1NXWA

Micarec ph 5.1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding response regulator
publication title Crystal structure of the response regulator 02 receiver domain, the essential YycF two-component system of Streptococcus pneumoniae in both complexed and native states.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Signaling protein
total genus 40
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nxwA00
1U8TA 1ZH2A 1Z18A 3LMKA 1EHCA 3L6UA 4MYRA 5BRJA 5JS2A 2Q5CA 4MR7A 4RK6A 1F51E 1TLFA 2GX6A 3OMXA 4Z9AA 5CNMA 4RK4A 1Z26A 3OMWA 4G0XA 4MR8B 3CTPA 2JVIA 4ZMRA 2L17A 1JFVA 5T3YA 4YGXB 4MR8A 1DBWA 4B09A 3CKMA 1SXHA 2RGYA 3CLKA 3CRNA 3EQZA 1HEYA 1L5ZA 5HKOA 1JH9A 2IPLA 1NY5A 1DZ3A 1NXSA 3C3MA 4OBBA 4WXEA 4YWHA 4KREA 2CHEA 3K4HA 4KZKA 3CU5A 4LZLA 1LBIA 3KTOA 2B1JA 5DCLA 5CNKA 4P1ZA 4E7OA 4WXMA 4MQFA 4ZJPA 1NTRA 4RWEA 1DBQA 3M9XA 3QX9A 1JBEA 5TPWB 4H3KB 1JL3A 1J56A 2A9PA 5FBKA 1ZN2A 3HUTA 5PNTA 3LOPA 2IPAB 4G97A 3LKBA 4WT7A 4Z4IA 2JBAB 1KRWA 3HCWA 3LTEA 4RV5A 1KGSA 1MB3A 2MYPA 5EWLB 2JBAA 1DRJA 4JAVC 4HNQA 1RPJA 3QELB 2FEKA 3CG0A 4MGEA 3VNBA 1PNTA 3C6QA 2E4XA 5EWLA 3KJXA 3Q7RA 4YO7A 3RVSA 2A9RA 4PYRA 1ZHHA 2QZJA 1M5TA 4IRXA 4MR7B 1Y1LA 1DG9A 3MMNA 1EWVA 1CHNA 1M2FA 2MSLA 1DP4A 5JNRA 2PUGA 2IPNA 2ZAYA 1GUBA 4JB2A 1NXVA 4EYGA 1JHZA 4NCBA 2GI4A 2W42A 5B3JA 3H6HA 1D4ZA 3LUKA 4L4UA 4OLBA 5BQ3A 1NATA 1T34A 2QV0A 3GT7A 5C5CA 4RZSA 3T6KA 3RVQA 5HM6A 5F64A 4TMYA 5C5EA 3H1FA 2P9HA 3JVDA 2F8TA 4KFCA 3CS3A 1NXXA 4RSMA 3VNAA 2PUEA 5B3JC 4N0QA 1I3CA 2FKAA 4XXHA 5TQ2B 1DJMA 2E4WA 4F3TA 1H9CA 1VKRA 2GBPA 4KMRA 4IGAA 4RU1A 2AYZA 5TQ2A 2WRZA 1RXEA 1LJUA 5ED4A 2WB4A 4ML3A 4MLCA 3KKEA 2F8SA 2WY2D 3DLHA 4KQ9A 2IPMA 3HVRA 3KS9A 3KHTA 1Z2DA 4JOQA 3HZHA 2JB9A 3N53A 1APBA 4N41A 5JS1A 4Z4HA 3HEBA 5JNTA 1K66A 3KLNA 1XHFA 1YS6A 1EAYA 3H75A 4LDAA 3GV0A 4Q6BA 4IF4A 3A0RB 4RK0A 3TD9A 2MYNA 3FFXA 4Z4CA 5JNSA 5KWSA 4EGSA 1NXOA 1UDRA 1PEYA 3SAJA 2FQWA 3URMA 3T38A 5I4CA 2R47A 4LE1A 3HDVA 4UHJA 4MRMB 3RVRA 3RVPA 2FQYA 4N03A 4MRMA 2PUFA 1VPWA 2FEPA 2LPMA 4RK5A 5T7BA 1JLKA 4OLAA 4F11A 1QO0D 9ABPA 3HK2A 3SQNA 1U0SY 3NNDA 1RZRA 1FSPA 4ETNA 4MR9B 2OQRA 4D6YA 4Q6WA 2PKXA 3MIZA 2M1ZA 3SM9A 3QK7A 1LBHA 3B2NA 4LE0A 5FWYB 3H5IA 2NT3A 4MR9A 3FFTA 5FWYA 2V0NA 3GBPA 3H5OA 1A04A 2ZWMA 3DBIA 3NHMA 3O2SB 4EVQA 1ZGGA 6CHYA 2CD7A 4M88A 1ABEA 3JPYA 3FMVA 4KK3A 4RDCA 3RVLA 6ABPA 4WUTA 4XFKA 3RH0A 3MM4A 1ZH4A 2FLKA 2QW1A 1BDHA 2VUIB 4HYEA 4HNRA 4KRFA 5GQSA 3DGEC 1BVHA 2AYXA 1Z25A 3Q7SA 3ROTA 1A2OA 4ETIA 1YVUA 2NZVG 3UKJA 4RY9A 3LUAA 4RK7A 2DRIA 4W5OA 2JCGA 3M9WA 3SG0A 3O21A 3F7NA 4MQFB 2LBPA 4PICA 5TPZD 2QR3A 4DQDA 3QEKA 4IMJB 1YK1A 3FGZA 2FMKA 2HQOA 3HV2A 4S05A 1YMVA 4EY3A 1Z12A 1NXPA 1ISSA 3UUGA 3IP7A 1USIA 3KG2A 4MS3B 1LJLA 3HJFA 3O2QB 4H3HB 2QXYA 3D8UA 1DC8A 1QNLA 1QP0A 4MS3A 4PEVA 2FEWB 1IIBA 2NUBA 5IUKC 3RVNA 1BA2A 1ZGZA 2LUOA 3LKVA 2M98A 2PE5A 3BRSA 3CZCA 4KPYA 3BILA 4XLTA 4G0MA 2PUDA 4PZ0A 2RDMA 3RVJA 4FE4A 3F73A 4KVFA 3N0WA 3IDOA 4L85A 1MAVA 5JNUA 1YIOA 1Z13A 1YS7A 4WWHA 1SXGA 2RJNA 1FFSA 2FVYA 4NV3A 4XARA 1XHEA 2PJUA 4O1HA 2FW0A 4MPTA 3IPCA 4MS1B 4QYMA 1BDIA 5IULC 4O5AA 3EGCA 3O2JA 2QU7A 4MS1A 4NICA 3ILYA 4QPJC 3F6CA 1FFWA 3EULA 3K9CA 3N75A 3OO1A 3QX8A 5IC5A 1QPZA 4GPAA 2MSKA 3UK0A 3A0UA 2NZUG 5IBQA 3H1GA 4PE5B 1CEYA 4LDZA 4D74A 3NNNA 4LRQA 2MYTA 3O74A 3Q41A 5EWMB 3H5TA 2FLWA 2FTKE 3OLXA 1ZY2A 2KYRA 3MQ4A 3I45A 4GNRA 2WJWA 5EWMA 8ABPA 2OENG 2R4QA 3RVMA 1FQWA 1MB0A 3SY8A 4G0ZA 2JVJA 2ID9A 3G85A 1ABFA 5TQJA 2I6FA 4G0YA 5JNVA 4Y9TA 1P6QA 5KQPA 1ZVVA 1FFGA 3CHYA 3Q15C 3FFWA 4IILA 4N47A 4OG2A 1M2EA 1RZRD 2ID7A 3EDCA 4FB4A 1VRVA 5IEBA 4KV7A 4YS6A 1PEAA 5DTEA 3RVKA 4FE7A 1QQAA 3OO0A 1KRXA 3BREA 3HS3A 5TQ0B 1D2AA 4XAQA 5CHYA 5KQGA 5TQ0A 2NT4A 4E7PA 4EYOA 1GCGA 1JYFA 1SRRA 3QLUA 3JS5A 3RVOA 1JDNA 5BRAA 1RNLA 1JFTA 2H3HA 4ZPJA 4YCSA 4RS3A 3I09A 4KQCA 1URPA 1K68A 3W9SA 2FQXA 3QLVA 1Z2EA 2BGGA 3OM0A 1SD5A 2VYCA 3CG4A 2WWVD 2QSJA 3QLUC 5IUNC 3H5VA 3E3MA 3N0XA 5JNWA 3OM1A 3KCNA 1QKKA 4DN6A 2E4VA 4JB0A 2N9UA 1SXIA 3N6VA 1C4WA 3O1HB 5KI6A 3NHZA 3OLVA 4G0QA 4OTZA 4RY0A 1QQBA 1A0OA 4EYKA 1YTUA 3QLVC 4RY8A 3OLYA 3RQIA 2E4UA 3L49A 1PUXA 1MVOA 2LP4Y 3JTEA 4XASA 3C3WA 1JFSA 1TM2A 4F12A 4MLDA 1E6LA 2R48A 2H0AA 1DRKA 1JF8A 3N0RA 5EWJB 4Z9BA 1YK0A 4MS4B 2P4UA 1L5YA 2RJOA 5EWJA 4W5TA 2E4YA 2PL1A 3DLBA 2CHFA 4MS4A 1OXKB 5DGCA 5CNIA 2VK2A 5KQLA 1P6UA 4TLLB 2O20A 4O1IA 1F4VA 1P2FA 5KC9A 3H5LA 3HSYA 4YR7A 4YLEA 3TO5A 3G1WA 2PMCA 1JYEA 3P9YA 7ABPA 1BAPA 1QO0A 1QP4A 3O1JC 1EWTA 3TX6A 4Z4GA 3LUCA 5CNJA 1D1QA 1GLGA 1W9HA 3ILHA 4CBVA 1AB5A 3QEMB 1OXBB 4NCAA 1EFAA 1R8JA 4G0OA 3QEMA 1U04A 3GWGA 3MA0A 3DZDA 1NXWA 4JA2A 4G86A 5FWXB 3JY6A 1Z17A 4LX8A 2QVGA 4TN5A 2FMFA 3MYYA 3O75A 5KQMA 3I5AA 5FWXA 3JPWA 3F6PA 4RKQA 3IP6A 3EAFA 1M5UA 3O1IC 5DKFA 3ROFA 4ETMA 3GBVA 2PLNA 1QP7A 2IDMA 1EWKA 1U2PA 2PUCA 3BBLA 3LUDA 5GOTA 4IMIB 5FBHA 2GWRA 2MSWA 1DBPA 1USGA 5BR1A 4RK1A 2VUHB 3LFTA 1RXIA 5TPWA 1DCKA 3CFYA 3HXMA 2IYNA 3I42A 3OQMA 2FMHA 4ZYLA 3KSMA 3Q9SA 2YHAA 4MQEB 4OATA 3OQNA 1D5WA 4RXUA 2R25B 