5EQUA 1FMD3 3EO6A 3PNAA 4JGYC 4U36A 2F4LA 4JX0A 1W6MB 1X7NA 1YO8A 5FMOS 2NYYA 5FP7A 1RUE1 2B39A 1WCUA 2DDUA 3MI8A 3H8OA 4IEXA 1UY2A 5EP9A 2VUDA 4KWKA 1JU4A 3B93A 2WZEA 5L7OB 2D3SA 3HN1A 1UYPA 2DU1A 4GJYA 5F2SA 3FBYA 4LNVA 2WZPP 1DZRA 4IQPA 1WLWA 2IVIB 1HIXA 4JZRA 5A6YA 5C3RA 2FDIA 2E53A 1O91A 5LBBA 3VBUC 5JPNB 1CAWA 2R32A 3Q9OA 2JD9A 1R1A2 3EMRA 5F3EA 4AAXA 1KJLA 2CNAA 2ZGPA 2Y6GA 3NMBA 4LK6A 1EAH1 5FZDA 3ATGA 3HT2A 3WNMA 4MHRA 5A3LA 4IERA 4G9SB 1W9TA 4OHWA 5A7QA 4TN7A 4AI1A 4WM7C 1MZFA 1HN0A 4A42A 2HYXA 1IPKA 1ODMA 2I45A 3VHOA 1AR63 5HXMA 1H8TC 1XBFA 2GNDA 2DU0A 2WJSA 1L7LA 4M3CB 2W92A 4ZONA 2WZR1 1H2NA 2DTWA 2A70A 3E1F1 3RJ2X 1RUJ1 1PGW2 1OOPB 2Y64A 4I0AA 1YXWA 4LKSA 1NA1B 3T4VA 4IE7A 2ZHLA 4DO0A 1ZBE1 3WP5A 4KU8A 4LA3A 2BWAA 2YBSA 5F32A 4D0QA 4YVWC 1WBLA 2WNVB 4D7YA 5LZ6A 2J1TA 1W8WA 1ZZCA 3LA2A 3FUQA 4DIQA 5C8CB 3I54A 1AJKA 2A6WA 2PTMA 2R30A 5EV7A 1HRV1 3AL5A 2FBEA 3NKTA 2FMYA 1GKBA 1W8FA 2R043 3RYRA 3BTXA 1TMF2 4GMP3 3BU7A 1QKQA 1UD1A 1XPWA 1TNFA 4FAHA 4G4FA 1GNYA 3WW1A 4Q0VA 1PK6C 2UWAA 3KT4A 5A1FA 1YIFA 1MR5A 4LA2A 1JN2P 1CJPA 1PVC3 3D8CA 3N9QA 3OSDA 5FMBA 4AXOA 3VBFC 1PO13 2JG9B 3NJYA 2W46A 2C24A 1UXZA 1VBA3 2V72A 5A1LA 3MPBA 2RHPA 4AEDC 1W6NA 2VNGA 1IG0A 4CDXC 2OZ6A 3OBAA 3C3VA 1UY0A 3TEZA 2XBO1 1PGSA 3W21A 2AH2A 3SH3A 3MIDA 4QB1A 3WLUA 3AP9A 3LCPA 5FP4A 4CRQA 2HWE1 3I4IA 2Y8KA 1S0BA 1SEFA 2NMNA 5A7PA 3WVJA 5HBAA 2Y6KA 4QGNA 1S0GA 3PIJA 2FCUA 4LLOA 4RN5A 1W6OB 4XEZA 5H9PA 2P34A 4H3WA 2IC1A 1E5RA 2UWCA 3ON7A 1GZ9A 4QPYA 1QDCA 2VQUA 2W47A 3POIA 2DVGA 3ZVXA 3KF5A 4JDNA 3PVEA 3RDIA 3WHTA 2RS33 2J1SA 5FKBA 3T0AA 4YARA 1YQ6A 4AI0A 5CAZA 2CU5A 2W3JA 3AP5A 5FUIA 2GH2A 4UF0B 2WO2A 4Q0PA 4KBZA 4P9WA 4WM8B 3KCYA 4GULA 1S2EA 2AEYA 4FOVA 4N53C 4KU7A 2BW8A 3ZIWA 4BMEA 3I2IA 4A3ZA 4DUWA 4CCCA 5J3UA 5IVFA 3WNPA 4MXWB 2TEPA 5EIYB 1H30A 1WD4A 3T08A 1LHNA 1PIV1 4A2UA 4BHPA 4LO5B 4I0WB 4M0HA 4AR2A 3UESA 4MGSA 1T2XA 5CFCA 2JICA 5GZGA 3VBHB 3DKWA 2WZ8A 1AYN2 4GQ7A 3WQ1A 5CG8A 3HWJA 4FPFA 1IPSA 2BNOA 5T5JA 1OPOA 2XUMA 4AFAA 4RGGA 2P6HA 4IGPA 5T54A 1QNYA 3MLKA 1T6BX 3VHRA 4D6SA 1Y3TA 3S6PA 2RR12 2R073 4ORFA 1F2NA 1IQAA 1FV2A 1QJX1 1SHWB 4GB32 2Y6LA 4YZ4A 1DGWA 1YI9A 2CWSA 2IXCA 4QDRA 4V2WA 3VBOA 3ILNA 3HMYA 4JKLA 2HH9A 4SLIA 4FOQA 4RQPC 3LE0A 4HOOA 3MLLA 3H3LA 5LRSA 1SLCA 1DZQA 1SBFA 4CSWA 3WG2A 2G19A 1GUIA 1SFPA 1GYKA 3DXUA 2UY8A 4NWWA 4CDWB 2JB8A 2GSYA 2QBXA 1Z7S1 4CEYB 1Y9MA 4JTOA 3SH5A 1VBD1 3VKLA 2ZAHA 3ES1A 4ZXEA 1LECA 3JD71 2O1QA 2GZWA 4Q8KA 3CL1A 2Y60A 1RUH2 1WKYA 4LHSA 4X8PA 1ND2C 3NJVA 3MIEA 2CWMA 1BEV1 3U11A 2BJSA 5IW0A 2YHJA 4PIXA 3ZFEA 1DGRA 1LOFC 4LUKA 4FSJA 1A34A 2H6CA 3BOWA 3L9JT 3LSDA 1TE1B 4QB2A 3TEWA 1VR3A 4HKOA 4Q0SA 4XF1A 1XNAA 3D82A 2JE7A 3QOPA 4QDSA 5IVYA 5F39A 1UOBA 4K8RB 1OA2A 4IV3C 4BIFA 3TBDA 3H8UA 1CAVB 1XE7A 4HG6B 5BPXA 1ZM1A 4Q27A 2CTVA 5G05L 3TYJA 1XQNA 3LFMA 3DUIA 4IESA 3C2UA 3ZFFB 5FZAA 4OHXA 5DZGA 4Y4YA 2BBVA 2Q8OA 1G6NA 4LO4B 1UKGA 3U75A 4ZZ8A 5IAXA 4OUMA 3FC0A 1X8EA 3RSJA 3LGRA 4JHZA 4KG0A 2OPKA 5JOZA 1YHFA 2R16A 2D5FA 2J1UA 1XXNA 4XMAA 1LU1A 5IT6A 5C3SA 4BJ0A 1K42A 3RFRA 3OEAA 1XYOA 3POWA 3ZX7A 4BM8A 1DQ6A 4D3WA 4E4HA 3WNXA 1IPJA 4JCKA 2L9LA 3OCPA 2GMPA 1R1A1 5JMCA 4RS5B 4NIHA 3NQHA 1UNBA 2NM1A 2RDNA 3GM8A 1RUG2 2W91A 2PHFA 3PJYA 2ZOEB 5C3PA 4YGDA 3VBSC 2RM22 1JYWA 2P1BA 5C70A 3VL8A 2X8KA 5F6LB 1JMUB 1PZ7A 3HBZA 3H8XA 1RXGA 3GHNA 1ZZBA 3I3QA 3O0VA 3MIGA 4HN0A 1H4GA 4GB33 2H0VA 1NCQC 3WDXA 3K51A 4AHZA 3NNFA 3OPWA 4LXLA 3U4XA 1PMJX 2XOMA 3KHBA 3G7DA 3WINE 4PBOA 5A6QA 1NKGA 1WCKA 1BK0A 4Q4V2 3V0AA 4XF4A 4NHLA 3O1SA 3M7AA 4BU2A 5C9AC 2FDJA 2YB7A 2DTYA 1O8PA 1STMA 4A7KA 4MUVA 1VBC2 3NAPA 4COUA 1FPN2 1PO21 2Z2SB 4GWIA 1GP6A 3B9CA 4OMDA 4FPOB 2VPVA 4PDWB 1LAJA 2RDRA 4K9SA 4GH4C 3JB4C 3GZAA 1R082 1TMF1 1ENRA 3JB8A 1ULEA 2PMWB 1GWLA 1QXJA 4JVAA 4K21A 3DF0A 2JG8B 3RG0A 2VZVA 1CESA 1MS3A 3LOIA 1O4ZA 2WNOA 4RSUA 4LHNA 1W8UA 3T2PA 2IWGB 4OQ9A 5DXDA 4EQVA 3VKOA 2R062 1VP6A 4E27A 5JMOA 1NQJA 3ORJA 5CB7A 4U2AA 5JI7A 1DF0A 3O1UA 2QKDA 1YQ2A 2MEV2 4O9EA 5BNOB 2BQPA 3H0OA 4X6RB 4K1YA 3U1XA 5T55A 4AVBA 1QJEA 2CSGA 3TWIA 2BZDA 3WY6A 5BY5A 2DWRA 3ZXDA 3QLQA 