1NY6A

Crystal structure of sigm54 activator (aaa+ atpase) in the active state
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
247
structure length
247
Chain Sequence
EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation of the transcriptional activator NtrC1: structural studies of the regulatory and AAA+ ATPase domains
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords transcriptional regulator (NtrC family)
total genus 66
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ny6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ny6A01
1P75A 4DXAA 1I2DA 3KB1A 3OESA 3P1JA 2EYQA 2FU5C 1GM5A 5EE9A 1SVSA 3OAAD 3CRMA 2ZRDA 3CW2A 4PC7A 4US0R 4M1SA 3PUYA 2GCNA 3RABA 2R6FA 3LDAA 1W36D 4IEIA 2WV9A 4ZKDA 4HDQB 4WBSA 4LGMA 3ZIAA 5FOVA 4KSCA 1BYUA 1PV4A 1EX6A 4ON9A 4QHYA 3I3SR 1NKSA 1QHSA 4LBVA 4UKDA 2W2XA 5KHOC 3CKLA 1S9HA 4C7OA 2VHJA 3LD9A 4FCVA 2HUPA 4PHHA 2C9OA 2CLDX 1XXHA 2GXAA 3FKSA 4IVPA 3NBYC 1JR3E 4KU4A 2YINC 4HAVA 4GBMA 5J4YA 3PUWA 2ERXA 4RD2A 1AIPA 4FN5A 1CRQA 3SHWA 4C0KA 3CRW1 4YXWA 4R2HA 1YVDA 3RNLA 3SN6A 4ACAA 5DGXA 3EX7C 4B2PA 1YZLA 4PHGA 3SBDA 3X1XA 1YU9A 2F55A 1DELA 2IYRA 4M21A 3SYKA 3NG1A 2WBLC 5FI0B 1XCPA 4DIDA 2C5LA 1IY2A 5CDFE 2WJGA 3TVTA 2RGNC 3F5FA 1YR7A 1MO3A 1JR6A 1Z63A 3LA6A 4UNPA 4OI4A 3G5UA 2YWEA 1MH1A 1R4AA 4GZMA 4F92B 1HT1E 3W3ZB 3VKWA 4IRUB 3KFXA 4DSTA 1XX6A 2F43A 2FFHA 2WWYA 1QHIA 4IDPA 4D4LA 4MKGA 1NBMA 1E9AA 3PEYA 2V1UA 3BGWA 3K1JA 4PZYA 4C0LA 5FBVB 1E0JA 4LV6A 5JWHA 4CIDA 2O0HA 2RHMA 3BBPA 1E79A 1SQ5A 1PZNA 4RY2A 3EPKA 3GEEA 4DHEA 1OHHD 2BBWA 3IIKA 1RRFA 1OXTA 4NCJA 4QXAA 1AS0A 4M9SA 2IYWA 3KJIA 4ZDWA 3GEIA 2NIPA 2O5VA 4FXPA 4TMWA 4F91B 1NIPA 2R9VA 1NN1A 3BB4A 2JLZA 4V0MA 1NVVQ 1OLOA 2FSFA 5JZVA 4OHYA 5C18A 1ZMXA 4XD7A 2FPKA 2NPIA 5CIQA 2P6UA 5E95A 4QOSA 2ZRAA 3AJIB 1WP9A 2OAP1 4DLXA 5A5GA 5F3WB 4JL8A 1SHZA 2H16A 5TARA 4A9AA 4B43A 1E2EA 2ZRPA 5C1BA 4NCNA 4BFSA 2KSQA 2Z5FA 3ASYA 4ASUD 5JFGA 2AK2A 3KKPA 2GTPA 2GAAA 4ZI2A 3IO3A 5KPJA 1NSTA 4OI2A 4QM7A 4Q9KA 3TVDA 3EWSA 1RRCA 2YV5A 4EJSB 2PX3A 1A2KC 1G64A 2FFAA 4YLGA 3EPJA 2Q3FA 1S8FA 2J87A 2IT1A 1XPRA 4EIWA 2BMFA 1R10A 4N0EA 4AI6A 2GEVA 3AVWA 3U61B 3UK6A 4JLAA 1CR2A 2XSZD 3UXMA 4TT3A 1WA5A 2ZRFA 3QUSA 3DM9B 3VU9A 3OF5A 2A2ZA 2JLQA 2LKCA 1WCV1 1M1YE 4BLPA 4RSGA 4TYNA 2JLYA 1KO5A 2OFXA 4M4SA 1G16A 3CR8A 1ESNA 4C0AC 1SXJB 1N5LA 2HXYA 3ND9A 3KDSE 1P4SA 2OT3B 2YKGA 2JEOA 2C77A 2R44A 3TGPA 1EFUA 3WRYC 1G8PA 2XTNA 2ONJA 4FCTA 2ZRJA 3FFBA 1N0VC 4W7SA 1XTSA 2XZPA 3I8XA 4RFSA 2G88A 2EFDB 4YMVA 3K0CC 3H0KA 3E2IA 4PPQA 3VR1A 4BE7B 2Q0HA 3UATA 1E9EA 3FMIA 2W0MA 4EAQA 1YQTA 3SDZA 1BH2A 1MABB 4G1UC 4N3NA 2OXRA 4DEYA 2GETA 4I99A 4LJ8A 4HAXA 4PAOA 1NMYA 2ZQ5A 4JBXA 2FX3A 1RC8A 5D3MB 3THXB 2H18A 3DVLA 4II7A 4CF7A 4MKFA 3J81k 3ECCA 3HR7A 1M2OB 5FBLB 1NG9A 1W4AA 1AQUA 3UANA 4DWJA 1WQ1R 2QA5A 3EW9A 3L8YA 1NSFA 4EFNA 5AK0A 1BIFA 1XJQA 2GXQA 3W90A 1LFDB 2ZAMA 3LFUA 2FZLA 1KO8A 1L4UA 1Q20A 2JIZA 4Q1CA 3PXGA 3CPEA 4OQXA 5GJBA 4Q4HB 5EQTA 2ZJZA 3IEUA 3K0AB 5DH9A 3LVQE 3OE7A 3O47A 4PANA 5E7IA 3GD7A 3VHLB 4ESVA 2IC5A 4V0ME 3AVUA 1XD2A 4DB2A 5EE0A 2ODBA 4B33A 3DOEA 3UIEA 2JLWA 1SVKA 2IYZA 1UKVY 5KOYA 4XD7D 5FL7A 4B71A 1QBKC 1B0UA 2G83A 1P6XA 1XZPA 4FWIB 4JVLA 2FA9A 3RS2A 3SJZA 2E1RA 2ZE5A 5FPTA 1HQYE 1OFHA 2FEOA 3OIVA 4YONB 3R9XA 1Q1QA 4NE2A 2GJKA 5FPHA 2QQEA 1F2UB 3Q72A 2CDNA 4YMTA 2JLVA 3WHLA 2FGKA 3AF4A 1I4DD 1OFTA 1HA3A 4XVRA 1CR0A 2ZRLA 1D2NA 1DAGA 3CNOA 1TUEA 4QL3A 4AYWA 4JN6A 1R8SA 1EFRD 3AKYA 2QGNA 1VDZA 2F6RA 3L0SA 2C9CA 4DB4A 4PC6A 4PC3A 5FTMA 1OE0A 2CK3A 4TTQA 3HP1A 5JHGB 1KI8A 3HPQA 2EFCB 4C2TA 4PPNA 3R9IA 1NVXQ 1QHHB 1EFCA 3B6EA 3L82B 4A4DA 2IYVA 2V6IA 4Q03A 4HZUA 4QGHA 1IBRA 2P0EA 4A2PA 1Z2CA 4FMCB 1D9ZA 4NYIR 4QGAA 1ZM9A 3PCRB 2QM8A 3ZLJA 1E2HA 3C8UA 5SZKB 1MOZA 5CM9C 3AV0B 3BFXA 1OFUX 1ZM3A 3I5XA 3C41J 3RC3A 4DCSA 3THYB 1XEXA 2OILA 1KI1A 2QAJA 3AB3A 2AD5A 1OH8A 4TN1A 1VTKA 2VP9A 4RJLA 5DI3B 1E0SA 4Q21A 2IUUA 2ECKA 3D31A 2BM1A 1E2MA 4NL4H 4PAQA 4A2WA 3QJYA 2NO7A 2ODEA 2CBZA 4HAUA 4URZR 1OXXK 1KZGB 2CCGA 1AS2A 5HCNA 3UKDA 1TPZA 4RZXA 4DC9A 4GZLA 2ZS9A 4Q1DA 1FL9A 1NVMA 1ONBA 1MO5A 3B82A 4IVQA 5CM8B 2BOVA 2O0JA 2ZRBA 3EG5A 3RRYA 4DDTA 1UKYA 4HEJA 5JJIA 3KL4A 1KOFA 3AF1A 2VHTA 2D4HA 3LWNA 4U7DA 1EFHA 1ZJ6A 4B3GA 4JT2A 4LV8B 3QF4B 2IYYA 3CZQA 2BEKA 3DDCA 5BN4A 2O0KA 1DO0A 3IQWA 4O3MA 2QNRA 1T0JB 4FWTA 1QG4A 4TSFA 2QBYA 2XTMA 1Z6GA 1SVIA 4FWDA 1OFIA 1EK0A 2WKRA 1R0XA 3SI7A 2ZANA 4MUAA 3REFA 3Q9LA 4BFVA 2DWOA 1TAGA 3QBTA 1E2GA 5E7JA 3U7EB 5IF9A 2XOKD 3MGCA 1UDWA 2Q3HA 5FPYA 5KSYA 4B75A 2ZRMA 3PEWA 3BOSA 5K8UA 1UKZA 1TEXA 4WW0A 4DCUA 3HDTA 4LWZA 1QVRA 2WSSD 4TLCA 2FSGA 5EP4A 4Z1MD 5J47A 1UF9A 4OI0A 3FGNA 3AVTA 1OXVA 4A82A 4AYTA 1PJRA 2GEDA 2WVJA 4A6XA 1QRAA 3K0FA 4AIIA 2ORWA 1IXRC 2V55B 3C16C 4D81A 1E2QA 1NLZA 2QTHA 5JJKA 1PLLA 1S3SA 1S0UA 2PL3A 4TQUS 5GJVC 4E09A 3A1VA 2X8AA 1A82A 5M04A 3CX7A 3QEOA 1SKQA 2C78A 2ZREA 1FX0B 3VFDA 1KI4A 1KIMA 3W5IA 4ILEA 1N6NA 3IHLA 4C0HA 2QT1A 1MO6A 2FOLA 5AUPB 3T5GA 4FMDF 2F1RA 1XP8A 2J0UB 1QHGA 4TSFD 4FWHA 3R7WB 1KDOA 2GJSA 