4MQEA 5TPZA 1TMYA 3QELA 5IEJA 4KK4A 3H1EA 2GKGA 2FN9A 4MAAA 1CYEA 4YV7A 4ZMSA 4KNYA 1NXTA 1QMPA 3A10A 2PL9A 3T8YA 3OQOA 2E4ZA 2L2QA 1USKA 4JASB 3NNSA 4LE2A 4EYQA 2JVKA 2HPHA 1S8NA 2LIVA 1VLZA 3EQ2A 3M6MD 4TLMB 1ISRA 3DGFC 4F8JA 2HJ9A 2FSPA 1DCMA 1E6MA 4RKRA 4UHKA 4Z99A 3T95A 4RXTA 4Z4FA 2X7XA 4N0PA 2A9QA 4H60A 3KYIB 1DCFA 3SNKA 3HM9A 5KC8A 1WETA 4YRZA 4YP9A 2QVCA 3HO1A 3BRQA 1ZDMA 4G0PA 1W25A 3TB6A 4N76A 3GRCA 3MF4A 2L19A 1GUDA 2WMYA 1JWLA 3CZ5A 1ZESA 3EJWA 3C3KA 3LUHA 5DLEA 5ABPA 3JVIA 3GA5A 1D1PA 3IP5A 5IX8A 4D6XA 4W5RA 3QLTA 4QICA 1TVMA 1PNRA 2B4AA 3OLZA 2CWDA 2A9OA 3GL9A 4W5QA 5D2CA 3EODA 1Z15A 4EVSA 2TMYA 4HNSA 4F06A 2MYUA 1JX6A 2IOYA 3E61A 3NBMA 1GCAA 2XDYA 3IPAA 4WZZA 1B00A 3TMYA 2HSGA 3HDGA 5TE9A 2HQRA 3D02A 3C97A 1C0EA 2FMIA 4EUKA 1ZAYA 2J48A 2HQBA 5HSGA 3H5WA 4QYWA 3GYBA 5HQJA 5E3JA 4S04A 1U2QA 1P8AA 3H6GA 2L18A 3LUGA 1LK0A 3R0JA 2WJAA 2PUBA 1BDJA 4RXMA 2IKSA 2JK1A 3Q7TA 3N8IA 1YMUA 2FXIA 4P98A 4EVRA 2PAFA 3FDFA 4Z0NA 3CNBA 1E6KA 5IUJC 2JRLA 1Z16A 4JP1A 4NQRA 2PUAA 2YHBA 3KYJB 3LUJA 1DC7A 1E2BA 1XWWA 1JDPA 1MIHA 4Z4EA 3KLOA 1KMIY 3OLWA 4Q7EA 4DADA 1AB6A 3A3KA 1PHRA 1TJYA 1ZITA 3IP9A 4W5NA 3S99A 3HUUA 3LUFA 2FN8A
chains in the Genus database with same CATH superfamily
4Q1FA 4NOKA 4HWSA 3CLSD 3L6UA 3BOSA 3JD0A 4JBLA 3EEYA 5KCMA 3VSDA 4EHKA 2AH5A 4C4RA 1GKUB 2AHOA 4IFEA 2ZRLA 5I4KA 1TT7A 4CLEA 2AZMA 1WSWA 2PQ6A 4Q01A 3VI4B 1BFKA 4PAGA 2DSNA 4PBRA 5CX1A 5DYYA 2HPZA 4YGXB 1GPMA 2V6JA 1OE0A 4XCVA 2B35A 3RRNA 3IVAA 3H17A 4NVRA 2ERYA 2PZAA 2W2VA 4F7DA 4NESA 5E95A 2CHEA 1XCBA 1CQIA 3DKVA 3CX3A 3I2KA 4IW3B 4LZLA 4TTAA 3OESA 2OC9A 3AF1A 2W6JA 4P4SA 2UZ4A 2ID4A 3IUPA 3SD7A 1QHSA 5BMVF 1JEDA 2APJA 2P2CA 1B8UA 3WL8A 1YTLA 3I39X 1PFGA 1IG3A 5HJ7A 4OM7A 1OAKA 3ZGYA 2WTUA 3TM4A 4OI2A 3D8SA 1E0KA 3DKKA 3PFBA 3EYWA 2BOVA 1KQPA 3ZY2A 4KKVA 2DFKB 4GI1A 3G79A 4C0WA 3M4ZA 2CSXA 4V3BA 2JDIA 3GGPA 4IIGA 1U0TA 1P74A 4N7RA 2QY9A 1BFUA 3O6VA 5IJWA 3QELB 3ADKA 2HMSA 1CXZA 1PNTA 2SKEA 1L3CA 1IC6A 5ED0A 3DZBA 3E4DA 3ZHRA 2ZXUA 3UANA 2GVDC 1W96A 2OBXA 1C1YA 2XADA 3DZFA 1LS6A 1IAVA 3R0QA 4KGVA 3ZWWA 5BO5A 4EWLA 1DP4A 4UXHA 1IEXA 2OK7A 4FR0A 1W5EA 4XB6B 4GS5A 4NARA 1PX2A 4WKPA 5EE3A 4PHHA 3VGPA 4KMSA 1KE1A 3X43A 1Y6JA 1N2OA 5C5CA 2XQKA 3H1PA 1K92A 4RZSA 4XPZA 4BVLA 1FFAA 2WABA 1IQUA 2P9HA 3BGSA 3MINB 4OQYA 3W5DA 4RD2A 1XAHA 2R3SA 3S5UA 4YCMA 4E2YA 5AW1A 3GEIA 4HDKA 2C3OA 2R97A 4K46A 4KFCA 1E5TA 2A88A 3OQVA 4RSMA 1PG0A 3LZ6A 1ACJA 2D7DA 2GVZC 2XVZA 2ARKA 1H9CA 4UM9B 1JECA 3MUNA 3OA0A 5B64A 3K96A 3BXHA 3MWDB 2Y0PA 1HLFA 1YRHA 3DAYA 4CM7A 1OTXA 2GPJA 2HN9A 3QSGA 4XI9A 1G8FA 1E3JA 1RLTA 1QFMA 1VHTA 4ISCA 2X15A 1NVDA 2P1ZA 4Q03A 4QX6A 2REOA 2VWHA 3JQGA 1XXLA 2QV7A 3WLFA 2FXVA 3FB1A 2VZ9A 4CL0A 1AKWA 3V46A 5A62A 4RK0A 4IJVA 4QQNA 4I4IA 5FI3A 3ZGLA 1G4UR 4JIMA 2VPTA 4YROA 2Y66A 4Y67A 5BT9A 1A69A 4DLUA 2EIHA 1JRLA 4R5HA 2EC5A 1TK9A 1S8AA 3W5BA 3ROEA 2NVOA 5B3LA 1J2UA 4L3OA 2A9FA 5DULA 3DFZA 5DYIA 1R0XA 4URZR 1ZI9A 4CUKA 1R37A 3AFHA 2GAAA 4D46A 3GPLA 1AO0A 2LDXA 3AH8A 4ZRMA 4F4IA 3EH2A 1KC3A 2WNIA 4MV1A 3AUYA 4RSGA 5EQDA 5H0IA 5HFNA 2PGIA 1Z3IX 3T3HA 5GZ3A 3E8XA 1A1SA 2VYVA 3F67A 4ZEMA 2XRZA 3U3DA 2BMVA 4NFLA 2PNFA 4X24A 5LNK1 4M1TA 4B6GA 2OQRA 1DHRA 4J7XA 3MIZA 1KNQA 1S7GA 1FTGA 3I01M 4CMKA 1KORA 4QECA 3H5IA 5I5EA 2AN9A 1Z4OA 4MROA 5CBKA 5L6LB 5IJ0B 1LNZA 4AJKA 4B4UA 3HCOA 2JFOA 3MSXA 1N7GA 3ND9A 2XCSB 1L3BA 2AMLA 3GMTA 2CHVA 3N86A 1NG9A 1XGKA 2JAXA 3D1VA 1UK6A 3SMVA 4ATNA 1P73A 5CLFA 2ONYA 3GT0A 3E3OA 1PT5A 2Y2VA 4XRGA 2KBEA 1OXTA 1JAHA 1WNFA 2VUIB 3HJBA 4GOJA 4GZ5A 4HLUC 4JKOA 1YD7A 5COAA 3UMVA 2NAFA 2XMPA 3L0DA 3Q7SA 5LWQA 5AVVA 4BO5A 3JWEA 1V7ZA 3O2NA 3M6LA 2P2NA 3R44A 3RSGA 2H85A 3W8FA 4Y0AA 5EUBA 2BT4A 2NLOA 3KTAA 3T5MA 1N3IA 2PN1A 2V3VA 1G55A 2XUIA 3FJ1A 3IV6A 3ER9A 3JQPA 2ETVA 5F12A 5JCOC 1YVRA 2VKQA 5D5PA 3D4BA 2QR2A 1B2RA 3L8CA 4OEHA 4MVJH 4BWYA 3AR4A 4O2AA 1BMQA 4XOIA 1EH5A 2C3PA 5JH7A 2ZIUB 5FBLB 1H5NA 2AJCA 3WDLA 1M7BA 1L6RA 1O6FA 2HO4A 3WDMA 4H16A 3WSTA 4BUJA 5I6DA 5L7WA 1H3FA 2HCTA 4CKZA 1LJLA 3SBDA 4YMLA 1L7PA 5AVTA 1E7QA 1RHMA 4XIIA 1QNLA 3T34A 1LRLA 3EUFA 4FS3A 2IJGX 3ENQA 3KT3A 5CPFA 4W5HA 1W30A 2VNHA 5JO0A 2LUOA 2XB9A 3P2JA 2JLVA 5JJLA 1EFPB 2JCXA 1NUHA 1Z7BA 4GBED 4FX2A 4DM7A 3MXOA 4BAGA 4JYBA 4DIOA 4ZO8A 1XVTA 3IEXA 2P9YA 3ODPA 4M1QA 4AYXA 4YUVA 4M1EA 3HCDA 4AXBA 5BT8A 4FE4A 2VOEA 1SC1A 1Q0ZA 1T1RA 2J0UA 3IDOA 2Y92A 1FOEB 1UJMA 1WKVA 2VTKA 2SKDA 3P0FA 4GSYA 4LRWA 5B3AA 3VI3B 1WB5A 2GKOA 4QPCA 4JI3B 3HUFA 2DH5A 3L8HA 2C4VA 1UFOA 4XX1A 3MT9A 4Z1MA 1H85A 2GEUA 1QAOA 4I5FA 4MS1B 3RS2A 2YJGA 121PA 1SY7A 3LGAA 3NJ4A 4ND1A 2CNDA 2I4TA 4RA6A 3MJVA 2IUEA 1Y81A 1JQ5A 1KJWA 3GAMA 2ZAIA 3D6AA 4QOGA 3U81A 2O14A 3OCWA 1FSZA 3R3UA 3UHOA 3MMZA 3A4IA 5BWBA 2BR4A 3BK2A 2E87A 3IPXA 4HQ6A 4XQGA 2IH5A 2KMLA 3H5TA 2FLWA 2JRCA 4DMGA 1FBNA 4EGJA 1EK5A 4YV0A 2AVNA 4X54A 1WCIB 3T7EA 9ATCA 4AJNA 5JD5A 4QBFA 5EWMA 1U63A 2QN7A 2M32A 5AK3A 1T2EA 3PPIA 1NQAO 2WMNB 3EPPA 1YFZA 2RHDA 1NBMD 5BSFA 1X7WB 1AT1A 3DBLB 4FYJA 1TZKA 4Q7LA 3DZHA 2BF4A 4IDEA 4OAPA 3K70D 