1NY6A

Crystal structure of sigm54 activator (aaa+ atpase) in the active state
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
247
structure length
247
Chain Sequence
b'EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator (NtrC family)
publication title Regulation of the transcriptional activator NtrC1: structural studies of the regulatory and AAA+ ATPase domains
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 66
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ny6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ny6A01
1QHSA 1CU1A 1SVOA 2GWHA 2ORWA 1NN5A 3IGFA 1NLZA 3AKDA 2PZFA 4LYFA 4MDFA 2PLRA 4YMWA 3KX2A 3N70A 3EX7C 2V7QA 3BE4A 5H8WA 1CRQA 4PQRA 2OT3B 3DO6A 1XXHB 1GKYA 4PAQA 1NJFA 4QHYA 4RVCA 5AUPB 1Z29A 4BPBA 4X8HA 4HDOB 1YR7A 3AV0B 4OQNA 5IRCD 2LWIA 3PIRA 4L5BA 1T3HA 3AGPA 2DWZB 2FEOA 4JLAA 1XPOA 3CKLA 1TEVA 2GCOB 2B7CA 2OFXA 3MJRA 1TADA 4HSEA 4ZI2A 4Q48A 4QNMA 4HB0A 2ZR0A 1RZ3A 1DVRA 1OIVA 1W47A 2DHRA 3KUDA 2ANBA 3LW8A 1E79A 1QVRA 2O8BA 1JB1A 4M1SA 4LBVA 4OJQA 4KITB 2DZOB 3BB3A 2YYZA 1Q21A 2AL7A 4ESVA 2X1VA 1IN4A 1KZGB 2WICA 4CEJA 1R6BX 2ERYA 3V4RA 1ZUIA 2RGXA 3L82B 2GJSA 5F98A 4IDOA 4IXMA 4Q9KA 4RZ2A 5CK5A 1KIMA 4UNQA 4M9ZA 2ODBA 3W90A 1P2TA 3RS4A 5GVSA 1JNYA 1NSTA 5FTKA 1TX4B 3G5UA 3CPEA 4ZDJA 1PUIA 1GWNA 1YZGA 4EFLA 2P0EA 1ZBDA 4NYIQ 2IYRA 1KHTA 1E9RA 4OI0A 2CCJA 2XNDD 4HB2A 3QXJA 4J0QA 3QOFA 3NEYA 2V54A 1KMHA 4R71A 2CVFA 3QVUA 4C3ZA 4HI0E 3CPHA 1CJMA 5JLJA 4YDHB 1E2FA 3SDZA 1G64A 3MHVC 2FFQA 2QI9C 1VPLA 5IT5A 3CF2A 3THYA 1IQPA 1MO5A 3EA0A 3KKMA 3W6NA 1ONBA 4F38A 3THOA 4P31A 3T34A 4HLDA 1OXXK 1F2UB 4URUR 2ZI5A 2ZRDA 3LLMA 3B8HA 3R20A 2O8FB 4KVGA 2GZAA 4UXIA 1OH6A 4RSGA 3KXKA 3U7HB 1N6IA 4AURA 1XTJA 1MRNA 1Q12A 2A5JA 2XXAB 3CO5A 4QJ5A 2P5SA 2J7PD 4MRPA 4M1KA 4MRVA 5KUTA 1DPFA 4QFMA 4WVFA 4AK9A 2MMCA 2ZJZA 2FSFA 5L3QB 2ZYVX 4BFVA 4HZUB 2AWOA 2DWQA 3T5GA 1TPZA 5L3SB 2OAP1 2XB4A 2J45A 4LDJA 4TWZA 3GEEA 5EXXA 4ITRC 5LB4A 5CM9C 1ZMXA 1XF9A 1YZNA 1ZUNB 1Z0DA 4DCNA 4AIIA 4PZLA 4MGYR 3MWLA 3QG5A 3KFXA 3EASA 1AS3A 4BFXA 2GESA 1KDOA 2G0TA 2HCJB 1XCMA 4B73A 3CONA 5C2JB 5G53C 3RLFA 4GT1A 1QHXA 2ZJAA 1R5NA 1T8UA 1NLFA 1RYFA 4AKEA 4N1AA 1BIFA 2CHVA 2VP0A 2ZRJA 3A36A 1XPRA 3P4XA 1F60A 1N0WA 1G3MA 1GSIA 2YZ2A 3K0AB 3K1JA 4LHXA 4MGKR 2N1BA 1BKDR 1YZTA 2OXCA 5EXTA 2ZANA 1XMJA 5DYGA 2ONJA 5FPKA 4HATA 2OBNA 2WSSD 3KKQA 3TIFA 1XTSA 1Q20A 2Y8EA 4HLCA 1NN3A 2BMDA 3QI2A 4M21A 3IIMA 2GHIA 2R6DA 4A2WA 3QQ5A 4L16A 4XTRA 1Z6YA 2IS2A 3TNFA 4DCUA 3HPQA 4M4SA 4Q21A 2FNAA 2F55A 5JCZA 3LQQA 5C1BA 1UM8A 3CRVA 3AF3A 4F4IA 4A8JA 4FW9A 3SBEA 2Q3MA 4JVNA 1Z2CA 1LY1A 1KY2A 3GFOA 2GJ9A 2VHQA 3QIAA 4URYR 3K9HA 4PZZA 1D2NA 1UKZA 1E0SA 2W58A 1ZNWA 1UF9A 3IEUA 4ZDIA 3U4QB 3OE7A 1ZIOA 4Q4AA 3LW7A 3EIQA 4PANA 1DAGA 3PV0A 4PPNA 5JSZA 2F6RA 4DCSA 2QTVB 4Q4HB 3AVVA 2DR3A 1RFLA 1G41A 2RCNA 2I4IA 3EZFA 2WBLC 4QBFA 3FMFA 1ZM4A 1IM2A 1ZU4A 3W3AA 4DB2A 2ZJOA 3ZS8A 3GLFB 3LRPA 2AK3A 1LF5A 2UVQA 4QBHA 1E2IA 4OHZA 4FI3C 2ZS8A 2ZE6A 3HR8A 4GSYA 4O2RA 3GJ6A 4R9UC 1B23P 3O8BA 1EFTA 2FEMA 2GDJA 1L4YA 3VMFA 1KI2A 1Z6TA 2ZI7A 4LC1A 2D2FA 2ONKA 1OT3A 2OHFA 1HUQA 3K0FB 3M6AA 1GUAA 1QHNA 1XD8A 2GJKA 3JZAA 2HYIC 2P3SA 2QPOA 4B2PA 4PO1A 4BQSA 4TMWA 2NO6A 3KKOA 2ATVA 3KXLA 3WRYC 5EP1A 3H0KA 3DZ8A 4JVSB 1N6NA 4MYTA 2BM1A 2BBOA 2ZAMA 2IYXA 2BVNA 3F0TA 2GCNA 2JJ1D 1G7SA 3L0OA 5DN6A 1G3IA 4V0OA 4A8JC 3FHOA 4JZKA 1UPTA 1W5TA 3U7EB 3F5FA 4KSCA 1MO6A 5CK4A 2CL6X 2IYVA 1XJCA 2CK3A 2ZEJA 5TB5A 5HZHA 2GXQA 3KQUA 3T5DA 1KO1A 2CEAA 3GLHB 4KCGA 1G9XA 1UBFA 3RRNA 1KDPA 4B3CA 3CPJB 2ZRGA 4DDWA 3IEVA 4NL4H 2F3TA 2VEDA 3NHAA 1COWA 4LX0A 1QG4A 3BWDD 1OKKD 2F3RA 3GMTA 3ZQ6A 2DVWB 2RAPA 3AVOA 4HAYA 2W2TA 1VG1A 1X1SA 1E1RA 5JZVA 2EFDB 2I1QA 3VR6A 2F9MA 3P4YA 1NMYA 2JA1A 1W0KD 3MFYA 4C0LA 4CF7A 4EPRA 4MRSA 5F9FA 2L0XA 4ERNA 2YWEA 3UATA 4M1WA 2WOOA 6Q21A 1HE8B 1E2QA 4A0HA 4UXJA 5FR2A 3B5JA 5FUWA 3BFKA 1F48A 3NH9A 2WMOB 4B43A 4PHHA 4JVLA 2G1KA 2YOFA 4YXWD 4ZCLA 1LTQA 2WJYA 1G1MA 3O47A 1ETUA 3ZIAD 1XEXB 4KV9A 4NONA 4XD7D 2ORIA 421PA 3ONWA 2B6HA 1XZPA 1GVNB 3U3MA 5EP4A 4D0NA 1IBRA 2JASA 5CDFE 2R8RA 4NH0A 3KJEA 3CIOA 2J0QA 3T12A 3LLUA 3WP0A 1YKSA 3RABA 1P4SA 4DSTA 3AUYA 2FX3A 4C0KA 1NY6A 5K8UA 3REFA 4BFSA 1CKEA 3GJ8A 2HYDA 5CDFA 2IYZA 121PA 5JWRA 4WZBE 5GJWC 3ZJYA 4AG5A 2WWXA 2YC4C 3RYTC 1NVWQ 1ZNZA 4DSOA 2J41A 3KTAA 3SYNA 1E3MA 1G8GA 4PZYA 1F2TA 1XBTA 1ZD9A 1CR0A 4S2EA 4QHSA 3VHXA 5A0FA 3ZVLA 1P73A 1E32A 3B1ZA 2V4ZA 3CR7A 1DAKA 3C5CA 3OIYA 4CEIA 4D2IA 2A5YB 4Q03A 3NDBB 5CIWA 1ZYUA 4WZAE 5BN5A 4DLSA 4QJ3A 1KO5A 3QJYA 3QXSA 4TYQA 3L8ZA 1NVVR 1ESNA 2NZ8A 2WWWA 4P0TA 4IOJA 3E2IA 1M2OB 1FP7A 1K5GA 2OBMA 1UBGA 5DGXA 5ANRB 4LOAA 4TT3A 3L8YA 2O0HA 3MWKA 1H8ED 1P2SA 3QBTA 2PT7A 2C9YA 2NO7A 3KB1A 2VSFA 2ZS9A 1RKBA 2EFEB 1CR1A 2FV8A 2QL6A 3LX5A 3VU9A 3NDPA 3ECCA 1NI3A 4NZYA 4ZV4A 2YC2C 1EK0A 4NP6A 3TH5A 4CRWB 1CXZA 2IEZA 4KAXA 2V7QD 4TLEA 3N2EA 5J4YA 3H2YA 3N2IA 3ASYA 1S3SA 1IXRC 4QM7A 1JAHA 5KSOA 1R0XA 3T35A 4Q4JA 5FUVA 3X1XA 1Z6AA 3ZVRA 4UXHA 5JS8A 3QSYA 2O8BB 5DIFA 4HUTA 4TYWA 4I4LA 2W2XA 1WDTA 