2ZSEA 1W2HA 1WDTA 4RD3A 2IYLD 1FW6A 1T4GA 3U3OA 4A15A 4RD1A 3CPJB 3AKCA 3EZFA 2HT6A 1ZU5A 3AGQA 1CR1A 3DKPA 2KJQA 1A5TA 2CVHA 1XXHB 2W6JD 1RJ9A 2JJ1A 3PUVA 4HATA 2PMDA 4Q9LA 2QGZA 2ZSFA 4MGYR 1OH6A 2XTZA 1E2JA 4Q7LA 4C7OB 1CF4A 3WMEA 3LQRA 1ZRHA 1TEVA 5KTYA 2VLIA 2P67A 5HR5A 2W6ID 3BFVA 4LSGA 1Z0KA 1P72A 5FI1B 2MMGA 3CNLA 2J5XA 1P73A 3VMFA 5L3QA 1DVRA 5B30A 5J4VA 2K5UA 2BMEA 2AFIE 2WOOA 2XXAB 4XTRA 5HE9A 3GJ8A 2ZSDA 3RS5A 4Y0VA 4JVSB 1TU4A 3EZ6A 4LJAA 1E0KA 1IN6A 1YKSA 1IAQA 4AY2A 4JKYA 1U0LA 1G18A 3QG5A 4DDVA 3GLGE 1OJLA 3THYA 4LI0A 1XTQA 1NN5A 4S35A 3K53A 3T06B 2BVNA 3GLHA 3IIJA 4LJ9A 2CK3D 2AN9A 4NH0A 1TQ4A 4UXJA 4KSBA 2QAGB 4BASA 3OZXA 2BJWA 1EFRA 1VCMA 3RWOA 2C95A 2BJVA 1T3SA 1D8TA 1RE0A 4NONA 2IS4A 4IXNA 4OKSA 3VX3A 1XF9A 4MDEA 4JLMA 2V6JA 2EFHB 3U7GA 1GILA 2QSZA 1RPZA 2CJWA 4HLCA 4NDZA 3VX4A 3EC1A 4FIDA 4DSOA 2ZPTX 4HB2A 3VKHA 5L3SB 1LS6A 5DHAA 1N6IA 1FQJA 4HAZA 2CE7A 3V4FA 4I1OA 4OK5A 3ZVMA 2ZAOA 1GKYA 4C2UA 2JDIA 4TZ0A 3QXXA 3THOA 2FG5A 3OE7D 5IK2A 3HU2A 1VHTA 2HJVA 2RHDA 3HPRA 2VP2A 4Q7MB 1AK2A 1YR6A 1UFQA 2WJIA 2QMOA 4FINA 3V9PA 1ZBDA 1NBME 4JBWA 3SNHA 1EWQA 1GG2A 3B2EA 2GA8A 4JKIA 3WY9A 3A4MA 2NMVA 4UNNA 1AZTA 2N42A 1GSIA 1FTNA 2XAUA 3IPYA 4PO9A 3B5JA 4DLYA 3E5HA 1K5DA 2QEQA 5ANRB 2XX3A 1CJVC 4A1FA 3K70B 3KTAA 1CBUA 4FMDB 1YRBA 4QNMA 1KI6B 3DHWC 4TTRA 1KSGA 5KDOA 1O3YA 4TMZA 1TADA 2JLSA 4PQRA 4FI3C 3I5YA 1AGRA 1II8B 2TMKA 1UPTA 3EARA 1WE2A 4M1YA 4ACBA 1ZIOA 3AQ4A 3RSOA 2D62A 5KO2A 1RW4A 4OI1A 4A6PA 2J0QA 4KAXA 5KSZA 2RGXA 2YNMA 3B1VA 3B1ZA 3LV8A 4L16A 4RD4A 4DT1A 4DCNA 1TL7C 4JJZA 1PUJA 3FKQA 4X8OA 3W34A 1VHLA 5FOXA 1G17A 3VLFB 1ZYUA 2LKDA 2L0XA 2KB0A 3K09C 3RS0A 4FMBB 4CT5A 2N1BA 1JPNA 2AWNA 4TT3D 1GP2A 1YR9A 3NKVA 1W4RA 4RZ3A 1TMKA 4KCGA 3MD0A 4BRWA 4YMSA 4B3XA 1XD8A 2ZUDA 3N5CA 2QP9X 2GF0A 1G5RA 1KDPA 4LHZA 1W47A 1BOFA 2JATA 1KI2A 4I81A 2VPPA 3D7MA 3M6AA 3Q7QA 1SXJE 3QPUA 3U6KA 1BKDR 1FZQA 1KK3A 2PCJA 2OBNA 2XITA 5FOSA 3VR2A 2CVFA 3QKSA 2ZU0C 2EW1A 5H8WA 3PITA 1LW7A 3MG9A 4C0QC 5IK2D 4CVNA 3C4JA 3GLFB 2B6HA 5BW8A 1IONA 1W7AA 1FNNA 3T5DA 1F60A 3WBKA 1XD2B 1X3SA 2ZI9A 2ZE8A 2QE7D 5KU1A 1D2MA 1XCMA 2QTFA 2W2VA 1JBKA 1ZM7A 4BRUA 4QHSA 2YOFA 2ASEA 1YZUA 1X8KA 2ZRGA 2GDJA 3QXSA 5CIWA 4Q9JA 4OQLA 3W6PA 2REXB 2IA5A 1U8YA 3MAAC 2DHRA 2D7DA 4S2EA 1NLFA 3JVVA 3ZS8A 4TLEA 1N5IA 2HT1A 3SHFA 4K8OA 2V6ZM 2IX3A 6Q21A 2Z43A 4V02A 1KJZA 2ZUCA 3K0CA 3W5JA 4OQNA 4V0KA 1ODFA 3A8TA 2QZ4A 2EFEB 4H9GA 2DB3A 3PENA 2QY9A 5H68A 1KAOA 3LX8A 1L8QA 2ZI4A 5J40A 5SZIA 3PQCA 1RYFA 4WZ6A 1WMSA 1OXSC 4AG5A 1E6CA 3CRVA 3QENA 4MYUA 5EUQB 4PSVA 1GL7A 1ZNYA 3GLHB 2VSXA 2BEJA 3SFVA 1Z2AA 1ZNXA 4B47A 3GFOA 1XFAA 4Q00A 1KY3A 3CNNA 1Z6XA 3F3YA 3QF4A 4PO1A 2FV8A 4Q66C 2QG6A 3TLXA 4GT1A 3AM1A 1UJ2A 4LBWA 1VG1A 4HZIA 4JLBA 3M4YA 3AP2A 1E9SA 3I32A 3ASZA 3NBZC 1U9IA 4OHVA 2QP3A 2OFWA 5BYKA 3P4XA 1Q44A 5FBWB 2V1XA 2ZUBA 3RAPR 1DAHA 4IJMA 3VNUA 2ATVA 1GL6A 1FMJA 4OHWA 2IUSA 4TYQA 4BQSA 1GKIA 4NZYA 2PEZA 2O8CB 1NIJA 2R6GA 4J0QA 4F38A 1GRNA 2QAGC 1ZP6A 4O0MA 3VKGA 2JJ1D 2QBYB 4PHFA 3W6NA 2QMHA 4Z54A 1M6NA 4MKHA 4GSYA 1VMAA 3LY5A 4JVMA 3FKSD 4KVGA 2DFKB 2WWGA 2RGGA 4Q4JA 4V0LA 2HCBA 3ZVRA 2DWZB 4WVFA 2HYIC 3OFND 4B32A 1COWD 3EWAA 1T9HA 2ZI6A 4KVAA 5C46F 1ETUA 2WWWA 4GNKA 1G41A 1Q3HA 4MITA 5AUQA 4QBIA 4YQFA 1UEJA 2B7CA 1WBDA 1KI7A 4HI0E 1TQ6A 2P6NA 1KMQA 2NTYC 3U3RA 1IXZA 1H65A 3CRRA 3E70C 1G1MA 3L0IB 4HZUB 3MFYA 4IXMA 4MRVA 5JLJA 4JVNA 4MRSA 1KJYA 5L3VA 2VA8A 4DLVA 2UKDA 1VKJA 3OAAA 4XWAA 1XRJA 2UVQA 2VTKA 5DN6D 1XMVA 1DG3A 5TXGA 4D0NA 4DJTA 1IQPA 2ZJBA 1GRRA 2ZYUX 3UWKA 1MT0A 1M8PA 3KKOA 3LBNA 4KO8A 2HJGA 2EFGA 2BBSA 5AUOB 1NY6A 4KITB 1YZQA 4D0GA 5JEDA 2QM7A 1JQJC 1S1MA 2F7SA 4LC0A 5DHFA 2IXGA 4QNRA 4MYTA 4MYCA 2C98A 4P31A 4IOKA 5G40A 1G20E 2ZYVX 2NPFA 1S2MA 5EE5B 1Q0UA 1R5NA 3RS3A 1GOTA 4NKRA 5EP2A 5KYKA 4NPHA 4L9WA 1T6NA 2QU8A 2REOA 2DZNB 4M1OA 1R2QA 1NY5A 3L8ZA 3LQQA 3LW8A 1W44A 3DM5A 5JEEA 1HT2E 4BZPA 3QKSB 4UXHA 4C30A 3K9HA 3NIBA 1KI9A 1JJVA 4ERNA 5GVRA 2RGEA 2F43B 1NJFA 4M9ZA 4N0DA 4A36A 3Q7PA 1F2TA 1Q12A 1ZM2A 4D80A 2QMUA 3CB4A 1CLUA 1GNPA 4EPVA 3IGFA 2OO7A 4EPWA 1GWNA 5FFMA 3OFNA 1GNRA 4KV9A 4QFMA 2ZI3A 4QJ4A 2ZRNA 2CLCX 5GJWC 3THWA 4CEIA 2O8EB 5CJPA 121PA 1VIYA 1JAHA 4YDSA 3RVBA 3VAAA 3KQUA 2QPAA 1XCGB 1G8FA 1G7TA 2DYKA 5KNDA 4MRNA 4A2QA 2QRZA 1KMHB 1CJUC 1LB1B 2OCAA 3OIUA 3ONWA 4EQ6B 3UMSA 3KB2A 2QRNA 4XH9B 5HZKA 1MKYA 2IS1A 4JLOA 1E2NA 2CL6X 4Q4AB 2OBMA 3GQBA 4UJ5A 2EVWX 1E96A 4Q4HA 1R8QA 4RFSB 1E2IA 1U9IC 1UBFA 2FZ4A 4LPSA 3NWJA 4A0FA 4MDFA 2CNWA 1GITA 1DAIA 1DBSA 1FUUA 3LXRA 3WXMA 3L43A 4AK9A 1KO7A 4KLNA 3JZAA 4LZZA 4QGFA 5EUMA 3SBEA 1N6LA 2E9SA 4HUQB 2ATXA 2RKOA 3ZD7A 3ADBA 4HUTA 1P2VA 1YHNA 4PQFA 1PVOA 2NO6A 2SHKA 3A1TA 3OEHD 4O2LA 4Q18A 5FL3A 1W0JA 3NDBB 1SVWA 1XZQA 1X1SA 1VG9B 3B13B 3DKVA 3A6PC 2J45A 3BORA 4LPKA 1XMJA 4BFUA 1UEIA 2IL1A 2I1VB 2GVDC 3TUIC 1LF5A 2RGNA 5KSOA 1FP6A 1K6MA 5KUTA 2IWRA 4A8JC 4KHZA 3QSYA 4WXRA 1HUQA 1W4CA 3FE2A 3MSXA 2PZFA 3CX8A 4QG7A 3EASA 4L4UA 1SKYB 4QJ3A 1E94E 2QT0A 2WSSA 2ZITA 2Q3MA 3NH6A 5L3QB 3GPLA 5FH9A 5EP3A 1Z8FA 