3C3JA 4YI5A 4C29A 2ORIA 2F67A 1GPLA 4G37A 3U1TA 1XCMA 2EFDB 1IK4A 4NE9A 2X6QA 3WICA 1Y6GA 1YUNA 2HEGA 2VF4X 1PVDA 2J30A 3IDAA 5KS2A 3UGJA 5HTKA 5GY7A 5AI9A 3QVWA 2PX3A 3UJPA 3ZE7A 4KWIA 2XMBA 3KT0A 2W8ZA 3RS3A 4LDPA 4HTFA 1IXZA 3UC9A 2AOUA 4JBNA 3V8MA 1GLNA 1H8EA 4LJ4A 4C4YA 4R40A 4D4LA 5LD2C 5C80A 1VRWA 4EGCB 2J6BA 3LQQA 3OIUA 7AT1A 2DWPA 2FFQA 1SBCA 2WF7A 4BZQA 2CXUA 3CLVA 4OK6A 4UBJA 5I9TA 3AUKA 1IMOA 1NMYA 4NBTA 2C4NA 2FUEA 3OX2A 2ZQZA 4CTJA 4MCHA 3ZLUA 1Q1BA 1E9SA 3AHGA 3DEAA 4RPLA 1OLUA 4I4TF 4UXJA 1FMTA 1OU4A 4D2IA 5AJVB 3OQBA 5DI3B 5FYQA 3ZHUA 5AJWA 1K89A 2ATCA 5IVDA 4PGAA 1JG1A 1E2LA 2OD9A 4L74A 3R6GA 3UMGA 4EB6A 4LJAA 3KXIA 1ZK0A 1BD4A 2TS1A 2Z4RA 3DULA 3HYSA 4GI2A 3WLPA 4G89A 1TOAA 2V6IA 4G0QA 1I5EA 5JW6A 2B1RA 2CDAA 3D7RA 1OFTA 1E9EA 2C7GA 1Y1TA 3FRIA 1H2HA 4W8HA 3TLYA 1XU9A 3ONVA 5K05A 1YDEA 4UASA 3IAXA 2VZEA 5E9AA 4XWWA 1P7YA 5F1KA 3DKPA 1P5HA 3OPNA 2QL5A 4RH1A 2P4UA 4JGGA 2I80A 2HCJB 2PL1A 4FYHA 3UOGA 1NVGA 2J3DA 4KN8A 4MS4A 2Z4SA 4RVHA 2QN9A 5K0CA 1RXSA 2NU7B 1S1CA 2JLCA 1IHDA 1R7RA 5CNIA 5DMXA 3V1MA 3TW6A 4TLLB 5DP1A 1NLYA 3FWYA 3BE8A 5JFTA 4OLJA 3IAFA 1J8MF 2HV9A 1QAQA 3H5LA 4Z8XA 4YR7A 4ZIRB 3G1WA 4ZMBA 2YBEA 2EJUA 1FDTA 2HDHA 7ABPA 2BEWA 2P9BA 3H2BA 1B0PA 5CB4F 4QGBA 2AEJA 1NFQA 3ZIAD 1BCRA 3G0IA 4UMFA 4L4YA 1E1QA 1MAHA 1X1SA 2J6CA 4MJ7A 1TQ8A 4V39A 2H4YA 1ZK1A 3FTPA 3PD0A 3I8XA 3HB5X 3H1BA 2G25A 4DMHA 1CJVC 2AX4A 2VJOA 3MA0A 5FKJA 5FUBA 3GD5A 3GXBA 2ERCA 1Z17A 2H1VA 1KO7A 1XB2A 4D4KA 1VCOA 1FUYB 1KYIA 4FFLA 1GVHA 3BSSA 3IJ5A 1FNSA 4M1ZA 1A9YA 3STTA 5K45A 9LDBA 3GLGA 5LQJA 4HAZA 3ROFA 4HATA 2ZJ0A 3DZ8A 1C81A 1HF3A 2FVXA 3WRXC 3KQYA 1KP2A 1QGUB 3QVJA 5HOEA 3RDPA 1T6YA 4Q1CA 3ZQJA 3NRJA 5A1TA 3CZAA 1ECGA 1G2QA 2H9AA 3AR6A 1VBMA 3I4FA 1STOA 3A2NA 5HF6A 1UBKS 2CXHA 4JC5A 4M9ZA 3ROMA 3OQMA 4K6CA 3VAYA 2F3UA 1TCVA 1DZIA 4W7SA 3WL4A 3H3FA 2CXRA 1QZTA 4DYHA 1Q0TA 1KFJB 4DDHA 1FSSA 3IOCA 4RE5A 1UAYA 5K0NA 3UMSA 4I50F 1TMYA 3JQBA 2ZIEA 2XYRA 3VZBA 3CINA 4RETA 1H2RS 2GGSA 2W2KA 1SMKA 2D0PB 2LE0A 3AGQA 3F8WA 1H05A 3PGA1 3HACA 1QUFA 4N4AA 4YXFA 1KDTA 1JDSA 1QMPA 3F9CA 3GFPA 4JXXA 3UUWA 2NU6B 2BE9A 4E1VA 5AXAA 3BE6A 1Q77A 1M3SA 1UODA 4JUCA 4PVCA 5GGYA 4Y9RA 2XTJA 4LFCB 1QHXA 3M1YA 1QB7A 4UU7A 3VPAA 4CWAA 5ARBA 1UC9A 1HE2A 2H4HA 3P97A 1TADA 4GLOA 2NO6A 4IIHA 2FFHA 5GMOA 3VVMA 2BEUA 3OAAA 3EGOA 4JUIA 2D1TA 4TZKA 5BQOA 1W2GA 3NWPA 1D2GA 1EX7A 3CLTD 3K0AA 1ZM9A 2QAGC 1H5QA 2I7DA 5LQDA 3D0RA 4LKRA 3DO8A 4KN9S 5FJIA 3PU6A 2YVLA 5HF8A 3ZUGA 4QFMA 3OSUA 4OYLA 2OQIA 1YS9A 3KDSE 5DK4A 3A4VA 1KH1A 4YQZA 2HF2A 3EUWA 4EPXA 5BWOA 4WY8A 4C7MA 1F14A 2FI1A 1X1QA 3C8DA 3CRVA 4CKWB 4JOSA 3ZWBA 1V3TA 4R7GA 3RVDA 2XGGA 1X1CA 2FZWA 3MMPA 5BN4A 2PUHA 3GA5A 1VI5A 2I2FA 3W9YA 2VK4A 2H4WA 2JASA 4JT4A 3NKLA 3Q5GA 2G67A 3PVZA 4AN1A 4FDAA 3VYSB 1DWOA 4S1TA 2V7PA 2GBLA 3OLZA 1NSTA 1WCXA 4K9KA 3GLFB 1FP6A 2CNWD 2AJ8A 2I3ZA 4QOFA 3DW3X 3GMSA 3UCEA 1KMQA 4Q48A 4YIHA 2ZVDA 2QT1A 2O2HA 2BRUC 3DV0A 2JBHA 3N2NA 4R3WA 3TMAA 1P2VA 3S55A 4HH1A 2BSXA 4A82A 3QMMA 2NZ8A 5D3QA 5DYGA 3P71T 4ZAWA 1UH5A 1YV9A 3CLUC 1DARA 4K5QA 4UEJA 3VU3A 3G59A 4W9RA 4E5NA 2OC4A 1WE2A 2HRDA 1L8OA 3AHCA 4P98A 5J23A 4ZAVA 3KVRA 1E6KA 5CCDA 4Y1EA 4B6SA 1GRCA 1Z16A 4XQ0A 1M1NB 4CMEC 1ZMTA 1TUEA 1RDFA 4NQRA 5KJCA 1LDEA 1QZXA 3ENVA 3WNDA 4GKBA 1CNEA 2CFSA 4I08A 5A7GA 3GCWA 3CUWA 5ALMA 1DDIA 4DZRA 1PHRA 5FUQA 4W5NA 2HMTA 2PA0A 1IY0A 2CL6X 2E1PA 2Q8PA 3DMTA 4FI3C 5LP6B 2ZJOA 3KBOA 1LLCA 4UCWA 3E9RA 5FPKA 3E9YA 4Q18A 4KR7A 2W70A 3D2BA 3HZZA 3D6JA 1JIKA 1N5MA 4ND2A 5H7XA 3QNWA 4WKCA 5A4FS 4G41A 1LD3A 1DRWA 1JAXA 1DWQA 5J58A 4KP7A 1ULTA 1YCGA 1Z29A 3JALA 3PUVA 5L4SA 2YYSA 3C3YA 1J0BA 1Q83A 2Q5JA 1G3UA 1DBWA 2HIAA 5EJFA 3SBXA 4H1VA 1SXHA 5M5BA 4JVNA 3U4HA 5B7NA 1ECPA 2JAUA 2JJ8A 3OF3A 1VPDA 3EGXA 2PQMA 3WIEA 1V5WA 3TLEA 4RO0A 4UTNA 3JQAD 4OAQA 1DIBA 1EVZA 2HU5A 3RAPR 1VL0A 2BELA 4UBKA 4YBZA 5DCLA 4D9FA 1LI5A 2JJ2D 1VE5A 4ZV9A 3ZGNA 1NTRA 3EC1A 1D04A 1L8LA 1IZ7A 1WMEA 2VCHA 3G2QA 3O8QA 3SQDA 1JBEA 3EZ7A 1Z36A 2EX4A 3ZU2A 3OZAA 1EQAA 3I05A 1KZGB 3N2YA 4V24A 4B3TB 4CCAA 3E9MA 2ZIXB 3ETGA 2IKQA 3QUSA 3KQWA 4XOUA 2YOHA 2W9XA 1MW9X 3FJYA 3FLEA 1RLUA 1N3LA 4WZAA 5BSRA 4G0VA 5DT9A 2F9MA 2JIZD 3CC8A 2C1XA 2QIPA 4B3XA 2C95A 3KKNA 3EPLA 1I8TA 3AG5A 3B52X 4I4NA 1RC1A 2BMFA 3VC3A 2JKYA 1VLQA 3BWDD 4TS1A 3R0VA 3KJGA 3M4XA 2HHHB 4WESA 1EMDA 3IOYA 1N5DA 2HOQA 1Y1LA 2FSFA 2JKZA 2NU9A 3BWYA 2I1QA 4EB3A 5TX7A 4E0BA 1EFDN 2PKQO 3SZMA 3HZRA 3TN7A 5YASA 2ODPA 5TV2A 2OV6A 5CDFE 1U81A 4WVFA 1R16A 1KK0A 5EYPB 2LRHA 3BTUA 4G5YA 3H6HA 2CC2A 2XRFA 4PAMA 5LA6B 5EINA 2OSVA 3LA6A 3BB1A 3KJNA 3DMYA 2X7JA 4QXPA 1P7VA 2ZS8A 1GZVA 1U2RA 4DCOA 4ALMA 2AOTA 2HMUA 2B8JA 2CFCA 5ETJA 1M5RA 1DINA 1XFDA 3RG8A 1QHFA 3IDSA 1FX1A 4DLRA 3W8DA 1DJMA 1V5IA 1LWOA 1VMEA 2G06A 1JDZA 5BSGA 4KIUA 1AZTA 2EG9A 4EF4A 1VRCA 2BMWA 5IAJA 1ID1A 4JLVA 3DF7A 3OZXA 5BV0A 4ZOLA 1PFVA 1X1EA 1O6CA 1J09A 1FJXA 2ZYRA 5KX5F 2K7ZA 2CLSA 3W06A 3QPDA 4RJLA 3IVGA 1BG6A 4BYGA 3DAGA 1FMFA 2JB9A 2CUNA 2JLUA 1CRQA 4I46A 2VT6A 5EPUA 4PPNA 2QTFA 4W5WA 3ZV5A 3EF0A 