1NY6A

Crystal structure of sigm54 activator (aaa+ atpase) in the active state
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
247
structure length
247
Chain Sequence
EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation of the transcriptional activator NtrC1: structural studies of the regulatory and AAA+ ATPase domains
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords transcriptional regulator (NtrC family)
total genus 66
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ny6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ny6A01
4C0QC 5B2ZA 2DHRA 5J5CA 4NZYA 1KJYA 4FD2A 1JXMA 3GJ0A 4PTLA 1QHIA 5IK2A 1JBKA 4OHXA 5JHGB 4EKDA 4LSGA 3THWA 1UKZA 2AKYA 1SHZA 2PX0A 3OZXA 2VSFA 2JDIA 2Q21A 2AD5A 5A0FA 4LJ4A 2I3BA 1QG4A 4TMWA 1OXXK 4KFTA 2ODWA 1X1RA 1RRPA 5JMTA 1KGDA 3UK6A 1HH4A 1XCPA 3KJIA 4GZMA 3K0FA 4GOKA 1LS1A 5L3QB 1LF0A 1YKSA 1G41A 1NIPA 4Z1MA 1MRNA 4NCJA 1OB2A 1PLJA 4NYIR 2B6HA 1V43A 3FVQA 4A92A 1SULA 5DYGA 3RYTC 3EWAA 4GDFA 1KJZA 1TF7A 2QN6A 2IS6A 2GCNA 2ZU6A 1DAEA 1G7CA 4LPKA 4Q1BA 3PEYA 4ACBA 4JT4A 5LD2C 1E1RA 3TUZC 1BH2A 2WKRA 2D2FA 1E2LA 2HCJB 1NSFA 2C95A 1KJWA 2YJTD 2DFLA 4EPVA 1KI8A 2IC5A 4KXFB 2F7SA 1ZVQA 3MJRA 4Q5IA 3EG5A 1E0AA 3A36A 2P2LA 2O0JA 4IDOA 1S96A 4NYIQ 1G3RA 3V00A 1S3GA 5JRJA 1HT2E 4LY6A 4ZIRB 3AP2A 2Z5FA 2AWOA 4DB4A 3PEUA 2LWIA 2UVQA 4TQ9A 3BH7A 4PPQA 2Q9BA 2ERYA 1T8UA 2YZ2A 3GQBA 3IBGA 3QVVA 4OK3A 1P6XA 1GL9B 3RRZA 2IWHA 4OI2A 3BK7A 4FCWA 2RGEA 4DT1A 3HU2A 1P9NA 4EPYA 1L4UA 3QIAA 2JLXA 2AFHE 5C2JB 1M8PA 4B3DA 2BJVA 1EXMA 1G19A 2GBLA 2JJ2D 2VO1A 4MRVA 521PA 1DELA 4LDJA 2RH5A 2BC9A 2BM1A 3QSYA 2GTPA 1UDXA 4QGGA 4Q01A 1EESA 4V0KA 3EZ7A 2WAXA 2GRJA 1R0XA 1YE8A 4LI0A 4TT3D 