5FZIA 4EYUA 4W6XA 1ZBA2 3PUAA 5FZGA 3SLIA 1OD5A 1R092 2ZMLA 2XL9A 3T30A 1TME2 4Y20B 5JDBA 3J7LA 4AFCA 3V0BB 3I2GA 2GC3A 2XJVA 4BXFA 3IDBB 4NVPA 2PYTA 1O5UA 4QXCA 3EHKA 1POV1 3U14A 2A7AA 2GDFA 3ME2A 4V1PA 5CIRA 1OI6A 2D7FA 5GKAC 5A33A 5LRRA 5JXJA 4CCJA 4QM9A 4N43A 4AVTA 4FBFA 2H0BA 3LDRA 3MFAA 4BQ4A 3R4SA 4M00A 3M4FA 1ST8A 1U0AA 2WFF2 4NJ4A 1QMJA 5JUVA 1CAXA 1UY3A 1EUTA 3DYOA 3R0RA 4QQHA 4PT6A 3VL9A 4MGQA 2ZEZA 3OD4A 5FYMA 2CDPA 1Q3EA 2GC0A 2KM2A 4W4ZA 2JE8A 1B35A 4YGEA 2WNUB 2VZQA 4HK8A 2ORXA 1BXHA 2R1DA 5FREA 3ACLA 1F4HA 1JU3A 3T4HB 4YFZA 3ACIA 5T5PA 4A45A 1U5ZA 4J1WA 2DUOA 3J9SA 3ZFGA 3EXUA 5DAWA 3CO2A 2EXJA 1FNZA 3AZYA 5CBLA 1C8M2 1AYN1 3THPA 5IK5A 2YPJA 3FE5A 4RR3B 3R4DB 1VMHA 3JXSA 5DAVA 4CP2A 3PL0A 3PUQA 3OD0A 1HRI1 3S7EA 1GV9A 5CFDB 5BNNA 2RR11 2VUCA 3UKVA 4CEWC 4NWVA 3WNKA 4XDOA 3UETA 1RUI2 2AC1A 2YC4A 4E4SA 4YZ1A 1WLTA 3I2KA 3FLRA 3ZYFA 2FCVA 3PMSA 5E16A 3ZXEA 1Q43A 2VL4A 2EIBA 1SPPB 5DUWA 5FZHA 2WS92 2DCKA 1SLTA 3DPRB 4QKDA 2ATFA 2UWBA 4CDQC 3FFZA 2NP0A 4HMZA 3DL3A 1QEXA 3C7GA 4QGLA 2R063 4COYA 2A6XA 1WCQA 3SCGA 4AOCA 1KFUL 1WCDJ 4Q0QA 1HXS3 4FI9A 2VULA 1OBNA 4XDQA 3VD3A 4C1WA 1V9U1 1VALA 2BDRA 3X29B 3Q8FA 2MHFA 2NQYA 4TLFA 1VAKA 4MOAA 1NLQA 1QJY2 1RUH1 4XJZA 5DUVA 1ZBA3 4QX0A 1H1IA 2P37A 2QCSB 4IGQA 4OHYA 4I02A 1CAUB 3WUCA 3FZ3A 4M4RA 5K7PA 1KXGA 4FPCA 1WBFA 1ALYA 2GMMA 4Q0UA 1RITA 1UYXA 3H3ZA 1RJ7A 3FUOA 2B9VA 4I2OA 5ABJA 3ZYRA 5A7WB 2UU8A 2V4VA 3UNPA 3JBG2 4AAPA 2QFEA 1CN1A 4WM7B 4YRDA 3IM0A 2ES3A 4G3YC 2VMCA 2Z5WA 1GZWB 1WW5A 1H8TB 2D6NA 4BQWA 3M3OA 3PVOA 5A6ZA 4M4PA 5FY8A 3HEIA 2QUOA 1GOFA 2VQAA 1W9YA 5I0TA 3ASIA 4INDA 1KJRA 2Y6HA 4LTAA 1DDLA 4GMP0 1JYIA 1N1SA 2R0FA 4R9DA 1US3A 4ISRA 4CZSA 5D8AA 3H7JA 2ZKNA 4XC9A 4YVWB 3INAA 1UMIA 1QOTA 1XYPA 3NKGA 3SEPA 1FOD2 1RUG1 2WN3A 1C8M3 1EAH2 3PIGA 1CPMA 5J09A 5M0TA 3O1PA 3AZWA 2VUJA 2G1MA 1H4HA 2RM21 1REEA 2D3PA 3GGLA 4XAEA 3KGLA 3K2OA 2VMFA 1QJU2 2VTXA 3NVCA 2F17A 5BV6A 1H2KA 3K4ZA 4EWDA 1AR92 1PHMA 1PK6B 1W04A 4QPIA 4XFAA 1E5IA 1W8HA 1D4M2 4BMBA 3GXUA 1ZRFA 1SDDB 1UX7A 2JENA 1RUI3 2WAAA 4FP2A 3VBFB 1RL3A 3IDAA 4AI9A 4PF5A 3KSCA 2ZHMA 2Z69A 4UYBA 5GLVA 5LY1A 4BE3A 1RMU3 2WS93 4H55A 3ENRA 3JUUA 3A23A 4AEDB 1BHGA 1W9FA 4Q4V1 1M06G 3CDZB 4QXHA 4XABA 3W5NA 1EYBA 4L11A 3HQRA 1VBC1 4S2GA 3N7LA 4YVSC 3WZ1A 1FPN1 3VBRB 3ZO0B 4AE2A 2WA3A 5LASA 3U37A 4PI0A 2JDAA 2JDZA 3R4UA 1XNDA 1I5PA 1R081 3HNBM 3E97A 1W6MA 5F7UA 4SBVA 4QX3A 3WNLA 2X09A 4XFGA 5A7OA 1VBB2 3AMPA 3H8RA 1LHUA 1PX4A 2G9ZA 1DP0A 4LIVA 3LF7A 4MV2A 3VZJA 4XYXA 5L7OA 4CPBD 2VJXA 5GALA 2ARCA 2I07B 4LKDA 3TN93 2D6OX 1W06A 4P5YA 4XJWA 3SKVA 2D6LX 2GALA 3CEWA 4Y1YA 4AGRA 4UFJA 1V6KA 2E63A 2Z42A 2MEV1 1ZX5A 2E7QA 4X6QB 1CX4A 1G9AA 1G86A 4KL1A 1NT0A 3UT0A 4D7SA 4TLGA 1MEC1 4DUVA 3A21A 5JSRA 1Q8SA 2UY9A 4N53B 5FBZA 4P9LA 2FMDA 1RUE3 1R091 1WWYA 1CQ9A 2O8QA 4CVUA 2B8MA 2YROA 2WABA 4FXGB 1OF4A 5EHDA 2EALA 2VH9A 2LTNA 1Y7BA 2F6BA 3IMNA 1BKZA 1SLBA 3VHPA 2XPJA 4BIOA 4LO8A 2D5HA 1ZZ9A 5FPZA 4NIGA 2D6PA 5KHHA 4B1MA 5FY1A 4ISQA 1OOPA 1KFXL 1NA1A 1YI7A 1W05A 1JTZX 4COVA 1CIWA 4CP1A 2XONA 4KWJA 3BIEA 1PX3A 3BN6A 2B45X 1O4TA 2WFF1 2VZOA 2WNVA 4TXWA 1ND3C 1K3IA 5FZOB 5KXCA 3LDBA 4Y1XA 3C7EA 3IDCB 2EAAA 3ZYJB 4FP3A 4N9IA 3GF6A 2CAUA 2JECA 4XURA 5CYYA 3M3CA 4AWDA 5JXHA 2X5IB 1HV1A 4RQPB 1QJFA 4IEZA 3MFCA 3IZOA 1AR82 3NV3A 2IXIA 5FPLA 2E26A 5CFCC 1MZ6A 4YPJA 1UQXA 3IIIA 2WZR3 3M70A 3OG2A 1RUJ3 5JIAA 3AZZA 2AUYA 1RIRA 2OX0A 4QAWA 5DUUA 5APAA 3WUDA 2JG9A 3FLPA 2EIGA 1ZBE3 4FVVA 3VKNA 4LK7A 4B7EA 4OI1A 4AGVA 3Q8EA 4ASKA 2OQ6A 1VMJA 2DF7A 5FR3A 1W8ZA 1HRV3 2EA7A 1ND2B 4MG2A 1QJX2 1NXD1 5F5QA 3P6BA 5FPXA 1UMZA 2ADDA 4DRVA 1CZVA 2GU9A 3MF9A 3WF4A 1NE4A 4QM8A 2BTVC 1V0AA 1YFWA 3ZPOA 1OLQA 1V6OA 3R6SA 4I01A 4R8HA 1O3SA 2B5HA 5FZBA 4IV3B 4IEOA 1JBCA 3AB0A 2VZTA 2BV4A 5DN2A 1W6OA 2HWD2 2E32A 3RPQA 1IKPA 4WVWA 4DINB 1D2QA 1ZRRA 2QQOA 3ZFEC 5H9QA 2W52A 4H14A 1B09A 1S0JA 2XBO3 1KD7A 1QQP2 3I59B 5A7NA 4PIYA 3OOXA 5AC92 4BYYA 4UF0A 1QJY1 1BEV2 5C4WC 5I0RA 1C1LA 4WM8A 2HWE3 2ZGNA 1JZ3A 3BTYA 1W9WA 4QPGA 4AI3A 1YJLA 1P8JA 1OLME 3IBMA 5K9YA 5T52A 3UJOA 3MIBA 4YWAA 4LBLA 3SC7X 1NY72 4FPHA 3O1TA 