1F2TB 1Q22A 4LJYA 1G7SA 4URVR 3X1WA 1E2KA 3UG6A 1E98A 1Q57A 2RGDA 4CRWB 4U02A 3E1SA 3BH6A 3UMRA 1W1WA 1KI6A 1KO4A 4AG6A 3A58B 2ZIAA 3A36A 4MGKR 4DRZA 5JWOA 1A7JA 2R65A 2YWGA 4JJKA 5EXXA 2BDTA 2BV3A 3B1YA 1KSHA 3BWDD 2QN6A 4MGIR 1XPOA 3ZZTA 1CKEA 3GLHE 5IT5A 3K9LA 3CH5A 2MSCB 3KQNA 3OEED 3RRMA 3W9YA 4IOMA 1IJFA 1JALA 3GJ0A 1LY1A 3U3KA 3H2YA 1YZKA 2WJJA 2GNOA 1IHUA 4BFTA 5F9HA 4NBSA 5P21A 3C5HA 2IWHA 1YE8A 3AGPA 1CTQA 1DAMA 3KXLA 2RGAA 4Q1AA 1JECA 4IDOA 621PA 1UDXA 5AUNB 1E3MA 1HEIA 1R5BA 1G3MA 3UMFA 3FOZA 2OZEA 1JJ7A 4TLDA 5F2EA 4MYHA 4B73A 2C03A 1TU3A 5EXSA 4RD6A 5IHPA 1ZUNB 4NP6A 3SJBA 4ZIRB 1NMZA 3BC1A 2YWHA 3EA5A 4LC1A 3C7KA 5KNCA 2GHIA 1CRPA 4MKIA 3QKTA 2FJUA 2H17A 2IHBA 2OG2A 521PA 3S1AB 3Q8XB 4Q4AA 4B3FX 4C0JA 1XXHE 2G77B 3PUZA 3QPVA 1CU1A 1VYTA 3KJGA 4ARZB 2J41A 4D26A 4HDOB 2FNAA 3A4NA 3TRFA 3HU3A 4NYJR 2XB2A 4WOPA 1TNDA 2X1VA 2Q21A 4OL0A 3QG1A 1JAIA 1GFIA 4NTZA 5UKDA 5H70A 2QUZA 2P6RA 4U5XA 2O8DA 2CCJA 5JSZB 2YYZA 1CIPA 1P5ZB 1UADA 3CZPA 5HTKA 3BD9A 4CEIB 2FPLA 3K0FB 4D2IA 3EXAA 1X6VA 1GDDA 2HEIA 2WAXA 4E22A 2V9PA 3AVOA 2CEAA 2WIBA 1SHKA 3TNFA 4X8MA 3Q5EA 1QHXA 3A1WA 1M74A 3B85A 3HR8A 4OHZA 1T5IA 1KDRA 2I4IA 2YZ2A 2WJVA 2ZYWX 5FTLA 4AKHA 2PCLA 1HQCA 4EPXA 1AJEA 1KSJA 3NVAA 4B6FA 2ZXUA 5B2ZA 1AKYA 3IBYA 1XB2A 3TH5A 1A1VA 1FTSA 1ESMA 5FR2A 4M9QA 2DFNA 1Z5ZA 1R0WA 2E87A 2PT7A 2HLDA 3KXIA 1D6JA 3KJHA 1MV5A 1NVUQ 2NO1A 4V0NA 3TSOA 4E03A 3SR0A 2JIZD 5AJXA 4QJ5A 4G5QA 4EDHA 3CBQA 3GLFA 4LRSA 4LYFA 2FE4A 3AVPA 3BERA 2WPDA 3O8DA 4NHOA 4BUJA 3ZYCA 4N1AA 4F4CA 4PO8A 5FUWA 2ZETA 2KRKA 4Q5IA 1KAGA 4RD0A 1MO4A 3NC1C 2ZJOA 4UXIA 3DPUA 3SQXA 2BBOA 1P62B 5IDVA 1HV8A 4MRRA 1E2DA 1YR8A 1FX0A 4HB4A 2YC4C 3PG5A 5LBIA 4JS0A 2WM9B 1NJGA 4Q47A 4XSGA 4O2RA 3GLGA 4PXAA 1P2UA 1FP7A 2CE2X 2XZLA 2OM2A 3QVUA 1QVAA 3T61A 4L5BA 3ZS9A 1Z3IX 3K0SA 2J0SA 4B48A 3U3JA 4BZQA 3ADDA 2VP4A 4LJ5A 1OKKA 1OW3B 3GFTA 3MWYW 4PQYA 3AVXA 1KI3A 5GJCA 1KTVA 1FUKA 4M0LA 1ZC3A 1G3UA 5EE1A 3R7WA 2IEYA 2WMNB 1E9FA 3P32A 4PZLA 4URYR 2R2AA 3B60A 1G21E 4OJKA 5HE8A 2O52A 2QMEA 3DEFA 5CYPA 4HLQB 2ONKA 2GCOB 3W8RA 4TQAA 4AC9A 1LVGA 2OV2A 3LX5A 2DBYA 4PR0A 4GOXA 2XEXA 2VL7A 3HWSA 4US1R 2PJRA 1RIFA 1J70A 4YMUA 1H8ED 1EGAA 1HYQA 4C9BA 1M7BA 2RCNA 2XSZA 1X1RA 3CIOA 4HLDA 1E2PA 1NMXA 1E9BA 2C8VA 3K70D 1OIVA 2Z0MA 4E07A 2NGRA 1T5LA 4AD8A 4CGZA 4B74A 2GWHA 4HLUC 3VR3A 4A92A 2ZS8A 4TQ9A 2GRJA 4YXWD 3I61A 4Q7JB 4ZKEA 5CB8A 2WICA 4B44A 1W46A 3TIFA 3REGA 5C2JB 2GXUA 4UQOA 3AF2A 1RFLA 3HYRA 1T0HB 5C4MA 3FMPB 1UAAA 2ZEJA 5DYGA 3EPHA 3R8CA 3S1AA 2IYUA 3AUYA 5FTJA 2VHCA 5LPNA 2ZYTX 5D3MA 3TKLA 3BB1A 5K8IA 3THXA 1SKYE 4DDWA 5DIFA 5JHHB 2B92A 1TX4B 1EXMA 4G01B 2D2FA 3WNBA 2QROA 4ZCLA 5TB5A 2X2EA 4M53A 2VQSA 2I1QA 1LV7A 3U44B 2O8EA 2DY1A 4GI7A 3LH5A 2QTVB 2RMKA 4I1SA 4KFSA 1P9WA 3IBGA 4LY6A 1W5TA 2AHOA 2QAGA 3QF7A 4W5JA 3HYTA 2BC9A 2IS6A 1AS3A 2ANCA 5KPDA 3K0EA 3VU9B 4ZDIA 1ZD1A 4LYHA 4GMXA 2V54A 2QI9C 3NC0C 3PEUA 4RZ2A 1F2UA 1NRJB 5CDFA 1WXQA 4B6EA 1SXJC 3BB3A 4LRTA 3RRNA 4BEJA 3WP0A 5ELXA 2D7CA 3CX6A 1JI0A 3TE6A 4UNRA 4ZCIA 3M1IA 3QOFA 2VSFA 2AKAB 3MHVC 3GJXC 4DUGA 5LB4A 2NG1A 1E9RA 2CCKA 1ZNWA 4LUCA 1Z22A 3LLMA 4XSHA 3M0EA 1QZMA 1P9NA 4TWZA 3OIWA 3ZDQA 4P4SB 4XWKA 1EWRA 5BQ5A 1Z0JA 4G5SA 3EC2A 4JYCA 2BM0A 2CMKA 3CO5A 3QE0A 4R71A 2QQ0A 4AURA 2FN4A 3FFAA 3ND8A 5BYJA 2H8KA 4D6PA 3UPUA 1G3QA 3HU1A 4EPRA 2FFBA 2ODWA 2XOKA 3FHOA 4TLAA 2FDCA 3ZGXA 4TL7A 2BCJQ 4HB3A 4D4JA 4BFZA 2VH5R 1Z06A 1G6OA 2A3RA 2KBEA 1XTJA 3U2QA 4G5RA 5JI2E 5K8LA 3ZZ0A 4OJQA 1N6HA 4JLJA 4QBFA 2KBFA 3QY0A 1C1KA 5AJWA 4URXR 1BMFD 2J1LA 3V4RA 2MSDB 2O8FA 2G1JA 4LHYA 2ZRKA 4ESHA 1W48A 3JZMA 2ZJAA 1VIAA 1J8MF 1J2JA 1KK2A 1J8YF 4M8NE 4C0SA 2WWHA 1XBTA 2W6JA 4WA7A 2AXNA 1Y63A 1Y3AA 3MUFA 3WMGA 4D4MA 4B3DA 2GCOA 2OCYC 2PEYA 2G3YA 2F3RA 1CJKC 3IQXA 2OAQ1 4URWR 2RGBA 5AJYA 3TUJC 1BMFA 1GAJA 2IYXA 1UKEA 4DKXA 3QKUA 2NQ2C 4BEBA 3IHWA 3FVQA 2OEPA 1KNXA 2G0NA 2IHYA 3T1OA 2ERYA 1AM4D 1Q1ZA 4MUBA 4OHXA 5J4KA 1II8A 2D3WA 3EZ2A 5CB6A 1KYIA 1VYUA 3H86A 5JRZA 1G8YA 4HSEA 3GLIB 3W8NA 3FPAA 4LBYA 5B64A 2FSIA 3FMOB 2H57A 1QG2A 1OYWA 3SOPA 1E9CA 1X37A 2ZSBA 1NI3A 2ZI7A 2JLXA 3FWYA 4DSUA 2IF0A 1OSNA 3U6BA 3QXCA 1E99A 2OUKA 4MRPA 3KUCA 4F4JA 3MWJA 4JL5A 2ORIA 4LJ6A 2ZE6A 4Z1MA 1Z6YA 3TSZA 2J59A 1ZAKA 3MWKA 4EJSA 5BN3A 1IM2A 1Z29A 3U3MA 1E2FA 1GKUB 1W49A 2ZR0A 1JR3D 2Y8EA 3SE0A 3FYHA 4LCBA 4QC2A 1ZUIA 3SJAA 3KXKA 4KBGA 5BXQC 5AJZA 4WAUA 4U00A 4QHTA 1P7CA 1AKEA 2V7QA 3WMFA 2A5FA 2ZVQX 1SZPA 1KJWA 2IBMA 1L4YA 3I8SA 3NHAA 4KODA 3LBIA 4TL9A 3LO5A 3X1ZA 2RH5A 4JSYA 1XU4A 4B3CA 1FNMA 2A30A 2VP5A 2AX4A 1G8GA 4B35A 3WP1B 4B2IA 4ZIRA 4FWGA 3LAWA 1FMLA 2AK3A 2J46A 1SXJA 4D25A 2H92A 5L3RA 2C99A 5EZ6B 2B8WA 1NN3A 5CLLA 2WTUA 3RS7A 3A1SA 4Z8XA 1HY3A 1RZ3A 4TL6A 3QXJA 5CYOA 3RC8A 3PR1A 4A3VB 2A7QA 2W83A 3WNDA 2ZRHA 4TLBA 2KI5A 4Q48A 4A0HA 1CEEA 3DZDA 2GAOA 3GLIA 3DMNA 5JRJA 1B23P 4MA4A 4MQBA 3O8CA 2WHXA 1CJMA 1AA9A 4CT4B 5HPYB 1XWIA 3VR5A 4FW9A 2FH5B 1XMIA 2C9YA 5TVKA 4H1VA 1DAKA 2YHSA 5AJVB 2GBLA 4XWOA 4KFRA 4IFEA 5K8TA 4JBYA 4X8LA 3A4LA 1P60A 1KDTA 5CK5A 2HYDA 2V3CC 