4IKEA 6Q21A 4AG5A 2GJSA 2GNOA 4NTZA 4GITA 2F1RA 3U7FB 1W36D 5BN4A 4NE2A 1IHUA 1XXHB 5FBWB 2IUSA 4D80A 2O5VA 2AHOA 3SHWA 4IDHA 1RYFA 3BERA 5EE5B 3CW2A 5E95A 4AIIA 1DARA 4MYHA 3B6EA 1XTIA 4NL4H 2VHQA 5FTKA 3LW8A 1FPMA 4KU4A 3QXHA 4A8JC 4B3XA 2GAOA 3LQRA 1E79A 2CCJA 1XEFA 1MKYA 4P4SA 5J4LA 4RY2A 1KK0A 4G5OA 4LC0A 1DPFA 2ZRKA 4OI0A 4US2R 3R9WA 1KK2A 1MR3F 1OH7A 1GRQA 1PUIA 1XD2B 4BFWA 1AZSC 3EPJA 4B32A 1LB1B 3EA0A 4P4SB 1GL7A 3RS0A 1IXZA 3B2EA 4Q1AA 4C9BA 4A0FA 2BEKA 1ESMA 3IO5A 2NGRA 2C2HA 2R65A 3BS4A 2VRWA 5EP3A 2FMXA 4MYTA 3KFXA 2KRKA 3T15A 4DCNA 4KBGA 2V7QA 4HZUA 4XSHA 1GAJA 2NPFA 1MABA 1X1SA 2V9PA 5SZIA 5KTYA 4XOIA 4YQFA 5JSZA 1GKUB 1HE1C 3Q3JB 3U3MA 1JI0A 2KBFA 2OE2A 3TE6A 4DEXA 2VP2A 4LBYA 2IXGA 3CKLA 4M53A 1QHHB 3SHFA 3U7GA 1U99A 1YZQA 3ASYA 3BAFA 3KB1A 5LB4A 1II8B 5GJWC 3CH4B 4LHXA 2GWHA 2J0UA 4RSGA 4RD0A 3SFZA 2IYUA 5E4FA 2ZJYA 3UWOA 2MSDB 3BORA 3RS2A 5C18A 2H57A 4II7A 4ZI2A 1XZQA 1Z6GA 3UANA 3CRVA 2DYKA 2VHCA 3OHMA 4P33A 4Q4HB 2QMUA 4PZZA 3QF7A 1FMJA 4G5SA 3U6BA 5FI0B 4KVGA 1XRJA 1EX6A 1HYQA 4B2IA 1JXOA 1XJCA 4MDFA 5KSOA 3LLMA 3LVRE 5CM9C 4P3YA 1KO5A 1M2OB 3THXA 3VR2A 4QHYA 4GP7A 3PUYA 5SZJA 2UZIR 1CBUA 3LH5A 1PV4A 4OHYA 2QG6A 1E2JA 1YHNA 4M9XA 1RJ9B 3WNCA 2XAUA 4TTRA 3SN6A 1U2RA 2JLWA 5JI2E 1QG2A 2P5SA 3CB4A 5DHAA 1Z6AA 4RD6A 3BIFA 4XD7D 5FBRB 3QXXA 2VBCA 2QRZA 2YYZA 4HDCA 4LBVA 1AKEA 1CLUA 3KDSE 2ECKA 3JVVA 3SFVA 3LY5A 2O52A 3RS5A 1DVRA 2WKPA 4HSEA 2V6ZM 3GJ7A 1SXJB 3A1UA 3W90A 3KQKA 2DPXA 1W49A 5J4KA 1KMHB 4GSYA 1F6BA 1KAOA 2D06A 4NYJQ 1DO2A 1Q3TA 2VH5R 2ZI4A 3K0AA 3VU9A 4Q7KA 2FZLA 4NYMQ 2WIBA 4JZKA 1ZU5A 3LWNA 1SHKA 3NBXX 4TWZA 1R8QA 2B8TA 3T12A 1MO3A 3ECCA 2OXRA 4HUTA 4MKFA 4XSGA 4M8NE 4BEBA 1UFQA 