3LOBA 4XF0A 4MXWA 5FYUA 3MPPG 4K1ZA 5FFOC 4Y1VA 2C6SA 4NRMA 2BOJA 1POQA 2BVBA 3KQ4B 4LOTA 1W2NA 3VBSB 3VBHA 4XBLA 3JBG1 1F15A 2IZWA 3H50A 4BB3A 1JUIA 4K8FA 4QKFA 5EJZB 2AACA 1PZ8A 3HR9A 4JGZB 3H1YA 1X8MA 3LEIA 4IW3A 3BI3A 4XOGA 2BFUL 4DZGA 4WV8A 2NLRA 1NCQB 3H3UA 3D0JA 2D98A 1RVF1 1AX0A 3NW4A 3U07A 3VDDC 1DQ1A 4FTSA 3POBA 5GJ6A 1SQ4A 1PIV3 1QGLA 2OIIA 1YFUA 1LHWA 1YIPA 4MLOA 1TEIA 3S57A 1C57A 5DAQA 5C9AB 2G4IA 3A0KA 1UO9A 2BYVE 5IK4A 1I1EA 2YV8A 1FOD1 4CDWA 4CP0A 2VCCA 2FD8A 2BP6A 1DCSA 2OQ7A 2Q1FA 2YBKA 4CU6A 5E88A 4CEYA 1CVNA 1QJU1 2ZZQA 2GN7A 2WYSA 1NQDA 3AZXA 2ZHKA 2WO1A 3UGFA 1AR91 1K5JA 4CYDA 1QJX3 1O3TA 2RS12 1D4M1 2QQKA 1O4YA 1EPWA 1OA3A 2VXJA 2Q0AA 2A6VA 3NV4A 2V09A 4I09A 4PF1A 1UL9A 4YZ3A 3ZKUA 4R4ZA 3S5AA 2BGCA 4A6OA 4QKNA 1KDMA 3JZVA 1JHNA 4H7MA 1BCXA 4XVHA 1GWMA 2PFWA 2GNTA 1I5ZA 4FQZA 1NZCA 1PMIA 1VJ2A 4HONA 1LOAA 5C5UA 4YGBA 5LEKA 5JOXA 4HKWA 5EFUA 1DQ5A 1PO22 3IPVB 1CAVA 1QHDA 1Z7S3 4E2SA 2XVGA 1OD3A 1VBD3 2G9GA 2YDEA 4AFDA 2J7MA 3RRDA 2XH6A 2MPFA 2C1FA 1YEWA 3JD73 1ZZ7A 2ZAAA 4FPYA 3ZFFA 4E2QA 5FJKA 2PXJA 4ZU5A 5C5TA 3BPZA 1OA4A 1X33A 1BEV3 2XJUA 1S2KA 2CGPA 1ZZ8A 1VBB1 3HQXA 2VW2A 2JDNA 4TYSA 2R7EB 1OUXA 1E5SA 1UMHA 4BQ1A 4N90A 3B7MA 3SNMA 4B29A 3PHMA 5GZFA 2VMDA 3ZYPA 4UW3A 4LUMA 2Y26A 5J1XA 4OFGA 2DFCA 5BNPC 4W50A 4RS5A 4XTPA 1UZ0A 4QHOA 1LHVA 5EWSA 2UYBA 1MZEA 5FZ7A 4OI2A 3VHNA 3H9AA 2DBNA 4HANA 4MGYE 1YWKA 4UW5A 5DUXA 2BBAA 3RYKA 4BDVB 2J1AA 1RUOA 2D43A 4P9GA 2VQ0A 1YJKA 4HL0A 4QQLA 3LIHA 4XTMA 1JW6A 4YW2A 5B4XA 3SCFA 1PNFA 4IEUA 3O1VA 5LA9A 5J37A 1OC1A 1PM7A 3TNPB 2YXSA 4AVVA 2XLGA 2KD7A 1DHKB 2NZ9A 3SEEA 1F35A 2JX9A 3UYJA 2ZX2A 2HWB2 3OGGA 2PAEA 1VLNA 5J98B 5I93A 1R1A3 3ECQA 4IL7A 1O6UA 1SLAA 2W68A 3THTA 5FZ1A 4K6BA 3RZLA 3MV01 3L2YA 1YQ8A 1B35C 1PGL2 1OQEA 2RDSA 1X36A 2ZGQA 1NYWA 4PDWA 4QPGB 3WV6A 3I2DA 1BMV1 5ERLA 3MYXA 1AXKA 3FWEA 4GD4A 5HV4A 1AR81 2VVFA 3ZXFA 2JG8A 2XR4A 4NO4A 3T1LA 4D8MA 1JS9A 1IHMA 1I3HA 2W87A 5KR7A 2XJPA 1VAVA 1COV2 4YSFA 5ISLA 2I74A 2BVVA 2HEYF 4CDUC 4COWA 1N3OA 4DS0A 1LU2A 2H6BA 1J3RA 1WW6A 3JCIA 1U5IA 4LO6B 2QNKA 2VTFA 1ZA7A 1PO23 1HRI2 2IXJA 5BNOA 1XNCA 4WVZA 2W1WA 4META 2WQ4A 5FPVA 3FMGA 1TMF3 3ROUA 3MW4A 3QH7A 4YZ5A 3TB0A 3RZZA 4D94A 5FOJB 3WP6A 3BTZA 3AYDA 1BVVA 3B5LB 3PMEA 1X82A 2VZPA 3HOBA 3K3OA 4LBOA 4P9JA 3KM5A 4PI2A 1H0BA 4Y20A 3TNQA 3QBQA 4KQ7A 3V0BA 1IS3A 1RUF2 2GC2A 5J36A 2OYZA 1HLCA 1LCLA 2HWD1 4GZ9A 1YLLA 5FYIA 1OKOA 4RYDA 5HCBA 4HBNA 3T2QA 1V9U2 4Z82A 2E9QA 4ZY9A 2BUKA 1RHI2 3WW4A 1H9PA 1TVGA 1QQP1 4PQ9A 4QQOA 5AC91 2CHHA 1V6MA 3I2JA 4LBJA 5EXOA 3KV4A 1UY4A 4CXWA 1JOPA 4L97A 5EJ3A 4QDQA 5T3NA 5H9RA 2VZRA 4F3JA 1RGSA 1VAMA 4LBNA 3WCSA 3P1IA 4LBQB 3DN7A 1OH3A 2VY0A 4MO3M 1H6YA 2WNUA 1NY71 3VD9A 1YC61 1G7YA 3A4UA 4EN0A 5FTTC 1HKDA 1POV3 2BWCA 4KMQA 5KC5A 4XUTA 1ZRDA 5L9VA 1VB2A 4CTEA 4FAGA 3VUOA 3O0WA 2D6MA 5EYYA 5L9RA 5I91A 4B4RA 3ZMOA 2DUPA 1MS5A 3ZXLA 3IN9A 5IFTA 5JOYA 4DOUA 2XJSA 4RL7A 4LBMA 2VU9A 1W28A 4DUXA 3W58A 4OI0A 4RR3A 1OLRA 1L7QA 4LORA 4AI2A 3VD7A 5LA1A 2W9XA 2B7YA 4QWNA 5CFDA 2C4XA 1HV0A 3ACHA 2P5BA 3NV2A 4GIQA 4V2VA 1K5MA 1UKRA 3WD5A 2GP5A 1YNAA 2ZGOA 4XIKA 1WW4A 1SG3A 1SPPA 3T2TA 2OUHA 4XZUG 4DY5A 2YC2A 1XOYA 3DPRA 4AQ6A 4YVSB 5FZCA 1DBNA 3V64A 1AYN3 3WSOA 2D40A 3N7JA 3E5UA 4ATFA 1LJ7A 4A7ZA 4JRAA 5L9BA 3VDAA 1CWPA 3PUHA 3T1MA 2CY6A 1F5JA 1XU2A 2Y34A 5DDJ2 2RR13 1QWRA 5IYYA 4E2GA 2MNGA 2RVAA 4NROA 2RS11 4Y5SA 2JD4A 4RFT0 4NHKA 3OGRA 2K9ZA 4CUBA 1WGPA 5K0UC 2CYFA 2YC0A 2HEWF 2B4KA 3GDBA 1MQTC 2CV6A 5F5IA 4LKEA 5T50A 3O14A 2AEZA 4FPLA 4QU2A 2VMIA 4OHVA 1CAUA 2A3XA 5FY4A 1JZ4A 4AGGA 1FXZA 1QOOA 4M0NA 3ETPA 3HNYM 4RHV2 1WZXA 3CJIC 2XUEA 5A32B 3AKRA 5JIUA 2LROA 4QT6A 1GBGA 1URXA 3C7OA 2RDQA 3OF1A 4OUSA 4QX1A 1RUC2 1IQDC 2ZMNA 3VN4A 3ZDVA 1V9U3 5A7WA 4CUCA 2FDFA 2WT0A 4IV1C 2ZPXA 1AR71 3AMNA 3POEA 5L7OC 5IUQA 2E7TA 1RUH3 3C8XA 3CZUA 1A3KA 4WM7A 4F8AA 3IDEA 3CMGA 5F3GA 3DEMA 1GZWA 1W8TA 1L7RA 2NPIA 3F2ZA 1H8TA 4Q2FA 3ZYBA 1YRZA 2ZABA 5KWRA 3MUY1 3D4KA 2RE9A 5JXGA 1YQCA 2VZ3A 2V4AA 5GZEA 1UCXA 1TG7A 4QMAA 4OZOA 3KCCA 4FPKA 3MF6A 1J58A 3JQXA 2DCZA 1RTVA 2QQVA 4HK9A 2PHDA 5D21A 1OMIA 4Q1RA 