4TYYA 2OESA 2CCGA 5KOYA 1QZMA 3IUYA 3X1ZA 3IKJA 2F7SA 3VHLB 2QAGA 4GRAA 4PQYA 1P75A 2WM9B 3AUXA 3CLVA 1GAJA 4B32A 4CEJB 1KI8A 3BJIC 1N5LA 3TR0A 3BFXA 1HTWA 1E79D 3QKSA 2C98A 3HU2A 2WWFA 2ZRNA 4QBIA 3WNCA 2O5VA 2QMOA 3QEJA 1P62B 1OV4A 1KTVA 3HU1A 1E6CA 4XOIA 3A37A 1OHHA 3NBFA 1P9NA 4ILEA 4OI2A 3K8YA 3OIVA 5E4FA 1N2CE 4RZUA 5A5GA 3RRYA 1YR8A 2J46A 2W83A 3DOFA 5BN3A 1FQKA 2YWGA 4KO8A 2K5UA 1IN7A 3Q3JB 1Q1QA 4LUCA 2XGJA 2FWRA 4TL7A 4QC2A 2Q9CA 3MGCA 4YC7A 2F1JA 3PUXA 4ZO4A 3I61A 3ZD6A 1KMHB 4KFSA 2ZJ2A 3KL4A 2ZRMA 2IYYA 2W0SA 1VIAA 2QP9X 2C78A 2EVWX 3IPYA 3UIEA 3THYB 4LJ7A 2PCJA 3D8BA 3VKHA 4B33A 1P5ZB 3OEED 4GZLA 4P32A 5BWMA 1U8YA 1U0JA 3RWOA 3KW6A 4IXNA 1W2HA 1YU9A 3P26A 1IN5A 2EFHB 1NNEA 1HYQA 3WNDA 1AZSC 2QQ0A 1SGWA 3BC1A 1EX7A 3R7WA 2QAGC 1W7AA 1KSFX 2XZOA 3EIHA 2D7DA 1H8HD 4ZIRA 2DFTA 2ZVQX 2BKUA 5FI1B 3SBDA 4RKFA 1W0JA 3DL0A 4JYCA 4RCZA 3Q9LA 2QZ4A 3N5CA 3DDCA 3A8TA 1T5LA 3TVDA 5HR5A 2REBA 3ZZUA 3OEHA 4ZKDA 1VDZA 3AVXA 1U8ZA 2ZRFA 3AVYA 3PCRB 3PG5A 5IF9A 3RWMB 4OQXA 3GP8A 3KQHA 3EIEA 4BGDA 4Q66C 3FKQA 3MLEA 3L0IB 3TJZA 3CX6A 5SZKB 1MT0A 4OQMA 1RRGA 4OHVA 4C0QC 1Q1BA 3B1XA 3PEVA 5CYOA 3DEFA 4P3YA 3I4LA 1R5OA 4TSFA 4IDPA 1VG8A 4US2R 4KODA 2IS6A 1NN0A 1JJVA 2QU8A 1W2GA 1N0VC 2RKOA 4WA7A 5G41A 1TTTA 2OSBA 3GLHE 1NLYA 4PC6A 5JS7A 2GZHA 4QL3A 1S9HA 2GXSA 4IOMA 2R6FA 2ZTSA 1DOAA 5KDOA 4DZZA 3WXMA 5JEEA 4D82A 4UJ3A 2QENA 2Z43A 3FOZA 2XSZA 1W36D 2IBMA 2OUKA 2WKPA 1CBUA 1LS1A 4IEEA 2GEVA 3FTQA 1MKYA 4OHYA 2ZSEA 4A8JB 2QPTA 3H84A 1JQLB 1KK1A 2OM2A 2OV2A 4M9QA 4H1VA 4WOPA 1E2KA 5DLQC 3W3ZB 1AGPA 1Z28A 1YRBA 4A1FA 2C99A 3C5HA 4A0GA 3GFTA 1WBDA 4CVNA 4Q4AB 3ZZTA 2B92A 2GKSA 1E2DA 2ZI3A 1Q44A 2GJ8A 2QRZA 2HCBA 3FVQA 4Q9HA 1AA9A 4B34A 4B76A 1A4RA 1JPNA 3GD7A 1RC8A 1HA3A 4WXRA 5E7IA 4NKRA 3I1FA 1CLUA 2WHXA 5EZ6B 1VCNA 1GM5A 3K0SA 3SC3A 1XNJA 4BFUA 3DKVA 4Q18A 4JS0A 3U7GA 3FMOB 3D7MA 2C8VA 3OE7D 4EIWA 1DEKA 3VLFB 2ZE7A 3B9PA 4Q00A 5FOXA 1E9BA 2YWHA 4MUAA 2CL7X 5CM8B 2PZGA 1GFIA 3TW8B 4EPWA 2D3WA 2ZITA 2JLYA 3ND8A 2BMFA 5C4MA 2VO1A 3VR3A 4NE2A 3DMNA 5KU1A 1CJTC 2ZUDA 4O0MA 4F91B 2Q0HA 5FL7A 4LBZA 4ZCIA 1NP6A 3X1WA 3QE0A 1N6PA 3VX3A 3W9YA 4PO9A 3B7GA 2WVJA 2HEIA 5EE3A 521PA 5DH9A 4Q7LA 3QKRA 4G01B 1E9FA 1BMFA 1N5JA 4JIMA 2ZU6A 3MCAA 5FL3A 4ASUA 4E03A 1AKYA 5K8LA 2V55B 5ELXA 4JLOA 3GQBA 3EC2A 1TQ4A 1ZUHA 3Q8XB 2ZROA 1UKYA 1E4YA 4XJXA 1X8LA 5CLQA 1OH8A 2FPLA 1XTQA 2O0KA 1F3OA 1VCOA 2QRNA 2WZQA 3SJBA 4QGFA 4G1UC 1E1QA 3UXMA 2FPKA 3BAFA 4U5XA 1E4VA 1T4GA 5DN6D 1GL7A 1MV5A 3UKDA 4LPKA 5GADl 2Q3HA 4DDVA 4LJ6A 3LVRE 4Q7MB 2IHYA 4PPQA 2CK3D 4L4UA 4BLQA 4URXR 3WNBA 2QMHA 3NIBA 1E9EA 4PPGA 3BIFA 2OEPA 1OJLA 4JSTA 2IF0A 4LV8B 2A30A 1Z22A 2IT1A 4Q1AA 4URWR 3NBYC 3T15A 1NVUQ 4TLAA 4BFZA 1KYIA 1G6OA 2VBCA 4JLBA 4OYHA 4PXAA 3RNLA 2MSDB 2RHMA 3L2OB 5J47A 3K09A 2PJRA 4G0NA 1TMKA 3FWYA 4KYUA 4A2QA 2JIZA 2ODEA 2ZYWX 2G6BA 1NIJA 3TUJC 2JLVA 3AVTA 2C9CA 2G3YA 1E1RD 4PSAA 3O8RA 3WRXC 1R10A 3CRW1 5DYIA 2H18A 2QT0A 1MH1A 5FI0B 4B44A 2C96A 3NWJA 3I5YA 2V8OA 4KBFA 5DHFA 4US1R 2J3EA 1DG3A 1II8A 2QSZA 4NTZA 3CNOA 5KNCA 3K70C 1KK3A 4ZCMA 1TQ6A 3EG5A 1KNQA 2JLQA 4UQOA 1SVSA 4K8OA 3VX4A 3GCGA 3U60B 3K9LA 1QRAA 4WAUA 4GOJA 4ZDWA 3TK1A 4EPYA 1GP2A 4DB4A 2YOHA 1VIYA 2JATA 2GK6A 3TUZC 5EE1A 4W5JA 4I1UA 2F1IA 4QKQA 1S2MA 5AUNB 1QHYA 4TQ9A 3QPUA 4FN5A 4A92A 2PZEA 3NVAA 5LBIA 3L0SA 3SQXA 8OHMA 3C14C 3FGNA 1KJZA 3UG6A 2WJJA 4IDHA 2VRWA 1TNDA 4M1OA 3GLGE 3B1VA 3EPJA 2YJTD 3KTAB 2RGEA 4JT2A 4DLZA 1JXMA 1YHNA 2Q9BA 4PHGA 2EYUA 5CB6A 1F2TB 1JR3E 2O52A 3A4NA 4DVGA 4NPHA 2BCJQ 3QPVA 1XJQA 5FUYA 2ZJBA 5JRJA 3WYFA 3GLGA 3ADBA 3K09C 3A1VA 4PSKA 4GFDA 3CF0A 1U9IA 3U3JA 4B6EA 1Z6GA 1EFRA 5H70A 4CEIB 2D06A 4A82A 3I32A 4WXPA 1LV7A 1OB2A 2AR7A 2V1XA 1JR3A 4RD3A 3BORA 3RS7A 4C0BA 3EARA 3FDIA 2KRKA 3VR2A 4GI7A 2Z0MA 1FOEB 2R62A 2KSQA 1FFHA 3VFDA 1KAGA 2BMEA 3GJ0A 2JJ2A 1E2JA 3D31A 2C5LA 1YZLA 5KSPA 3B9QA 1QBKC 3F3YA 1Z8FA 3VU9B 4JVMA 2ZS7A 2CNWD 4RD2A 4EJSA 4EQ6A 2VHJA 4IHQA 4PC7A 4TT3D 1Q57A 4Q01A 4BLOA 1LS6A 5B64A 1DO0A 1PZNA 3L43A 4HLUA 2XNSA 4BLSA 4ZKEA 1GRQA 4TMVA 3UMFA 2RGAA 4C0JA 4C9BA 2FSGA 4Q4JB 3LD9A 2VHCA 2NQ2C 4MH0R 2BC9A 4AY2A 3QEOA 3UG7A 1D2MA 2ZSBA 4AKGA 2C03A 3Q72A 1GDDA 4V02A 1A1VA 1OXVA 5JI2E 3PUWA 4FMCF 2BEKA 3UMSA 5P21A 1SKQA 3SHFA 2V3CC 3C4JA 1IY0A 3O8CA 4FMDF 1EG7A 2WJHA 3NEJA 1L4UA 1UKVY 1M8PA 2XTMA 3QKSB 5A4JA 3EZ9A 1U9IC 2KE5A 4Q1BA 4TQAA 1M6NA 1KDRA 3I3SR 4URZR 1SHZA 4TTRA 5M04A 3QF7A 3O8DA 1N6RA 4UNRA 4IOKA 4FCWA 4JLMA 1SULA 4IJMA 1Z0IA 2FZ4A 1HH4A 1G8YA 5EUQB 3I5XA 5EP3A 1VHLA 1JEDA 3B1WA 2Q3FA 4A6PA 4D81A 3ZYCA 4HLQB 1NJGA 2CMKA 2OLJA 4LHYA 4DDTA 3EZ7A 3VKGA 1D6JA 1R4AA 3EAQA 1NBME 4F4CA 5KSZA 4KXFB 4QHTA 1OHHD 2QTFA 4B3XA 2IXGA 4XVUA 2Q9AA 2W6IA 1LB1B 4EJSC 2ECKA 1XRJA 4U02A 2IYUA 1I2MA 3AVUA 3IBYA 2PEYA 3E70C 4HLUC 5GJVC 1C9KA 1KMQA 1K6MA 1NBMA 1D5CA 3HDTA 2BBWA 3U44A 3HYRA 1AGRA 3FMPB 2GXUA 4BEBA 2DCUA 4PPFA 1FMJA 3AQ4A 2FFAA 2P5TB 1TUEA 4FXPA 4A4DA 2A2ZA 1BYIA 2JLUA 4CZ2A 1Z0JA 3CF6R 3IDQA 1ZC3A 3DZDA 4FWIB 2J0UB 1N6LA 1TEXA 4RKEA 4BECA 4DKXA 2OAQ1 1XEWX 4OQLA 