3DMNA 2KB0A 3KJEA 4Q1FA 2IYRA 2PT7A 4DC9A 2V7QD 4EIWA 5M04A 3AKEA 3E70C 1OPXA 2ZYUX 2ORWA 4M2LA 4ZCLA 3HDTA 4HYYA 2SHKA 1FMLA 5E7JA 3LV8A 4IOKA 3PVSA 1Q44A 4EJSC 3GLGB 3BB4A 5K8UA 3PV0A 2GF0A 2ZEJA 1GRRA 4J0QA 1BMFA 1HEIA 4WXRA 2OBLA 3WHLA 2ZI5A 1VCOA 5EXPA 4CZ2A 3RWOA 3FKQA 3QE0A 4M1TA 1ESNA 3UWKA 4YDSA 4Q18A 2ZS9A 2G1KA 3BJIC 2WPDA 4XVQA 1NVVR 4Q00A 2XOKD 3GFPA 4LJYA 4F7WA 1KDTA 5DI3A 1OB5A 4FWGA 1KO1A 2ORVA 4TSFA 2J59A 4HAVA 4HB0A 1OT3A 3K0CC 1R8SA 2P67A 2EVWX 2VIIA 2EQBA 3IO3A 4DUGA 1EG7A 1O3YA 3DDCA 5F9HA 2J7PD 1S9DA 3SYKA 1OIVA 2F9MA 1JB1A 2NOAA 3ZQJA 2OBNA 1OE0A 4IJMA 4X8OA 1Z22A 4XD7A 1Q0UA 4L8GA 1F60A 1Z0AA 3CPHA 1YRAA 4GOJA 5HCNA 5KOYA 3THYA 2CL7X 4DLZA 2WM9B 1XTRA 1KTVA 4Q66C 2YWFA 2ZREA 3SJAA 2W0MA 1II0A 3GLIB 3TUJC 2D74A 4PC1A 1NRJB 3FKSD 1YZNA 1GVNB 4WZAE 3OE7A 1ODFA 3LQQA 4TL9A 3PUXA 4TLAA 1U90A 1WMSA 4Q9JA 3SR0A 3WRYC 4E5UA 1OHHD 2HXYA 5CIWA 1Y63A 1TQ4A 2ZXUA 3UG6A 4RZUA 4GT1A 3ND9A 4TLCA 4C0HA 3AF4A 1K5DA 4TYWA 1N3BA 2YHSA 1YR8A 1MRSA 2FF7A 5GJVC 2JJ1D 3T1QA 1IBRA 2O8BB 2QT0A 2UKDA 4PPFA 4AWXA 1ZNWA 2DWPA 5HE9A 2IXEA 3ZDQA 4PSAA 4RD2A 1RJ9A 4FWHA 4B35A 3WMEA 3T35A 4CDGA 4M1KA 1GG2A 4B71A 4Q02A 1AS2A 2OAP1 2PZEA 4NMMA 1KAGA 3NH6A 3BGWA 1UPTA 2E9SA 4C30A 3T1VA 3T34A 4IVQA 1GZSA 3SE0A 2JLSA 1IN5A 2A5GA 3BBPA 1RRGA 3FOZA 5F98A 4ACAA 3KXLA 2HF8A 2PJRA 3NXSA 1KSHA 2ZRDA 4JLJA 3H1TA 1Z29A 2QAGB 2ZI9A 4HUQB 4LCBA 5FH9A 3LLUA 4Z54A 4D0NA 3WYGA 4OYHA 3A37A 3W9YA 2ZRJA 4Q1DA 2R2AA 4EFNA 1TUIA 4QM6A 3QKSB 3QY0A 4DSNA 4TL8A 1U0HC 1YRBA 1AQYA 1UM8A 4AD8A 4JMPA 2HLDD 2J0VA 3DOEA 1IQPA 3AVTA 4TYQA 3LD9A 5TDHA 1FQKA 4OQXA 3RS3A 3C15C 2CE7A 1NLFA 4FMCB 1KI2A 5CJPA 3TSWA 1KDRA 2PBRA 3L8ZA 4RZ3A 3UMRA 2ZRFA 2OSBA 