4WZFA 4YVWA 1ND3B 3LQCA 1MEC2 3T2OA 1OH4A 2YFZA 4FFHA 1E57A 4L8QA 4OULA 5JZGC 4ITCA 5CEHA 3I3DA 4XXAA 1PVXA 4IXLA 3USUB 1WMFA 4N7IA 5KHGA 2LM3A 5C3OA 2VMGA 2FDHA 4OYUA 3SKJE 1PK6A 2RS52 1MS0A 5LA0A 2DUQA 4QQ2A 2XJQA 5A3NA 2DCYA 4LOSA 3BIWE 5FZ3A 3VBFA 4Y26A 2ZGMA 4A4AA 2VR4A 3UJQA 1UIKA 2Q8EA 2OW4A 2W95A 2HWB1 3TRSB 5C8CC 2A6YA 2A75A 4OVEA 4AEDA 3PTYA 4CDXA 5IVVA 3ACFA 4XDPA 1OQDA 1RUG3 3K77A 4XCBA 2WA4A 5HCHA 1PGL1 3MICA 3P3NA 4UFKA 2RM23 4JKKA 4YLZA 2XHKA 3RGBA 3S30A 3VBRA 3JU9A 1DGLA 5SV8A 4FQ4A 2Q8CA 3RZJA 3PJQA 2ZGKA 1H9WA 4ZXKA 1SACA 3DKQA 5CVRA 4ASLA 1WA6X 2ZZJA 3RQ0A 3J8F2 3U4SA 4XILA 2JG9C 2C9KA 4IETA 1X9PA 4NAOA 3POFA 1NAEA 3I2FA 3CLPA 5K8SA 3NNMA 1MS1A 1ULGA 1CD3G 1R1ZA 3C7HA 2WNEA 3CHXA 4ZS2A 5FDBA 1COV1 3BOPA 3ZM8A 1S0IA 2PHXA 2ZX4A 3QD6A 4GKXA 1JXNA 3T0BA 5JR2A 1DGWX 3GZEA 3N9OA 4LBKA 4XETA 4Y33A 3GCXA 4A41A 4EWAA 4RFRB 4EZHA 1OQ1A 4Q4V3 4A6SA 3WW3A 2JWPA 2PHWA 4QD2A 4EROA 1DYOA 1S4CA 2JJ6A 2HYKA 1VBC3 1ULCA 1UOJA 1FPN3 5DABA 4FTEA 5C4WB 2ERFA 1AZDA 1LOGA 1S1AA 2WYFA 3ZN6B 5JR7B 1R083 2O8OA 1K5MB 1DU3D 4N53A 5FP9A 5J48A 5F3IA 2W39A 1W3VA 4Y22B 5F5CA 5BXXA 4S2DA 2ZA9A 3ZIXA 2WQZC 4YG3A 2A1XA 3WDTA 4R9CA 1QH7A 1RUF1 4UI9L 2ZEWA 4Q8LA 1G9DA 1XB9A 3D6EA 5IFPA 4MXVA 1UAIA 2YY1A 1JZ2A 1V6LA 3KVBA 2NN8A 2W5FA 4B8EA 3GBWA 2HWF2 3Q8CA 1KS4A 4IE5A 2X10A 3CIHA 4JGYB 4KG8A 4MVTA 2MEV3 4UBHA 1BZWA 4C8DA 3WHUA 3WF2A 1W90A 3N9NA 1W0OA 2K2SA 1RHI1 1MVQA 3FJSA 4GKYA 1O59A 3MUZ1 3SISA 3LAGA 5FZOA 1EV12 1R093 4DB5A 2PAMA 1TME3 4NAMA 2JB4A 1NCRC 5FZLA 3VDDB 4LT5A 4YGCA 4ZPIA 2X5IA 2ORZA 2ZX3A 1FX5A 3AKQA 4RQPA 4YW4A 1T6GC 4WBBA 5SV5A 3VBUB 5A3MA 2K0GA 3RZMA 2GP3A 2TBVA 2ARAA 5A70A 3EQEA 2FDGA 1CZSA 1Y9GA 2EIEA 1G8WA 4XBNA 4AVCA 4JAAA 3DV8A 4XW3A 4P02B 3EYPA 5FY9A 2WSUA 1LOBA 4YFWA 4EWEA 3O7OA 2RJKA 3J7HA 4XBQA 5FO7B 1HDKA 3P5BA 2WFF3 4IEWA 4DQAA 4J1XA 2AYHA 2RJLA 2WWSA 5KC6A 3AJYA 4UWDA 5ACA2 2PHRA 4NRQA 2LUWA 3AXDA 1ND2A 2RMU2 3GNEA 1D7PM 1U5YA 2BRTA 1RVF2 3WDWA 4EN9B 5LW9A 2DVDA 4RGKA 5IVEA 2SBAA 5I8TA 4JQRA 1HB4A 4Q4X2 1F9KA 4GWJA 4YG0A 4BQYA 2A5ZA 4LPLA 4IE0A 3WG1A 4XACA 5KBFA 2XB6C 4IV3A 4ZZ5A 3K4DA 3OBTA 4ATEA 2YFUA 4GWNA 2JDYA 4KI5M 2D93A 1GP5A 1RUD1 1AYM2 5FK7A 2BU9A 5IWFA 4CUAA 5F3CA 3ES4A 4XUNA 4BK5A 1H2MA 2J1RA 2J42A 5FY7A 3SMHA 1HQLA 4AEJA 5LBFA 5DDJ1 3AP6A 3I59A 3ZXJA 3J26N 5EZWA 5IJRA 1OURA 3GZTB 1UU6A 5FLHA 1ASJ2 4D6QA 1XNKA 4AFBA 2XQXA 1VRH2 1J3QA 1HJGA 5KXEA 3POJA 3KV5A 4PJYA 2ZMKA 3ABZA 3LD8A 2DBIA 1ULOA 3LEGA 5A3UA 4CCMA 1R64A 4FXKB 4K7JA 3FHAA 1REDA 4IEPA 4RHV1 4CDXB 5C8WA 1I6XA 4PCRA 1BQPA 5BNPB 4Q1PA 3WQ0A 4CU9A 3WR0A 1IGOA 1AL21 3HQUA 3OYWB 1MACA 4BPZA 3LPFA 3RS6A 1RUC1 3MV11 4C1XA 3BB6A 2VNVA 3VBSA 5FBJA 3WF1A 1XE8A 4L92A 4YW6A 4UFLA 1XJAA 2WIIB 1HB2A 1QJY3 4FO9A 3KHCA 1AF9A 1TZOA 3GYDA 1DQ4A 4F7ZA 1ULDA 3LIGA 4JGZA 4CCNA 1JH5A 1WLCA 1LULA 4DPNA 5A6XA 1C4RA 4Y1ZA 3F95A 1NCQA 1UX6A 1GOGA 2DVBA 4EN7B 3WP4A 5FPUA 2W1UA 4RS5C 5ANQA 1IKQA 4NPLA 2E6VA 2ZHNA 1DQ2A 3M2MA 1GP4A 5IATA 4R52A 1N3QA 3VDBA 1UWWA 5C9AA 1LEDA 3K48A 4QX2A 4MGTA 4N9HA 3JBG3 1OLMA 2NMOA 5FYSA 2HWC2 4NIDA 3N7KA 2WSVA 3JQWA 4CE8A 1ZZ6A 1O5LA 4GJZA 2RS51 2P3JA 2AR6A 3K75B 1RVF3 4NN0A 1HXS1 1LGNA 4CDUB 1Q56A 2DVAA 3B00A 4Q4Y2 2FQPA 2PHLA 3SH4A 1A8DA 2VCMA 2D97A 3IT8A 1VB4A 3EJKA 5GZDA 5T5OA 4Z92B 1FATA 3BODA 4S2HA 5I0DA 4XUOA 2BFUS 4HPKB 4E4DX 4X8NA 1SDWA 5LK5A 1WMEA 5F37A 1FOD3 4O9GA 4Q4W2 5LBEA 5L36A 1EAH3 3VB9A 2HBTA 5FWJA 2Y6JA 2BGPA 3GHMA 4BCUA 4E4ZA 3IPVA 5EPAA 1LR5A 3H42B 2WWUA 1PMHX 1O3RA 2JG8C 3KMHA 4RD7A 1D0GA 4QHBA 5C33A 1QXRA 4QGMA 1BMV2 3LA3A 1QJU3 5FKCA 1XC6A 4YW3A 4FOWA 1AR93 4HSJA 1GNZA 2PLV2 1D4M3 2ZCWA 3BVCA 2IXLA 3ILRA 1OVSA 3J8F1 3E6CC 3RZKA 4XFCA 4YW7A 3MBWA 5FYBA 5FAXA 2O14A 5C71A 4AVAA 5K4LA 1J84A 1FMD2 5LY2A 3I3BA 3VV1A 4D7TA 2W1QA 1F4AA 1UZZA 1V6JA 3N35A 1UOGA 4EV0A 3B01A 1DIWA 3I3EA 4IEYA 1SBEA 2Q30A 4JV4A 3VBOC 3RMXA 5BNQA 1MS4A 2EICA 1POV0 2WT2A 1LGCA 5FK8A 3ZR6A 5LB6A 1C3HA 1CONA 3B02A 1WCSA 2XJTA 4L2NA 4KBBA 3NNLA 4YG6A 2YGMA 3K46A 1VBB3 3MZHA 4JTNA 5FZKA 1GANA 4NE9A 2WQ8A 1DFQA 5I0SA 1WUVA 4W8JA 4N8MA 4UT5A 2B9UA 3THDA 4QXBA 5F2WA 4PHZA 5GZCA 2PHTA 2HWF1 