3ZW8A 4NWIA 4B3BA 5AHXA 5K8LA 5I01A 4ITUA 3X1DA 1YB6A 4MQLA 4JSRA 4RJTA 5AVYA 2N46A 2R8PA 4GLLA 5BNTA 3Q3JB 4KFSA 5TS2A 1OT5A 3O5AA 1ELOA 2YNMD 3QBDA 5TEWA 2WWFA 4KPUB 1JIVA 4K9PA 2ZPUA 1FUEA 2R47A 2WSSA 4X97A 1LX6A 3IULA 2FMUA 2QBYB 4QOSA 2HTEA 2RG7A 4W99A 3W34A 1HT3A 1KSJA 4MRMA 4BKQA 1FRNA 1U3UA 2DPYA 1R9GA 2ZPTX 5T64A 5FNVA 1TNDA 5AI5A 4RA9B 1HFJA 5DOZA 4LG1A 2PYDA 4R8RA 2WIFA 3L8FA 5DBIA 4ETNA 3DTYA 2XT9A 2QMHA 3F4BA 5HXAA 4QZVA 1LBHA 4CM3A 3KOUA 4WFKA 3AHIA 1CE8A 1ODSA 3D4OA 3KYCB 4URWR 3C87A 1UPXA 4KWEA 2C31A 4KN5A 5HS6A 5D3KA 4S0XA 3I9FA 5A4AA 5A2GA 2YCLA 1AK9A 2IY9A 3NYRA 3V7WA 5JCPA 3ZLJA 1K5HA 3MTQA 3GEDA 2A0WA 4MVYA 2B20A 1FTSA 1YASA 2ZR0A 3QBVA 4WEQA 6ABPA 2IZZA 4L4SA 3TZHA 3PZRA 3OX1A 3EMVA 2G8NA 2YASA 3AM4A 4C6SA 2CVFA 2ECPA 3R1IA 3UFXA 5IT4A 3IAS1 4Y6SA 1V5GA 1J4AA 1XTPA 3D59A 2PR2A 3BXGA 4P8RA 3IIEA 3UHAA 3GZ4A 3ETJA 4KGZA 4RY9A 2Z1DA 2JFYA 2ZSUA 3ON5A 5TRTA 2WYUA 1M8PA 2ATIA 1W2HA 1G20B 3RV3A 1QWOA 4UBIA 3DWEX 1HTWA 3HR7A 5DLPA 3W8NA 5J4VA 1OFUX 2BFBA 2GKSA 2ORWA 2WINI 4I4CA 1G21A 4GX0A 4ZYUA 2WLSA 2P11A 1XUOA 2VDMB 2RK4A 3U7QA 5B4UA 4GNKA 4WBNA 3FNQA 1IZZA 1F4LA 2PT7A 1V41E 1NXPA 4KZPA 1XMSA 3H2KA 4MYSA 3IB6A 1GXSB 3DFKA 3BHNA 4A36A 4PW0A 4RZQA 5AUQA 2G0TA 1QYCA 2OT3B 3GUUA 3AQ4A 2A3NA 4JVSB 2EJWA 2PM8A 3WGOA 3CX6A 4GKVA 2GR9A 4NEHB 4P6VF 1H66A 2D13A 5AH0A 3RVNA 4DM3A 2M98A 1L7BA 3CUEF 4JFAA 3N87A 5CTAA 3SZUA 4GR5A 3VVBA 3WLAA 4WNAA 3ZCXA 4EF6A 2QE6A 4CKBB 1C7QA 1A7AA 1XVAA 1P1IA 4FHEA 3VZCA 2V59A 2IZ7A 4ZQBA 1R9MA 2QUJA 3RSOA 1TCCA 3IRUA 3KC2A 3RJTA 4AG3A 4D9MA 1T0UA 2UUCB 4MB2A 1C14A 1LBQA 1PYGA 3LOQA 4XWTA 3OTQA 4YAKA 1GA4A 3G3EA 1CR1A 2PYIA 5HRUA 3DL0A 2D8MA 2Q46A 1LK7A 5DYNA 1YL5A 1P2BA 1YDMA 2R1ZA 2ZRPA 1T1GA 2QN2A 3FPEA 3LDAA 2DQZA 3OF5A 5FFNA 5JWHA 3IV9A 2IS2A 4YDSA 4ZVRA 3B1JA 1XF1A 2HFJA 3F6CA 4E3ZA 3OO1A 1B43A 3OZWA 1LZLA 1I14A 1XEWX 2GTPA 2FETA 2NUAA 2I6UA 3A0UA 3K71B 4J43A 1B73A 2FUNB 1KPIA 4EG4A 1RABA 3EEQA 3G7SA 3GI1A 3NNNA 4TT3D 2RB4A 4H0NA 4QUJA 3G89A 3AFGA 5JO9A 3ES9A 3VBEA 3CN7A 4DUGD 4JR2A 1FQJA 3Q0EA 1W6RA 2HMAA 4GGOA 2HK9A 4RJJA 2VJNA 4G0ZA 3REFA 3PXUA 1XRMA 1U1IA 3ABZA 3EY4A 4IZIA 5KSOA 4E32A 1JKMA 3GVXA 2PKRA 4MWDA 3VH2A 4YUYA 2O2IA 1CZHA 2O2YA 4PU0A 3WO0A 5FEUA 4NULA 4C9BA 4G5XA 4IEFB 4CFZA 5DTQA 4B8WA 1YVDA 3HY6A 4CKEB 1PEAA 2OTCA 4KTTE 1NUUA 4A6PA 1KRXA 4YRRA 2I2AA 3I9LA 3E22B 4XAQA 3VYVA 4MEAA 2OYSA 3AR5A 4AZSA 1HGXA 1SBHA 2FPRA 3H1TA 4K9MA 1T36B 3KV3O 4FINA 1K7FB 1TD1A 4NNOA 1CDEA 1MQAA 1IJFA 3SFTA 2PU5A 4GLJA 5J5AA 1UT6A 4DXAA 4EYOA 5CBPA 5JY1A 3GJ7A 3JWIA 2NQTA 2H4JA 1JDNA 3E58A 1HNWB 5EJ7A 1FTYA 4FT4A 3WLIA 4TV8B 2WVAA 2DBRA 3UGTA 3U5TA 2JLZA 1HOTA 1CJTC 3A4TA 2QM3A 3O4FA 1C3OB 1U0EA 1E9FA 3KL2A 3MWGA 5B58T 2QSJA 4ENUA 5LIRA 5LQCA 4G5RA 1ESNA 4EUFA 1YB1A 2ZSEA 4HUTA 3CLTC 4A5SA 1IBRA 3LPMA 4U1RA 1VJ5A 2O2CA 2QPOA 2WZQA 2E4UA 1B8NA 2VJMB 3E9DA 2CEKA 5FPHA 3GH3A 3DBOB 2OV3A 1TM2A 1TVEA 2IY7A 3UXYA 2PTGA 3GVPA 4JVMA 3P19A 4FUTA 4R7ZA 2QN1A 1GSHA 5EWJB 4HRYA 2WF8A 4XIYA 1PL8A 4OJQA 4DQ0A 1LI7A 4LJSA 3R9IA 3WIUA 4AO8A 4ZCTA 1AQIA 5KOJA 4W5TA 5AKEA 1WEHA 5H3LA 1V5FA 4LY9A 1CV2A 2GTHA 5GJCA 1THMA 2IVFA 5P21A 2ZBEA 4JLMA 5SY9A 3SSMA 1NC3A 2AF3C 3EXEB 3EXIA 2RHCA 5ALTA 3FPHA 2YH2A 3GMIA 4CCSA 5KTOA 3OTOB 1NVAA 1RWWA 1A8UA 3OUZA 2J3HA 3SE0A 3O4VA 2W2QA 4QQRA 3NBYC 1GHTA 2Q5HA 2VP2A 4RABA 2YUIA 1LEHA 1UDWA 3SJCA 4F04A 3A6FA 1QO0A 3I3OA 1CY0A 4QTYA 1QP4A 1RJWA 1ETUA 1Y34E 2J9YB 1XXHE 5IM5A 2YW9A 3ENZA 3E9EA 3EIOA 4G1MB 2OBMA 3Q7QA 4ZT6A 3UJHA 4DLTA 1N8KA 4JYMA 5L51A 1EFAA 1R8JA 1ML3A 1SG0A 4I99A 2EDCA 3QEMA 1U04A 2BJWA 4R2JA 4JJ6A 1E2IA 1F0NA 4OOFA 5ALOA 2P79A 2BFCA 4V0SA 3SHQA 3T54A 2C29D 1T35A 1ZH0A 2FUKA 3K1ZA 5KMGA 4H4EA 3D7LA 4WK6A 1W0KD 3JQCA 3FHOA 1T5HX 1ZNZA 2JAOA 2L82A 4DM4A 3IHLA 6REQB 1UPTA 5EJIA 2A0YA 4J3JA 5HP4A 3ZY5A 1AQLA 3KFLA 1J21A 1NKTA 4ROSA 5BR1A 2PPLA 3QVVA 1ZMXA 4OMUA 4CEHA 3AB3A 3X3HA 5ICEA 4W5JA 5ER9A 4CM8B 4DR1B 1TQ2A 3CNEA 1J0EA 3FKQA 2W2MA 4LGVA 2ADOA 2WUGA 4KYTA 2UYHA 2IW3A 2WQ7A 3ZXXA 3KUKA 1GZHB 4MQEA 3KSBC 2QVZX 3WL7A 4IDQA 3DKRA 4LY3A 3H8SA 4EUSA 1GKLA 1FP2A 2JGDA 3H1EA 4H6WA 2ZB4A 2I7TA 1JAYA 3CWCA 2IE8A 3FTEA 3BFVA 3DZIA 3H99A 2Q2OA 4MUJA 1F8UA 3NVMB 4B7UA 4ZMSA 1QHHB 2B2XA 1XEXB 1GUAA 2LVBA 1DV1A 3H0CA 1KEPA 2QE7A 1Z4NA 2IHUA 2HU8A 4OMFG 3TI9A 1USKA 4G1VA 1K3UB 2XW6A 3R5HA 1OZFA 1UBOS 4EYQA 1T0PA 2WWWA 3QVGA 1Z63A 5ICMA 3FWHA 2WPNA 1NF8A 3M6MD 2BGKA 2GAJA 4TKUB 4B4OA 3PHCA 2QD4A 2XBLA 1NVUQ 2XY4A 3DNMA 2R6HA 3KVYA 3D4LA 2OCPA 4NZMA 4XPIA 3R7WB 5CFLA 3GLIA 3G8BA 3ZKWA 1ZIOA 1UMCB 3ZDQA 4ZDIA 3U62A 3VTZA 1NBME 4WI1A 1GZDA 3LK6A 3MJTA 3KYIB 3OTGA 3SNKA 3UB2A 4AJ1A 4W4TA 4TPKA 2FHSA 2UUOA 1HR0B 5KYXB 5DNDA 1MN6A 4YJHA 4KR3A 1OHHD 3G9UA 4W9NC 3ISJA 5ITVA 3TB6A 3Q6IA 4MP8A 1PTKA 3GRCA 3V00A 4GP6A 3LUHA 4EFMA 1XRSB 1DI0A 4EK9A 2C84A 2ST1A 4BGDA 2R1TB 4NDNE 2W5UA 1PHPA 5EESA 3LECA 3H8VA 1P1KA 4EPRA 4HDNB 5DM70 1AKQA 2MR6A 3T1YB 1TVMA 2IXFA 1ZCAA 4DQKA 1QWSA 5EJ2A 1Z75A 5AXDA 1VJTA 1Z15A 3R40A 4HNSA 3FCUB 1XZ8A 3BTVA 4NBRA 1A5ZA 3WTBA 2IOYA 5FLXA 2H18A 