4HB4A 3GCGA 3WNDA 3KZ1E 4HDQB 1Q21A 1TQ2A 1AGPA 1YU9A 3TH5A 3U5ZB 3B8HA 3KJHA 4B74A 1FFHA 2OAQ1 4O25A 1ZMXA 1W5TA 1LFDB 1T5LA 1BIFA 1LF5A 2HT6A 3F0TA 1OJLA 1PJRA 4EPXA 2XXAA 3GFTA 1UEIA 3BD9A 3PEVA 2GZAA 1T3HA 2JDID 3O8DA 1G5TA 3U2QA 2QMEA 1HT1E 5IRCD 4CGZA 5AK0A 4BWYA 2FX3A 2P0EA 1P2SA 2WIAA 4NCKA 3WMGA 4DIDA 3ADDA 3U3RA 2CVFA 2GK6A 3PFIA 3GLIE 2CL6X 1PUJA 2NO6A 2WBLC 4LV6A 4UNRA 3D3QA 4UNNA 1JALA 5FTNA 1E2MA 4F93B 5EUQB 4DHEA 2A78A 4URXR 4NBSA 3A6PC 1YQTA 2G1JA 4YC7A 1LVGA 2QP4A 2OG2A 1JJ7A 4GNKA 2ZIAA 3EZ6A 3THWB 2F6RA 2IYYA 1OFTA 1P75A 4ZCMA 1E99A 3HU1A 2ODBA 5JFGA 4LWZA 4KSCA 1TU4A 1KIMA 2OLKA 3CNNA 4IDQA 4MRNA 3RANA 1EK0A 3SJBA 3K9LA 5AJVB 1FZQA 4L16A 4N1AA 5BYJA 2FNAA 1FTNA 1VPLA 1YZKA 1XTQA 4GMXA 1TF5A 2O8FB 2DCUA 1Z6TA 3GJ5A 1HV8A 5FI1B 4IOJA 1W1WA 2VP4A 1XMSA 3K70B 5LB2A 5TVKA 5F2EA 1B0UA 1OKKA 3DVLA 2CHGA 4M0LA 4S35A 3ZH9B 1X8JA 1IY0A 1COWD 4PO1A 5HKKA 1YR6A 4ARZA 1R5BA 1GRNA 1RW4A 2R44A 4IVPA 1CJTC 3SNHA 1W46A 5AUOB 4BE7B 2ODNA 4UNSA 1S9HA 5JLJA 4EAQA 1XEWX 1BYUA 2CDNA 4GMDA 4RCZA 2Q3HA 4XVRA 4D4LA 2C9CA 4BFYA 3D7MA 2FFHA 5KDDA 4IHQA 2Z6VA 1CKEA 3FHCB 4F4JA 4DVGA 2XGJA 2TMKA 4TT3A 1TF2A 1Z0FA 5E7MA 3ND8A 2XTMA 4LHYA 3TSOA 5H8WA 4HLUC 4PO8A 4GP6A 5FTMA 1T3LA 1E1QA 3I72A 2ZJAA 2FV8A 3FE2A 3HWSA 4A2PA 1B23P 1LS6A 1J70A 1VHTA 2OFOA 1TTTA 3QBTA 2JLQA 4PO9A 5A5GA 5F3WB 5BN3A 2XSZD 1XDBA 5E3HA 1F2TA 3VFDA 1S8FA 1YJ5A 2ZETA 4KLNA 2ZE7A 4M21A 5BYKA 1PVOA 4CT4B 721PA 5IF9A 5CLLA 5GVRA 1ZC3A 2W0SA 1AIPA 4LRTA 4E07A 4LJ6A 2RMKA 3ZYCA 2REBA 3LAWA 3UG7A 1GNQA 1GNPA 5D3QA 2C9OA 4V0ME 1Z0KA 2WVJA 1E9CA 2JLRA 5KNBA 3X1DA 1CULC 2XJ9A 1VECA 3TR5A 4MGKR 5KUTA 4JL6A 4BEJA 5FPHA 3REFA 4M1MA 1ZCBA 2JLYA 3C4JA 1Z28A 4D0LB 1OXSC 