1LEMA 3D3AA 2K46A 2VD7A 1AR62 1GFF2 2DURA 5JVVA 3CKHA 3OBRA 4B4PA 4OMCA 2VUAA 4PLOA 5GM0A 1XRUA 4LITA 3RWNA 1JYVA 3B3QE 5F9TA 2YMZA 3PU8A 1EV11 5JOWA 1M4WA 5GLWA 1OFSA 1HB3A 3RVHA 3USSA 2XMLA 2VVEA 2P3YA 2XKOA 3ZXAC 2XL7A 2XKPA 2FZ2A 5BUVA 1WMDA 3MHZA 2FZ1A 1H6XA 4F83A 2OXBA 3SCHA 2C5DA 5JAXA 1E5HA 2XVLA 1GNHA 1W9SA 2R042 2B46X 4OUEA 5FYVA 4K20A 1GU3A 3AP7A 4QX7A 4RR3C 1AVBA 2QQLA 5DG1A 3IAQA 3T3YA 5F8PA 2QZ2A 2HBUA 3VD4A 2BERA 3O12A 3O5SA 1Y9QA 1BVP1 1N3PA 5FCCA 2OKXA 5FOBB 4E9KA 5FXVA 4TZDA 4J25A 5E6HA 3VZNA 1PO12 4P00B 3WP3A 5ACA1 2FHRA 5C7GA 2Z79A 4OLLA 3GZUC 4B7KA 1VBA2 2VBBA 3LSEA 4HLTA 1DG6A 5JXIA 2GN3A 2RMU1 5K0UB 1LGBA 3KD4A 3VZKA 4PIZA 4HKLA 1MQTB 3HVDA 4HVRA 1AR83 1W39A 2ZGSA 1HB1A 2R6QA 2YU1A 5E89A 3BU0A 3FLTA 3OPZA 4Q4X1 4R9BA 2EF6A 1QOSA 3I2OA 1RB8G 2OPWA 3CJIB 5CKQA 5DQ0A 4AK3A 2OT7A 1V70A 2Y38A 3LA7A 1Q8OA 2ZEYA 4XCAA 1FAYA 1XNTA 3NJZA 4QX8A 3D0SA 2V73A 5CKMA 4OI4A 1AYM1 4GH4B 4IV1B 2ZS6B 3M3IA 4AW7A 5F1RA 3NSTA 1BBT1 2ZGUA 3WDYA 4C0BA 1W0PA 2R49A 4XJUA 3W5MA 2QQIA 3WDUA 3O1RA 2Q1ZB 2JDKA 4AF9A 2HKXA 2PHUA 1JHJA 3VKFC 3ZSJA 5A3TA 5HI0A 4RA0A 2JDMA 1VMFA 4NPRA 1ASJ1 3AFGA 1VRH1 1A6CA 2E31A 2RS32 1LENA 1GWKA 3D5OA 4C90A 3NAPC 2W08A 1J1LA 5HCAA 4QXKA 4LBQA 3I8TA 3PVBB 1YCIA 4LEJA 4MH0E 4QKBA 4KGQA 1ODNA 5FQ0B 4H2AA 1TQ5A 1W8OA 4FFGA 3I2HA 3FHQA 1BJQA 2HWD3 2WAOA 3LPGA 2KA3A 5DMYA 3ZYIB 1UW8A 1W6QB 2G9FA 3URFA 3CJXA 4CUGA 3OTFA 1AUYA 3L2HA 5JZGB 2LS6A 4S2FA 4B1LA 2ZACA 2WL1A 1AR72 2R1BA 5FZ9A 2YG0A 1RYYA 3AMQA 4NIIA 1QQP3 4HXCA 3WW2A 4GWMA 4L0PA 5AC93 1V6IA 3PLQA 3CNAA 2HLEA 5FZFA 2KXLA 3I97A 2ZXQA 5D1IA 3KF3A 3QCWA 5FYYA 4AHWA 3PUIA 2ARXA 5EJ1B 1ONAA 2RV9A 4OZXA 4XFHA 3BYWA 3U10A 5IVBA 4LKFA 3LDKA 3IMMA 2YUEA 2QDRA 5J7MA 1UZWA 2LRPA 3POGA 4ZHNA 4A7YA 5FZ4A 3UGGA 1UZVA 2R072 3RZHA 2YBPA 4FCAA 5GLTA 2VCBA 3AKSA 1D0HA 3AMMA 4YVSA 4LE4A 4XE9A 5LEJA 2WO3A 3ACGA 3BALA 5CU1A 2C26A 2HWC1 2VOXA 2VC9A 1XU1A 1V6NA 2P3KA 3WF3A 3HIFA 2XXZA 1W6PB 2BOIA 1REFA 4GA9A 1MPXA 4N43C 4ZU4A 4AQ2A 5IK7A 3AJZA 2JE9A 3RZGA 2VM9A 4ZS3A 4CPBA 4P9YA 4O61A 4ZU7A 4Q4Y1 4M01A 4XHBA 2X05A 2EIDA 3ZSKA 4GXLA 1FYUA 4MGZE 5JCTA 3VBRC 1AXZA 2X53S 3KB5A 4HT1T 5E8AA 1JYCA 5A32A 4CA9A 3KT7A 4CP9A 4Q4W1 1UPSA 4AG4A 1JYNA 2BGOA 3W20A 4BWOA 4CEWB 3BCWA 1Q8PA 2EXHA 4BXSV 2ZTNA 4TWTA 4Z1VA 2VNRA 3MGUA 4NOTA 1JI6A 1Z0HA 2ARBA 2TUNA 2ZX1A 4HFSA 5C6CA 5FMOL 3ZFGC 4QPWA 2RS13 4XJ8A 1DYPA 2PLV1 4PLNA 3OY8A 1UU5A 1C28A 1VBE1 4DMIA 1AX2A 3VZLA 5CG9A 1W3XA 1KGYA 4YZ2A 2CDOA 2VOKA 4YM0A 4CDQB 1FMD1 1PNGA 2CL2A 2PN5A 3OUJA 5CISA 2RJ2A 2ADEA 3CF6E 5BNNC 1K45A 3RI8A 1ZVFA 2V5YA 2XWJB 1BYHA 3O1MA 1YFXA 5GLZA 1LRHA 2WDBA 5FXXA 5KHIA 1JYXA 4J6GA 1G9FA 1S0EA 3KS7A 2JKBA 4TTGA 1ND3A 1BLZA 4JKMA 4BZ4A 3FBMA 1AR73 2WR9A 4E8DA 1XNBA 1NCRB 1QJZA 2WLQA 3PURA 1S0FA 3USUA 3AM2A 3ZSMA 1KQRA 2P17A 1ZREA 4P08A 3E5QA 2ZBJA 5FUPA 5BYNA 4MADA 1H1AA 3I7DA 4MZUA 1SFYA 1QH6A 2JXAA 5HV0A 2Q8DA 1OVPA 2J1VA 3ZPYA 2OA2A 3WOGA 3OJBA 5IHRA 5FZ8A 1AR61 2FCTA 2V5DA 4IDZA 2XJRA 3FHIB 3I49A 1LOEA 4PBPA 1AJOA 1QXPA 3SHRA 1Q8VA 2R0HA 4IEQA 1ZRIA 4MYEA 2VG9A 1GZTA 2X5IC 1Q5OA 3WG4A 1SMVA 4AL9A 5I8YA 4IGOA 4M3CF 1CZTA 1CAWB 2VOWA 3KGZA 4Y3OA 3W9AA 3N7MA 5C3QA 4DXTA 4KH9A 3OB8A 5JSPA 4MGKE 3WQBA 5ABJC 2WT1A 5H9SA 3ZYGA 2VOVA 3ITQA 1FV3A 5DZFA 1NOVA 3E6DA 1LODA 2C0ZA 2IXHA 2R041 1JYTA 1C5HA 3MW2A 4KWLA 4GMP1 5E1RA 3TAYA 2HWB3 4HSLA 2YU2A 3UGHA 4BQ2A 5JLVA 5LK7B 3N4MA 3NNJA 3N9LA 1WD3A 2GC1A 2Y6FA 3J7NA 3ILFA 1UIJA 1PVC1 3NRUA 4JDOA 3AMHA 5CKNA 2X29A 1PO11 5A1AA 5IVJA 1WW7A 1N47A 3AVRA 4MGIE 5C4WA 1VBA1 3ZN6A 3NO8A 1JZ5A 1MS9A 2GNBA 2XHNA 1I9RA 2QVSB 5D8AC 1JZ7A 3H1MA 4Y22A 3AC0A 5FWEA 5EYXA 1HW5A 3U0ZA 5IK8A 3BGAA 1COV3 4XFFA 1UOFA 3VKMA 2LALA 3AZVA 5FXWA 4BISA 2IVJA 5L73A 2XDVA 1C1FA 1KEXA 3ZKYA 2BNNA 3N9MA 4O65A 1RUD2 4QPIC 2E7AA 3VZOA 1H2LA 1OKQA 1DLCA 1EUUA 4MSVA 4JGYA 3HAGA 1HRI3 1YYNA 3GALA 1GQGA 3ZDSA 2GNMA 3KV6A 4L99A 3G6JB 4FFFA 3CZJA 4ONUA 1GQPA 1N1YA 2Q1MA 1O7FA 1W6NB 4BQ3A 4RGAA 2RS31 5FPAA 3VLBB 1ACCA 4W6YA 3VDDA 2VQTA 5J96B 3KLSA 3THCA 3CU7A 4XFIA 5CADA 1RUF3 4BQXA 3VBUA 4NR1A 1W0NA 3ALQA 4XFBA 4EJRA 4CP9B 1UU4A 4QU1A 4R4XA 