5DCWA 4KE7A 2XDYA 2XTZA 4IGKA 4MKHA 4QG3A 3B89A 5JDIC 3D02A 3GJ5A 3AINA 2P2YA 4FHCA 3WV5A 2GXUA 1FLNA 4JEUA 3N74A 3T4UA 4DB4A 4DA8A 4EJ2A 4BWFB 2NZJA 3TSCA 2XNKA 3GYBA 2NO5A 2TMGA 4O59O 4GSKA 2IYQA 1DDOA 2MINA 2PZ8A 4F56A 4RHUA 1MO4A 5EUMA 2JIRA 1JJFA 3U6BA 3RE1A 1JFFB 4FCWA 1PGJA 3NM4A 4AD8A 4EZBA 5JSZA 3WK8A 3N8IA 1L1QA 3GA0A 4I3GA 3FDFA 3VH4A 1PQ4A 1HH4A 5G0SA 3MPOA 2I3BA 3JATA 2VKTA 5THXA 5IG2A 1UK8A 2PUAA 4J6FA 4B4KA 5HIKA 2XGOA 1LSOA 3VKGA 5DSXA 1E7MA 5KTNA 4GRIA 4IDNA 1IVSA 3O3OB 2XUFA 2GUGA 1ZITA 4IFTA 5KHAA 4D02A 2OO5C 3FUXA 3LLMA 1S3FA 3PHBE 4TXMA 4KEAA 3ZDXB 3GJYA 1R10A 1SPXA 1ZZEA 2A9KA 1CNMA 4UM8B 2Z6AA 4B7XA 4AULA 3Q3GE 5ECWA 4WZBA 4X3PA 1XLUA 1JPNA 3RC9A 3J81k 5T67A 2P7IA 4GYYA 5KWJA 3J81A 3OPYB 2QW8A 4G0XA 4MR8B 4LQCA 2XUDA 3CTPA 2E7ZA 1ZL2A 2TSYB 4E6PA 1KEEB 4B09A 4DCNA 2FZ5A 1P5RA 2IXDA 1BXRB 3OEHA 3NC1C 1L5ZA 1NRXA 4Q7JB 2Q3HA 3WYFA 1HNNA 4PSCA 3UJ7A 3P9NA 4C7OB 4KX5A 2N1BA 3INRA 4KREA 3QKIA 1PT8A 3EMKA 5DM60 3K7EA 4U3JB 1RYBA 4HX2A 2XUAA 4J1QA 4KG7A 4F60A 4I0WB 1XLTC 2UYGA 4D4HA 2WKRA 1DAFA 5AXBA 3SX0A 1YZQA 2ZUTA 4MRPA 5SY4A 2G0AA 3TTUA 4BVGA 1E6WA 3F2VA 4QBHA 1QIMA 2XTNA 3F3YA 3RKUA 1L7QA 3S1AA 4AQ7A 1KJZA 1Y7HA 5LUAA 4DV1B 4XIFA 4OI1A 3PQEA 3AVTA 4YRPA 3UKDA 1QGAA 2ZXEA 4LZZA 4WA8A 4DIDA 4BO3A 3GUYA 4GMDA 3ET4A 2FG5A 2BTOA 3AU9A 1GNSA 2CK3A 2MYPA 5BRNA 4ZT4A 3YASA 4AZ3B 3NV9A 4DLYA 1RMYA 2CDCA 4DJ5X 4HNQA 3D5TA 5ELMA 1T9HA 3HFSA 3P2MA 2J0EA 4YO7A 1EXMA 5AD1A 1AQJA 3AUXA 1C0KA 2IE0A 4LX0A 3IO5A 4HS4A 4DJFC 5LOVF 3SDZA 2B5VA 1CVIA 1G8JA 2OHHA 2QT9A 2AJTA 2EWWA 4HC4A 3CNHA 4JUDX 1P4RA 2VAXA 1AXRA 1WRBA 1AA6A 2WTMA 1MJNA 5LJIA 1YS4A 2J08A 1ADGA 1RLOA 2JHPA 1GM5A 2OZPA 1SVWA 4EYEA 2RKOA 2IT1A 1PT6A 4YAOA 5KNCD 4NCBA 3DOFA 1JKXA 1NG1A 1V4VA 2P2SA 3GPCA 3JV7A 1Z5WA 3A3NA 4K7JA 2W48A 3A6ZA 1S4MA 5A04A 1VSQA 2A57A 2RHGB 2ZP1A 4ZQHA 5F64A 1UMDB 3BD8A 5H1YA 4YRGA 5ER6A 2VT7A 3WKBA 3I3SR 3ZWVA 3WNZA 2D2VA 4DIUA 5C1OA 4OL0A 1AKNA 2PXXA 4S0ZA 3MINA 2B1GA 4I50B 1FA9A 3CX4A 1V6AA 3N70A 4N0QA 3A28A 3RTDA 4AUEA 5FOUA 2JLWA 4Z9YA 3SKYA 3SXJA 1WZEA 1G5TA 1G8MA 3QV2A 1PK9A 2NTEA 4XD7D 4GU5A 3TKYA 5EQFA 2WFLA 4F2WA 5B57C 1QHNA 2HIGA 3BKWA 5IBRA 3KKEA 1NN0A 5H5JA 1KAEA 5EMMA 5CT8A 2VSNA 3L8DA 4HNUA 5B5SA 3MWDA 2FB9A 1BH2A 4GGMX 1BE6A 1EFHA 4MUHA 3KQVA 1OASA 4NMWA 3ZY3A 2PGDA 3B12A 3HEBA 3QYJA 1E5LA 5IM4F 2EF0A 4EZEA 3VMMA 3QBJA 5KOYA 1LFDB 4WCFC 4HL6A 1L5LA 3JR3A 3RSHA 2PX2A 4C2TA 1NNI1 2R5FA 1UZUA 2RGGA 4KFRA 2G80A 4H08A 2C5BA 3WLTA 3DEJA 1QIHA 2PMWB 3LVFO 4WERA 2ATXA 5IAAA 3I2YX 2KJQA 4KO8A 4LWOA 3I34X 4B8YA 5SYAA 3CF6R 1E0DA 4PONA 4ZO6A 7YASA 2JLBA 4FK8A 3R6WA 3L4KA 2FPMA 1G5IA 3IE1A 1X2EA 1KTIA 1FQKA 2E85A 2XPCA 1YH3A 3SICE 3TPCA 2EYUA 4LGYA 5FV4A 5IXSA 1MQ8B 3WSVA 4IOKA 2B4KA 3EBLA 1ST2A 4HDCA 3ELBA 4KYUA 1UT8A 3UEOA 3BMQB 1Y8RB 4MA0A 1GRQA 2Y8EA 1LQUA 4QXOA 3VJKA 2A1UA 2QP9X 2YXLA 3T52A 4AQYB 4D6YA 1GCIA 5JVDA 3MTAA 1KQOA 1Z5PA 2EATA 2GBGA 2E48A 1GD1O 1H2BA 1QJ4A 2J45A 4FSHA 1E2JA 7MHTA 1CVRA 1N2SA 1NVMB 2PFGA 2WILA 2F1IA 2GQ0A 4S12A 5AKGA 1J90A 2IEBA 4WLUA 1KARA 1KZ9A 1PGNA 2YHUA 3IAM6 3V2HA 4LXHA 2NXWA 3P2EA 3M1IA 5IJ0A 3EEBA 3CVXA 2ZZKA 221PA 4B1FA 1ZIXA 4FWTA 1RAHA 2C4TA 3HJNA 1GTG1 2HSJA 2K5UA 1Q84A 3H1AA 4M98A 1NVEA 3VAAA 5BSMA 4GM4A 2YIMA 2FX5A 3OE5A 2XCUA 4WLOA 1OBCA 4C05A 7REQB 5HZGA 1CRPA 1BW9B 2W2XA 4HNRA 1OYYA 2P9GA 1Z0AA 3EZGA 3TQFA 1F2UB 3RU7A 3TQIA 4X3OA 3CF4A 1GFWA 2VHJA 5D00A 1QIDA 4M4SA 2HBYA 1CUJA 4IXDA 5LLDA 3UMBA 3LG2A 3U7JA 5IKMA 1TQHA 3HDYA 3PDJA 2XKKA 1OSNA 1Z5ZA 3RU3A 1XYYA 1PG5A 2JCGA 5HRCA 2PBZA 2WHYA 3HVIA 2EKQA 2VHVA 1RAAA 1AE1A 3BPSA 1R74A 1C3VA 1T3HA 3HJTA 3NDJA 4X6XA 4YJ2F 4YVFA 3TJZA 4BLOA 4F72A 1NBIA 2JA2A 4CM6A 4D4GA 4DIBA 2YY5A 1KVRA 3ECSA 3UIEA 4BHTA 3C3EA 2ZREA 3FGZA 3K9LA 4ACBA 7GPBA 9MHTA 2CFRA 3HV2A 3I76A 3ZE2B 1EGAA 1W59A 2JIOA 4EY3A 1KXZA 4AX8A 1DE0A 1X8JA 3CXRA 1GYQA 1RQNA 2H00A 1NUQA 4ZVUA 3U4GA 3O2QB 2QXYA 1A7UA 1ZVJA 3CSUA 4AL4A 3OECA 2QDXA 2VQ6A 4ZODA 3SSOA 3LYHA 1E3SA 3TBKA 1QFSA 1TO6A 1E0SA 2YS6A 4P86A 4BQSA 1PJCA 2A5JA 4PG5A 5ITWA 1EWQA 1W94A 1EFPA 4MVJG 5A2QA 5JD4A 4JI2B 2RIRA 2CYBA 2WFMA 3B60A 3GJTA 4IM7A 3HL4A 4LJ8A 4L5IA 1CYDA 4BNFA 4QU0A 4CEJB 3J7AC 4FEGA 1MT3A 1UZMA 2NMVA 3I6YA 2PS0A 2QXTA 4OUDB 2H7XA 5FT9A 4X91A 2XD9A 2OORC 5EKXA 1VIMA 4JLWA 5JNUA 1A98A 3GZNA 4Q3EA 1Z6AA 2Y9PB 4II3A 2PZJA 5AKZA 3I2JA 2CV0A 2FVYA 2LCIA 1TJPB 3G9QA 4Z5XA 1GU7A 4NJMB 5LFAA 1OAOC 2XMRA 5AKIA 3V8BA 3SPXA 1KFKB 1L7AA 1EIWA 2H6EA 4LWZA 4MS1A 1L7NA 2LR0A 4F5WA 1DL5A 3X44A 1NC1A 3KEMA 4NONA 4CF4A 4C30A 4ZA2A 2YV4A 3C8MA 1KDZA 4AZVA 1DXQA 3KOOA 4ZVSA 3WKDA 1NBAA 2HDWA 5FADA 1WULS 1LDBA 4D74A 3NCTA 2JFWA 2RIPA 3L46A 4IHKA 3KU4A 4OXXA 3G2JA 3AU8A 3UA4A 4A8TA 5CXQA 1Q15A 3JAKB 3L0PA 1NVBA 3OLXA 1KI7A 1HEUA 5EHQA 3WY9A 5I5GA 1A5TA 1CQWA 1L9KA 5F21A 1VFNA 2OENG 5BPHA 5JAUA 3O93A 2IHKA 5KDOA 2OCDA 5CM9C 3M81A 5BNIA 4MQBA 5AT1A 1ABFA 4LYGA 3JRNA 3L3BA 2QM7A 3MT8A 1X7WA 4G0YA 4J2TA 3CJQA 3K0SA 1QH9A 5F3RA 1HYQA 2NW6A 2K87A 3LI2A 4DUYB 3THXA 2GCGA 3LAWA 1USVA 3STUA 3QEOA 3RUHA 5C4IA 3K9BA 