4HLQB 2VPPA 1UF9A 1A7JA 3FYHA 5TXGA 2IF0A 1KDOA 4K81B 3DKPA 1KI1A 1SVOA 4V0MA 2EFGA 5AJXA 1IN4A 5AJYA 4BRUA 3UATA 2FG5A 1KSJA 2QGNA 2H8KA 1TEVA 4BLTA 1OIXA 4LJ8A 3AKYA 3AGQA 4L4UA 3I8XA 3WHKA 3EC1A 1NVMA 3E5HA 1XEXA 2AL7A 2JASA 3EPHA 2WWWA 4B48A 3R8FA 5J40A 3K70D 2A5DA 3NEJA 3GP8A 3ZVNA 2A7QA 3MRSA 3KKMA 3KL4A 1N5LA 1RRFA 2G83A 5SZHB 4C4PA 5G3YA 3K9GA 4JKYA 2W2XA 4P31A 3D6TB 4G3XA 3HU3A 2ZSAA 3BE4A 5DGXA 4Q4LA 2CNWD 1QHGA 3VX4A 4ZDKA 3B13B 1XP8A 4LJAA 1II8A 1KNQA 1WA5A 2GETA 3RABA 3TR0A 1XEWY 4W5HA 2HDNB 3TW4A 2FJUA 1S1MA 1W36C 1RVDA 2XB4A 2CCKA 3MD0A 3DKVA 1IONA 2RHMA 2Y8EA 2QTVB 1R10A 3P4YA 3BH0A 4HZIA 2O8EA 5C46F 1TUEA 2C04A 4W5WA 3S1AA 3PJRA 3NVAA 4RKEA 4A6XA 1T0HB 3K70C 4NONA 1TU3A 2UZ3A 4JVMA 2O8EB 1DAHA 3K09C 5EXTA 4F38A 2Z43A 2V3CC 3Q72A 5KU1A 5LDDC 3LW7A 5FL7A 3M4YA 2XX3A 1Z2CA 1NG9A 3CNLA 1Z07A 4RZ2A 3U7EB 5KPDA 2AR7A 3TVDA 1RFLA 2E87A 4PC3A 3I5XA 2RGBA 1Z6YA 1FX0B 1ZM4A 2AKAB 2IHBA 5J4YA 3GMTA 5DI3B 2QROA 4RFVA 4KO8A 1UKVY 2GBLC 2IK8A 2R6CA 2ZJZA 1GUAA 3I4LA 4KVAA 1D2MA 2GJ9A 2JJ8A 2MMCA 2YC2C 4M4SA 4EDHA 3O8CA 4E09A 1P72A 2CBZA 5J4VA 4FWTA 2ZTSA 2PH1A 3GJ4A 4MUAA 2D3WA 2R8RA 4TMVA 3TK1A 2BCJQ 5JJKA 2GK7A 2P6UA 1VIYA 2ZYVX 3CF6R 3KUDA 3VU9B 2GZHA 2IYTA 2QE7A 4V0LA 2ZI3A 5G40A 2V1XA 2QNRA 3VQTA 3CF2A 3MHVC 1WE2A 4KYUA 2ZU0C 4A0GA 2I1QA 2YKGA 3DMDA 2ZAMA 3TVTA 2W6ID 1H8ED 1J90A 3FWYA 3WXMA 3VR4A 2F1JA 1L4YA 2Q0HA 3FFBA 3CX8A 3K0AB 4Q47A 3FMPB 1IAQA 4LRSA 1QVAA 2XNDD 1SGWA 4Z8YA 5IHPA 2OCPA 3PITA 4TQAA 4QOSA 2G88A 3EW9A 4LBZA 3ZIAA 2YV5A 1GKIA 2Z0MA 4NCHA 1IOZA 5UKDA 2HEIA 1XXHA 4AY2A 3S1AB 3DOFA 2IS4A 2QPTA 3U61B 2RGXA 3B60A 2OUKA 1Z47A 3B9PA 1R6BX 3RSOA 1QZMA 1F2UA 1MABB 4NH0A 2RGDA 4HI0E 5EE3A 4B34A 