1G8FA 3R7WB 4ON9A 4QG7A 1E0KA 1HY3A 4ZIRB 1G5RA 2VP6A 3C8UA 1M34E 3BRWD 3MRSA 4IFBA 4ACBA 1HT1E 4B48A 5JSZB 1Q1EA 2ODWA 4GPTA 4AKIA 3BOSA 2J0SA 4M1YA 4FCTA 1VYUA 1VHTA 1MOZA 1NN1A 4TMKA 5CB8A 2KB0A 5DNYB 4CT5A 2EQBA 4LJ8A 2F9LA 4PHTA 1W0JD 4G5SA 2BOVA 4BZQA 1E2GA 4YMTA 1FX0A 2ERXA 2FFBA 2YHSA 4XVRA 3SNHA 2EFGA 4F92B 1IONA 4KYIB 3VR4A 2ZI9A 2QMUA 1G7CA 4M22A 2HUPA 3AVPA 1CJKC 1NKSA 4Q19A 3MAAC 4OK5A 1OYWA 2RGCA 2E87A 4B3DA 3KUCA 3KDSE 3Q5DA 2BWJA 3G0HA 3NG1A 4JN6A 1II0A 1OFIA 1Z6XA 5JHHB 3SQWA 2D74A 2FG5A 3TRFA 2E9SA 2ZR9A 2DB3A 4JT4A 1YRAA 2ZRBA 1CR4A 1P6XA 4AYXA 5CYPA 3NBZC 4K46A 1OFUX 4LHVA 1G291 4TSFD 4PR0A 4C30A 2ZSFA 2J0VA 5KO2A 1AKEA 1XCPA 2YOGA 1VYVA 1ZP6A 2VF8A 1XU4A 3CH5A 1Q3HA 2AHOA 2IYWA 3D6TB 5FPSA 3AF0A 5DI9A 2O8EA 1GG2A 4DHEA 2A5FA 2V6ZM 4MUBA 1KSGA 3H1TA 2AXNA 2QNRA 1AM4D 1MO3A 2QN6A 1GRNA 5DSZA 2CHGA 3U6BA 1YZQA 1R0WA 2HF8A 4AYTA 2HT6A 5DE3A 2QMEA 1XWIA 4LHWA 5HKKA 2AWNA 1YZUA 1YQTA 4TTPA 3TE6A 3T1VA 2VL7A 1ZJ6A 2ASEA 1T0JB 4D4MA 2VA8A 4JLKA 1IOZA 2JLZA 2Z83A 3JZMA 1KI7A 1N6KA 4CDGA 4Z8XA 1TL7C 3C15C 3CZQA 2G88A 1E0JA 2WAXA 3SJZA 2ZETA 5KNDA 1Z3IX 5L8VA 1Z5ZA 3VR1A 3TGPA 4D25A 1XD9A 4HZIA 1FNNA 4LRSA 4B47A 3UPUA 3DVLA 1NIPA 3RC8A 3U7FB 2J9RA 1OE0A 1SVMA 2ZAOA 1X3SA 3SR0A 3FMIA 1SHKA 5KTYA 5AUQA 4KSBA 1JI0A 4E07A 2JGNA 4LYHA 1NG9A 1KDTA 2QSYA 1OFTA 2ZRHA 4O25A 4YQFA 1G8PA 1IJFA 3QKRB 2GTPA 4P4TA 1YZKA 5J4KA 3K70B 3QXHA 1P2VA 4KFRA 4QGGA 4YMVA 3RS2A 5FL7D 1ZIPA 4CYMA 4LRWA 4DRZA 2ZI6A 2A3RA 2OCPA 4WW0A 2P6RA 4UKDA 4UNPA 1RIFA 1F6BA 4C4PA 3K70D 1BMFD 2AN9A 1CS4C 2LCFA 2QM7A 3PEUA 4JYBA 1G20E 2KBEA 2NIPA 1TU4A 2V6JA 4RCYA 5LD2C 1TUIA 5JCPA 1PVOA 1IJEA 2WPDA 3BERA 3REGA 1Z0KA 3EA5A 1CIPA 3MUFA 4Q4LA 3SN6A 5E7MA 3A1TA 1E1QD 2OO7A 3FB4A 1E98A 2AFIE 3CRRA 4RZXA 1CRPA 4YMUA 3V4FA 2LKDA 3A6PC 5JMTA 5FTMA 4CGZA 3CWQA 5KNBA 4DJTA 1RRCA 3DM9B 1DAFA 3IQWA 2WWGA 2ZSDA 1NSFA 1M7GA 2FMXA 3IQXA 1WXQA 5K8TA 1D9ZA 1OXTA 2C2HA 3ZDQA 2P65A 2IWHA 1ZM2A 4JLNA 4FWHA 3DOEA 5AJVB 5EE5B 4DEXA 4XH9B 4RFSA 3B78A 1W48A 2LKCA 1T5IA 4NCKA 4A0RA 1KZ7B 3HU3A 1AJEA 2JIZD 1TAGA 4HB3A 1II8B 3PEYA 1E69A 1UBCA 2A5DA 1U94A 3RS0A 1AQUA 1OPXA 2BIFA 2RHDA 5DISB 4TL8A 2IW3A 2QTHA 2RGBA 1R8QA 1SVKA 1GZSA 2J1LA 1E2NA 3R9IA 3WMGA 1GL9B 4B3FX 4M9XA 2MSCB 1P7CA 1SVLA 1R7RA 3LA6A 2A5GA 2ZJYA 1G8HA 2G77B 3PITA 5G40A 2CLSA 3LQRA 2BV3A 3HYTA 2XITA 4DLRA 2QBYA 5IHPA 4BZXA 5E3HA 1X86B 2J59A 3PUZA 2PMKA 2IYLD 3I72A 1A82A 1GL6A 3CB4A 2CJWA 3ICQB 2OLKA 2DWOA 1AN0A 1A2KC 1KNXA 1M7BA 2QE7A 4Q7JB 2FGKA 2WWIA 2RGGA 4M53A 4LY6A 5LB2A 4JKYA 1XMVA 4OI4A 5JWHA 3FFAA 2B8TA 4Q1DA 3GLGB 5FFMA 3UANA 2QROA 4XIGS 1GKUB 3MMPA 1AQYA 1N3BA 3BS4A 5AUOB 2GCPA 4K81B 3LWNA 3D3QA 3TLXA 4IOLA 1E9CA 4I1SA 1BYUA 2FJUA 4S35A 5FPTA 3OIWA 3WBKA 4V03A 4DBLC 1J8MF 5AWFC 3ZGXA 3V9PA 4GOXA 1KGDA 3K53A 1EFRD 2ZM5A 4HYYA 1JR3D 4QRHA 3HR7A 5BYJA 4E5UA 3K0CA 1L8QA 2VPPA 3QNUA 2MMGA 3EWAA 2SHKA 1G4UR 4BE7B 4M1TA 5L3RA 2BEJA 4EJSB 4EQ6B 1J8YF 2TMKA 1DE0A 1XD2A 3HPRA 4RJLA 5KDDA 2VH5R 1ZVQA 5TXGA 3OZXA 1CF4A 2AKAB 4BRWA 1OLOA 2JJ2D 5FBVB 2C95A 2GEDA 2J87A 1DG1G 4GITA 1RE0A 4DLYA 4MKHA 3EC1A 3SJCA 1XP8A 3QXXA 2I1VB 2QPAA 1N6HA 2V6IA 3TAHA 3WBJA 2QUZA 2R6CA 3FHTA 4A3VB 2YV5A 4NYMQ 2XEXA 2XJ9A 1AIPA 2DYKA 1CTQA 4ESHA 4N0DA 1W1WA 4PC1A 2ZE8A 2C77A 2UZ3A 2YINC 4OQFA 4DIDA 1UEIA 1Q0UA 4RZ3A 2FDCA 3T06B 1MO4A 4KLNA 4JJKA 4B75A 4AI6A 2ZRAA 2NZJA 4U7DA 2YKGA 4E22A 1UDXA 3AKYA 2IS1A 1GILA 1G5TA 3ZLJA 1Z0FA 3TSOA 3TSZA 1W49A 1XB2A 5HCNA 1UEJA 2JLXA 2IC5A 2JAQA 2PLFA 4BRUA 4DLVA 5J5CA 3AVQA 2NPFA 2B8WA 3Q85A 2FF7A 2J5XA 2ZUCA 3ZVMA 3QY0A 3SJAA 1G3QA 1BOFA 2FN4A 4FIDA 1G18A 2OCAA 3I92A 3LY5A 1SZPA 2O8DA 4BLRA 1R0YA 4KBGA 2FSHA 5D3MA 3LDAA 3ADDA 1E0AA 4YDSA 1NMXA 2FPMA 2HV8A 3K0CC 3NXSA 3I73A 5JWOA 4V0KA 5IDVA 1WRBA 1M7HA 2H7VA 2RGNA 1DTSA 4TMXA 3T61A 1BO6A 4JBWA 1I4TD 4MKFA 4ZDKA 2JJ1A 5G3ZA 4V0MA 2G0NA 3ADKA 5TARA 3EPLA 4P4SA 2BDTA 1YE8A 4EFMA 4MITA 1T9HA 4QNRA 1P61B 3U44B 2GETA 3AP1A 1KO4A 1Z47A 2QP3A 5DHAA 2W6ID 4YLGA 2RB4A 4W5HA 3DPUA 3ZH9B 5DI3A 1HQCA 1P2UA 4Q47A 5HCIA 3THWA 1ZCAA 1KI6A 1NBMD 1KO8A 1X37A 1FUKA 2AD5A 5JI3E 2CVHA 4TL9A 5EE0A 4PO8A 3VNUA 2AXPA 1M74A 5FUXA 4CEHA 4MYHA 1KK0A 4DDUA 4AD8A 5FBQB 1W46A 3CUEF 3RS5A 1OXUA 2NTYC 4OI1A 4C0SA 5EJEA 2BJWA 4LV6A 1MABA 4KJZA 4LJ5A 4TYPA 2ATXA 2XZLA 2OFWA 1Z07A 3RRZA 3KJIA 1TU3A 2ZJ5A 3E1SA 1UFQA 5FPYA 3EWSA 4WBSA 2X77A 4F7WA 1PLKA 1I4DD 2EYQA 1FX0B 2VP5A 4TLCA 4LJ9A 1U98A 3A4MA 2CBZA 5B30A 3FPAA 3T1TA 2X2EA 2WTUA 1NY5A 2FE4A 4DLTA 3BBPA 2RGNC 1T91A 3AKCA 3LXXA 2DPXA 1U8AA 3KJGA 3LXRA 3QVVA 4NBSA 2R2AA 1ELOA 4KFTA 4JBXA 1N5IA 1ZD1A 4F93B 2WJGA 1DS6A 1VKJA 3AJIB 2BBSA 4OK3A 1UBEA 1W4RA 2IYTA 4UNNA 1NKTA 4C2TA 2WIBA 4M8NE 2WMNB 2JLRA 2ZJ8A 4MQBA 1XZQA 3BFVA 3SEAA 1FPMA 4Q9IA 1OXSC 3UMRA 4TYNA 3CRMA 4CT4B 5JEDA 2HLDA 5KHOC 3IHWA 1ZCBA 5BW8A 2AK2A 2RGDA 3B2EA 3KB2A 2H5EA 2Z4SA 3OAAA 5JJLA 3LX8A 1Z83A 1HURA 3B85A 4BUJA 2I3BA 4E09A 4JL5A 4GMDA 4PC3A 4RD1A 3MG9A 4A2PA 2FA9A 4DUGA 2O8EB 1SVIA 1SKYE 1JQJC 2QY9A 3KQLA 2FH5B 2JLSA 4Q02A 4RD4A 1IHUA 3K9GA 3NC1C 2IUSA 2G9NA 3WMEA 