4N47A 3V2GA 4EENA 4JQSA 5BWCA 1C4KA 1UBUS 3AOEA 1VRVA 1FZQA 2G4CA 2O0JA 5IEBA 1DLJA 2PV7A 4DGQA 2O48X 2ZUUA 4HPXB 4ZO9A 3U7EB 4Y6OA 5KJFA 4AC9A 3TKAA 1SUCA 4TSFA 5CPBA 1OH8A 3H9QA 1Q3KA 3SQMA 5D87A 4Y2JA 5KQGA 3Q8WA 3ZDYB 1V1RB 4GYWA 3AW8A 5A9SB 5KX5B 2FG7C 1PW5A 3F6SA 3AXSA 4YCAA 1E2FA 1ARZA 3HMKA 1E66A 1F5SA 4NNJA 4KQEA 5CX4A 4FI3F 2XRYA 1U5BB 4NMXB 3KZCA 2HLDD 3L84A 4R3NA 4GZ3A 1RXYA 2JLAA 2HBRA 3I30X 1HLDA 3IKJA 2GFQA 4R9SA 4XVRA 3RBZA 3RC1A 1JMYA 3NOOA 1P9NA 3I32A 3TLBA 1JP7A 4BVEA 3CG4A 1HDXA 2VS1A 2WWVD 1S2DA 2UAGA 5DI3A 3TRIA 3ZGXA 3CMMA 4OBEA 3IBSA 3OM1A 3O1HB 5JJIA 4R9VA 4C01A 2ZE7A 2FSVA 1ZMOA 1UFRA 4AWAA 3GY0A 4BQIA 3SNHA 3RQIA 1ZOIA 1VCHA 2WBLC 1SXJC 4CCYB 4D0SA 5JMTA 2YWHA 3QXHA 3TTXA 4F12A 5L3SA 4BX0A 1KY2A 4IDCA 2EVWX 3HPQA 3PZBA 5KNBD 2BI7A 4OQQA 3WLNA 2CVZA 3LH5A 4EPWA 1QHIA 1YK0A 4IO0A 2CNOA 3C6XA 1LSSA 1V8OA 3O4RA 3OZVA 4JROA 4ZRNA 4YMUA 3DG9A 1FX0B 3EC2A 3BG5A 3LVQE 1Q6ZA 1O0CA 1M6EX 2CHFA 3WTCA 3STWA 3R5JA 3ZY6A 4Y2HA 5FDFA 2NU7A 5GM2A 4C04A 5LL6P 1XMOB 1X7XA 1RMQA 5EVCA 3RUCA 4CNQA 2VP5A 4MLPA 1KEWA 4H77A 2HXYA 4UVDA 1NU8A 3AV0B 1C1HA 3P9YA 4UQLA 2WU0A 1DX9A 3PE3A 4ZIRA 2XOEA 3O1JC 3CUVA 1NW8A 4RTLA 3ZHTA 3KPUA 1GAWA 1N1GA 2QW0X 1VCIA 1QKJA 2QTBA 3QOYA 4B75A 4S1NA 5IYZF 1EFVB 1QIJA 3OZ7A 1IHOA 4I1RA 2Z8ZA 4R0MA 3OJEA 4RMNA 2G83A 1C1XB 1WW3A 2GK4A 1U6KA 1Z6GA 3DOHA 3OETA 1U0HC 3OD5A 3PFNA 4Q1BA 1OH5A 3II6X 1G6HA 1EFCA 4ZTBA 3CNQS 3EW7A 2VAPA 3S2FA 2JH9A 3O75A 1IEQA 4GZ6A 1PBNA 1WMAA 4TT8A 5G02A 3KKKA 4L76A 1SUEA 3ICPA 3UOAB 1G2PA 4ETMA 3O1IC 3CUYA 5JXWA 1DIOB 2QT0A 2ZVQX 4LMRA 2GDZA 3BBLA 2FP4B 4ZEXA 4JQZA 1QMGA 2QNBA 3AJ9A 4E6EA 2RARA 1R9JA 1XDUA 4IWXA 1IBSA 1QGUA 2E55A 2VUTA 3NS7A 1I10A 4A27A 5I7VA 3OIVA 4Y2QA 3WWYA 1MTOA 2VP3A 4PLCA 3DDSA 2PX6A 4TQAA 4XSVA 2YX1A 3NFYA 5KVQA 4C88A 2C3MA 3KSMA 1PSDA 5HUJA 2C82A 1VMDA 2FZ4A 3GLSA 2I22A 2WD7B 2YXBA 4L15A 1XLVA 1FDVA 3MWEA 4DWJA 5FBVB 2MU1A 4JI4B 4V38A 4KDRA 5FWDA 4YT2A 5TC4A 3FUWA 4UUPA 3W7VA 1AUXA 2ZU0C 4KK4A 4RDHA 5DYWA 4IH9A 3B7WA 4DA6A 5FL7D 1PQWA 4JGIA 1VIDA 3LM8A 1XNHA 5CUQA 4BFZA 5HKBA 2I62A 1O94A 3Q3EA 2CBGA 4FIDA 2G88A 3RUPA 3T8YA 4B6FA 5KHOC 3KQLA 1QTQA 4D8UA 5H3HA 5CD1A 2QL9A 1SVKA 5L6MB 2NU6A 4BE4A 1ISGA 3ZU3A 3AJRA 1CULC 4PZPA 3CEMA 4B3CA 4XYEA 2TRSB 1KMHB 3EVNA 2RKWA 2ZJAA 2NAPA 1HQCA 1ZIYA 3DKIA 2FSPA 3PIDA 2GERA 3W2HA 2Z83A 4ITRC 1Z47A 2AA3A 1RPTA 5K3BA 4RHTA 1F12A 5LB2A 3O3CA 2EGGA 2HIMA 4H6XA 4LTDA 5GIOE 1AHNA 1GRNA 1Q2UA 1GWNA 2A1IA 2AN5A 4FOOA 4OHUA 3NGLA 3NIFB 3TQTA 4U2FA 1ZA1A 3VNUA 1IEWA 3VZQA 2PD6A 4AXXA 2PQ0A 1ZLYA 3H2JA 1Z0DA 2Z8XA 3H9CA 5K9ZA 2DKFA 3PDIB 1EUYA 1JG7A 1BMFA 1JFLA 1NZJA 2IH4A 4CKWA 2HDNB 2Q62A 3ZDBA 4DT1A 4OA8A 3PC7A 1FP7A 1QUEA 4R4JA 4U8HA 3PXGA 2DGDA 3IEVA 3FUVA 1IOWA 2OEPA 1IBMB 1BKSB 2KLHA 3OPYI 2J3IA 3BDVA 4L0CA 4ZD6A 2CWDA 3V2UA 3K5PA 1K9VF 1SQFA 1YQWA 3NXKA 1Q20A 1NW4A 4FEAA 1VC2A 5GVRA 4IDOA 3K1YA 1VHWA 1X87A 3IPAA 3FY4A 4IQ8A 1G16A 4CMBA 4BECA 1YZYA 2NXJA 3QPCA 4DQLA 1FSFA 2JHAA 4YRDA 2ZUEA 3SJUA 1P4SA 1U1CA 2FMIA 3E53A 2OLKA 5FA8A 3HO8A 1FDUA 1X7YB 1FYVA 1R8SA 4OXIA 5HSGA 2AXNA 4QYWA 4ER3A 4WDRA 2VZLA 4AMGA 3LK7A 3WWDA 4XTCS 1NPDA 1DQRA 2B4YA 2Q4RA 3T5CA 2XA9A 3VNQA 1W4AA 5JCJD 3I9V1 1O95A 4G5QA 2WWIA 5DGHA 5DLYA 3PDCA 5EUCA 3WBJA 4AIIA 3AZPA 1XK6A 4JYAB 4QJ5A 5DE3A 4MRAA 3T4PA 3WGJA 3PWZA 3U4QB 1HDRA 2PMDA 4WXHA 5IVHA 2YINC 2PNJA 3U6KA 4YRTA 2XWPA 1YA4A 3MBOA 4U00A 4MW7A 2AZDA 3VFDA 3AEKB 3X2EA 2OP0A 4FXPA 5FLEX 5I9IA 2FN3A 3CO5A 1M1NA 3I64A 3FWZA 4IGFA 4DC9A 1HL3A 3L7LA 1P1JA 2LCQA 2QLBA 2OZEA 3I6ZA 3JVEA 1NW6A 3BGIA 1KK3A 2CKMA 3TVYA 3ZI7A 4CDMA 4IH4A 5KUTA 1Q22A 1Z18A 1Z7WA 3FI9A 3EXFB 5LP6A 1CTQA 3S2UA 1MAUA 3A7DA 1Q44A 4AECA 2O5EA 1HZZA 5CNMA 3MZ0A 5KKNB 1VSVA 1V7PC 2OXRA 4KO3S 1HV8A 1Q21A 2UYYA 4KPGA 2O07A 2YWDA 5CVCA 3VHRA 3NJRA 1EYZA 1YR6A 1SUBA 2CFTA 3KLPX 5DZSA 1P1BA 4R71A 3WYNA 2COUA 2Q6KA 2P1RA 1QO9A 1S8FA 1CJKC 3IXLA 1NV9A 2FPGB 5ALJA 1HFEL 1ZH8A 2HSZA 4WXEA 4YWHA 3R6TA 4DMLA 1Z5OA 3ISVA 1LBIA 3D0OA 3KTOA 3P96A 1GQ2A 2CD9A 4O25A 2N3ZA 5CNKA 4CQMD 1Z6TA 1V1MA 4X94A 1I3LA 2AI1A 3QTBA 2F4VB 3CIOA 5DSTA 3VSBA 3GX1A 3VA7A 2C7RA 1AQNA 3QYFA 16PKA 3IIIA 3W5AA 3LT2A 4X1KB 1AGNA 1QZUA 1DXOA 1TXGA 4YBRA 1ADFA 3HCWA 4WTOA 3HY4A 1RQXA 5JWOA 4MUEA 3OJOA 1DO2A 3W2FA 1TFUA 3H5RA 3KL4A 1S96A 2AC7A 4L0DA 4TTJA 4PG8A 4ZYXA 3UHJA 1IM2A 4M1KA 2JGLA 4HUQA 1T1SA 2X9NA 3KELA 1ZHHA 4KH1A 4IRXA 5ALKA 4LISA 1DB3A 1ODTC 3HA7A 1R0KA 3BDAA 2DHDA 2IOHA 3TSZA 3QMVA 4KBFA 1UKVY 3EIXA 3KWLA 3GRZA 5JYBA 1X86B 2IYLD 2J1LA 3NIBA 2BN4A 2IPNA 4MRVA 4D4MA 4O3FA 4PTZA 1IXRC 1NXVA 1CEXA 2GLTA 4MVJD 4DRYA 2VP0A 1U0NA 1YU6A 2D0DA 2OQ2A 3GGJA 4CUZA 3OBBA 4QUEA 1YZHA 4U9HS 2P69A 2F1RA 4TQ9A 4NZ9A 1TKRA 4KO1S 3T7IA 1AO3A 2XLCA 5LA6A 2G08A 3D7SA 4J0FA 5FQOA 2C0CA 5DHQA 2IP4A 1VHQA 1TCAA 3HDJA 1LPBB 3OT4A 4EA9A 4EMSA 4KQMA 1U4OA 3T3MB 1RSZA 4XXHA 4ZHSA 4LS3A 3HA3A 1JHMA 3ZVKA 4IZOA 3KTFA 3OE4A 3JYNA 1E2MA 2BTEA 5FYDA 3KXPA 2AYZA 2QYSA 2V1UA 3ANMA 1UFQA 3GGOA 5ED4A 1DXYA 2G6TA 5TEVA 4M8LA 5IVKA 1WHTB 4JLBA 1Z4KA 1H9AA 2E49A 3A2MA 