3DL0A 2ORVA 1XTRA 4WXPA 2JAQA 4ZCMA 4Q4JB 5LD2C 3B1XA 3U4QB 1JXOA 3K0AA 4TMTA 4LYAA 2XJ9A 4RCYA 1U98A 1FPMA 3AKEA 3I73A 4DCVA 1IY0A 4YC7A 4JLVA 2IS2A 4ARZA 4P4SA 3U5ZB 4D4KA 4NCIA 5FOTA 2AR7A 1IJEA 4KXFB 1N5JA 3TK1A 2NZ8A 3TJZA 1T8UA 3GEHA 2PZEA 4JLKA 4ABYA 3H4MA 4Q01A 5FOUA 4EUNA 5JSZA 2FGJA 4W9MC 4FD2A 3WYAA 2JLUA 4I1VA 4LV5B 4XOIA 4ZI3A 4LJ7A 4P4UA 3GJ6A 3NEYA 3AEZA 5FL7D 3IIMA 3PJRA 3DMDA 3B9PA 2ZR9A 3GCGA 5IRCD 2PLRA 1FQKA 1N6OA 2OCPA 2WPDD 5HKKA 1UBGA 2D74A 3K8YA 3O8RA 1S9DA 4NCHA 3RYTC 3T1VA 3C5CA 4L15A 1EFTA 4ASUA 2FF7A 1ZIPA 4G5OA 1ZC4A 2Q6TA 1MRNA 1QHHA 2P65A 4NMMA 1J99A 2JJ2D 2VRWA 2HDNB 2IYSA 1NG1A 1VPLA 2RAPA 1OXUA 4Y0AA 2ZTSA 2GXSA 4BLOA 4DSNA 1G8HA 3GFPA 2J0VA 1H8HA 1N3BA 2NOAA 1XEFA 4BWYA 1G5PA 3KUDA 2CHQA 2X19A 1GNQA 2JGNA 3KKMA 1IY1A 2A5JA 4ITRC 2JJ2A 4GFDA 4JMPA 4DEXA 1DG1G 3KQHA 1QHNA 2HLDD 1DE0A 2AD1A 4TZ6A 4GOKA 4R2IA 3B7GA 2XJ4A 2QPTA 3P26A 1NVWQ 3GJ7A 2A5YB 4JLDA 2V8OA 3W3AA 4AKIA 3BAFA 1RRPA 3A1UA 2EU8A 4W5HA 1J90A 1Z6TA 3R9WA 1NBMD 3VQTA 5B57C 2ZJ2A 1ZM4A 4IDQA 3LRPA 3W6OA 2DCUA 4HAWA 4IVRA 2PLFA 2CJWB 4JT4A 4X8HA 3TSWA 3PVSA 2DFTA 2F1HA 1Q21A 821PA 1CULC 2XB4A 1ELOA 3FTQA 1VCOA 1II0A 3CONA 4IOLA 4PZZA 1KMHA 3LNCA 5G3ZA 4G0NA 5SZHB 3BFKA 1XNJA 2WSMA 1K5GA 2XNDA 2OE2A 2OLJA 3RLFA 1J7KA 2IXEA 3DO6A 5DI3A 5DNYB 4IHQA 3U7FB 2RGCA 4LHVA 4EPTA 4D0LB 2VBCA 2B21A 2XNSA 3CRQA 5L3SA 1OYYA 1Z07A 1PUIA 1VYVA 3AP1A 4EQ6A 1JNYA 2BMDA 2BCGY 2B8TA 4B76A 1VECA 1Q1EA 3OEEA 1JEEA 2YJTD 3I62A 1KKMA 2R6DA 1P2TA 2JJ8A 1T3LA 1Z0DA 4M1WA 1LNZA 2JDID 1K8RA 2WKPA 4EFLA 3MMPA 2IYQA 3RRZA 2X2FA 1IXSB 2GBLC 1KSFX 1NVVR 4QKQA 3IUYA 3GJ5A 1JPJA 1NKTA 4HLUA 4OYHA 5GADl 1L2TA 3D6TB 3WYGA 1D5CA 1G4AE 4WZBE 3N2EA 1W36C 4P3YA 2BKEA 2NO9A 4G3XA 3TQFA 2A78A 4QBHA 4TMVA 1GTVA 1OIWA 5DISB 3BH0A 3JVUA 4OK6A 2JLRA 4NU0A 1SXJD 3CM0A 5BWMA 4LOAA 3U60B 1GUAA 4EFMA 3Q5DA 1US8B 1SVMA 5BN5A 3ZVLA 4F93B 1KGDA 1G7CA 3EZ7A 4DLWA 2QP4A 1OHHA 5DI9A 1U0HC 3ZH9B 2D2EA 2PZGA 4Q1EA 3CLVA 1N2CE 3GP8A 1E79D 1ZD9A 2C04A 1PLJA 2BMJA 2G0TA 2OLKA 3AVQA 4XTCS 2BWJA 2EYUA 2WJYA 4QM6A 3D8BA 3B9QA 3IILA 3WRXC 5CK4A 3X1DA 2GJ8A 4YDHB 2J0UA 3QVVA 1CP2A 4KI0A 1KZ7B 2Q9CA 1QHYA 4PSKA 4F4IA 3KKQA 5CJ2A 4R9UC 3RANA 3IDQA 1OIXA 2B7BA 3H84A 5KDLA 4KYUA 2MSEB 3V00A 5JWRA 2XGJA 2GKSA 2AFHE 3T35A 5G41A 5A0FA 5GVSA 2CL0X 3PFIA 1A4RA 2LWIA 3MJHA 4O25A 3H1TA 4OQMA 2F1JA 3NH9A 3TAHA 3ZVNA 1MABA 4JLNA 1OT3A 1MRSA 3BK7A 5A4JA 1O87A 1KO1A 4CEJA 4BGDA 4Q7KA 1N0WA 1Q1BA 2R62A 4IFBA 1IOZA 1XTKA 2YOGA 2I3BA 2WIAA 3QPWA 2PBRA 3NBXX 5JCPA 1DEKA 4GITA 1ZCBA 3TUZC 2ZRIA 1RVDA 1U81A 4JSTA 4WZAE 1FFHA 2VHUA 4P32A 1WRBA 1II9A 3EIQA 2OSBA 4CW7A 4NYIQ 4BLSA 1KHTA 1GZSA 1X86B 1F3OA 1E1QA 4V03A 1Z0IA 3K9NA 4Z8YA 5CLQA 5AWFC 4C3ZA 1G3IA 5JS8A 1UBEA 2EWVA 2P5SA 4LYJA 2XXAA 3P4YA 3SYLA 2FEMA 4FMCF 3IKJA 4GP6A 5LDDC 2GEUA 3HJNA 4D82A 1JXMA 4OQFA 4PX9A 2PT5A 3MWLA 1P9RA 5EZ5A 3WYFA 1E1RA 3K9GA 4LRWA 2WJHA 5JS7A 2DVWB 1T8TA 2VO1A 4NYMQ 2O8DB 2ZRCA 1AN0A 1VCNA 1ZINA 2FMXA 2IXFA 2VHQA 1R0ZA 2VP6A 4AKGA 5TY0A 4M1KA 2HF9A 2O8BA 2ZSAA 1NLYA 4BPBA 2Z4SA 4AKEA 4AYXA 4P0TA 3TR5A 4BZXA 1W0KA 2J3EA 2FSHA 3FHCB 3K70C 2WWXA 3T12A 4TMXA 2O8FB 3BS4A 3NEJA 2GVZC 2GZAA 1C4OA 1JEDA 4OK3A 4A8JA 2F3TA 2EQBA 2R6AA 3O8BA 5DN6A 2J7PA 3OHMA 4H1UA 4DIEA 5JMTA 4HDCA 1YRAA 1QF9A 5TMPA 1U8ZA 5J4HA 2PJZA 3CPHA 1SVOA 4CZ2A 2BIFA 3SFZA 2W0SA 2W58A 4GL2A 1W0KD 1EESA 4C4PA 2DWQA 2Z4RA 4I4LA 4DUGD 4GDFA 3BIFA 3EA0A 1S96A 1E32A 4XVUA 4CEJB 2ZJYA 1Z0AA 1OPXA 1CS4C 3AF3A 2ODNA 3WNCA 3ZD6A 4US2R 3KX2A 3I1FA 2D06A 4XIGS 3KW6A 1JB1A 4M1TA 2VF7A 2CL7X 1I2MA 5EJEA 2CLSA 1E1RD 4RKFA 2ANBA 4TTPA 2V4ZA 3F0TA 2VEDA 1G5TA 1SULA 1MR3F 2W2TA 2DWPA 3AP3A 2VSOA 2GK7A 2RB4A 5FPKA 1G291 3ICEA 4FCWA 4QGGA 2AKYA 4L9SA 3Q3JB 3TBKA 1F5NA 1Z47A 5LD2B 1TTTA 1R5OA 3FMFA 1COWA 3TR0A 1LS1A 2Z6VA 1DO2A 4BECA 1IN4A 2GJAA 2HXSA 2VYFA 4LHXA 2JA1A 2WAYA 5FUYA 4A0RA 5JECA 2QORA 5LB2A 1PLKA 1ZNZA 2OHFA 4NYJQ 1XEWX 3NXSA 1E2LA 1LTQA 3BXZA 1E0AA 1T3HA 2GILA 2BKUA 5FPSA 3AKDA 1WBBA 2X77A 1G4UR 3CR7A 1M34E 3VTKA 3UWOA 2XNDD 4K81B 2FPMA 1KKLA 2UZ3A 1P2SA 2P2LA 4TYPA 5HCIA 5G53C 4F7WA 2EWWA 3QXHA 3ICQB 2N46A 2IYTA 4EPYA 1H8EA 4WIAA 721PA 3L0PA 3ZZUA 1DS6A 1CR4A 1S4QA 3UG7A 2XZOA 4BLRA 1HURA 1U2RA 3BH7A 3G0HA 4DLUA 1G9XA 2H7VA 3SU8A 4KBFA 1QZXA 3SZRA 2QPOA 3EAQA 4IOJA 4KYIB 4B3BA 2O8BB 1NL3A 3QBVA 5FBRB 2R6CA 3T1TA 4GRAA 2ZJ8A 5EXPA 3CWQA 2QE7A 3MCAA 3FDIA 3N70A 1G19A 1OKKD 1D2EA 4MGZR 5JI3E 1ZU4A 1E69A 3RSLA 1EX7A 2QENA 1N0UA 4A8JB 1IN7A 1R7RA 5AR1A 1W2GA 4NCKA 4DLTA 5B58C 4LBZA 5FTNA 1RKBA 2HCJB 2GK6A 3IPXA 3KQLA 3AVVA 5F9FA 4HYYA 4Q4LA 1VG0B 1M7GA 1YZGA 4IKEA 2Q9BA 2LCFA 3SYNA 4JIMA 1U99A 4KFUA 3QKRA 1E4YA 2AWOA 1HH4A 5KDDA 1GIAA 1AGPA 2KWIA 2H1LA 4W5WA 4KLZA 3MRSA 2YC2C 1RYHA 1N25A 1VCIA 1SGWA 4ZPXA 3F8TA 1W5SA 2A5GA 2PMKA 4KJZA 1QDEA 3C15C 1G3RA 3U4QA 3IO5A 5DO9A 3TQCA 2J7KA 3VNVA 5CITA 2P3SA 3T15A 3EIEA 1UBCA 2WOJA 2OFOA 1R0YA 3AF0A 4LHWA 3TAUA 3PIRA 2OCBA 3CF2A 1WF3A 2DFLA 4HB0A 1UM8A 3TMKA 2ZVPX 4MH0R 1Z6AA 4CEHA 5FUXA 1R6BX 4Z51A 4HUQA 2ZJ5A 3SS8A 5E7MA 3P20A 1BS1A 1C1YA 