1T8TA 2PMDA 1C4OA 3WYAA 4XVQA 4Q9JA 3B60A 2ZI4A 3ZQJA 3AF4A 3U3KA 3SHWA 4IVRA 1PLLA 5DO9A 1S0UA 5E95A 3WMFA 5GJCA 1ESMA 3U6KA 4A15A 1COWD 1S3GA 5AJYA 5LD2B 4N0EA 3LBNA 4C7OA 3ICEA 5CIQA 4RD0A 3RC3A 3I62A 2CDNA 2ZIAA 3IO3A 1RJ9A 4EUNA 1OH7A 5KYKA 4B71A 3RS3A 2HDNB 3RHFA 2IWRA 2F43A 2IXEA 1R2QA 4ARZA 4HDQB 4BLPA 5TV2A 4DIEA 3VR5A 1JAIA 1KSJA 2R6AA 2OXRA 4W7SA 3QKTA 3KQKA 5HKKD 1D2EA 2HJGA 4UJ5A 3SZRA 1FNMA 1TF2A 3UWKA 3AP2A 3GJ4A 3PJRA 3M0EA 2G1JA 2H16A 3EPKA 4NHOA 3RSLA 2XAUA 2J7KA 3WYGA 3CX7A 4PTLA 4LYJA 4D26A 3KKPA 1EESA 3H4MA 1XX6A 1E99A 2A78A 3OFNA 3Q5EA 3RRMA 4D4LA 2AX4A 3SFZA 1ZRHA 3JVUA 2VP4A 4M9SA 4DXAA 4QM6A 1K5DA 3TUIC 4HAXA 5J4LA 2VHUA 3RVBA 4C2UA 1OF1A 3GEHA 4Q1CA 2ZRIA 1G19A 1JXOA 5IK2A 3TMKA 3QKUA 1A5TA 1IXSB 1G7RA 3QF4A 1OSNA 1RW4A 2VHTA 4HUQA 3V00A 2D7CA 3PR1A 4A6XA 4H9GA 1XEFA 5EUMA 1M1YE 3GJXC 1SXJE 2OBLA 3I8SA 2ODNA 1P60A 2CLCX 1KKMA 3DHWC 4YONB 4HAZA 5JJIA 2VP2A 2NO9A 4FD2A 3GEIA 3W8RA 3BB4A 1D9XA 2WOJA 3K9NA 3P1JA 5FTNA 1T3SA 4I81A 3BD9A 4I99A 1ANKA 1SXJA 1G5PA 1C1KA 5HE9A 2GF9A 3IHLA 3LBIA 1LW7A 2WPDD 2IX3A 3S1AA 5G3YA 1NG1A 3CZPA 2F1RA 1G16A 1XTIA 4B3BA 2OFOA 2W6JA 1CULC 4P33A 4GMXA 5C46F 3OEEA 3W8NA 2DBYA 2EW1A 4RFSB 1S1CA 4LWZA 5TMPA 4M0LA 1VCIA 4EAQA 4R2IA 2PJZA 2CE7A 4Z1MA 4JKIA 4QOSA 5B58C 2D62A 2XZPA 2OG2A 2ZRPA 2QGZA 1QHIA 1P9RA 3IBGA 2VQSA 5AJXA 1FTSA 1JALA 5SZHB 3EW9A 2HT1A 4A36A 4IRUB 1H8HA 4NDZA 2R9VA 2CLDX 5JRZA 1DAEA 1OIWA 4LK2A 1J7KA 2YWFA 4JLVA 2QAGB 3MWYW 1KOFA 3PVSA 2WSMA 2QBYB 2CHQA 4W9MC 2R65A 2QM8A 1QF9A 3SE0A 2R6GA 1JECA 2H1LA 2IUUA 3CBQA 3R8CA 4DCTA 5EE9A 1KJYA 1KAOA 4XWAA 4DT1A 5AJWA 1LNZA 2GA8A 4Q1FA 2JDIA 1WBBA 1WCV1 2CJWB 1VECA 2VYFA 1TF5A 2PCLA 5FR1A 4A9AA 4CIDA 1XJ0A 1DELA 2NO1A 4KLZA 4TZ6A 1PJRA 1E94E 1SXJC 3BH6A 1QHHA 2GNOA 4KU4A 4XSGA 1HQYE 3LBHA 1W4BA 2REXB 3AVWA 1P9WA 2QT1A 4YMSA 4M2LA 4TLDA 3B1YA 4X8LA 4QGHA 4C0HA 2QE7D 1FUUA 5GVRA 4MGZR 4BZPA 3U61B 3WY9A 1EWQA 4PAMA 1GTVA 4DLXA 4UNSA 4U00A 3THXA 1UAAA 3KZ1E 4G5QA 3QENA 2C04A 4ACAA 3C41J 3CM0A 5BQ5A 1Z08A 4LGMA 2ZXUA 1DO2A 2V1UA 3NKVA 1JPJA 1XEWY 4NYJQ 1ZC4A 2ZSAA 2XB2A 221PA 1MR3F 3PUYA 5FBWB 3K0EA 4PX9A 4US0R 1G6HA 3ND9A 4LCBA 1XD2B 1AS0A 3AM1A 4LJ4A 4RY2A 5JJKA 5C4GB 2DFNA 2OCYC 3H86A 2P2LA 2XOKA 4LHZA 3PXGA 1SQ5A 1PLJA 3DMDA 4PSVA 4IDQA 1ZU5A 3M4YA 4PAOA 5EZ5A 3BGWA 3GLIE 2O8CA 1E2LA 1W4CA 3ZZ0A 3ADCA 3TBKA 3CH4B 3A1UA 2FU5C 2HXSA 2WIAA 4QBGB 2Z6VA 1S9DA 1E9AA 1RRFA 3SOPA 2OZEA 3LVQE 3GLIA 3WP1B 2EWVA 3KXIA 5JFGA 2JCSA 1W5SA 1PUJA 2HJVA 4LZZA 3FKSA 4FMCB 1X8JA 1Z06A 4D6PA 4NCIA 1DARA 3CWZA 1G3UA 1V5WA 2GJAA 1YR9A 1ZAKA 3E5HA 1R8SA 5FOWA 1ZNXA 3FYHA 5HPYB 4FMDB 1DAIA 1F5NA 1L2TA 1VG9B 1VTKA 2GRJA 1RRPA 1JR6A 2VSOA 1LF0A 3OEHD 1EFUA 4JLDA 4HAWA 3EXAA 2WWYA 4TLBA 4LC0A 4II7A 3EPHA 1V43A 1R0ZA 1XTRA 3QG1A 2X2FA 2IA5A 4DWJA 1C1YA 1G17A 5FOSA 2FFHA 2O8DB 3M1IA 3TW4A 2EWWA 5D3MB 5FBRB 4NYMR 1W36C 4AG6A 3UK6A 1CJUC 2ZYUX 3FHCB 2CE2X 1KSHA 1XPUA 4LSGA 4NMMA 1US8A 3DKPA 4FWDA 5HTKA 3CX8A 4I1VA 4TN1A 2KI5A 2NGRA 2XTNA 4P4SB 3SU8A 1BH2A 2REOA 3PFIA 1N5KA 2E1RA 4GP6A 1G21E 4WIAA 4O2LA 2NOAA 4ABYA 4JBYA 3AH8A 4FCVA 2XTZA 4EPXA 5DI3B 2JJ8A 2GF0A 5C18A 4MKIA 3THWB 3SFVA 1HT2E 2XSZD 1KI6B 1GNPA 1HV8A 2V9PA 5AR1A 2IS4A 1XMIA 2KBFA 3QXCA 1FW6A 3WHKA 3OIUA 2OCBA 4LBYA 4LBWA 2D2EA 3GJ3A 1G3RA 4L15A 2H57A 721PA 4MRRA 4CEHB 3SYLA 5KPDA 1P3JA 1GRRA 1Z2AA 2GEUA 3JVVA 3LV8A 3W34A 1MABB 1XXHE 1H65A 5BN4A 1JBKA 1Y63A 3B6EA 4OHWA 5FH9A 5D3QA 3U3OA 1KJWA 1U81A 2GK7A 1Y3AA 2AFHE 4JMPA 3TKLA 1KI9A 4H1UA 2ORVA 4MGIR 4AWXA 4EKDA 5GJBA 1XXHA 1FL9A 5TDHA 3TVTA 2GXAA 1KK2A 4LRTA 3TR5A 5F9HA 1J99A 2ZPTX 2P6NA 3QUSA 2GZDA 5KDLA 1LVGA 1WQ1R 4OK6A 1UADA 3KJHA 4IW3B 1I4LD 2KJQA 2GCOA 4PC2A 5CJ2A 4TZ0A 1DAHA 2NO0A 1RPZA 1A7JA 2UKDA 2YNMA 3NHBA 4NCJA 4BLTA 2IYSA 2ZVPX 2GVDC 4MYUA 1U90A 2OILA 3WHLA 1IXZA 2CCKA 2N42A 1WB9A 2WV9A 1G4AE 1E9SA 2ZREA 2FSIA 4M1MA 4ASUD 2VIIA 3BH0A 3HP1A 1U2RA 3RDPA 1ODFA 4C0AC 2QP4A 2B21A 1N25A 2IYQA 2HLDD 2W0MA 3OAAD 1GNQA 4LPSA 2VSXA 3C7KA 3IIJA 2H8KA 4KI0A 2XNDA 4B3GA 5H68A 1IY1A 1JJ7A 1SKYB 5H1YA 4DUGD 3BH7A 2GVZC 4JL8A 2IL1A 4C7OB 1A2BA 1T3LA 3KKNA 2O0JA 1NF3A 3L0PA 4Q1EA 3SI7A 4B74A 4JLJA 2RMKA 1RJ9B 1KY3A 2AKYA 3FFBA 4PHFA 2F43B 3UWOA 4ARZB 5FTJA 2A9KA 3IPXA 4HEJA 5UKDA 1UJ2A 3BB1A 3MWJA 4EPTA 3AF1A 3AEZA 1E96A 2CNWA 621PA 2HF9A 5KSYA 1J2JA 5CJPA 1RVDA 4DSNA 1OW3B 1L7VC 3W5JA 2QG6A 3B82A 3QBVA 4TMZA 4ZPXA 2WJVA 2XJ4A 1F2UA 2J7PA 1KKLA 2VF7A 3AKEA 1E9DA 3NBXX 1OB5A 3KFVA 3CRQA 4A0FA 4ZI3A 2D4HA 2O8FA 5JBQA 4Q7KA 5LDDC 1TQ2A 3A1WA 1GNRA 2VLIA 1QDEA 3CR8A 4V0LA 5AK0A 5JHGB 2Q21A 3AB3A 3ZD7A 3Q7PA 4R2HA 4IEIA 2XXAA 3EZ6A 1ZD8A 2BBTA 3OFND 4MA4A 4D4JA 1K8RA 2CXXA 2HXYA 2BHRA 1SVWA 2R44A 1W4AA 2IEYA 3OHMA 1ZNYA 2IF2A 3QF4B 1EWRA 2PL3A 4OL0A 1JEEA 2BCGY 2JEOA 4HUQB 4RD6A 4D0GA 5HZKA 3BK7A 5L3QA 1W44A 4HZUA 4MKGA 1S96A 5L3SA 3CNNA 4PQFA 4GOKA 1AS2A 1N0UA 2PH1A 4TTQA 4FINA 4IVQA 4BASA 5IK2D 2X19A 4IKEA 3SS8A 1ZM9A 1GITA 4QJ4A 2ZRLA 2PEZA 3EZ2A 5E7JA 1FZQA 4GNKA 2PX3A 3F8TA 1AZTA 4GBMA 2WSSA 1Z63A 1SXJB 2DY1A 1G7TA 1E2PA 3A58B 2YVUA 4BFTA 