1SKYB 1G4AE 1ZD1A 2P5TB 1U9IC 2DY1A 4LYFA 2DFTA 4QFMA 1J2JA 4PQFA 2X19A 3G5UA 1U81A 4IVRA 1T8TA 1Z0DA 3HR7A 4NPHA 1AZTA 3NTUA 4B2PA 4BFUA 3NDPA 2NZJA 3OAAA 4M9QA 2J0SA 1E9RA 2VF7A 3WP1B 2REOA 1KO8A 5C4MA 1OFIA 1U94A 2Q6TA 3VLFB 2W6JD 3AVXA 1VG0B 1QVRA 3CR8A 5D3MB 4EPWA 1ELOA 2QP3A 5HTKA 1XJ0A 3CM0A 2H7VA 3VHXA 2W83A 4AK9A 4GL2A 4P4TA 3QPVA 5EP2A 2YWHA 3A4NA 4KFUA 3AVOA 1O87A 2ATXA 1WQ1R 2QGZA 2VP9A 3PENA 5K8LA 2HYIC 4DLRA 4RD4A 1E1RD 3G0HA 3TJZA 2H92A 1M6NA 2R6DA 3CRW1 2GVDC 2ZJBA 4XWOA 4GPTA 5FR2A 3BWDD 4Z51A 1M74A 1EGAA 2RGCA 4DCTA 1G8YA 4PAOA 5E7IA 4IDPA 5JWOA 2JIZA 5H68A 1W0KA 1XPOA 1CJKC 3SQXA 2FGKA 1SKQA 1E9DA 1LNZA 1E2PA 4JLPA 1E4YA 4Q19A 1C1YA 3PG5A 1E2EA 2WMNB 3LDAA 4M1YA 2V4ZA 2ZJOA 3R7WA 5CB8A 3W3ZB 4BPBA 2PEYA 2ZAOA 1NBMA 1XFAA 3NHBA 5DN6D 1OSNA 5IK2D 3NWJA 2O8CB 2YOFA 5AUQA 5FOWA 3SJCA 1KMHA 3RRNA 3B78A 3HP1A 2WOJA 4DDTA 2QMOA 3MUFA 2J0QA 2A3RA 1QHSA 4C3ZA 1XCMA 1F2UB 2QSYA 1VTKA 3NDBB 1P2UA 2WHXA 3IBYA 4H9GA 5KNCA 4URVR 1R0ZA 5CM8B 4BLQA 2GEDA 1Z83A 1OHHA 1G3UA 5EUMA 2ZRNA 4X8LA 5AR1A 1NJFA 1Q22A 4HAYA 5EZ5A 3DZDA 3A4LA 4IDNA 3H2YA 3TQCA 2BBOA 3DZ8A 2NMVA 1NI3A 1A1VA 4BZPA 2QMHA 2OCAA 3KUCA 1VDZA 2RKOA 1U8YA 4RD3A 1AS0A 1R5OA 3AF2A 3QOFA 4DWJA 2FSHA 3VX3A 1WB9A 1P3JA 3BH6A 1SVMA 2FSFA 4O0MA 4R71A 2CJWA 1I2MA 2NO7A 4NDZA 4L15A 3U7HB 3T1OA 2GDJA 1T5IA 3FHOA 2IBMA 4D4MA 3HPRA 3F3YA 3Q85A 4GOXA 2QY9A 3L0IB 4WAUA 2LCFA 2OEPA 4ZDWA 3QF4A 4I1VA 3ADKA 4AG6A 1HTWA 1AQUA 3SS8A 2Q9AA 4H1UA 2NTYC 4ARZB 1JPNA 1EWQA 5FPSA 1JR3D 2IYVA 5P21A 3EZ2A 1ONBA 2DZOB 4PPGA 2BCGY 4M1WA 4D25A 1JQJC 3UMSA 5HR5A 4KCGA 3TW8B 5FPTA 1P2VA 2VP5A 3RLFA 2IF2A 1A2KC 2JGNA 1P60A 1QHYA 3OEED 4A0HA 2IYQA 4HUQA 3OESA 2FSGA 4EJSB 2V8OA 