4EKDA 1TUIA 1VG8A 4Q1BA 2O8CA 3GLIE 2IEZA 4I1UA 3Q85A 4V0OA 4DCTA 1KNQA 2F9MA 2IF2A 4GMDA 1D9XA 4DZZA 1U8AA 1EG7A 1X8JA 4IEEA 5FBQB 3B78A 1ZUHA 3KFVA 2JASA 4PTLA 3WHKA 1BO6A 1RRGA 5DE3A 3GLFE 3ETLA 3R20A 4RZUA 4UNQA 2JCSA 3ZQJA 1ZW6A 1G7RA 3QI2A 1NP6A 5HZHA 5JBQA 3ZQ6A 2CHGA 4IW3B 3N2IA 5DYIA 2HV8A 5KNBA 3LLUA 1CJTC 4TYYA 3AUXA 221PA 4BFWA 2YWFA 4CDGA 4RCZA 4PHTA 1KY2A 1ZD8A 4E5UA 3LW7A 1TF2A 1P3JA 4M9XA 3L0OA 5EP1A 3RHFA 4DLZA 4AWXA 1KK1A 4PFSA 4B2LA 2G9NA 4YMWA 2DPXA 1XMSA 1GVNB 1XJ0A 1DPFA 2AL7A 1TF7A 5H1YA 2GJ9A 4RKEA 3MJRA 3RWMB 1OB5A 1W4BA 4POAA 1L7VC 1US8A 3VHXA 3I92A 3CUEF 3NBFA 1OV4A 2F9LA 3TW4A 5D3QA 3X1YA 3C14C 4BLTA 3KQKA 1XPUA 1KK0A 2ZS7A 1NN0A 4PC2A 1A2BA 3T34A 5J5CA 4HAYA 3RDPA 1ZCAA 5DSZA 3P27A 1SVLA 2CXXA 3KKNA 3DOFA 4KFTA 2IUTA 3QQ5A 5SZJA 5FTKA 3TW8B 1V5WA 1N6PA 1H8HD 1M7HA 3U7HB 1TF5A 1YZNA 2G1KA 2Z83A 3GLGB 4M22A 1TQDA 4CYMA 3WBJA 1G6HA 1DAFA 3LBHA 1I4LD 4RVCA 4LK2A 1DAEA 3OIYA 4C0BA 2IK8A 1IN8A 4PPFA 2GCPA 2WKQA 1XEXB 1Z28A 2QL6A 3PV0A 4DBLC 4M2LA 2GZHA 4K46A 2ZM5A 3GJ3A 2VIIA 1HE8B 3RS4A 2DZOB 3NTUA 3X2SA 2J9RA 3CF0A 1OF1A 2A9KA 3G82C 5HKKD 5TDHA 2PX0A 4TL8A 1HE1C 2V7QD 1XDBA 1S3GA 3ADCA 3AVYA 3I72A 2Q9AA 4P33A 2FFQA 2QSYA 2NO0A 3BJIC 1Z83A 4P4TA 3B1WA 1BYIA 3GJ4A 2ZR7A 1DARA 5EE3A 3QEJA 2GZDA 4M1MA 1DOAA 1U94A 5FUVA 4JYBA 1XJCA 4Q9HA 1F6BA 3EIHA 3GMTA 3NDPA 1YJ5A 1WB9A 2P5TB 3U44A 3CH4B 3BRWD 4CEHB 1X8LA 2C2HA 3QKRB 3THWB 3LVRE 3SEAA 1W0JD 1C9KA 3OEHA 3SJCA 4UJ3A 4R7ZA 2ZE7A 3VR6A 4Q19A 3CWZA 2YOHA 1OH5A 421PA 2OESA 1NNEA 3SC3A 2VF8A 1OB2A 4DT1B 1YZTA 4L8GA 1E9DA 1XTIA 2NZJA 2UZIR 1ZVQA 5G3YA 3IEVA 2YVUA 1DTSA 3QNUA 4Q02A 4B34A 2WWFA 1FOEB 3SQWA 1AZSC 1U0JA 2CNWD 3I4LA 5TV2A 2GF9A 4NYMR 4ZO4A 4IDHA 1E1QD 3QIAA 1P61B 2W6IA 2WZQA 3D3QA 4IDNA 1F48A 2MMCA 4DDUA 4PPGA 3VR4A 1Z08A 4A0GA 4GP7A 5FR1A 1W36B 3ZIAD 5L8VA 3PUXA 3R8FA 1T91A 2PH1A 3AH8A 4RFVA 3DZ8A 4G5GA 1XEWY 5KSPA 5JJLA 3K09A 1U90A 1V43A 3LXXA 2ZROA 1N6RA 3ADKA 3FHTA 4TYWA 4JLPA 3FB4A 5J4LA 2DR3A 2ZU6A 3BE4A 3KTAB 5C4GB 2H5EA 2R8RA 3B8HA 1TQ2A 1Q3TA 5DLQC 1GL9B 1N5KA 4BLQA 4ZV4A 1XD9A 5F98A 2ZI5A 4GOJA 4LX0A 4JZKA 4QRHA 2OBLA 4R98A 4UNSA 4TMKA 5FOWA 3PEVA 4DLSA 4DVGA 4PAMA 2CHVA 2C96A 1Z0FA 3NHBA 1N6KA 2AXPA 4QBGB 2G6BA 1E4VA 2GESA 2F1IA 4URUR 1GRQA 4LJ4A 4ZDJA 8OHMA 1LF0A 1JR3A 2J7PD 2WMOB 3KZ1E 1ANKA 4BFYA 4BFXA 1JQLB 3MLEA 4XJXA 3A37A 1HTWA 2REBA 2W00A 4EJSC 1OH7A 4LDJA 3L2OB 4OBEA 1AQYA 4Q1FA 2IW3A 3ZJYA 5JCZA 3EZ9A 4DLRA 4PSAA 4Q9IA 2BHRA 4ZDKA 2OXCA 1DADA 2FWRA 1CXZA 4GPTA 2VP0A 4XVQA 1S1CA 4PC1A 5E4FA 2WWIA 1IN5A 2HF8A 2KE5A 4JL6A 3T1QA 5E3HA 1I4TD 1RJ9B 5EXTA 3CF6R 1NF3A 2BBTA 3EPLA 2A5DA 3KJEA
chains in the Genus database with same CATH superfamily
3IP9A 1JDJA 1BMDA 2EYQA 4R8KA 3T3DA 1SVSA 3CRMA 4LFAB 1T36B 3KVYA 3RBXA 4YUWA 1IMJA 4L8LA 5I7UA 2HGSA 2ZDQA 1W36D 4TS1A 3TOSA 4WBSA 2IVZA 3ZIAA 2JW5A 1T2EA 2HA5A 1PD0A 3C3BA 3NBQA 2Q4RA 4X91A 3VR4D 1PV4A 4ON9A 2LCIA 4QHYA 3IG5A 3IDZA 1KYVA 1NKSA 1XLTC 2OFPA 3TTVA 1EG2A 1H3FA 4M9RA 3DJYA 2H65A 3E23A 4P3OA 2XMDA 1H42A 3J7BA 3SSAA 4HNVA 2OWDA 4IJKA 5FPQA 2IJGX 2P2ZA 4EITA 1EDEA 5CEEA 3FKSA 1K82A 3HJ8A 5E6SA 3UYKA 2PUEA 2XVAA 5IYZA 2YINC 2KW0A 2R6R1 4GBMA 3IT0A 2ERXA 4QXQA 4FP9A 4R68A 4DCGA 2VUSA 1KS2A 2QLTA 2VJLA 2WLSA 2FUG6 4C0KA 2RBEA 1NXWA 2M9MA 4A1OA 1B8NA 4U7TB 2RBKA 4R1OA 5DGXA 5AJHA 5ITXE 3EX7C 4B2PA 1UFVA 1YZLA 2YYSA 1TK9A 2OHJA 4PHGA 3SBDA 2HADA 5ES3A 3TB6A 1FFYA 1B8OA 3E2PA 4B31A 1L2CA 4DM4A 1J5PA 1T1SA 3JWHA 2WBLC 4DIDA 2C00A 2C5LA 3EXFB 4TZKA 5I51A 2C4UA 1XN1A 2ZJ3A 3KU4A 1Z63A 3F6EX 2QCUA 2R48A 3ASUA 3H2SA 1MH1A 4UAVA 2O2XA 4PWZA 4E1VA 4QSHA 3V1MA 2W9XA 3VO9A 3VKWA 2X3UA 1Z35A 4XVHA 1NI4B 4PCAA 2F43A 2WQ7A 4AJOA 3UJBA 3C2QA 2CZQA 1Z4NA 1PVVA 1NBMA 1WLYA 5EMJA 1PEKE 3AI7A 2Q6KA 5FA5A 4EWLA 5FBVB 5GIOE 2G9QA 2L82A 1OVGA 2O0HA 2GR9A 3CW9A 3GBVA 5GWXA 4ZAWA 1DQPA 1DPGA 3BBPA 4N40A 4COOA 3B48A 4ZODA 2PSHA 2QRPA 4JWTA 1LSUA 2QSFX 1ZOPA 1DKQA 3CURA 2DBRA 4QXAA 4E11A 1TEHA 4B81A 4ZDWA 4RTPA 3OLVA 4G8JA 1W52X 3GEIA 3EXIB 1NAHA 4FJ1A 2NIPA 5GQSA 4F91B 2VXCA 4G84A 4WKPA 2R4TA 3OQIB 3IODA 2R9VA 1QYCA 4KUHA 1NN1A 3QLEA 4J7AA 3IPAA 3JYQA 4HVAA 3QVGA 3NKLA 4BV9A 4ETMA 1UK6A 4DBLE 4ANFA 2DWCA 4OHFA 1ZMXA 2WDZA 2NPIA 1CUFA 3OCJA 1NBHA 3BXHA 3OF3A 5DYTA 2WT8A 3PUKA 1E20A 3HM9A 3IP7A 3ZZMA 2NSLA 1BN6A 1QV7A 5I9IA 4IEFB 3FKEA 4EMTA 5F3WB 1SHZA 1JA9A 5TARA 5EOVA 1MIOA 4F2PA 1XDWA 3QHQA 2FKNA 2QTRA 5C1BA 4P36A 2P3OA 3EDCA 3KSDO 4N7MA 5A0VA 4ASUD 4CKYA 4HY3A 5IWCA 3RW9A 2AK2A 5FBKA 2RGWA 3TX6A 2ZVDA 2HWJA 3VZQA 3VC7A 5KPJA 1NSTA 3D2AA 4Q9KA 2ACVA 1JHAA 4Y6OA 4TTJA 1XHEA 5ED4A 1NYLA 2FFAA 3Q3VA 3RU9A 1OBOA 1S8FA 5ALLA 4ZFNA 2J87A 5JCXA 4U2BA 3CJTA 3TEFA 3VSDA 1C81A 2LIPA 4PG5A 5G0SA 1QK3A 2BMFA 1R10A 4AI6A 3ROKA 2ODTX 4UOZA 5A06A 2GEVA 3UF0A 3AVWA 4ZVLA 3U61B 4NXNB 1SU7A 3UK6A 3FNIA 1RQ7A 4IDGA 3UXMA 5D7NA 4HKTA 1CE8A 4TT3A 3K9QO 2PTGA 4PFJA 3VGJA 3DM9B 3F6RA 3ZIDA 5JT1A 3SVZA 1NPYA 1WUTA 3QMWA 1ZJJA 3LUPA 1M1YE 4NOMA 5AKLA 4J2OA 5KNBD 1FNDA 3C3PA 3VPBA 2OFXA 1Y9JA 4M4SA 1JFLA 1KETA 1P0QA 1TAHA 1DMSA 2H4JA 