2X8AA 1VMAA 1B0UA 4GL2A 3S1AB 2BJVA 2QAJA 1Q1ZA 5B57C 4B35A 1IY2A 3K0AA 1HE1C 2QGNA 2IUTA 1YR6A 4DLUA 2GBLA 3KQNA 2VTKA 3NH6A 4IFEA 2BMJA 3CNLA 3A1SA 1SXJD 1TF7A 2ZUBA 3P20A 5B2ZA 5K8IA 3X1YA 1X8KA 1E2HA 3VTKA 4URVR 1QG2A 3R8FA 4Y0VA 5AJZA 1LFDB 2BM0A 3TQCA 1J70A 2OE2A 2ZU0C 5BYKA 2GAOA 3OF5A 4IVPA 2W6JD 4QXAA 4HAVA 4Q9LA 2IHBA 4BWYA 3W6PA 2KWIA 2WKRA 4NCHA 2UZIR 1U99A 1CEEA 4Z8YA 3PENA 2ZRCA 4Z1MD 1PV4A 1U0LA 4JSYA 1KI3A 4XWOA 1GIAA 1YJ5A 821PA 2J0UA 1XTKA 3P32A 5FTLA 3U4QA 5BXQC 4NYIR 1ZM3A 2MSEB 5TVKA 4Z51A 3U3RA 3GLFE 4O3MA 5SZJA 3NTUA 3W5IA 4DT1B 4F4JA 1KI1A 1NVXQ 1S1MA 4MDEA 4FMBB 1WE2A 3U5ZB 4Q4HA 4D0LB 5EXPA 3G82C 2A7QA 1FP6A 1Z0AA 1WMSA 1FTNA 3P27A 4LV5B 4N3NA 4B2LA 1T0HB 5LPNA 1T6NA 4JL6A 3GLFA 1GKIA 1QHHB 1BS1A 4R98A 2CL0X 5F2EA 4BFYA 4BEJA 4NU0A 3VKWA 1MRSA 4B6FA 2WWHA 4W5WA 4V0ME 1UDWA 2JDID 3I8XA 2NPIA 3PUVA 5FPHA 3HJNA 3OESA 2GBLC 2G83A 1X1RA 4LI0A 4RFVA 3THXB 1NVMA 3GJ5A 3ASZA 3K0FA 1OFHA 1O87A 2NG1A 4OBEA 2H17A 4DCVA 2ZRKA 2W2VA 3GPLA 1QVAA 1VYTA 1VCMA 4XTCS 4FWGA 2ANCA 2GAAA 3ETLA 2N46A 2BKEA 3ZS9A 2QORA 2Z4RA 2AD1A 1KI4A 3MJHA 2B7BA 1YVDA 3QPWA 4I1OA 1U0HC 1W36B 1ZM7A 1ZW6A 4PFSA 1EFCA 4G5RA 3U2QA 2DFKB 5J4HA 3Q7QA 4OJKA 5FOVA 1IN8A 2WKQA 4AYWA 1XDBA 2P6UA 1OKKA 3PQCA 3BXZA 1ZINA 2O8CB 4L8GA 4TL6A 4GDFA 4IDNA 4OHXA 4P4UA 1HEIA 1QZXA 2C9OA 3GLHA 5JECA 3IO5A 3LNCA 1FMLA 4MYCA 2ZYTX 2WJIA 1W0KA 2PT5A 5EXSA 1Q3TA 4QGAA 1E2EA 1WA5A 2QQEA 2XOKD 4EDHA 2ZQ5A 4Z54A 1WP9A 4HDCA 3GLIB 3IILA 2W00A 3X1DA 3J81k 3LAWA 4Y0AA 3FE2A 4BFWA 4X8OA 4L9SA 4NYJR 3MSXA 4TMTA 2PX0A 3RAPR 1EFHA 4AC9A 4JLPA 4JJZA 4D4KA 5EP2A 1S4QA 3VQTA 4XSHA 1TQDA 4KFUA 4YXWA 3LFUA 3VNVA 3GFPA 4L9WA 2DZNB 1OYYA 2JLWA 4LYAA 3PEWA 2QEQA 1XFAA 3LH5A 3LO5A 4XD7A 3ZIAA 5CITA 1CJVC 2P67A 1EXMA 1DBSA 2IXFA 2WAYA 3CW2A 3AGQA 4DSUA 1OH5A 1AK2A 1IN6A 3FKSD 3AP3A 3TSWA 5KPJA 4B2IA 2GILA 1S8FA 4AKHA 1RYHA 4X8MA 1QHGA 3MD0A 1NMZA 2DWPA 4OKSA 2XX3A 3IIKA 3C16C 1Q22A 3HWSA 1XEXA 2F1HA 4MRNA 3A4LA 1I2DA 5L3VA 1II9A 4NCNA 2EFCB 1KO7A 2IK8A 3DM5A 5CLLA 5HE8A 4G5OA 4Q5IA 2EU8A 3RANA 1US8B 3SYKA 1WF3A 2VP9A 4D80A 1CR2A 2FOLA 2PBRA 4R7ZA 4HB4A 3R9XA 1D8TA 3TQFA 1IAQA 4V0NA 3RSOA 1O3YA 5J40A 1X6VA 4CW7A 5EQTA 1XCGB 1J90A 1E2MA 2ZE5A 1NVVQ 2ZR7A 4KVAA 5TY0A 4DLWA 1OIXA 4EPVA 1DAMA 1EGAA 2FZLA 5FBLB 3ZVNA 1R5BA 1NRJB 3TAUA 4EFNA 4LJAA 1GOTA 1VG0B 4G3XA 2FGJA 3B13B 1EX6A 3W6OA 2QA5A 4GZMA 5J4VA 4FWTA 1CP2A 4G5GA 2DFLA 5FOUA 4WZ6A 2Z5FA 3AF2A 4KHZA 1P72A 3X2SA 1N6OA 4XWKA 2H92A 2Q6TA 3NC0C 1UKEA 4GP7A 1FQJA 5SZIA 4LJYA 1XMSA 4TQUS 3VAAA 3R9WA 3GJ7A 4DEYA 4DC9A 1NL3A 4HAUA 5F3WB 3T1QA 2NMVA 3T1OA 2RH5A 5FOTA 4POAA 1DADA 1H8EA
chains in the Genus database with same CATH superfamily
3E84A 3AIIA 3UMGA 4L74A 5TEWA 4X64B 4UVIA 5AM5A 1KEZA 4UQLA 3PGXA 4IIVA 3WFZA 3UTCA 1QUTA 4EATA 1YS2X 4FOSA 3DVAB 2GCOB 1X9HA 4GBED 2WU4A 2B8NA 1GO5A 5F5NA 3KTDA 4AP9A 3GU3A 3GRVA 4KO3S 3ID6C 3KSBC 1U1GA 4RLQA 1YB6A 1IN4A 1HBJA 2OV8A 1R6BX 3GPYA 4IJ5A 1WNFA 1M1NB 5DGCA 4OX9Y 4BIIA 1P2TA 3RS4A 4OB6A 5TR9A 4KJXA 1P31A 4LF5M 4FCCA 2CCJA 3FUXA 3QOFA 2IOYA 3THSA 1RWBA 1XNRM 4J91A 1P0MA 2IDZA 1OPRA 4YRRA 2Q6VA 2WM2A 1KMMA 1MRNA 4GD3Q 1Q1AA 2VOJA 5LJIA 1P45A 5A5FA 4CMKA 1B1CA 3MGKA 5J2UA 5KUTA 3OKFA 4WVFA 2B94A 2OAP1 1ZMXA 4EZBA 3L28A 4KYTA 4DIKA 1NI4B 2H0RA 5C1IA 3OPMA 5G0UA 3ZK8A 1RYFA 3CXUA 3A36A 1H85A 2FPIB 2H52A 1N0WA 4NLLA 1Z4MA 3OZFA 1V2HE 2ZANA 3ZQKA 1XZDA 3PNMA 4DNXA 1RJDA 1ZWKA 5CA0A 1K6IA 3HU5A 3HZRA 4L08A 4O2BB 4Q21A 4LOKA 4PAWA 1UIMA 5EKDA 3KKZA 5JCZA 1PGYA 4BO7A 2R5FA 2FK7A 3M5CA 3D02A 4S1OA 3LW7A 4KVZA 2DUMA 1N78A 4M0EA 2DR3A 3D6FA 1TFUA 3ZS8A 4PZCA 2ZS8A 3IVGA 3NUQA 4R9UC 3V8BA 3KQOA 2GDJA 1ZMBA 3AI2A 4AJNA 2E4UA 4C7KA 3K1YA 3RVQA 1Z13A 1ZO8A 3K2IA 1FJGB 2QPOA 1WDKA 2NXWA 3BSYA 2PLAA 4FFDA 4QTTB 3SYMA 1G3IA 4A8JC 2VUTA 1TW3A 3KQUA 1KO1A 4AWAA 4KCGA 3RRNA 3GJQA 4F3CA 5IDXA 2GRUA 3CUSA 5B3JA 3A9VA 4LX0A 1QG4A 2YV2A 2R47A 3RRJA 2F9MA 1S5PA 4Z4FA 1Z4JA 2G08A 4G1BA 1L4MA 1JDTA 2OC9A 1HDGO 5EP4A 4WKPA 1OIPA 4W63A 3ER9A 2IZ6A 4ZT6A 1V34A 5G4LA 3UGJA 1USWA 4AG5A 3M82A 2WT8A 2HIHA 1ULTA 3COPA 3LBAA 2Q4OA 3AHJA 4EFKA 2JVIA 3RVRA 4QHSA 5A6SA 2A5YB 3PGVA 1NVVR 3M81A 2ZWAA 3EPPA 1J0CA 3H2HA 1H8ED 1W73A 2PT7A 3SR3A 4A6DA 3IJEB 3WL6A 3HTXA 2JFBA 5DCWA 1GGHA 1JAHA 5KSOA 5ALHA 1E1YA 3KPWA 5I4IA 2ZM6M 1L1TA 1ZRMA 5IM4A 4FYJA 3IUYA 1XQ1A 3VHLB 2WG2A 3DQZA 3FZNA 1N5RA 2BM9A 1P9NA 5H3HA 5E4FA 5DBHX 3RRYA 2G17A 2R48A 2OOKA 2VK2A 3QMWA 1Q1QA 4PCAA 3ZD6A 1YHYA 2QTNA 4UQPA 1EGHA 4RANA 1EP9A 2P91A 4B33A 3GHYA 1YU9A 5B5SA 2PGAA 4J2OA 2ASVA 1SGWA 2XZOA 5J2UB 2D7DA 5KNCH 4JUIA 3DL0A 2HFKA 1KJJA 1HNZM 1MG0A 2B8EA 1UJ6A 4DM4A 3G17A 4RK6A 3HP7A 1JHZA 1QIKA 4OHVA 2Q41A 3F92A 3PEVA 1VLQA 2P2YA 2DAKA 2YHAA 5FEUA 3L1VA 5CA0B 1S9HA 1EK5A 4IHJA 2XSZA 1SOVA 2IBMA 3K9QO 5AVKA 4YAKA 2V5AA 3HY5A 1MKYA 5EY5B 2HXGA 4BVKA 4CVNA 3ZZTA 2GKSA 2B34A 3LPLA 5JQGA 1H2XA 4QUJA 2IYEA 3ZI7A 1NA5A 3QNWA 2CL7X 2D3WA 3P5BA 1MW9X 1LI5A 5AKJA 4OF4A 1CY7A 4LBZA 1IQRA 2DPMA 5HOEA 4REOA 5LP6A 2Z8YM 4RH1A 4L8VA 1L5NA 3OO1A 4O2AA 1JZSA 2WIFA 3NTOA 3T3DA 