5IVCA 5FP8A 1SCRA 1AL22 2PQQA 4KNCA 1MS8A 4YNIA 3SXWA 1WA4A 1ENXA 2DFBA 3OUIA 4JGZC 2VW1A 4AYUA 2D6KA 3ZR5A 2QDNA 1RHI3 3KCXA 3AXEA 1H8VA 4EN8B 2CGOA 4FPEA 2A3WA 3E6BA 3OY8B 5A3WA 1JOBA 1DQ0A 5DAXA 4PQQA 4ARYA 1K12A 4CCLA 1PGW1 1XE0A 2VW0A 3R05A 2P2KA 3UK9A 3WDVA 3UKTA 1S55A 2HEVF 4QHZA 4NPMA 4AZZA 5KHKA 1HQNA 2AZ5A 1RC6A 3GBGA 5KXBA 4JDMA 1YQ5A 3MO4A 3HJRA 2VZSA 1D4VB 2ZEXA 2R071 1GR3A 2WWJA 2XWBB 3IKWA 4Z07A 5LA2A 5A7SA 3P3PA 3N3HA 2ILMA 2VTXJ 3POSA 1OF3A 2DV9A 5FMDA 4HETA 2VBPA 2VZUA 2DYCA 5FXZA 1W2UA 2C9AA 2PAKA 3MDPA 2W2IA 3CQOA 4UOJA 3AX4A 2VO5A 4NHMA 4NRPA 4XJ9A 4CCKA 5AVPA 3BUCA 2Y0IA 2QTWB 1C5IA 3K4AA 3KV9A 4IUGA 5CFCB 1XSQA 2ID4A 2BEOA 3ST7A 1OOPC 1NA1C 4OCTA 2CAVA 1SBDA 4Y24A 2QQMA 3NWKA 1HXS2 3ZXKA 2EXIA 5A3PA 2IUWA 5A3OA 4NHXA 1CIYA 1X50A 4OHZA 4P5HA 3IB3A 1SCSA 1IG3A 2WNVC 4H7LA 3UV9A 1PZ9A 1DZTA 4R9AA 4UFHA 3TEYA 3VBOB 2AREA 2JIGA 3BPSA 2E33A 4GALA 1JUHA 4XQDA 5BNPA 1RUD3 2VVDA 3OYWA 1JODA 3WCRA 2VAUA 2WO7A 3LKJA 4FPJA 5CNAA 4CU7A 5DDJ3 2Y33A 2Z4FA 1W2AX 4AI8A 1UPIA 4AVSA 2JDHA 1S0DA 1U12A 3PVNA 3T09A 4D69A 5JPMB 2EAKA 5AFEA 4URAA 4CXXA 1W2TA 5FLJA 3ZSEA 4XHXA 2YGLA 3RMYA 1JZ6A 4XF9A 5FP3A 5FIXA 5LATA 1S0CA 2WC2A 4WZCA 2EXKA 4RHV3 1Y4WA 3ZFEB 3WEZA 5FZMA 3AYAA 1AL23 1O8SA 2VMEA 3GCWA 1HX6A 4XQ4A 4XXPA 5TSWA 3N36A 1CJDA 1NX9A 1IZ3A 1RUC3 4I3GA 4XIOA 1ZNPA 5FUNA 2JKXA 4Z2AA 3RYPA 4LQRA 3ZN4A 1NUKA 2DVFA 3RI9A 1ENQA 4BOWA 2CGNA 1V00A 3WXPA 2A71A 4LMFA 3QH6A 1L3JA 1Q8QA 1SZBA 3B69A 4NUBA 3H7YA 4KGGA 1W2OA 1AX1A 2WRAA 3H1WA 5D2AA 1OHFA 4CDUA 4HZFA 1UYZA 3FL7A 4W65A 4NIAA 1OPMA 4CCDA 4LE3A 3W59A 1JOJA 4WM8C 5KHJA 3B9IA 2P6CA 1SLIA 2XLAA 4FT8A 4GB31 3DCQA 3VZMA 3GBFA 4COZA 5HPOA 4HPKA 4QPGC 5DAPA 1NG0A 1MEC3 5FJHA 3KWVA 4WVMA 1XYNA 4K3UA 4JQTA 4YW1A 2IFWA 2Q4SA 3J4UH 3ZOIA 3VD5A 5F5AA 1CPNA 4YM3A 1AHSA 1LKNA 1F5FA 1RMU2 2VCAA 3DECA 4ZKTB 1LTEA 4Q5OA 2JDUA 4XAAA 2QJVA 1GICA 4DXZA 4GAZA 1J59A 5F6KA 1NE6A 2XVKA 2RS53 2PA7A 1ULFA 1ZA4A 3KVAA 3VBHC 3OGJA 3ZLIA 1VIWB 4KWUA 2XLFA 4BLJA 1O3QA 4P14A 4Z8BA 4JC1A 3ELNA 3AYCA 3MIFA 4OQ8A 3PTRB 4LO7A 4BQ5A 4Y5TA 3VDCA 2A73B 3WNNA 3I3MA 2QZ3A 2IXKA 3DXTA 3HT1A 3IWZA 2DCJA 1X9TA 2A6ZA 2P3IA 2VZ1A 3AK0A 3LWCA 2VE1A 1QU0A 4N7UA 4DEQA 3EB7A 2XGXA 3KZ4C 3M3EA 2KR2A 3M3QA 3MEPA 1UXXX 1SLLA 3PUSA 4ES8A
chains in the Genus database with same CATH topology
3MW3A 4XZPA 5T5LA 3RNSA 5KXDA 3TN92 2W0XA 3V0AB 1LOFA 1UN1A 2JEMA 3J8F3 3UKNA 2SLIA 3NAPB 2GAUA 4CDWC 2UYAA 4AHXA 4CEYC 4LULA 2WLPA 4ES9A 1CGPA 3UL2A 4LR4A 2N7GA 1RUE2 4B4QA 3ZSLA 2D3RA 2OUJA 4UXAA 1BBT2 2ZGLA 3ZXGA 3LZZA 1F8VA 5HCFA 3WX5A 3HD8B 3BTAA 1MVEA 4LBQD 4P9XA 4AQSA 1LB2A 2QE3A 4BA6A 4B3NA 2ETEA 2D44A 1RINA 1QDOA 1FI2A 1WLDA 1HQWA 2E51A 1DYKA 2VNOA 4K40A 3S0MA 4YM1A 1QF3A 3LB9A 3MIHA 3TOJA 1ZRCA 3ZFFC 2HWF3 1N1TA 4JRLA 4I3PA 1LESA 2WZR2 1N1VA 1ZYBA 5A33B 2EVXA 3A0NA 1RUJ2 4C0HA 1G9CA 1LOCA 1EV13 2F4PA 4N43B 2GMEA 2YZ4A 3AKTA 4AFMA 5I8SA 1ZBE2 1KRIA 4DNYA 4FTBA 2VMHA 5K0UA 4XQWA 1IS6A 3EBRA 1MQTA 1CAXB 1DGRN 3M8LA 4UBGA 4Q26A 5FRAA 2QQPA 5I0UA 1HRV2 1UF2C 2OVUA 2BNMA 1D2SA 1IS4A 2OZJA 3IIAA 3M1HA 4WVVA 4Y5Z0 3AFKA 3CJIA 1B35B 1EP0A 3QACA 3WQ7A 1FNYA 2ZJCA 4L9BA 3V65A 3NL1A 4GH4A 4IV1A 4HVQA 1MZ5A 4TSVA 3ZFGB 5ACA3 4DRRA 1OSGA 5AVAA 4ASMB 2RMU3 5DG2A 2R061 4FPGA 3WG3A 2ZKLA 4C91A 4FOYA 1U5XA 1IOAA 5FLIA 4Q4X3 5BNNB 1QNWA 2XBO2 3NV1A 1RUNA 1GQHA 1KITA 5FQ0A 2HJIA 4PDWC 1GSLA 2YYOA 5JWPA 1QY4A 1ZBA1 2HWE2 1F31A 4WVMB 1CR7A 3DGTA 1LHOA 4AEMA 1AYM3 1TME1 1ENSA 1W6QA 3KT1A 1C8NA 2XG3A 2BPA2 1BBT3 3WT3A 4LHLA 1NLRA 5JZGA 1Z78A 2ET1A 3S7IA 4URTA 1BK1A 1YUDA 4M3CA 1EY2A 1VBE2 4AQTA 1ASJ3 1VRH3 4DFSA 1J1TA 4W6WA 5BNOC 4UW6A 4Q29A 1H1MA 4YM2A 5C8CA 3ZMNA 4IEVA 4QX5A 2WINB 4Y1UA 2I2SA 1OFNA 1S2BA 4UW4A 3AP4A 1PIV2 4QQPA 3POYA 4HN1A 3B94A 5JI9A 4LHKA 5JSOA 5ABJB 2PELA 1AXYA 1KDKA 4XMIA 2TNFA 5FO9B 1W6PA 1C8M1 2ET7A 1A8MA 3AKPA 3AYEA 2WKKA 2B42B 1J3PA 4LLFA 1EPZA 3MLJA 5FO8B 4MX3A 4AHYA 2Y0OA 5GLUA 2ZX0A 1NLSA 1DLLA 1RUI1 3VGIA 5AFBA 2ZGTA 4Z2WA 5L19A 4P9IA 3FX3A 3O0XA 2ENRA 2ZGRA 3APBA 2WNUC 2UURA 4CEWA 2Q5TA 1G9BA 4BH9A 2A3YA 4I0BA 2HWC3 1AL0G 1RMU1 2WS91 4XF3A 5D8AB 5CA6A 4I30A 