3ZLVA 1XQYA 1QKJA 1N2OA 1OA0A 2HA0A 2OT3B 2YJGA 3DA8A 3KXEC 3ESCA 3OOWA 3FYCA 2OOBA 2JEOA 4REQA 4M0MA 2O3UA 2OV1A 3C6XA 1LX6A 2I91A 1G8PA 3MFQA 4LXYA 2DXIA 1RP1A 2QR5A 3FFBA 2WINI 3B5EA 4MI3A 1NBOA 1O96A 1XTSA 2DT8A 3DEIA 3I8XA 4KGVA 2G88A 3BX1A 4K9QA 4ZV9A 5KPTA 2Y1OA 4IQGA 3S8YA 2UZAA 4IUBS 4JU8A 3ANLA 1U0BB 2DAPA 3PTAA 3DQQA 4XA8A 2Q0HA 2BMVA 1HRKA 2ZBGA 2WM3A 5C34B 2X41A 2W0MA 4Q82A 4RH1A 3PQ4A 1OLSA 1XCBA 2HWXA 3O8QA 3SDZA 1QRSA 1A9PA 4DEYA 2OXRA 3RTAA 2GETA 4LJ8A 2JANA 2YJ6A 4PAOA 1BS9A 4JBXA 2FX3A 1KHHA 1WNFA 4CF7A 2JGDA 2X1MA 4QOIA 3J81k 2EF0A 1KYXA 2X49A 3EC7A 1PJ2A 1CW2B 3HKEB 3HR7A 3IEIA 1AQUA 4MRAA 4XDZA 1RKVA 5DMXA 2XVYA 3L1VA 3AIKA 2V74B 3RSSA 4NARA 3T0FA 4NU8X 3ZE0B 5J2UF 3SKXA 1BIFA 2GXQA 2X7HA 3BMCB 4Q1CA 2I6TA 1Q20A 2O4UX 4UM5A 4WXMA 3PXGA 1PWHA 2HU5A 3JQFC 3PF8A 4OQXA 1OI7A 2AC7A 3LT4A 3TKAA 3VVCA 1X92A 2IZZA 2FX2A 4GX0A 4U6NA 3ZCQA 4LNUA 2NQTA 2XGNA 2JIPA 1LDBA 2Z1DA 3H9CA 3M7IA 4R0NA 5DH9A 5HFAA 4AUEA 4EF6A 2D0DA 1VIMA 1U0EA 4RQBA 3GD7A 4OF4A 5DKFA 1KRWA 2VN8A 2PKXA 4WESA 2J7OA 4DR3B 1XD2A 1N57A 2CUTA 2FQWA 3SY8A 1I0LA 4B33A 1PR1A 3GROA 3JAWA 4RL4A 3FY4A 2YYAA 3UIEA 7YASA 1PU2A 1UXGA 2YQ5A 3PYLA 4XD7D 5KOYA 4B71A 1H3EA 2I7VA 3DT8A 3N87A 4AJIA 2JP7A 1P6XA 4JVLA 1DFHA 3GA5A 3EZYA 4M0KA 1OFHA 3LHKA 1GPH1 2FEOA 5I9NA 3VDRA 1QX3A 2BI8A 1Q1QA 4B7ZA 1QGYA 1L4MA 2Z8XA 2FGKA 4JNKA 1GTSA 1HA3A 2XT6A 4YO7A 1BE8A 1DAGA 1Z8NA 2B1GA 2OAGA 2LDXA 5K7SA 4PF1A 1EFRD 1ZN7A 3FPHA 1YQXA 1V3TA 3FYUB 3R0IA 2GPJA 2C9CA 3L0SA 4MUHA 2CEKA 4REMA 2AH5A 3GA0A 4PC6A 3VC2A 5HK9A 3DAYA 1WZNA 5JHGB 3HUEA 1A5SB 4H7HA 3L6OO 1RJDA 4EYQA 5IKMA 2NV0A 1J8FA 4PPNA 1ULAA 4QPNA 1QHHB 3R9IA 5DM60 1OXMA 3T1YM 4RZHA 5LBTA 4Q03A 2OOAA 1IBRA 3R09A 4H16A 3RNOA 4A2PA 1YFKA 1J8DA 2JNWA 1EBBA 1ZM9A 4NOKA 4DREA 3DUFB 2EGHA 5J2UA 4ARIA 4OMDA 3U61A 3VH4A 3DFUA 2OR3A 2P7HA 1ML4A 1VSTA 2GN4A 3M6MD 1KYYA 3D8LA 4FDVA 1YMQA 1GGEA 5DM2A 1OFUX 1RU3A 1BEUB 4YAGA 3BTSA 3KLPX 4PIVA 3AB3A 1K6XA 3G2OA 3SEQA 3ZGOA 2X6TA 1WQ4A 3KPYA 2H00A 3O7MA 4JDPA 4TN1A 1G2OA 2DAGA 3LZCA 4URHA 4UDXX 5E1MA 3SIWA 2WUEA 4NY1A 5JROA 5K0GA 4RJLA 4RLSA 5TPWA 5DI3B 1SUFA 4Q21A 2YL2A 3O4JA 3DE2X 2YHUA 4JI5M 4IBOA 3SVLA 1M83A 2AN3A 1ICEA 3G1TA 2ISCA 3D6HA 4M0EA 2NO7A 4RMNA 4HAUA 4JFAA 4PFKA 4X85A 1ONSA 4X66B 1EAYA 3WJ1A 1R0SA 3JQ9A 3Q8GA 5AW2A 2MOKA 2EG9A 4JJAA 5BXQC 3KUUA 2WRZA 1P3Y1 5LUBA 1HYBA 1MJFA 2O0JA 1G0OA 4P92A 5TMEA 3QWAA 4YUXA 1PW7A 4FT4A 2NYAA 4C29A 5EHNA 1D0SA 1Y5RA 4MXDA 1KOFA 3AF1A 5DNWA 2CMHA 3SR3A 4DDHA 1ZGJA 1R4NB 1Q17A 1ZJ6A 3HFGA 3G7SA 3L41A 5FX2A 2QRJA 4JT2A 4NBLA 2SICE 3PYXA 4JP3A 3QF4B 1RAIA 1LVHA 2APJA 2BEKA 4P34A 2OHGA 4RU1A 4X93A 1C0IA 1E7SA 1YRQA 3PT9A 2NXEA 4RADA 1Z5GA 1UBJS 2XTMA 3DTVA 3GAFA 1SVIA 4FWDA 3DEAA 2ZQZA 1UKCA 3LI2A 3SI7A 1J5XA 1P1RA 2CNOA 4K2HA 4WUVA 4YGYA 5LA6F 3NEAA 4DV0B 5BQOA 5IF9A 1E2GA 5T8KC 2V0NA 2FE1A 4NBWA 5CX1A 5TQVA 4B75A 2HJ9A 2ZRMA 2WU1A 3L1HA 1F12A 2QUAA 1XTUA 4IYJA 4NSNA 4BWGA 3JQCA 4ZA2A 2X0KA 3NWLA 1GSHA 1M1NB 4U6SA 4XARA 3RJTA 4DCUA 4TLCA 4TKVA 3TZCA 5EP4A 1MAVA 2HZ7A 3CVOA 4J0JA 4MR7A 1MG0A 4Y2QA 3FZYA 4UUBA 3D4PA 4DXDA 3ND5A 3GMIA 3U3ZA 3FGNA 4F3YA 4J1SA 1P77A 4A82A 4OQQA 2QUJA 5EYPB 3A3OA 1FA9A 1YXMA 3TNJA 2GEDA 5K0BA 5BNTA 3QPBA 2OBBA 4AIIA 3CWCA 4KQ9A 1IXRC 4G0OA 3VZBA 2C9BA 3C16C 4D81A 3O90A 4WOKA 5JDIC 1PLLA 4FGLA 2PL3A 2UUBB 3OQJA 3OO0A 1ADFA 4JBIA 1JKJB 2FXIA 4EX7A 5INTA 2ZOSA 1SKQA 1FP4A 3QEOA 2XUHA 3AY3A 1SXPA 3L7DA 1YONA 1RCTE 1WPXA 2VWHA 3GPYA 1MHPA 1RKQA 1M1XB 3IB3A 3FF1A 3ZE8A 3IP3A 4AWAA 2WIFA 4LMPA 4QYIB 1MO6A 1XDZA 1EX9A 2CFIA 1PM5A 2FOLA 3GGOA 4B5LA 2F1RA 2MYUA 1XP8A 4BN5A 3ELYA 3PA8A 4BU0A 4B7GA 1LC3A 1GADO 1DX4A 2GJSA 1KC1A 2FPUA 1O6CA 3H4IA 1WDTA 2QXYA 2Z9BA 2IYLD 3JX9A 3QVMA 4RD3A 4ZYTA 4OU5A 5KPZA 1T4GA 3EF0A 2XW6A 4OJMX 2OPHA 2GN9A 2M1ZA 2VCYA 3CPJB 4FOTA 3HCPA 1I33A 5HJEA 1X38A 2FRDC 5L7WA 2FPRA 3AGQA 2RAUA 1MOPA 4AECA 2D8MA 1P44A 4CKBA 4BE4A 2CVHA 4AT1A 2I54A 5NULA 3HEMA 3PUVA 2CBXA 3TM5A 1K7XB 2PMDA 5L40A 1OX6A 2VDKB 2QGZA 2QWXA 2ZSFA 1HFWA 3VR6D 1OH6A 1WB4A 1O5TA 2F59A 4Q7LA 4C7OB 4YHHM 3ZU3A 1CF4A 3LQRA 4HNGA 2HGZA 2W43A 3K2IA 1GA1A 1I5OA 3OZRA 1I1QB 4YCLA 4X66M 2I65A 4BYGA 5KTYA 3COJA 1SUDA 5M3BA 1Z0KA 2MMGA 2J5XA 1V34A 3B1JA 3FJOA 2FEKA 3THGA 3N8NA 1DXOA 1DVRA 2XFSA 1MDBA 3OCWA 4O08A 4YR7A 4KFCA 5J4VA 4HNSA 3VPGA 2JA2A 2FPPA 2WIDA 3N74A 3VC3A 3ZHYA 3P94A 2Q5FA 1CV2A 1MJGA 3IPLA 4HTFB 1QMPA 2ZSDA 3IOYA 1R64A 1LUAA 1UMBB 4Y0VA 3HN7A 3RS5A 1QC5B 1OAKA 4IIYA 4KAAA 3EZ6A 4LJAA 2QQFA 3PT5A 2AMYA 3OPYA 1E0KA 1IN6A 1JE1A 2JVIA 2NADA 4DV1M 3H2BA 1YH3A 5ER6A 3G23A 2B3TA 3GRRA 2R0IA 1K86A 1PR6A 4TKUB 5C8YF 3IBFA 4BLWA 4DMFA 1I6LA 1NVGA 3RTCA 3ABZA 1NW6A 2EJVA 3GFBA 3TTTA 4GVPA 2RH4A 2IQ5A 4KSBA 4BASA 4S05A 2BJWA 1VCMA 3RWOA 4XAQA 3U26A 1G4HA 2DUMA 5ALGA 5LYJB 1T3SA 4XQ0A 4XI9A 5IJ0A 5ISMA 3KZXA 4Q24A 5KOIA 4GKJM 2AC4A 1LVUA 1QK5A 2VDNB 4IXNA 4DV5M 1NU6A 2I4LA 2QTZA 3ZE2B 2VDWA 3RSZA 5HUQA 3HN6A 4JLMA 1APBA 3WJ2A 4NEQA 3U7GA 2X4GA 1LLUA 3RFXA 4XVCA 3F8SA 1GILA 2PU7A 1YVRA 2VZ0A 4S1VA 1RPZA 2CJWA 4RA9A 4YV1A 3IQDB 1PNTA 