2MJLA 2AFRA 1JKFA 1JHPA 4NENA 4MINA 2MSDB 2IBSA 4JC4A 1DQSA 4M46A 1CETA 4B9EA 4WKCA 1MH1A 4K0KB 5DNDA 5JATA 3DAFA 4G24A 4HWTA 4UQOA 1FA9A 2CVPA 2PZ8A 4ROSA 5JIBA 3P4UA 5HQTA 4RJJA 4FN5A 8OHMA 3C14C 4PZUA 4IDHA 4JI4B 1E7WA 2I6FA 3I5AA 3LIPA 3ON5A 4RNAA 2FW8A 2O2IA 3WYFA 3GLGA 1TYBE 5A6SB 1FFEA 1JG6A 5H70A 1K82A 4C0BA 5IVDA 4BKMA 1FFHA 3J7TA 3OZUA 3L29A 1W581 2XKJE 1QLHA 4WASA 2CNWD 4R9NA 4BO2A 5DF1A 3L4BA 4BP9A 2DPYA 4TT3D 4BLOA 1Y6ZA 5B64A 1U6KA 3C3EA 1XVIA 5ESXA 1TK3A 2JGIA 5JAUA 1A69A 2C03A 3R3WA 3JAMA 1A5ZA 3M33A 2AOUA 3MCVA 1LXCA 3PTLA 2RHOA 2D1QA 4M0KA 2BSAA 3E81A 4CIZA 3KBOA 4V1CA 5EUQB 2DPLA 1SB8A 4DV0M 4IIUA 1RE1A 1OHHD 4G23A 4NAHA 2W6CX 1MT3A 1Z4IA 5EC8A 3ZWDA 1ZJ5A 1I2MA 1G2QA 2QJRA 2XVXA 1VPDA 2QUIA 1FS5A 5J59A 1TUEA 3EXG1 3VSCA 4YO8A 3HB9A 1G8FA 2NXNA 4MAMA 1HY3A 4OMCA 3HWRA 2C8LA 3L7LA 4TOIA 1QB7A 4TMKA 1Y5IA 1Y8RA 1BMTA 4BCBA 2VCYA 2VJOA 4RXMA 4EY5A 1F8XA 3E23A 4I19A 2HUPA 4EB8A 2A5LA 4J0IA 4YRJA 4MVYA 4G0OA 3NG1A 2DB3A 3ISTA 1V92A 1YRAA 4IHJB 2XH8A 3H17A 1K75A 1COZA 1NAHA 4MB2A 2JGRA 3G9UA 2FK8A 3V8PA 2QNRA 1L7PA 5DSZA 2CHGA 3VHQA 1HWYA 5JQGB 2HSWA 2QMEA 4WADA 2UXCB 3ABZA 3DHNA 5I4BA 1L4NA 2J85A 3UMMA 3DWGA 1Z5ZA 1KJ8A 3ZHRA 4HZIA 2H4YA 2JI8A 1ZMVA 2ZB4A 5K9ZA 1B8OA 2JRLA 2GTPA 3AUTA 2CSXA 3DT8A 2JHFA 3D1LA 2GKGA 5GM1A 2ZI6A 5IZ7D 1KAHA 3OX4A 4O2AB 3IJPA 2X2PA 2KBEA 2FUKA 1PW5A 3ZD8A 5EMNA 1Z0KA 3MUFA 2X0JA 4Q4LA 4NENB 5JDCA 2AG5A 1FQOA 3T9FA 3UBTA 3LP6A 1DAFA 2ILVA 1ODLA 5EA2A 4IBKA 3D0KA 4A0RA 2O19A 1UBCA 5ICFA 3J80A 2MSWA 2V0NA 3H11A 1C7JA 2QJTA 5AKZA 4BLUA 2PUDA 2KMLA 4ZHQA 2FPUA 2BV3A 3I45A 4LVOA 3A6EA 2I5PO 1C3XA 2Q28A 2YRXA 5DOVA 4U2DA 1WPGA 4M53A 4MMXB 3FFAA 4LFAB 3GLGB 3ZY2A 5CCBA 2B4QA 4S35A 2FJUA 3G3EA 5FPTA 1WBJB 1DJPA 1U0FA 1FYEA 2N3ZA 1DX4A 3IBFA 1LW6E 3D8RA 4HYYA 3HR7A 4JI7M 1XP5A 2MMGA 3BIWA 3QWLA 4IHKA 3NAZA 2VH5R 5AW4A 1ECJA 2AKAB 3ICOA 3A4IA 1B6RA 1MJGA 3DDZX 4LE0A 4NIMA 3QXXA 2I1VB 4BJ3A 2N1MA 3FHTA 4H1TA 3MZ0A 1PZXA 2AOUB 2PZBA 4IR7A 1HE3A 1RAFA 4A5OA 4DR1M 2GN2A 1JIIA 2IS1A 1GILA 2FQQA 2VATA 3PVZA 4IS3A 1QOPB 3UXHA 4M3NA 5J5CA 5T7BA 3WBFA 4ZZ0A 3TDKA 4V1CB 4MGEA 2FN4A 1ORIA 1GTJ1 1T9AA 4RIHA 4HJRA 1UC5B 3WZMA 3LC1O 1NF8A 4ZDKA 3TCXB 1VDLA 2YXEA 3LQKA 2X4DA 3N5KA 1CY4A 1P61B 3CF4G 1L5VA 2C92A 3E18A 4CCAA 2E6KA 4X61A 4JLSA 4YCDA 3ZDCA 3VNUA 3KU4A 3MOSA 4LFBM 2ZYHA 4R9RA 5JZSA 7MDHA 4JQCA 3OQPA 1DP4A 5EJEA 3MBKA 1Y8RB 4S04A 3RRZA 2YJ6A 4EVSA 1I4DD 2NUPA 4RF1A 1ZBQA 1DG9A 4OK3A 3IUBA 1XAJA 4GKJB 5KQRA 4LZOA 3QGMA 4KGDA 2C3MA 3LX8A 1MA3A 4E09A 3IDOA 5IHXA 4LNHA 3ETNA 1Y1KE 5CT4A 5HYVA 2O3SA 5FWAA 3TZBA 1HGXA 1BWPA 2XDQA 3U3KA 5CH5A 4IDFA 5EPEA 1HT0A 1FDVA 3AWIA 3LBNA 1IRIA 3HXQA 4GX5A 4CM3A 4BLPA 1VHDA 4NCBA 1X7ZA 3LRXA 3K0HA 5HKKD 4HNSA 4R2LA 3ILXA 2BW0A 4FZJA 5DK6A 1V33A 5A3RA 2GR9A 5ALXA 4RVOA 4Q05A 4MV8A 4P80A 4MIYA 4PIVA 3GJXC 2XMSA 3WQBA 3SIXA 5L40A 2J6CA 2VJNA 1ZVVA 4ARSA 4LYGA 3V33A 1W34A 3CZPA 4NPCA 3FG9A 1CQZA 2HJHA 3EZNA 1UDRA 1NQVA 3K1TA 1CUEA 2V97A 4ZHQB 2R9VA 3RC9A 1IEWA 3Q0EA 5DVZA 3SZOA 2FPGA 4M76B 3TIIA 1WZ2A 1SXJC 4KU4A 4OHUA 3AHGA 3EVZA 5SY6A 2FZCA 3HGIA 3DTVA 1U2SA 3L40A 2DERA 1OV6A 3OT1A 1PL6A 1UAAA 4LVNA 1IWBB 2DVMA 3DEKA 4JC0A 2ZXUA 1XEWY 3P2EA 4K88A 1RZRA 1AT1A 1C7RA 4NG5A 1G6HA 3DEIA 1ZN9A 2BNKA 2W6MA 4NDNE 1AS0A 5H82A 2DFNA 5I7RA 3DMDA 1P0PA 1Z45A 1BU5A 2XB9A 3HDHA 2Y1DA 4RS4A 2O20A 5BWNA 3EHEA 3GLIA 4C7BA 3QU9A 4H17A 1QHEA 3KXIA 1X14A 1JAZA 1IUPA 1YR9A 4DW8A 1VG9B 3V7WA 5B7QA 3OZCA 1AOXA 2VQEB 3ZHCA 1KU6A 1R0ZA 3A70A 2VWPA 2MROB 4NYMR 3G6WA 4S24A 4AG6A 1XPUA 4MLCA 3CX8A 3NYWA 2G6TA 4Y28F 1Y4UA 4X41A 1JMKC 2M32A 3WICA 1V4NA 2JJ8A 2V9PA 2E21A 3WHKA 1XZBA 3H65A 4JITA 4WDQA 3N6RA 3IFSA 3JVVA 4ARCA 3FVTA 2BZ1A 3C85A 5L4LA 1KJWA 2ZAIA 2H31A 1NV9A 1XXHA 1JTEA 3HMKA 1QTQA 3T7CA 1G0NA 2JWSA 3B74A 1UADA 4KKXB 4YMLA 1NP3A 4QRDA 4CG0A 2CW5A 1XMXA 1DKNA 1U8CB 1U1EA 2OCIA 2OILA 4RJ2A 5AHOA 2Z2JA 2N42A 4YDQA 3HP1A 1KZHA 1ODFA 1CEQA 3SC6A 1EKXA 5LLDA 3ZTYA 5DLYA 2XDQB 3LY9A 4KI0A 2XOEA 2X4LA 5J1SB 3KKNA 2Q3LA 4N5DA 2IU4A 1RLIA 4PHFA 4BNGA 1E5DA 1X7ZB 3EOAI 4BNNA 3DGEC 3VZCA 1NUQA 4YRGA 3IAHA 1TC1A 2XCIA 1O08A 3B82A 1DKPA 2WJVA 1UC9A 2FMTA 3ST7A 2QRVA 3AB3A 1ILEA 3L6DA 4WLOA 4DVJA 2HXYA 4F8EA 1Q91A 3DE3X 2PL3A 1UJ4A 4G5FA 3GZJA 3O31A 1W44A 1MFPA 5IK2D 3J81S 1ZUNA 4URFA 5E6JA 2PEZA 3FD9A 2K7FA 1AZTA 5IXSA 2DCMA 2YVUA 2XRFA 4M0CA 4PLPA 1GQOA 5B57C 1VEJA 1TF7A 3GZNA 2SKCA 1GZ6A 1A98A 1OVMA 3VUEA 3VTKA 3X2FA 1SWVA 1LFDB 1J70A 3UY4A 3I01M 1YRLA 3ORSA 1XRQA 4QXAA 2XUOA 5MHTA 4ARUA 2PUJA 3NOVA 4JSYA 3GI1A 1E60A 1YJ5A 1RJWA 5FTLA 1U0BB 2GK3A 2UXBB 4FMBB 5FT9A 4UMVA 2FPGB 4IGFA 4MQMA 2IHVA 2XQJA 4Y6PA 5DV9A 3DTVB 5CT9A 3OT1B 3GT7A 2L17A 5JH7F 3NRCA 1OFHA 2I4TA 2Y0TA 1N75A 4E12A 4CFSA 2MYPA 1UKCA 5FOVA 4ZZ2A 4DIFA 1YR1A 1JB0F 4J1TC 3Q3HA 2I76A 3ZWCA 3IO5A 4KO4S 1YDGA 1I5EA 4QGAA 1LNQA 3DE6X 3GLIB 3IILA 1OI2A 4KW7A 1QRDA 1T3GA 3MSXA 5SYMA 4XUEA 4V3CA 1EDEA 3LFUA 2WWTA 4BMSA 3AFMA 4XD7A 3ZR4B 2WAYA 3AUJB 1PTJA 5E9QA 2VRCA 1RWKA 3MD0A 3IIKA 3GELA 3QP9A 4RESA 1MB4A 3WLOA 3OLVA 2VK8A 1CR2A 4R7ZA 4TMYA 