2XBMA 1THZA 3CONA 4OOEA 4Q9JA 8ADHA 1QHEA 1B3RA 4U9UA 4E31A 1BROA 2YZMA 2JZOA 3HZHA 3VPSA 2XR1A 1ENYA 4MJXA 5FOWA 1YS6A 1NE2A 2QJRA 2FA9A 1VIVA 3H75A 5HKLA 3RAFC 3GGDA 4TTIA 2C9DA 4MW2A 5SY6A 3DQQA 1BE0A 3A4LA 5EP3A 5IFLA 4J3NA 1XO1A 3CF0A 4GR9A 1A95A 3NASA 4EFKA 4WK2B 4Z3KA 1MDBA 3DPUA 4O4JB 1JBKA 4FZRA 4DG9A 3EVZA 3DDHA 5IN4A 1OX5A 4ZQIA 3QVUA 1EWRA 5JHHB 4KDCA 3SAJA 2LIPA 2NVUA 3WHKA 4IINA 2RH4A 2R44A 1DC4A 1LKZA 1XL0A 4LTNA 5IZCA 4ARUA 2DEUA 2N1MA 1UIRA 3UK6A 5DTJA 4IFIA 3EGVA 3UT0A 2C2BA 5K6AC 1SU4A 1YUBA 2YJTD 5CAEB 1LA2A 2Z5FA 4PFQA 3E2PA 2J41A 2HMWA 4KNVA 5E8JA 1VPWA 2QZ9A 4X6YA 2QBYA 5KSYA 1Q57A 1JJIA 4D45A 3I8SA 2F8MA 2FCAA 1JKJB 4PANA 1CETA 1N3BA 5EJGA 3IR5A 3SQOA 4G8BA 1EG7A 3OOEA 4MR9B 4RA9A 4Y6LA 4EKYA 4LC0A 4IMPA 4NLLA 1Q2XA 4Y7CA 3K0KA 1QJCA 4GMGA 1EDZA 3QKRA 4RD6A 3WOHA 1R5OA 3QE2A 4JENA 4LSWA 1JALA 2D3WA 4G0WA 2WPDD 3F1KA 4R54A 1LLQA 3KYCA 4OLFA 1V0JA 2RCYA 2ZJ4A 3ICVA 5SICE 1ZGGA 1QNFA 5K03A 2CD7A 1ZONA 4J49A 4QM6A 3NHRA 3FNEA 3RS9A 1JVSA 5ADHA 5LMNB 3LW7A 5BWMA 1SK8A 3RH0A 2LKCA 1UJ4A 2XH8A 1VKZA 3W3AH 1H9BA 4EKEA 4KRFA 2NTVA 1KVSA 4KXLA 2WT9A 1DBVO 3DGEC 5GQSA 3R7DA 3RSSA 3WLOA 4D8TA 1N5RA 1S2GA 5EMNA 4FZJA 4Y1GA 3LRTA 5BPFA 5B2ZA 3IMFA 2BGUA 3B6KA 2C59A 4O4LF 1DT3A 4YIKA 2FK7A 1O87A 1ZSYA 4Y1FA 4QBIA 4XJTA 4XGNA 2I54A 1NX9A 1Y7IA 4HZUB 1T1EA 5JSKA 1G20A 3N76A 4A8JC 2YN2A 5K6TA 1K7YA 2H2FA 5HBRA 1FXWA 1YK1A 3DOOA 4JKIA 4RESA 3STHA 4Q4AB 3U16A 2O5CA 5H82A 1XAIA 5IFKA 4S05A 2D06A 4P4LA 2D1SA 3UYKA 2E4AA 4C3OB 2Y76A 3G2LA 1RIIA 2BMAA 2QVLA 1Y6RA 3PE6A 4M8NE 4MS3B 3WNQA 3UHFA 4BNKA 1G8HA 4AP6A 2YZ2A 2XMCA 1GXSA 4HNVA 3L0SA 4Q9NA 4Q9DA 5IC6A 5E6UB 1F1JA 4CV3A 3VVCA 2O3TA 3GRFA 4PS1A 1F0PA 3ADPA 4RVCA 1QVVA 2DE0X 5FQNA 5KU7A 2Q7OE 2X5OA 4EMTA 4I9GA 1S01A 5DEOA 5CIWA 2PUDA 3ZDDA 4OSOA 3LWBA 3UW1A 1NQWA 2VHEA 2HO5A 1KHTA 2XNDD 4U9IS 4CKBA 4DCJA 6ADHA 3FVVA 1P7CA 2PCJA 3AJDA 2BFDA 3N0WA 3SSNA 1MAVA 1VHDA 3EFEA 2QI9C 4KR6A 2H0QA 2BVNA 2H4ZA 4OQFA 2R8YA 1LVHA 2PIAA 3RSCA 2FW0A 4QYMA 3ZR4B 1WKCA 3AHEA 4QYIA 3ZTYA 2H7CA 3VM6A 5TB5A 4N9QA 3L7KA 4TUYF 2WWGA 2IY8A 4K2AA 4MI1A 4RC9A 1F48A 2D8AA 2P4EA 4IIYA 4M0PA 4NR0A 3ZHZA 2GYYA 2GM4A 2BSQA 1GY8A 3QU9A 4OFBA 3D8HA 3THYB 1QZ3A 3QIVA 1Z0ZA 2C78A 1DJLA 2I4OA 4H7DA 4IQGA 4IWYA 4KLAA 2OFXA 2Z1MA 4M0DA 1YCHA 1EUDA 3FW1A 4N8SA 4G9GA 2XOXA 1AS3A 3HGTA 4CF3A 1FQWA 5CYPA 2UZ3A 2JVJA 1JFRA 4BKPA 4KDEA 3GBSA 3NTVA 4GX5A 1XQVA 4XDGA 3V8QA 3COWA 2VHWA 3AI3A 2ZAMA 2R1VB 3OE7A 5LD2B 4JZYA 3N8KA 1EIZA 4N9WA 5G1OA 5EE1A 2FZVA 3EA0A 3MYRA 2YWBA 2ZTHA 3PYMA 4NFSA 3GFFA 2Z6QA 3PXBA 1YR1A 4E30A 1AUQA 4MA5A 2PV0A 3FFWA 3LC1O 2YC2C 3B82A 2ES4A 3P20A 3KHSA 1GL9B 3MOGA 4PZAA 5E6SB 5KYUA 4GOLD 4O6VA 3V4LA 1RZRD 4HFNA 1S2OA 5E4FA 2VH5R 4KV7A 5EE9A 1GAEO 5I8PA 2FZGA 4Z0PA 4QOEA 3EMBA 3WOVA 3V4FA 4V0KA 3H65A 2J87A 4RGYA 3LA8A 1J0DA 3QVXA 5KJ6A 1VKJA 2QZPA 3ORFA 5FPPA 4B6PA 1CB7A 3ZCQA 4D0RA 4WFIA 1T36A 4OMCA 2P1DA 4DY4A 1ZCJA 2SBTA 4TM7A 3C1AA 2FR1A 2OGZA 2AOXA 3JS5A 3LU1A 1VI2A 3BJEA 2W7TA 4ZU1X 1JFTA 3C3AA 1ZG3A 2W2TA 2PVSA 3I6BA 1T0JB 1XJ5A 1FRVA 2IUYA 2JH3A 1HKUA 1KAMA 1ZUNB 3DC2A 4LZPA 3KYBA 1ZR2A 1RYNA 3AK4A 4L7QA 4TV8A 5I48A 2H8GA 2WE7A 3NO4A 2ILTA 4PQGA 4QGGA 2VYCA 3WBKA 1KR5A 3C7TA 3OD1A 1JPVA 3FLAA 2RGCA 3T7CA 1C3OA 1NDUA 1UXOA 3KCNA 3NCHA 3QWHA 4R2WA 1JEOA 5F1YA 4KAJA 2G3YA 5B6PA 2C58A 1UBHS 3IURA 3OP4A 1ZJYA 3NUGA 3REQB 5LJLA 1PUXA 3P52A 3A9RA 4D6PA 2B7CA 1U9YA 2JFFA 4GKAA 2W6JD 1MIOB 1ZWLA 1LSJA 5K3CA 3TW8B 2WUWE 2VJMA 5KTYA 3LSTA 4P7BA 1MABB 3W7AA 5H83A 3CA8A 1PEDA 1BTOA 1SUSA 2A0FA 1PTJA 4JP8A 5H4GA 2AZ4A 2C3YA 3KK0A 2C2YA 4KXQA 1L5YA 3IVCA 5EWJA 2AJLI 4PFKA 1Z08A 2VTVA 3JXEA 2YS7A 4MVXA 3R7SA 3W6UA 4TMTA 1PQYA 2JDID 1A76A 4GYJA 2JCSA 3A3OA 3Q3HA 2J9GA 2XGMA 2VHQA 1E9CA 3ANNA 4I2NA 4YLEA 4V0MA 1TYCA 4PHFA 1WXWA 4C4SA 1LGYA 3MBIA 4CHGA 2P65A 3GQBA 3A3YA 2QRZA 3OZBA 1L5NA 3SOZA 4Z4GA 2RGNA 1ANKA 3T7SA 3LPLA 2OHIA 1Y3CE 1RTTA 3W6NA 4CBVA 5HJEA 2HK8A 2I6QA 1R6BX 2VJDA 2XAAA 4JSTA 1W8DA 2EZ4A 1EPUA 1AS2A 1ZM7A 1X2BA 4ZVTA 2UKDA 1LDYA 3EUEA 3GWGA 3BRCA 3PLNA 1WZCA 2P35A 4J0KA 4JLSA 3L40A 1D8TA 4G1BA 4LXTA 3W1VA 1V3QE 2OPHA 4DDUA 1S02A 5ANRB 4F46A 1ZGBA 2ZTMA 3DTNA 4PHCA 4O8ZA 1DKLA 4B5LA 2WF5A 4BO1A 4EJSC 5K2OA 1JKIA 2ZKLA 4WIAA 4RKQA 3IP6A 2HJWA 1EM8B 1LZKA 2I6XA 2P5YA 1YR7A 3R4VA 1LH0A 1YB7A 4Q3BA 4UATA 5GAJA 3TRJA 4DYVA 4ZMRA 1D2EA 5JSQA 4NK4A 3OU7A 1Y37A 3CPEA 4CDNA 2FUG1 2C9YA 2CF6A 2GN1A 1GT91 2MSWA 1WMBA 2WZBA 2WM9B 4G5GA 5ALWA 3EARA 5E2BA 5IK2A 4D9EA 8GPBA 5CEFA 1E20A 2OFWA 4K9OA 2G07A 4ZXFA 1MEOA 3FNGA 5AVSA 1C2TA 1WZNA 4CM8A 2QL7A 4O5OA 4YCCA 2NU8B 2ZDQA 3FYHA 3OQJA 1F2DA 2IGBA 4CG3A 1QCYA 1M34B 5DIFA 2H0RA 4B79A 2V7UA 4OQMA 1LRJA 3GLVA 4UC0A 1L1FA 5IT0A 2FOLA 2Z56A 1E1CB 1JIUA 4XQ9A 3V9AA 5CDYA 2UYQA 2GAIA 3TR5A 5EJ8A 4GMHA 2DLDA 1QRDA 1ZM4A 2X4DA 3BJMA 1Q5PA 3SIXA 2DMRA 3K1JA 1MC5A 1P2GA 1WWKA 3A10A 3NWEA 4HWGA 2D0OB 2QAGB 3D3JA 3IAAA 1YRWA 1QHHA 3LQ1A 4OKIA 2PUVA 4PPGA 2OD7A 4D92A 2G1UA 2OY0A 5H8WA 1W4ZA 5A1JA 2FQ1A 2RGUA 1GITA 3TAXA 2C2OA 1E6UA 1S8NA 2OMKA 3NVKI 4W7HA 