3EC1A 4OCZA 1CS0B 3S2ZA 4OLBA 3AZOA 4HB2A 1Q15A 1B0PA 1W25A 1JLHA 2O05A 3G13A 3ZHUA 3PK0A 4CCAA 1N6IA 1FQJA 2W2KB 4IIJA 3TD6A 1GPNA 3V4FA 1J09A 1NZDA 4OK5A 1HOTA 4TZ0A 3HKBA 2V96A 3OE7D 2WJ3A 3THOA 1ZCFA 3ZCVA 3Q8LA 2RI6A 2PX4A 3A4TA 3SIPA 4ENQA 4OP1A 4U7GA 2RHDA 3SQNA 1AK2A 1YR6A 1UFQA 3CEHA 2QMOA 4FINA 4UNIA 3V9PA 5MN6A 4G8BA 2DBZA 3Q2KA 3ENVA 1HMPA 1GG2A 5JVDB 2JS7A 3NKFA 3OPVA 1F6DA 4D46A 5TIIA 2AJBA 2FQQA 2IDJA 5D5QA 1AZTA 2Y3IA 3ISVA 2GKGA 4G5HA 4WGFA 4UD6A 1SY7A 2PBZA 3PL1A 3WA6A 1UBOS 4PZYA 2EL7A 1P2FA 2FSVC 3I1JA 4LRTB 4EUFA 2XWQA 3E5HA 3UJAA 4BNUA 1T5BA 4Q37A 3U7QB 1MD9A 4X3PA 2QN2A 2A9JA 1A8HA 2VEOA 4FMDB 2Z95A 4C6RA 1XLVA 4QNMA 2P11A 1PJ8A 1QGDA 3ELWA 3G5LA 4TTRA 1YC2A 2G1AA 3HHXA 3CG0A 3K35A 4GVXA 4XIFA 3ZE1B 3OH8A 3FTNA 2JLSA 1Y7HA 3BZWA 3O4VA 3OMWA 4CM1A 2XMPA 4TXNA 3V2IA 3SARA 4EHAA 4JV5B 1L2DA 2QSJA 1AGYA 3EEIA 2TMKA 2ZJFA 1Y4DE 3USCS 4OEHA 3MA0A 5HS6A 2X22A 1B76A 2OENG 1RBZA 4JOCA 4M1YA 3RSOA 2IGBA 2D62A 2XDWA 4GS5A 1PTKA 4L9RA 4XWYA 4ALIA 4BKRA 3F98A 4A6PA 4WMLA 3TZHA 3GGGA 5KSZA 1CERA 3DAOA 4FU0A 3A1FA 2DUUA 1MN6A 5FYDA 4NDNE 4RD4A 1N8NA 4JJZA 3SC2A 2NLOA 3W34A 2JAPA 3JTMA 3N59A 5FOXA 4Y2UA 1ZYUA 2AG8A 2Y1EA 3AC0A 3MQ2A 3BBLA 3EMDA 4CM3A 1QC5A 3WYNA 1WGLA 3I2JA 1ZCZA 4RHFA 4CT5A 1WABA 3AEYA 3IX7A 4C03A 1EIJA 1JPNA 4DG9A 2BFBB 2NZYA 1N1DA 3FVRA 2AWNA 1R8JA 4I14A 1XJ5A 4D9CA 1YTUA 1CDDA 1FXWA 1W4RA 3C3XA 3PXCX 1RAEA 5EHXA 4Q1VA 5JPCA 3IQZA 4YMSA 1HJPA 2QLNA 3WB2A 3JR5A 3EN0A 4K9NA 2QP9X 1RAAA 2FJ0A 1JG2A 3WIBA 1ID8A 3IT1A 1B4DA 2JFZA 2DHYA 1KXJA 5LOVA 1S8NA 1I30A 3Q7QA 1TH2A 3CN7A 4MQEB 4WZAA 4FW8A 4PGFA 4GC5A 2PCJA 1VLZA 2B25A 4CIAA 2G40A 3MC1A 1JIXA 5F52A 1K4YA 3EWNA 3QKSA 1Y4SA 2EW1A 1DQSA 3HB1A 1LLDA 4BVKA 5H8WA 2R5FA 2XB8A 1UODA 1YBHA 1VPTA 2WSLA 4FR0A 3C4JA 4DM7A 3NT2A 5CDGA 2ZWIA 1CY8A 4MP8A 2DUJA 4KE6A 4JI0M 5HGXA 4MVXA 4F8JA 1AMNA 1YF3A 2NWQA 1WHSA 4MTCA 2VAPA 2HMAA 3EQ9A 3PCTA 1XD2B 3T9CA 1X3SA 2WG2A 2HMWA 3T7AA 1AY0A 2JIMA 5ALYA 1IHPA 5KU1A 3W4JA 4DV7B 2W2VA 2I4MA 5D1NA 4QHSA 4R3UC 4MAAA 1YZUA 2GDJA 2MTBA 5B6JA 2XDQB 4OQLA 5DEIA 2VZLA 1IC6A 4Z7QB 5MN4A 3PQEA 1N2BA 4V38A 3DLPX 3P0IA 4FHDA 1B0ZA 3NHJA 1BGVA 3GBSA 1IZ8A 1X7ZA 3MAAC 4G37A 1UFKA 3JVVA 4AJNA 4J07A 3I6BA 3CLUD 2C7OA 2V6ZM 1NVKA 3A06A 2Z43A 4G97A 1KJZA 2ZUCA 5F12A 4OU7A 2DH6A 4KPUA 1Y1KE 4RF5A 3SMPA 3IG8A 1I94M 2V5AA 4J3JA 3PENA 1NNUC 2QY9A 5KYUA 4C7KA 2HOQA 1KAOA 2VAXA 5L9AA 2PXXA 5CD1A 3LX8A 3B7NA 3L0CA 4E46A 1C7RA 2ZI4A 1Q39A 4EHIA 5FQOA 1X7XA 3P19A 1ZA1A 1TDJA 4WZ6A 3ZN2A 5J2TF 1B43A 1ZRNA 1SD2A 2FEAA 2V7PA 2GFIA 2GZRA 3IMFA 5EKTA 4BNFA 1KWKA 2GAIA 1O9BA 3KT6A 4II2A 5IREB 1JSCA 1XFAA 4KIWA 1KY3A 4RK0A 4WCFC 4WA8A 3CNNA 1Z6XA 3GL9A 3TDKA 3ZK7A 3F3YA 1DC6A 3IEXA 4PO1A 4N0PA 4YWJA 1OIPA 4RH0A 2MROB 3LYHA 4EUEA 1NF2A 4W9NA 2YWXA 1KYWA 3F8WA 4HZIA 4FDAA 4JLBA 1GYQA 3M4YA 3BD8A 3AP2A 2AI3A 1E9SA 3WLFA 5K01A 4ZQBA 4JQSA 3C7AA 4L3WA 3NBZC 4EYKA 3B3AA 4GGMX 4NE9A 3CNQS 4QDKA 1NW4A 1Q44A 4UTNA 1QOZA 4X71A 4OHWA 4BCDA 4G1EB 1SHLA 3WSVA 2CYBA 4NZYA 1WSBA 3PP8A 2HWYA 4G2TA 1KYQA 1T0BA 1NIJA 3OM9A 4J0QA 3FMGA 1L5ZA 1NRXA 1U8CB 1Q3BA 1V71A 2HFKA 3G49A 1XYVA 3H04A 3IIIA 3K0KA 2KRUA 7MDHA 4FGKA 3I5MA 4P2BA 2PUBA 2YS7A 2QBYB 3CC8A 5JADA 3IA7A 5HQJA 3LY5A 4OXYA 2J3LA 2AHRA 2L17A 3D3JA 4BV3A 4Q4JA 3VR0A 4V0LA 5I7RA 4IQFA 3ZJUA 2Z3ZA 1DX9A 1WJGA 3G2KA 4WVFA 4WBNB 3OFND 5DBEX 1COWD 3EWAA 4GR5A 2ZWOA 4YALA 2C84A 4DJAA 2H1VA 4GNKA 1Q3HA 4MITA 1PG5A 4I8IA 4ZHSA 2OO5C 4IS2A 4DG5A 3GYBA 3LT5A 3ZH2A 5I01A 4E5YA 4DUYB 4NI5A 5AM0A 2P6NA 2P9EA 5TRTA 1KMQA 2WTAA 4QXRA 3L8FA 1TCBA 1RWBA 3S1SA 4IXMA 4HZUB 1UJCA 5JLJA 4HDNB 1O8CA 4WK4B 4C3OB 3I1YA 5CH8A 4DLVA 2UKDA 1VKJA 3CUYA 4J16A 3W7VA 3J80S 3OAAA 3LCMA 1DCKA 1KYZA 2UVQA 1OR8A 2VWGA 4HRVA 3Q0IA 1FFXA 4G9EA 1FF9A 4KOAA 4D8TA 5DN6D 1XMVA 4LDNA 1NOKA 1DG3A 3RR2A 4AZFA 2WDPA 3NM5A 4QPPA 4DARA 3QYAA 3KVVA 3KKOA 4PM4A 3G9UA 1PWXA 3AHIA 2HJGA 4YPOA 4UHEA 2BBSA 4EL0A 1OI4A 2C5RA 3PPIA 2QM7A 3ESQA 4P93A 3H1PA 2BFNA 3ZHSA 2JI8A 3GF4A 2IXGA 4EB0A 4MYTA 1RT9A 1GCAA 1TIPA 1INLA 1Y4UA 4RXUA 3QU5A 4L5JA 4WCFB 5CCXA 1G20E 2ZYVX 1AMUA 4ZOAA 2XZFA 1AXEA 1EFLA 4PG8A 3RIHA 5JW6A 2J5QA 2QU8A 2REOA 3L4EA 2FKAA 3NB0A 5CA0B 2O2JA 4AJEA 2LVQD 1HT2E 2C5AA 5CGQB 3N75A 2VNSA 3IR7A 4RORA 4UXHA 4C30A 3NIBA 3LQ4A 1YB4A 4JLSA 1JJVA 1DEAA 2JGIA 1JV2B 2F43B 3IUSA 1NJFA 4N0DA 4NATA 3UQYS 1CEXA 3SSMA 3ZXYA 2QG4A 5JRDS 4MHOA 1PS8A 1OREA 5KOHA 3AF6A 1CLUA 4Z3DA 4KIFA 2H2FA 2QN1A 4L72A 2OO7A 4LX8A 2YH2A 4EPWA 4DV4B 2X1LA 1LLCA 1TTQB 1GNRA 4HXYA 4QJ4A 2ZI3A 3COSA 3THWA 4CEIA 2A0WA 4KQ6A 3ZQKA 121PA 4Q93A 4XZ3A 2P9FA 5SYMA 3RC7A 3VAAA 2BRUA 3X0DA 3ZK9A 3KQUA 5HIAA 1G8FA 1G7TA 4I4TF 2XYGA 2E85A 5DSTA 3PGXA 1WHCA 4A2QA 1UOOA 2QRZA 4AN0A 4B4UA 4FM9A 3C4QA 2LGJA 3JD0A 1XZAA 3OIUA 4GSLA 2C5EA 5AW9A 2VH2A 4EQ6B 4AUNA 1N2EA 2JI6A 3KB2A 3O31A 4PR3A 1QIHA 4XH9B 1MKYA 1E3WB 1L7RA 1TKCA 2CL6X 3VBEA 4IKOA 2MJ5B 1U0GA 2OBMA 2P9CA 2POQX 3AHHA 3C8ZA 3LWDA 3W68A 3B1FA 4H6PA 4Q4HA 1R8QA 4UMDA 1CNMA 4RFSB 5AVTA 4A0FA 1N7HA 1GITA 3OWOA 3LXRA 4WN9A 4D02A 3NALA 1QAQA 4KXMA 4X3CA 