1A5BB 1E2MA 3QLJA 5LWQA 1UWVA 5CVEA 1QH8A 5A3JA 1CG6A 1RKVA 5EHZA 2RH5A 1OAOC 3IG8A 4MQFB 1CJCA 3VPSA 1ADJA 4J9VA 4FDAA 4YMWA 3D6AA 2DU8A 3HJGA 1Z3CA 4PQRA 1XXHB 5BY2A 5GINE 4HDOB 3GAMA 1XLUA 3MRXA 3RC7A 2LWIA 2VDKB 1P6UA 1XPOA 3A0RB 3SJUA 2B7CA 2X23A 3GARA 3MJRA 5AI0A 2O7QA 3DVRX 5MDHA 3GLVA 4UARA 1W47A 2DHRA 2C97A 4E6EA 1P33A 1QVRA 2X9GA 1Z5OA 1K0UA 1E0DA 1G59A 4JEUA 3L82B 5JSHA 4ISCA 4RZ2A 1KIMA 4BL5A 1NSTA 2BLLA 3Q8KA 3B7NA 1E9RA 2D1RA 4RQBA 4AY4A 5I9BA 1VL8A 4UE3S 2IIBA 3CPHA 4A16A 4AZSA 4UTNA 1JU9A 3TF5A 4PRZA 2Q46A 2QZZA 4LRXA 1YDMA 3MIZA 2QRVB 4N49A 4TUYA 5KWIA 2A5JA 4HRYA 2ID9A 3CO5A 3EIWA 2C9DA 3QW2A 2V1CA 2CFCA 4C4XA 1M2JA 2FHSA 1W29A 4HCJA 2GO1A 5I9TA 5TT1A 4EB6A 1M73E 5LB4A 1ZUNB 4QDOA 3E9ZA 1UCFA 4MGYR 2G63A 3PICA 4NESA 1M9NA 4BBZA 3RLFA 1JTFA 1FQWA 2CYBA 2V9ZA 2IZ7A 4AKEA 5CJJA 2IBTA 3LPMA 3H1AA 3C45A 1Q20A 3GZNB 5DYTA 1BXRA 1MUUA 4B3MB 1N7IA 1L8AA 5DBIA 2P2CA 4FW9A 3V3TA 4L3WA 4RSRA 1U63A 4ZEWA 3JWJA 3MJ5A 2AG8A 3O4JA 2C2KA 1EVZA 1U2DC 1N34B 3Q7EA 5L4SA 2AJBA 4ZGBA 4NS4A 2UVQA 4JOBA 4F2DA 2OA0A 2P3SA 2ATVA 5I48A 1O95A 4JT8A 1ZJWA 5KHAA 3MHTA 2IYVA 4BNYA 2QKYA 3S28A 5AVOA 4B7XA 5E1DA 1ZUWA 3NTVA 4CMGA 1JBQA 3NHAA 5HS4A 3I76A 2OHJA 1VG1A 1X1SA 3GFVA 4MMZB 1W0KD 3PU6A 1XCBA 3EVTA 1G5HA 1E2QA 4NZ9A 1BFKA 3DXFA 2BT4A 1DZ3A 2ENWA 3IP5A 2IV3A 2ORIA 1MB9A 4BDTA 1L5QA 1EIWA 1LJLA 2P27A 3T12A 2I7NA 3BXEA 3WWYA 4CUZA 4X24A 1HSZA 1P2GA 4WZBE 3R6DA 2PUBA 3A6ZA 2YJ4A 5D5PA 1LDNA 1QH8B 3LYLA 4MQ4A 2XWPA 3S5JA 5K8CA 3GO8A 4WZAE 1XC7A 3VDXA 2PG3A 2XZFA 4TYQA 4IYJA 3JQ8A 2NZ8A 1K5GA 3L8YA 4JFRA 2Z95A 3OX2A 5IUNC 2J9FA 4QYMA 2P62A 2Q4RA 1GNVA 1O6CA 3GP3A 3OBIA 3RJMA 3ASYA 2OVFA 5K3AA 3T35A 3LA8A 2QSUA 4UXHA 2VH1A 3KS8A 3MTEA 3DAPA 2ADOA 4ZARA 1P75A 4B32A 1QIDA 4JV5B 2Q1YA 4YREA 1GCOA 4FDTA 1UMCA 3FSJX 2WWFA 4WJLA 4XOIA 5ALWA 3CNBA 2X9VA 2PWAA 3DOFA 4F97A 4HPWA 2GMWA 5LZ9A 1AF7A 1TC2A 5JS1A 1QONA 4E6PA 1QKJA 1WXFA 3WYCA 1R37A 4TUYB 1SU6A 4XR4A 1EZ4A 3WNDA 2QQ0A 5KVAA 3BC1A 4LWPA 1U3CA 2DFTA 5DNAA 2BKUA 3SBDA 5HS6A 3HCDA 4BQQA 1TJ4A 2Z2XA 3Q9LA 3RREA 4LKOA 1MORA 4EB6B 3GP8A 1YBAA 3TJZA 3JQCA 4RULA 4J7CA 1PIWA 1SPBS 1QP7A 1Q1BA 3B1XA 3IMFA 1WNTA 3DEFA 1F0NA 3OZ7A 5ALMA 5AVTA 1W2GA 2NNLD 1XXLA 1BXRB 1N5OX 2EOAA 4IEFB 1G98A 2ZSEA 5B1HA 1LFAA 2YFHA 1K7SN 1J20A 4KWIA 4Q3LA 4XYMA 3AEQA 2OHHA 3BREA 2QRZA 4RETA 3EQ9A 1DV0A 3K0SA 3GUYA 1WV0A 1GZDA 3SC3A 5BQ3A 1DI0A 3W0LB 2WFLA 3WWCA 1QOQB 2C8VA 3HY3A 2ZE7A 4H0FA 1VSVA 5CM8B 1L4KA 5FHRA 3B3FA 4Q3CA 3GEDA 2QG4A 4Y7DA 3ANNA 4E4YA 4B6SA 2PRZA 4P93A 4G9EA 3U31A 4BX2A 5FA5A 1YB1A 1TQ4A 4L8LA 1OH8A 3FLAA 3CF4A 3EW7A 4QGFA 3ZHSA 4YN3A 4QEDA 3UKDA 3W2IA 4LPKA 3JVEA 4FS3A 1UPXA 1SD2A 5AK6A 2VK1A 2A30A 4Q1AA 4BEVA 3NBYC 5F5XA 3U62A 5AW9A 7ADHA 3ZCPA 2CB0A 3TUJC 1ODKA 5K0LA 1IN1A 3DG9A 4GL4A 3WRXC 2ZULA 2R4QA 3C6ZA 4IXTA 4R2WA 2HX1A 4EG8A 5CFPA 1N36M 1R12A 3DF9A 1SVSA 1S2LA 3GCGA 4XCQA 1A9SA 3FE3A 1G5IA 1ZXLA 3TK1A 3ZNNA 3E1KA 2F1IA 4TQ9A 4A92A 4CN9A 3F47A 3OTQA 1NHGC 3TIVA 4QDKA 3LUPA 1Q3KA 4DVGA 3LZ6A 3KETA 4BNZA 4E1BA 3I32A 2Z3XA 2BKAA 1Z8DA 1XU7A 3EARA 3RSFA 1MU5A 2VT3A 3JQ8B 1ZL0A 5BUCA 1ESZA 3JYQA 2HHJA 2HMUA 2JB9A 2BMEA 1ZGGA 1WOYA 2JFWA 2ZBVA 3Q11A 2J9FB 3FOCA 3KUUA 1UODA 4PNHA 1M0SA 4BTLA 5I7WA 5FRDA 3S27A 2HC9A 1X7YA 1C9JA 1M0EA 3UMFA 1CZRA 1Y34E 1NE2A 1FJ2A 5A9RA 2NV6A 2YIMA 3LPNA 1D2MA 2MSLA 1GDDA 3E53A 2PKEA 1V5IA 4UM5A 1UMCB 4TQAA 4ZAZA 2O57A 4XJTA 1HH4A 4HVLA 1V5EA 4EGSA 3RGGA 1M6YA 3B1WA 5DOZA 4LHYA 3IQZA 1NUUA 2NSJA 4B3XA 3HXKA 2W6IA 4EJSC 4WCVA 1H2EA 2ZDGA 2IYUA 4I5GA 1R4MA 1TKBA 1D6NA 1MZPA 2F67A 1I10A 5D8DA 5BRNA 3TSCA 1R2YA 4PPFA 4G0MA 1GSAA 1GCGA 1Q6YA 2V7VA 1TEXA 4GU5A 2IE0A 3BDVA 4B4KA 1W0CA 1L1EA 1FYDA 1E0KA 2F17A 4B7HA 4AKIA 3EVGA 4EVIA 1VYUA 4TTTS 4YT8A 1PZGA 3O6VA 1N0IA 3SKXA 1AHHA 3HEBA 2OD7A 3C6YA 2ZJ0A 4XPIA 1TDZA 4CV2A 4ID3A 1NKSA 3CJRA 3ENVA 2FKAA 3LBFA 1G63A 1PJ2A 4RTMA 2JIMA 3WADA 4ED9A 5A3QA 2R79A 4K9SA 2JG3A 4Y9SA 1A9YA 1OFUX 1ZI9A 5LMUB 3ZDRA 2YOGA 1TJ3A 4ESOA 4U2GA 4ZJZA 5ARBA 2ZAGA 5FV4A 3JQ9C 5EJ7A 3PGMA 2B9VA 4XUGB 4CCSA 5HVNA 2ZOSA 3AEQB 1F38A 2VJKA 5IBRA 2AWNA 1UWCA 3T1VA 2ADMA 2R00C 2WFLB 5M2QA 4M37A 3W7AA 3CZQA 2WAXA 5CNIA 4X66M 3THGA 4DC1A 5L8VA 4J90A 4OLBA 4D25A 3BGVA 3LGXA 5IKMA 2A4MA 1CUDA 1EJ2A 3H3XA 3F9IA 4O25A 3CVWA 3VR3D 3EEQA 2HGSA 2JCGA 1TQHA 3FFWA 2B69A 1H4SA 3P2JA 3PEUA 1NZFA 2XQVA 4JR2A 2ZJ1A 1XQXA 4BO0A 5E7MA 1E1QD 3R9KA 2JGEA 3NB0A 3TQSA 3KCNA 2ZSDA 1DIOB 5TEVA 3G2LA 3AFIA 1BHQ1 1XO1A 3RS0A 3O26A 1GPDG 2OKCA 4WHMA 2A5GA 3TW0A 1F6DA 1KPHA 3USZA 1ADCA 3CB4A 2PGOA 5EMMA 3H9CA 3N87A 1UIRA 1VP9A 4G9BA 1NXXA 5EIBC 1LJUA 5EKSA 4P3PA 1QLJA 1K5HA 3T5PA 3OIWA 1NI4A 1I51A 3ZGXA 1WEKA 3A4YA 3K53A 1DKLA 1Z7YA 3EG9A 4IBEA 2XYVA 2UZ4A 1C8KA 2FRXA 3ZQ4A 3WK8A 4KIJA 1X7YB 1ACJA 1DG1G 2J5KA 3K2QA 3EXG2 2O05A 4L2IA 1GSOA 2ERCA 3NETA 3OT4A 5ALEA 3T06B 3TZCA 1RAAA 3LU1A 3U6SA 1M6EX 4Q93A 1QCYA 3OSUA 3ZLJA 3VC3A 4UCFA 4FHEA 4DLVA 3S2SA 4YGXB 1L6RA 5ESDA 3SJAA 2JD0A 3JQAA 5DRTA 1ZOIA 2O8DA 1R0YA 1U8UA 3QPAA 1WMFA 4GEKA 3R3SA 2ODPA 1R4MB 1YBFA 3EPLA 1YE8A 4MITA 