4PLMA 2AENA 3ETQA 4AEKA 5B2GB 1FT9A 1IS5A 1GZCA 3E5XA 1RJ8A 1YFYA 1Z7S2 1KS5A 2DCTA 2IFRA 3FFQA 4YW5A 4Q4Y3 1VBD2 4XJAA 5DZEA 4CDQA 2VXRA 3JD72 1TNRA 2O0OA 4QPIB 3RJRA 2VGDA 5CFDC 4A3XA 2GH8A 1A78A 4HVOA 1APNA 1PVC2 4Q4W3 5HXVA 1NXMA 1K5MC 2WFPA 4YYOA 2AGSA 1Y43B 3V56A 4BLIA 3TN91 1SFNA 3ZN5A 1GLHA 3SITA 3DPRC 2VECA 4EN6B 1UZYA 1NCRA 2PLV3 1VBE3 4XPVA 3KQRA 4M3CE 1FMD3 3EO6A 3PNAA 4JGYC 4U36A 1W6MB 1X7NA 1YO8A 5FMOS 2NYYA 1RUE1 2B39A 3MI8A 4IEXA 4KWKA 3B93A 5L7OB 2D3SA 3HN1A 2DU1A 3FBYA 4LNVA 2WZPP 1DZRA 4IQPA 1WLWA 1HIXA 2E53A 1O91A 3VBUC 5JPNB 1CAWA 2R32A 3Q9OA 1R1A2 1KJLA 2CNAA 2ZGPA 1EAH1 3ATGA 3HT2A 5A3LA 4IERA 4G9SB 4OHWA 4AI1A 4WM7C 1MZFA 1IPKA 2I45A 3VHOA 1AR63 1H8TC 2GNDA 2DU0A 2WJSA 4M3CB 2WZR1 1H2NA 2DTWA 2A70A 3RJ2X 1RUJ1 1PGW2 1OOPB 4I0AA 1YXWA 1NA1B 2ZHLA 1ZBE1 3WP5A 4KU8A 4LA3A 2BWAA 4YVWC 1WBLA 2WNVB 4D7YA 1ZZCA 3LA2A 3FUQA 5C8CB 3I54A 1AJKA 2A6WA 2PTMA 2R30A 5EV7A 1HRV1 2FBEA 3NKTA 2FMYA 1GKBA 2R043 3RYRA 1TMF2 4GMP3 3BU7A 1QKQA 1UD1A 1TNFA 4FAHA 4G4FA 3WW1A 4Q0VA 1PK6C 2UWAA 3KT4A 1YIFA 1MR5A 4LA2A 1JN2P 1CJPA 1PVC3 3D8CA 4AXOA 3VBFC 1PO13 2JG9B 1VBA3 3MPBA 2RHPA 4AEDC 1W6NA 2VNGA 4CDXC 2OZ6A 3C3VA 2XBO1 1PGSA 2AH2A 3SH3A 3MIDA 3WLUA 3AP9A 3LCPA 4CRQA 2HWE1 3I4IA 1S0BA 1SEFA 2NMNA 3WVJA 5HBAA 4QGNA 1S0GA 4LLOA 1W6OB 4XEZA 5H9PA 2P34A 4H3WA 2IC1A 2UWCA 1GZ9A 4QPYA 1QDCA 3ZVXA 2DVGA 4JDNA 3RDIA 3PVEA 3WHTA 2RS33 4YARA 4AI0A 5CAZA 3AP5A 2GH2A 4Q0PA 4P9WA 4WM8B 3KCYA 4GULA 4FOVA 4N53C 4KU7A 2BW8A 3ZIWA 4BMEA 5J3UA 4MXWB 2TEPA 1H30A 1WD4A 4A2UA 1LHNA 1PIV1 4BHPA 4LO5B 4I0WB 4M0HA 5CFCA 2JICA 5GZGA 3VBHB 3DKWA 3WQ1A 1AYN2 4GQ7A 3HWJA 4FPFA 2BNOA 5T5JA 1OPOA 2XUMA 4AFAA 4RGGA 5T54A 1QNYA 3MLKA 3VHRA 1Y3TA 3S6PA 2RR12 2R073 4ORFA 1F2NA 1IQAA 1FV2A 1QJX1 4GB32 4YZ4A 1DGWA 1YI9A 2CWSA 2IXCA 3VBOA 3ILNA 3HMYA 4SLIA 4FOQA 4RQPC 3MLLA 5LRSA 1SLCA 1DZQA 1SBFA 3WG2A 1GYKA 4NWWA 2UY8A 4CDWB 2GSYA 1Z7S1 4CEYB 4JTOA 3SH5A 1VBD1 3VKLA 2ZAHA 3ES1A 1LECA 3JD71 2O1QA 2GZWA 4Q8KA 3CL1A 4X8PA 1RUH2 3U11A 1ND2C 3MIEA 2CWMA 1BEV1 2YHJA 4PIXA 3ZFEA 1DGRA 1LOFC 4LUKA 4FSJA 2H6CA 3BOWA 3L9JT 3LSDA 1TE1B 1VR3A 4HKOA 4Q0SA 4XF1A 3D82A 2JE7A 3QOPA 1OA2A 4IV3C 4BIFA 3TBDA 3H8UA 1CAVB 1XE7A 5BPXA 1ZM1A 4Q27A 2CTVA 3TYJA 1XQNA 3DUIA 4IESA 3C2UA 3ZFFB 4OHXA 5DZGA 4Y4YA 2BBVA 2Q8OA 1G6NA 4LO4B 1UKGA 4OUMA 3FC0A 1X8EA 3RSJA 3LGRA 4KG0A 2OPKA 5JOZA 1YHFA 2R16A 2D5FA 1XXNA 4XMAA 1LU1A 5IT6A 1XYOA 3POWA 3ZX7A 4BM8A 1DQ6A 4D3WA 3WNXA 1IPJA 4JCKA 3OCPA 2GMPA 1R1A1 5JMCA 4RS5B 2NM1A 1RUG2 2PHFA 3PJYA 2ZOEB 4YGDA 3VBSC 2RM22 3VL8A 2X8KA 5F6LB 1PZ7A 3HBZA 3GHNA 1ZZBA 3O0VA 3MIGA 4HN0A 1H4GA 4GB33 2H0VA 1NCQC 3WDXA 3K51A 4AHZA 3U4XA 3G7DA 3WINE 4PBOA 1WCKA 4Q4V2 3V0AA 4XF4A 4NHLA 3M7AA 5C9AC 4FTEA 2DTYA 4A7KA 4MUVA 1VBC2 3NAPA 4COUA 1FPN2 1PO21 2Z2SB 3B9CA 4FPOB 2VPVA 4PDWB 4K9SA 4GH4C 3JB4C 3GZAA 1R082 1TMF1 1ENRA 3JB8A 1ULEA 4JVAA 1QXJA 4K21A 3DF0A 2JG8B 3RG0A 1CESA 1MS3A 3LOIA 1O4ZA 4RSUA 4LHNA 2IWGB 5DXDA 3VKOA 2R062 1VP6A 4E27A 1NQJA 5CB7A 4U2AA 5JI7A 1DF0A 2QKDA 2MEV2 4O9EA 5BNOB 2BQPA 3H0OA 4X6RB 4K1YA 4AVBA 5T55A 3TWIA 3WY6A 5BY5A 2DWRA 3ZXDA 3QLQA 4W6XA 1ZBA2 3SLIA 1OD5A 1R092 2ZMLA 2XL9A 1TME2 4Y20B 5JDBA 4AFCA 3V0BB 2GC3A 2XJVA 3IDBB 4NVPA 2PYTA 1O5UA 4DY3A 3EHKA 1POV1 2A7AA 2GDFA 3ME2A 4V1PA 5CIRA 1OI6A 2D7FA 5GKAC 5A33A 5LRRA 4QM9A 4N43A 4AVTA 4FBFA 2H0BA 3MFAA 3R4SA 4M00A 3M4FA 1U0AA 2WFF2 1QMJA 1CAXA 3R0RA 3VL9A 4QQHA 3OD4A 1Q3EA 2GC0A 2KM2A 1B35A 4YGEA 2WNUB 4HK8A 1BXHA 2R1DA 5FREA 3ACLA 4YFZA 5T5PA 1U5ZA 4J1WA 2DUOA 3J9SA 3ZFGA 3EXUA 3CO2A 2EXJA 1FNZA 3AZYA 5CBLA 1C8M2 1AYN1 3THPA 5IK5A 2YPJA 3FE5A 4RR3B 3R4DB 4CP2A 3OD0A 1HRI1 3S7EA 1GV9A 5CFDB 5BNNA 2RR11 3UKVA 4CEWC 4NWVA 1RUI2 4E4SA 4YZ1A 1WLTA 3FLRA 3PMSA 5E16A 3ZXEA 1Q43A 5DUWA 2WS92 2DCKA 1SLTA 3DPRB 2ATFA 2UWBA 4CDQC 3FFZA 2NP0A 4HMZA 3DL3A 4QGLA 2R063 4COYA 2A6XA 3SCGA 1KFUL 1WCDJ 4Q0QA 1HXS3 2VULA 4C1WA 4XDQA 1V9U1 1VALA 3X29B 2MHFA 2NQYA 4TLFA 1VAKA 1QJY2 1RUH1 4XJZA 5DUVA 1ZBA3 1H1IA 2P37A 2QCSB 4OHYA 4I02A 1CAUB 3WUCA 3FZ3A 5K7PA 1KXGA 4FPCA 1WBFA 1ALYA 2GMMA 4Q0UA 1RITA 3H3ZA 1RJ7A 3FUOA 4I2OA 5ABJA 3ZYRA 