2B98A 2YUTA 5BVHB 3PFKA 1BA3A 1PTJA 1VLHA 3JZAA 2IOYA 5JAUA 3SBEA 4FFMA 4Q12A 1KQ3A 3NUQA 4LVUA 2DWMA 4EVSA 4Z9AA 5ALDA 2P0YA 2H2AA 2DG2A 5JJBA 3L5OA 4LDAA 2NSYA 2CFRA 4JA0A 1L1FA 2UUAM 3GLQA 1NMEA 1X1SA 2JI9A 3ANSA 1T8SA 4WJZA 5DRTA 3A6PC 4MVJE 3BORA 4PFQA 1RDFA 1XMJA 2XUAA 4IDBA 1J8VA 5AJTA 1ZVKA 1E7MA 1XC7A 1LDYA 2I1VB 2GVDC 2OP0A 2YIVX 3A4YA 1LF5A 3OLCX 4YP0A 2H9IA 1U0SY 5CVTA 5KUTA 2UU9B 4A8JC 2WFAA 4KHZA 3QSYA 3T7IA 2SECE 4BATA 2VYVA 3LSTA 3ACBA 1W4CA 3DZCA 4QVGA 3ZU2A 3KP1E 1GTL1 3PSHA 3ZWWA 4B3MM 1E94E 2ERCA 2ZITA 1C7QA 3EB9A 4FGSA 4WKOA 3ZWOA 2GM5A 1JHQA 2Q3MA 3NH6A 4JIGA 1IH8A 4WBXC 4YK7A 2CKDA 2HZBA 1TB4A 1G5HA 1Z8FA 2M6RA 3FCCA 4D3YA 4LJYA 1HR0M 1J07A 4RM2A 1R66A 4QT4A 4URVR 3WNVA 2W5UA 4ER0A 4GW3A 1DKNA 1LBTA 2RGDA 3OZTA 2XIQA 3LUBA 4QQ8A 3E1SA 3C98A 1EH5A 3QVTA 4ODIA 1JL3A 4OHCA 3VSAA 3UMRA 1RAGA 2V7XA 3V7WA 3DTVD 4M0CA 4AG6A 4UHDA 4HLQA 1VEKA 3HGQA 4O6VA 4NJOA 4MGKR 3CNHA 5E26A 4MR8A 3AWIA 4GQAA 4DRZA 1GKLA 2R4EA 2H4YA 4BBJA 5EXXA 2BV3A 4F5DA 4MGIR 1KSHA 4OAPA 2QN6A 3C24A 4EL5A 2XZDA 3BPSA 3U13A 2WMDA 1DGHA 5IT5A 4LOKA 2MSCB 2EIHA 2BZ1A 1L7EA 3RUEA 2DTDA 4AO6A 2X8LA 3H1GA 4LAFA 4RO0A 4Y2TA 4TV9F 3X2FA 3BXFA 5BPVA 2DLDA 3U3KA 3UGKA 1YZKA 3UUGA 2GNOA 4BFTA 1W8DA 5MDHA 1G5QA 4NBSA 1SXHA 4KDFA 5F9HA 5AW6A 2FWMX 2OHVA 2Q2OA 3C5HA 2IWHA 3AGPA 5JOQA 1N5RA 1ZESA 1DGGA 4QE3A 1ABFA 4GQBA 5DGDA 1WDLA 2ZBPA 3KXLA 3T9AA 1R0KA 1HKUA 4HEA6 4HN9A 1P7YA 3H5OA 1PS9A 2AOTA 3H6GA 4ID3A 5E6JA 2QQGA 1E3MA 1DKMA 1SZDA 1GQ2A 3LIIA 2O8VA 3UMFA 3W77A 1RI2A 4WRRA 3FOZA 5IYZF 4BIMA 4TLDA 2CFSA 4OG2A 5C53B 2C03A 1TU3A 1NOJA 3D3EA 3VR4H 5IHPA 1ZEJA 1ZUNB 3SJBA 1Z62A 3H5LA 1NMZA 1H0HA 2GASA 3P9SA 1QV6A 1N36B 3PU6A 3AEUB 2BY4A 4NPCA 4LFCM 3H5WA 5LNK6 1JIUA 3WL7A 1MRZA 1ZH8A 3L7MA 1E3EA 3WZLA 3PC4A 2J30A 3NP7A 1Y1RA 4XPIB 2PZAA 2YBEA 3BE6A 4F71A 1XZJA 3ENWA 2RI0A 5DXAA 2VTDA 1CS0A 1DT5A 2G77B 2F5OA 3OQ6A 4GMGA 4MP6A 4ARZB 3U09A 1CY0A 2WAAA 1GQSA 1QP0A 3HU3A 1P74A 4UM9D 3DEJA 3OSUA 4BWFB 3A3KA 4CLXA 1H93A 2P3QA 2X1VA 1C7EA 1HFJA 2P6RA 4CKCB 3NIWA 3PDWA 4O2AA 4U5XA 3JQAD 1LRKA 4YRLA 1EM8B 3WFZA 3J81A 3RT9A 3WBFA 1FJXA 3DNPA 1NX9A 3BD9A 3OIGA 2FPLA 2VNAA 3K0FB 1A5BB 4K3VA 4D2IA 5GV7A 2UZ0A 3BEDA 4MVWA 4MWEA 5JSKA 4E22A 1N1EA 1TGUA 4TT8A 3NTLA 3R5XA 2XT0A 1YDWA 1ZRSA 3AVOA 1RRKA 4ZVMA 2XCQA 3DWIA 4QVKA 1SHKA 2PUHA 4PQEA 4AO7A 5LNK1 1XDSA 2I8AA 3D5EA 4MB6A 1U65A 1VE9A 1B00A 1RS0A 2TMYA 2YZ2A 4M9UA 5PGMA 4Q0MA 4F7DA 1TUBB 3T7CA 4MINA 5A7FA 4A73A 5IZ4A 1HQCA 1UK7A 1EB9A 3COVA 1NDHA 3INNA 1B14A 1J0EA 3L7AA 2ODAA 4FC7A 4Q3CA 2PKEA 3WGTA 5B6PA 5BPFA 1ZN2A 2TMDA 5FWYA 3HYLA 1QGAA 2YBDA 3CCFA 1R0WA 3KXIA 3N8GA 2HLDA 1D6JA 1XALA 3KJHA 3TNYA 2YVLA 4KR0A 2NO1A 4L75A 4KMOA 1VHDA 3SR0A 1QCCA 1VRCA 3ORHA 4DT1A 1BHO1 1QS0B 2HMVA 2WHPA 3CBQA 3FG9A 4G5QA 1L4FA 2HRBA 4QJ5A 1ZVMA 2FE4A 3BBZA 1H2BA 2WPDA 2NVWA 3AR5A 3O8DA 4IXDA 2G8LA 3O4FA 3VH3A 2XUZA 3AETB 2FY8A 1OJ7A 5DGIA 3V4PB 5LP1A 1Q2UA 4N54A 1OYVA 5EWLB 1Z13A 1KAGA 4L4XA 2KEBA 3RQIA 1MO4A 3DE5X 1PGQA 4NMLA 2H4ZA 1NQVA 3BJZA 3PR2B 3L49A 3VK7A 1COZA 2H31A 3KBBA 3KKLA 4Y2YA 4ZEOA 3PG5A 3WK8A 2P9YA 1QYIA 3CZ5A 4Y2XA 3RFWA 3EGDA 4JBHA 5ARCA 3UAZA 3GLGA 1O1YA 4A26A 4AP9A 4NBNA 4PXAA 1Y80A 3SHGB 2HB6A 3KDAA 4MQFB 2XZLA 1C1HA 1QVAA 1P17A 4ZANA 4F2WA 3LVFO 3U3JA 4A91A 1UT6A 4CCWA 5HJ7A 1XNHA 3MWYW 3JY6A 1I7DA 3B2QA 3VO1A 1CUYA 1KTVA 4BQPA 5A4IS 3V7UA 3O21A 1ATZA 1G3UA 5SY4A 3W3AH 5EE1A 2HA7A 2WSBA 3MGGA 2WWTA 3FZQA 3PRYA 3TZKA 3GG2A 3B60A 3AUFA 4GE0A 5HE8A 1JMVA 4Y2RA 4H4EA 3V5NA 4WECA 3AEQA 4GPAA 1SUAA 2EW8A 4RA6A 3DEFA 5HG0A 5CYPA 1PEYA 4D98A 4KNVA 4X90A 4BNHA 1E63A 2DBYA 4LF5B 1KP3A 4US1R 4XRGA 1J70A 1LKZA 2IY8A 1R37A 1H8ED 1EGAA 1HYQA 5ICSA 3DBVO 3E7PA 3HZJA 1MP0A 4RK4A 3HRKA 3VDNB 3PQ7A 4HLDA 3ULKA 1NU8A 4W5TA 1HZZC 1M72A 4GHLA 3GH3A 4GKAA 2C8VA 5KJEA 1OIVA 4E07A 3K70D 2NGRA 1T5LA 2W2NA 4IG9A 4AD8A 1S6YA 1SOAA 4KACA 1KFJB 1N34M 2XA2A 3VPHA 3GNLA 3I61A 4YXWD 2PVPA 1X7DA 2VHVA 2WICA 2ZBKB 2O19A 3TIFA 3REGA 3R5FA 2GXUA 5D01A 3EDQA 3BG5A 1TYZA 6REQB 2PRKA 2X8JA 4NV1A 4IBIA 2EXXA 2YIJA 3FMPB 2ZEJA 3H2KA 5DYGA 4ZTUB 1RBQA 2DSTA 5EMHA 3EOZA 1UAYA 1KE2A 3U0BA 3B6ZA 5CA1A 5C0OE 5D3MA 2A5LA 4R5MA 1C3XA 1CUWA 1QQAA 5EGNA 1SKYE 1P8AA 1FNCA 5CT5A 3GZ4A 1CUIA 1IL0A 2B92A 4J1QA 1RYYA 1TX4B 1Y8RA 3C1UA 4B9AA 3KQOA 4FNOA 2RARA 3UJCA 3CX4A 3WKCA 4MS4A 5TB5A 4M53A 3IE1A 4E5MA 2JPDA 2DY1A 5BR1A 4OB8A 2QTVB 5FP0A 4AMBA 1P9WA 1GPDG 5A5EA 4H15A 1W5TA 2AOTB 3KELA 4DANA 3M82A 1WXEA 1P1FA 4YI5A 2BC9A 3HX3A 2ANCA 2DGDA 3FDFA 4EGJA 1FUYB 4GBED 4N82A 1AV7A 4GMXA 4LS3A 5ALZA 1HSOA 3FNEA 1WWKA 1LV8A 4RZ2A 4KWIA 4HAOA 1NRJB 5G2OA 4LZAA 1EGVB 4GPEA 4LRTA 2HU7A 3L7LA 3LOQA 4FFRA 3WP0A 3FCOA 5AM3A 3TE6A 1JI0A 4ZCIA 5ITSA 3HU5A 2HWUA 3T9DA 3QOFA 1ZCJA 4DRXA 1EAMA 1MVNA 2IHJA 2AKAB 2HA6A 2VSFA 4NZ9A 1HETA 5F76A 3L6RA 4LSWA 4DUGA 1QLJA 1Z4LA 1X74A 4L07A 1EDZA 2NG1A 2VPWA 4G36A 3BKXA 3V2UA 2OWEA 5K0FA 3ZDQA 1NM5A 3WISA 1EWRA 1T8WA 1RJEA 5BQ5A 3PC3A 4ZAZA 1WHTB 1Z0JA 4WCFA 3KJXA 3UFXB 1A2OA 2CMKA 4Q3AA 3DBHA 2QQ0A 1FJHA 3BXEA 3IQGX 4J0EA 1C7YA 1TD9A 3FFAA