3AYXB 2OKGA 4XWGA 3BWCA 5F9MA 1IN8A 4UCQA 4GQBA 1JHXA 1XA4A 1YJQA 1MC8A 2IXEA 4FDUA 4M1WA 4TKUA 3UTCA 1U3CA 3KWJA 1N5JA 3PV0A 3R7WA 4Z4FA 1XTUA 3HHPA 1RVDA 3MHPA 1UMCA 1VG1A 1COZA 2H1IA 3HQ4O 3DE0X 4BVAA 4P2BA 4FWBA 4L27A 5DI9A 3PKIA 2BCGY 3V8RA 5CYGA 5REQA 3GDFA 4N8EA 4Z54A 2QG6A 5F76A 4BWVA 1G3MA 3Q3VA 2DSTA 1GUDA 4PZCA 1TF2A 3IT3A 4X7BA 3WHPA 5MGBA 2E5LB 2YWRA 3JVIA 2FAXA 1R8QA 3OJXA 4QBTA 3UK7A 2XNSA 2YOGA 3PGLA 1JJAA 4QICA 3NYQA 4WDQA 2R1TA 4WSOA 5HCNA 1RT9A 2QUZA 1Y5RA 4HDNA 3WQBA 1IQ0A 3P9RA 1YS1X 3PK0A 5IS2A 5FOSA 1RR6A 1OFVA 2X77A 3E61A 4HFRA 1K8XB 2WSLA 3IALA 4LYFA 1PJAA 1YZKA 3PENA 1BS2A 1KS2A 2WIKA 3IHTA 5HBGA 2CV1A 1ZQ9A 2ZRQA 2Q3LA 1QBGA 4HLNA 4ICIA 5CA0B 4UFNA 2HC9A 4OXNA 1C8VB 1XMJA 1LTQA 1N8SA 4HP8A 5EE5B 4V1CI 1A5BB 1L1EA 3KEQA 1M8JA 5JAZA 3PJRA 1H6AA 2JK1A 3AQIA 3P0JA 1BOFA 3QLJA 3PGVA 4TSKA 5AJXA 3IE0A 1JFFA 4WX2B 1K6XA 4RVFA 1E9BA 2NQ8A 1BCSB 1JQBA 1P4HA 4TVKA 1ENOA 3ASVA 2ZITA 3EFOB 3I5UA 3PEVA 4L08A 4AZTA 4BUZA 1Y1QA 1P6XA 2YHBA 4BLPA 4MVJP 3PFWO 4HB0A 3A26A 1JDPA 1MIHA 3BIJA 2EIXA 1PSZA 4Z4EA 3WK7A 1M1UA 4DYDA 4OJMX 1U1DA 4Q7EA 3ZTTA 5KYWA 2ZB3A 3UCXA 1J49A 4LSGA 2ONJA 3VTKA 4P4TA 4A23A 1XDBA 3KSUA 1AD2A 4MAFA 4MR7B 4DCMA 1BE1A 1U8TA 3CJTA 2M6LA 4MYRA 3AF4A 4PS0A 3OJFA 1VZ3A 1V8DA 1NMQA 2QORA 2GXSA 4RK6A 5K0TA 3GF4A 4GZMA 4IDFA 1JQ3A 3GUVA 3CGGA 3BKXA 1E1LA 2YVUA 3DPIA 3NEJA 3QG5A 1F2VA 2JVIA 4QGAA 2GRAA 3AETB 3FRJA 1SHKA 4LXUA 4OV6B 3OPYA 2X2FA 4MR8A 4RYDA 4YUXA 1N2BA 2HJSA 4IG4A 4YDQA 2GO1A 2VYFA 3I37X 1G98A 1KEEA 1SU6A 1NHGA 4GPIB 2FH5B 5T6BA 4N3AA 1BXRA 4HI0E 3ZDFA 2GZ3A 3C3MA 3ORQA 4AN4A 4PCAA 1OH7A 4KZKA 5AUPB 1YO6A 4QREA 2EFJA 2WYWA 3QHQA 4C7OA 1HYGA 1DC6A 1M2KA 1QQTA 1E4EA 2AMJA 2YHIB 4WXYB 5K4AA 4C5BA 4QT4A 4RKEA 1JQKA 1YQ9A 3AOGA 4U3JA 3ZJ4A 1R15A 2W6PA 3D6NB 5TPWB 1BO6A 1L3IA 2OB1A 3C0KA 5K5EA 2QMQA 2CXSA 2PEZA 3NU1A 4YLGA 4G97A 4M2LA 3FPGA 5CVDA 2JZCA 2YCBA 5AOVA 1W0JD 1IEVA 3HBNA 1V3VA 1ECBA 1ZISA 4LJ6A 5FA6A 1XQXA 3TH5A 5EZ6B 3TLAA 5KTRA 1DRJA 4JAVC 3VNBA 3WBBA 5JC1A 5EEGA 4DLXA 1B8OA 3C6QA 4TTSA 2P0EA 4AZ3A 4Q93A 3K9HA 5DSZA 1MXHA 5IWAB 1MEJA 3N2IA 3D5EA 1ZGHA 5HQ3B 5AK6A 4AJPA 3RYIB 3D7KA 1DS6A 1E59A 1C30B 1NASA 1NKVA 3NHBA 4LOJA 2QTCA 3WMFA 4DNOA 1E2GA 2H07A 4GXRA 4S1VA 4LF4B 1QHGA 3RLIA 2AZTA 1C7FA 4A1OA 4R8SA 1K7EB 1BEUB 3NIGB 5K3FB 4UU8A 1GL3A 1KSHA 5TNXA 3NLLA 1NATA 1N6OA 4YECA 1YS2X 2WG2A 3PEUA 1SZDA 5FV7A 4EG6A 2VPPA 4FGLA 1BRTA 2ACKA 1U4NA 1R6XA 1UMDA 1APBA 3AL0C 3OZCA 4L75A 1ZN8A 1MRSA 5CJ2A 3L79A 1SD2A 5FLYA 2E4WA 2O1SA 1AJEA 2CNNA 2QZZA 1SC9A 2ZRIA 2IITA 3AFMA 4L2IA 2ZI3A 4R1NA 4ZZ2A 4R9NA 3B9PA 1PZEA 2F3PA 2IFTA 2QUAA 3G9ZA 3OQIB 4RF2A 2WY2D 3KOYA 4PG6A 4DDVA 1V7CA 2CE7A 1XQ9A 4MV5A 4RVSA 3W4IA 1EHYA 3TYXA 4JOQA 3Q12A 2WU8A 1Q95A 4FLFA 4N40A 4AUMA 1UKBA 3KJZA 3HBLA 3P5SA 5ERXA 3T7TA 1ZM3A 3VR6H 1OZHA 5CYFA 1L5GB 5IWCA 3WWOA 3PNOA 3ZBTA 4BKRA 2HWKA 4PLGA 2XI4A 4X1OA 1FK8A 1FYDA 5BR4A 2FGJA 2WIDA 3B5EA 3PKJA 4YFVA 4CHTA 5JNSA 2PD3A 2HMVA 3HV0A 5F52A 2AFIE 3BK7A 1SG6A 3LT1A 1VE1A 2XJ4A 4NFYA 2Q2WA 1ZIPA 3DEZA 1YJXA 4MGHA 1AMOA 4K6OA 1EVJA 3AEQB 5K3AA 1JHAA 1MV5A 2PS3A 3P9XA 2FSUA 1GSOA 1LC0A 2O7NA 3IUQA 2Z8YA 3LQYA 4JX8A 4N03A 2B83A 4N3GA 1Y3AA 3HXOA 4R1UA 1UJCA 3ZU5A 4RSRA 3GJRA 1MBZA 3Q8XB 4L8LA 2CLEB 4RCYA 5T7BA 5JHGB 1W87A 3PB3A 4F96A 3BMQA 1Y8RA 3DYIA 1E1QD 3P4YA 4YRSA 1O0SA 2HF7A 2JLYA 5FWYB 3PDUA 4EM6A 3R3VA 2QMOA 1KZ7B 5GM1A 4CGYA 4L6CA 3H2HA 1E2EA 3HJAA 4S2UA 1LPPA 1ZO8A 1P19A 1SCAA 1A04A 3JD3A 4L4XA 3TXXA 1NJGA 4IAOA 5EZYF 2DF8A 4CM5A 2R62A 3WGVA 1ABEA 4HDMB 1DPFA 3AY0A 3GOHA 1FFDA 4NATA 1DIHA 4XFKA 1P1FA 2VDKB 4P3NA 2WAXA 3HSSA 4JBIA 2WSIA 2C9ZA 4FBLA 3Q11A 4LRXA 2M9MA 4CV2A 3C98A 3LX8A 7REQA 1HRKA 1CZOA 1BW9A 4MW6A 5EI5A 4A91A 4ETIA 3V55A 5L4LA 3TZCA 4B3JA 4DC1A 3UKJA 3R8FA 1UP7A 3JR7A 4IHJF 2HUNA 3UWMA 4HEJA 4BMOB 3USZA 3TTTA 4FB4A 4W5OA 3TOZA 4DG5A 4I66A 1EZ4A 4K1XA 1Q1ZA 2Y9MB 3F7NA 2PUTA 2H2WA 3DMGA 4GVPA 2VZ0A 4DNQA 3MAJA 5FAXA 1MUUA 1KO4A 2SECE 1KFEB 2X8BA 4IKPA 3NBKA 4XDZA 3E5RA 3OU6A 3Q9LA 5JJBA 3TLGB 1MGOA 2XE8A 3PTLA 4NV1A 2X0IA 4GBMA 4I81A 5LZ9A 4WOBA 5L3QB 3UUGA 3LXRA 1EP2B 2GN4A 4OHWA 3UCFA 4PTYA 3WLKX 4R68A 4MTCA 5HR5A 4OQNA 3U0VA 3WG9A 3BVPA 5F73A 4BLSA 3RWBA 2EL9A 4TVBA 2PAAA 2QN6A 3SJZA 4EBBA 3KZMA 1WPQA 3MLEA 4RJIA 3U4AA 5J5CA 3OAAD 5ESRA 1IBLB 2JLRA 1JNYA 5K99A 4EX7A 2JIBA 1Q16A 4MDEA 4GXNA 3FHTA 4HADA 1YR3A 4BFTA 1E1RA 1QZZA 2Q8QA 3HB1A 4AROA 2O06A 1Y3DE 3HI4A 1N5IA 4CEJA 2ECOA 2J3JA 3EEFA 1O5OA 4URVR 2IBMA 4WWHA 1WY7A 3SKXA 1FJHA 4PLVA 2AMFA 3SC4A 5HDQA 4PXYA 1RAFA 2KX7A 1I24A 4O1HA 3ROXA 3ZWQA 2C94A 3HBAA 1YXMA 3IPCA 2Z5VA 5EIOA 1FUUA 2FOXA 5I8ZA 3ETEA 2OL4A 3QA3E 2IPOA 1RKXA 2HQSA 2MTBA 4H35A 3TMKA 3WXBA 4NICA 5A7FA 3EG9A 4HQKA 2WYHA 5IJXA 3QX8A 1ADCA 3N75A 4IEEA 2W2LA 1W5TA 5C1PA 1QPZA 3KUDA 1ZGCA 5FHQA 2I4IA 3UJAA 3U1VA 3GJZA 3A06A 3OMLA 1CEYA 4MVJE 2HU2A 3SLKA 4LRQA 1QDLB 3A6LA 2JGJA 3Q41A 5CVJA 4QBKA 4CM9A 2CBXA 2WE8A 3LWZA 2ODAA 3HFRA 3PHIA 5BSEA 5BV7A 4TQUS 3JAKA 3WP0A 8ABPA 5IJ9B 1MVNA 2ZIZA 2AJBA 4F8EA 1JAZA 1QF9A 2OAGA 2J4CA