2UU8A 3JBG2 2QFEA 1CN1A 4WM7B 4YRDA 3IM0A 2ES3A 4G3YC 2Z5WA 1GZWB 1WW5A 1H8TB 2D6NA 3M3OA 3PVOA 2QUOA 2VQAA 5I0TA 3ASIA 4INDA 1KJRA 4LTAA 1DDLA 4GMP0 1JYIA 1N1SA 2R0FA 4R9DA 4ISRA 4CZSA 5D8AA 3H7JA 2ZKNA 4YVWB 3INAA 1XYPA 1QOTA 3NKGA 1FOD2 1RUG1 1C8M3 1EAH2 5J09A 1CPMA 3AZWA 2VUJA 1H4HA 2RM21 1REEA 2D3PA 3KGLA 1QJU2 3NVCA 5BV6A 1H2KA 4EWDA 1AR92 1PHMA 1PK6B 4QPIA 4XFAA 4BMBA 1D4M2 1ZRFA 2JENA 1RUI3 4FP2A 3VBFB 1RL3A 4PF5A 3KSCA 2ZHMA 2Z69A 5GLVA 4BE3A 1RMU3 2WS93 4H55A 3ENRA 3JUUA 4AEDB 4Q4V1 1M06G 1EYBA 4L11A 4YVSC 1VBC1 4S2GA 3N7LA 3WZ1A 5CG8A 1FPN1 3VBRB 3ZO0B 4AE2A 2WA3A 2JDZA 3R4UA 1XNDA 1R081 3E97A 1W6MA 4SBVA 4XFGA 1VBB2 3AMPA 1LHUA 3VZJA 4MV2A 5L7OA 4XYXA 5GALA 2I07B 3TN93 2D6OX 4XJWA 2D6LX 2GALA 3CEWA 4Y1YA 4AGRA 1V6KA 2E63A 2Z42A 2MEV1 1ZX5A 2E7QA 4X6QB 1CX4A 1G9AA 1G86A 4KL1A 4D7SA 1MEC1 5JSRA 1Q8SA 2UY9A 4N53B 5FBZA 4P9LA 2FMDA 1RUE3 1R091 1CQ9A 2O8QA 2B8MA 2YROA 4FXGB 2EALA 2VH9A 2LTNA 1Y7BA 2F6BA 3IMNA 1BKZA 1SLBA 3VHPA 2XPJA 4BIOA 4LO8A 2D5HA 1ZZ9A 5FPZA 2D6PA 5KHHA 4ISQA 1OOPA 1KFXL 1NA1A 1YI7A 1JTZX 4COVA 1CIWA 4CP1A 4KWJA 2B45X 1O4TA 2WFF1 5KXCA 2WNVA 1ND3C 4Y1XA 3IDCB 3ZYJB 2EAAA 4FP3A 4N9IA 3GF6A 2CAUA 2JECA 4AWDA 3M3CA 2X5IB 1HV1A 4RQPB 4IEZA 3MFCA 1AR82 3NV3A 2IXIA 5CFCC 1MZ6A 2WZR3 3M70A 1RUJ3 5JIAA 3AZZA 2AUYA 1RIRA 3WUDA 5DUUA 2JG9A 3FLPA 2EIGA 1ZBE3 4FVVA 3VKNA 4B7EA 4OI1A 4AGVA 2DF7A 1HRV3 2EA7A 1ND2B 1QJX2 1NXD1 5F5QA 5FPXA 1UMZA 4DRVA 2GU9A 3MF9A 1NE4A 4QM8A 2BTVC 1YFWA 1OLQA 1V6OA 3R6SA 4I01A 4R8HA 1O3SA 2B5HA 4IV3B 4IEOA 1JBCA 3AB0A 1W6OA 2HWD2 3RPQA 1IKPA 4WVWA 4DINB 1D2QA 1ZRRA 3ZFEC 5H9QA 2W52A 4H14A 1B09A 1S0JA 2XBO3 1KD7A 1QQP2 3I59B 4PIYA 5AC92 4BYYA 1QJY1 1BEV2 5C4WC 5I0RA 1C1LA 4WM8A 2HWE3 2ZGNA 4AI3A 4QPGA 1YJLA 3IBMA 5K9YA 5T52A 3UJOA 3MIBA 4LBLA 1NY72 4FPHA 3LOBA 4XF0A 4MXWA 3MPPG 4K1ZA 5FFOC 4Y1VA 2BVBA 3VBSB 3VBHA 4XBLA 3JBG1 3H50A 2IZWA 1JUIA 4K8FA 1PZ8A 3HR9A 4JGZB 3H1YA 1X8MA 4XOGA 2BFUL 4DZGA 4WV8A 2NLRA 1NCQB 3H3UA 3D0JA 2D98A 1RVF1 1AX0A 3NW4A 3U07A 3VDDC 1DQ1A 4FTSA 5GJ6A 1SQ4A 1PIV3 1QGLA 2OIIA 1YFUA 1LHWA 1YIPA 4MLOA 1TEIA 1C57A 5C9AB 2G4IA 3A0KA 2BYVE 5IK4A 1I1EA 2YV8A 1FOD1 4CDWA 4CP0A 5E88A 4CEYA 1CVNA 1QJU1 2ZZQA 2GN7A 3AZXA 1NQDA 2ZHKA 1AR91 4CYDA 1QJX3 1O3TA 2RS12 1D4M1 1O4YA 1EPWA 1OA3A 2Q0AA 2A6VA 3NV4A 2V09A 4I09A 4YZ3A 1UL9A 4R4ZA 2BGCA 1KDMA 3JZVA 1JHNA 4H7MA 1BCXA 4FQZA 2PFWA 2GNTA 1I5ZA 1NZCA 1PMIA 1VJ2A 1LOAA 4YGBA 5LEKA 5JOXA 4HKWA 5EFUA 1DQ5A 1PO22 3IPVB 1CAVA 1QHDA 1Z7S3 4E2SA 2XVGA 1VBD3 2G9GA 2YDEA 4AFDA 3RRDA 2XH6A 2MPFA 2C1FA 3JD73 1ZZ7A 2ZAAA 4FPYA 3ZFFA 4E2QA 4ZU5A 3BPZA 1OA4A 1X33A 1BEV3 2XJUA 1S2KA 2CGPA 1ZZ8A 1VBB1 3HQXA 2VW2A 4TYSA 4BQ1A 4N90A 3B7MA 3SNMA 4B29A 3PHMA 5GZFA 3ZYPA 4UW3A 4LUMA 2Y26A 4OFGA 2DFCA 5BNPC 4RS5A 4XTPA 1LHVA 5EWSA 2UYBA 1MZEA 4OI2A 3VHNA 3H9AA 4HANA 4MGYE 4UW5A 1YWKA 5DUXA 3RYKA 1RUOA 2D43A 4P9GA 2VQ0A 1YJKA 4HL0A 4QQLA 4XTMA 4YW2A 1JW6A 3SCFA 1PNFA 4IEUA 5J37A 1PM7A 3TNPB 2YXSA 4AVVA 2XLGA 1DHKB 2NZ9A 2JX9A 2ZX2A 2HWB2 3OGGA 2PAEA 1VLNA 5J98B 5I93A 1R1A3 3ECQA 4IL7A 1SLAA 2W68A 3THTA 4K6BA 3L2YA 1PGL2 1B35C 1OQEA 1X36A 2ZGQA 1NYWA 4PDWA 4QPGB 3WV6A 3I2DA 1BMV1 3MYXA 1AXKA 3FWEA 1AR81 2VVFA 3ZXFA 2JG8A 4NO4A 3T1LA 1IHMA 1I3HA 2XJPA 1VAVA 1COV2 4YSFA 2I74A 2BVVA 2HEYF 4CDUC 4COWA 1N3OA 4DS0A 1LU2A 2H6BA 1J3RA 1WW6A 3JCIA 1U5IA 4LO6B 2QNKA 1PO23 1HRI2 2IXJA 5BNOA 1XNCA 4WVZA 4META 2WQ4A 3FMGA 1TMF3 3ROUA 3MW4A 3QH7A 4YZ5A 3TB0A 3RZZA 4D94A 5FOJB 3WP6A 3AYDA 1BVVA 3B5LB 3PMEA 1X82A 4LBOA 4P9JA 4Y20A 3TNQA 3KM5A 1H0BA 3QBQA 4KQ7A 3V0BA 1IS3A 1RUF2 2GC2A 5J36A 2OYZA 1HLCA 1LCLA 2HWD1 1YLLA 5HCBA 4HBNA 1V9U2 4Z82A 2E9QA 2BUKA 1RHI2 3WW4A 1H9PA 1QQP1 4PQ9A 4QQOA 5AC91 1V6MA 4LBJA 5EXOA 5T3NA 4L97A 5EJ3A 5H9RA 4F3JA 1RGSA 1VAMA 4LBNA 3WCSA 4LBQB 3DN7A 2VY0A 2WNUA 1NY71 1G7YA 3A4UA 4EN0A 5FTTC 1HKDA 1POV3 2BWCA 5KC5A 1ZRDA 1VB2A 4CTEA 4FAGA 3VUOA 3O0WA 2D6MA 5EYYA 5I91A 4B4RA 3ZMOA 2DUPA 1MS5A 3ZXLA 3IN9A 5JOYA 4DOUA 2XJSA 4RL7A 4LBMA 2VU9A 3W58A 4OI0A 4RR3A 1OLRA 4AI2A 2B7YA 5CFDA 1HV0A 3NV2A 4GIQA 1K5MA 1UKRA 3WD5A 1YNAA 2ZGOA 4XIKA 1WW4A 3T2TA 2OUHA 4DY5A 3DPRA 4AQ6