4ZAXA 2Q7OE 3AP1A 1KO4A 1SXHA 1F1BA 2BI4A 2FP3A 2WT9A 3RU7A 2AI3A 3AIMA 3ZU3A 1ESDA 5COAA 3FY4A 5FUXA 2JEYA 3H8VA 3ZDXB 2ZLBA 3S0JA 3DL7A 5LQUA 4LV6A 1N1GA 2P77A 2ZJ5A 1QZ3A 3ER8A 4WBSA 4F7WA 4DUZM 4XPIB 2VF2A 2DPXA 3KJGA 3LQ1A 4KFTA 3K9WA 1N5IA 1IFYA 2FKNA 3PHJA 2JUJA 3DMTC 3VTAA 2P6MA 4D44A 2KNAA 2WYIA 5D00A 2H0AA 1HMYA 4Q02A 1IHUA 3LK7A 1W9MA 1TUBA 3GG2A 2ZBGA 3D4PA 3OLXA 4S1VA 5DO9A 1NUAA 5LD2B 4N0EA 3D0QA 1O97D 1M67A 1K63A 3LIIA 2HCFA 1J7JA 2HJGA 2CP8A 4UJ5A 3UWKA 4LZWA 2HSEA 1NBWB 2XAUA 1V48A 1ZK2A 5A7GA 3NIGB 1YRQA 1K5DA 1OX5A 1ICEA 1ADGA 3QFCA 3QF4A 1RW4A 3WLPA 2C5AA 3MUEA 2AOXA 3HCAA 4CL2A 2ZYGA 2CLCX 3GP5A 3V48A 4HAZA 4WTOA 3W8RA 2A67A 3ENNA 5KTOA 1IEQA 3KAJA 1E5VA 2H1VA 4O5OA 2PRYA 1VMEA 5C46F 4EKNB 2JL1A 3RIXA 2NUTB 1NXTA 5AI9A 3WFIA 2HHCA 2WAMA 2ZIGA 3K20A 2ZYAA 4ND3A 2B25A 3IP1A 1HZZA 3E5NA 2CNDA 3N8HA 4YRNA 4QUGA 3T1NA 4UDXX 4HQFA 1JECA 4H1WA 3K9OA 1XOIA 1DJOA 3GRUA 3CLTC 3IESA 2XQFA 1PQWA 3IT3A 4CDRA 3CX3A 3BSSA 2J3QA 1P9WA 4TLDA 3GCXA 5EJFA 3DTNA 2QE7D 5IJ9A 1A9RA 5KAPA 1WW2A 3C9PA 1O94A 4G5QA 2Y4OA 5B7NA 1ORWA 4AN4A 4HGQA 3OCVA 3EG9B 1UZMA 1KF0A 3PUYA 4PX9A 1SO8A 4Z6YA 1SQ5A 4XQ0A 3P2IA 3OCWA 4MUGA 1YIDA 1JQAA 3LP5A 4L2IB 3VZDA 2Z6VA 3TWOA 1WKCA 3CG4A 3LVQE 3LGSA 3FKSA 1X8JA 1GZUA 4HQOA 3W8FA 3QA3E 4HAWA 5LQRA 4JLWA 3NAQA 2HA7A 3JQAB 3KIPA 2O8DB 3EVFA 1XGKA 4PT5A 2WAOA 1GTZA 3TPZA 4X1YA 3WC4A 1TM1E 1I6MA 4RIGA 3R5HA 2Q27A 4MV5A 2F1OA 2XIQA 2NGRA 1Y7LA 4IKOA 4GZ5A 3N3AC 3K6JA 3ECSA 5LDHA 3AR2A 3MJVA 3VZPA 1GUBA 4MRRA 1U3DA 1L5LA 4FHZA 2XT9A 3ZE0B 4YAGA 5FIUA 4K6CA 3OMWA 3M4XA 2Y0DA 4DGSA 5IS2A 4ZEXA 2IDMA 3WGHA 2ZPTX 4CQJA 1L0BA 2Q2QA 3BE5A 1WB5A 1DAHA 3NHBA 2H00A 2ACKA 3MB5A 5CFQA 4A23A 4WI1A 4BNTA 1YMUA 4ZFNA 5ITVA 1LNSA 3QJ5A 3SY8A 4M1MA 4UAGA 2ZTCA 3RTEA 2RGUA 2D2VA 2IDKA 4HWOA 1GN8A 4CBVA 1TUBB 2Z2YA 3C7KA 3CE6A 2QLMA 1TZCA 4DUGD 1XN1A 1PX2A 4C4TA 3PSHA 1QQWA 5TT0A 4ZYZA 2G09A 1UFVA 2R8ZA 2XCLA 1OD6A 3NFRA 4CIVA 4ND5A 5DTMA 4ZVPA 3OKCA 4FDVA 4FBMA 3HCPA 2VF7A 3ORRA 2LHGA 2B0CA 3KFVA 1MJHA 4E33A 3Q7PA 5E4YA 5JZOA 3MXOA 1QDLB 2WJZB 2YWJA 3JW8A 3QF4B 5DBEX 4GOKA 4QJBA 2FEWB 1SVUA 2X19A 4ZRMA 1ZM9A 1UMKA 2C2MA 4JC8A 2XWJI 1V39A 4I50F 1VMAA 1VSUA 4P81A 4XX1A 4QPNA 1WVGA 2O2SA 3P20A 4KQWA 4QYIA 5C9ZA 3T94A 4LVUA 1YI8A 5F7OA 4D1YA 3FDFA 2CXQA 4BWYA 2PD3A 2WRZA 4Z8YA 1QLWA 1SCQA 1U0NA 1XTKA 3ZU6A 3RQSA 4IIWA 1X2EA 2WVGA 4CHTA 3OTOM 1WMSA 4BGEA 2PYIA 1C7FA 5IJ9B 3OESA 2HA4A 5JC1A 1I1QB 8CATA 2J3IA 4RFVA 3UK0A 3JPWA 2IELA 3GJ5A 2WYWA 1O87A 4P16A 3UA4A 4LJRA 1PZMA 2PV7A 1VCMA 1NVBA 2GAAA 1KI4A 4GPBA 4G5RA 3U2QA 2O5EA 3R5FA 2DUWA 2BZ0A 4MYCA 3W79A 4W6ZA 2PT5A 1Z36A 3LT4A 2ZQ5A 2EERA 2B1JA 2FN3A 5EMLA 5FP0A 3GVPA 5J58A 1OWLA 5A7HA 4LZLA 4C2AA 5K6AA 2JLWA 4LQDA 3B7ZA 4NBRA 3ZTTA 1IOVA 1TQ8A 2DWPA 4NS1A 4DUYB 3A4LA 4P86A 2V74B 4X1YB 2H7XA 2C0QA 3WL7A 4QDJA 4RIFA 4DMMA 3W8EA 1XZ8A 4Z53A 3HL0A 1XRRA 4E4RA 4EHJA 1TJ5A 3BHNA 1V8ZA 1FMFA 1DB3A 1N8SA 3SGLA 5JBIA 3JQ7A 4O1MA 1FVFA 2XT6A 2FEXA 2WC1A 1NL3A 4LOHA 2G1AA 4B3SM 5ITUA 1H8EA 2ZBQA 1ZV1A 2C7RA 3DO8A 4IJ6A 3WRVA 1HFJA 3GCWA 5LQAA 2ZBUA 3GDFA 1OCEA 3PE3A 4XFJA 1RSZA 1EE9A 3T9BA 3GFSA 1NJFA 13PKA 4X8HA 5IRCD 3M6MD 1X0XA 2FEOA 2HJSA 4EX7A 1RQPA 4LW8A 4B3JA 3KT8A 1HQDA 3IRUA 2YYZA 1VZ3A 4XDGA 2YNMD 4ZOCA 1LWOA 2PSHA 1DQYA 5GVSA 4XLZA 3S1LA 5FYQA 4ZDJA 4EDFA 2IYRA 1JDSA 2AHRA 1AQLA 5BURA 2WY2D 4X0EA 2EATA 1Y98A 4HWGA 3SDZA 3X1JA 3BTOA 4M49A 3URMA 4HLDA 2ZRDA 2FEPA 5JO0A 3JXEA 4MB7A 1XTJA 4CKXA 1VBFA 5DXAA 4QXRA 4FR2A 2F3UA 1ODTC 1JW9B 2HIGA 2NO4A 1RPJA 1GARA 1LBEA 2VPTA 4DCNA 1ZICA 1CWUA 3CONA 2Y1EA 4GT1A 3I0ZA 5LMNB 5ITRA 3KO8A 2QYOA 3BMCA 3R6GA 4ER5A 4BJ5A 2P0YA 4OGLA 3TIFA 1RQXA 3KKQA 3B3GA 3EXIA 1EP3B 4QYIB 3UJNA 5D3ZA 3WKEA 3DR3A 4GP9A 3AI7A 1UM8A 2WWVD 2GJ9A 4RTRA 3LFHA 3ETHA 1DAGA 3B6IA 1OA1A 2F6RA 4CHTB 1ZU4A 4KUEA 2VFAA 1QK3A 1EFTA 4QQRA 1G6KA 1Z6TA 2ONYA 5A4MS 2ONKA 4IX1A 2QRUA 1XZHA 3VDPA 5JH7A 4TMWA 3WRYC 1BE1A 5B6JA 3LUBA 2IOHA 2EWMA 1A72A 2BBOA 2JJ1D 3ZE8A 3FA2A 1W5TA 3D7RA 5JNTA 4B84A 4EFDA 4UBIA 1DGFA 3HDQA 4TWAA 3PPXA 5C8YF 1Z2DA 3IBTA 1VL2A 2X1HA 2W2TA 4A0QA 3P4YA 2JA1A 1GQ2A 5HM6A 3IP7A 1N33M 4IF4A 1UDCA 1C7QA 2H2AA 3WLMA 3NH9A 3U4MA 3O47A 3EQ2A 5E0OA 1XZPA 3U3MA 3UFXA 4AF6A 3KJEA 3O3NB 4OGWA 2GYVA 3UICA 4TKLA 2RGOA 3FRJA 4J75A 4IGIA 2VT6A 5HP4A 4BBJA 2JJMA 3JQ7B 3LYHA 3MGAA 4WH0A 3SIRA 5BN5A 4J9UE 5T8KC 4JELA 5G0VA 2I3AA 2BHSA 4TT3A 2C29D 1TZBA 1NJ6A 1QDUA 4ARIA 5K3FA 4HXFB 3MT8A 1ZRSA 2VSFA 5AW8A 2NXEA 2IEDA 2V7QD 2BSXA 2XEDA 4LYDA 3RAJA 3N2IA 1I3CA 5BOVA 2GD2A 3IMCA 1YK0A 5DIFA 2WTAA 2P9CA 4J4HA 1QZMA 1S2NA 3X1ZA 3HQ4O 3TR0A 1C8BA 1T15A 4B6GA 1W19A 1P62B 3RIGA 1E6CA 1OHHA 1D8AA 2IZ5A 2BGMA 3ILKA 2J46A 4MRAA 2APLA 1ZHFA 3DC2A 3FIUA 2QP9X 3RFUA 2PCJA 1LSSA 2Q2NA 1B26A 1RLTA 3VYUB 3P9YA 1RQ7A 1VA5A 2EFHB 3P9IA 1HYQA 2DFPA 3DQPA 4FGSA 3DCYA 4ZIRA 3CG0A 4JOCA 1IZZA 5F4BA 3E8XA 1AO0A 4RCZA 2I2DA 3QWFA 4GLFA 2R96A 2PXXA 4ZAYA 3ENWA 3AR9A 3MLEA 2JFVA 3I58A 4B5KA 2OHGA 3COSA 4C0QC 2V98A 4G56A 3BMCB 4UBKA 3I4LA 2E37A 1D0SA 1GTG1 3DV9A 3K73O 4KODA 3EXIB 2GXSA 1NXOA