3AEZA 2DWOA 821PA 4YLGA 3VR5A 3LXXA 4URUR 4AKIA 2OFXA 5FUYA 1Z63A 3LBIA 3TGPA 3ZD6A 3GJ3A 4MKGA 3A8TA 4TTPA 3WBKA 3MWJA 3Q7QA 1ZUNB 3EZ9A 2XOKA 4ZDIA 5GVSA 1Z0IA 5F9FA 3RS4A 5A4JA 2GILA 4JSTA 2PMKA 3MGCA 1ZM2A 2OV2A 4D2IA 3NH9A 1HUQA 3RWMB 4TSFD 4DSUA 5FTJA 3M1IA 2WJYA 5SZKB 3K53A 1AN0A 2PEZA 3AVPA 3VR3A 2P3SA 4LJ9A 2ZRMA 3IEUA 3QPUA 3WMFA 1VIAA 3W8NA 3I32A 4MH0R 4ZV4A 3I5YA 2OO7A 2R6AA 4XIGS 2FEMA 2IYZA 4MKIA 2C99A 2ZPTX 3VKWA 2ZRIA 1UBGA 3LX5A 1XNJA 3O47A 2JEOA 1UKYA 1NVWQ 3ZGXA 1N5KA 3AP3A 4QHSA 1PLLA 3TSZA 1MO6A 4A9AA 1H8HA 3L82B 4CEJB 1IN7A 1E1QD 3N70A 2ZE6A 1ZBDA 2XB2A 1GFIA 3NC1C 3A1VA 3VHLB 1W2HA 4GRAA 5BW8A 2ZM5A 4BLOA 2DVWB 2JATA 2WWHA 2ZR9A 4C0JA 2BBSA 2GJ8A 3W5IA 1TEXA 3CZPA 5CDFE 4PZLA 3GPLA 3THOA 5EP1A 5J4HA 2IUUA 4QGHA 3GJ8A 5FL3A 2A5YB 3UPUA 1TQDA 2WSSA 1P2TA 4G5GA 4U7DA 3L0OA 1W4RA 2IEYA 3O8RA 4Q7LA 5HZKA 1W7AA 1XEXB 2DFKB 3FTQA 4HB2A 1EFHA 3N5CA 4JS0A 4C0LA 1FL9A 1IXRC 1K6MA 2NQ2C 3E1SA 5KNDA 3OF5A 1DAMA 2JJ1A 3ZLJA 3TBKA 1KI6A 2GXQA 2QSZA 2ZI6A 4IEEA 3HPQA 4NYJR 2GAAA 4QRHA 4EQ6A 5JS7A 2W58A 3C14C 1RKBA 3ZQ6A 2X1VA 4BFZA 4MGYR 4A36A 4O2RA 3IIMA 3OIUA 2ZJ5A 2EWWA 3H0KA 4MITA 3GLFB 1FQJA 1HQCA 1TNDA 1ZNXA 4OJQA 4G1UC 4LYAA 1SZPA 5AUNB 1RZ3A 5JWRA 1X3SA 5FFMA 4BQSA 3QBVA 3A4MA 2V55B 3QUSA 3ASZA 1EFTA 2ZRGA 4BFXA 2LKCA 3T1TA 4LUCA 3AGPA 2BOVA 3TRFA 1UAAA 5AJZA 4NCIA 1N25A 1G1MA 3KKPA 1AGRA 1NF3A 2HUPA 2QQEA 3MSXA 3SZRA 3U3JA 2J87A 2ZYWX 1XBTA 1JAHA 3DL0A 4NP6A 1P9RA 2CLDX 4BRWA 4O3MA 2GKSA 2ZQ5A 1AK2A 2ZS8A 4UNPA 3RRYA 4YMUA 1OH8A 3WYFA 3KW6A 1SQ5A 3PEWA 4DB2A 4PHFA 4LJ5A 4MRPA 3KXIA 4OKSA 3SYNA 1CR2A 4B75A 3QQ5A 3IIKA 3X1WA 2RGGA 3TMKA 3SBEA 4CEJA 2ZUDA 3FPAA 3NKVA 4ASUD 3SJZA 3Q7PA 1NN0A 3WYAA 4DLTA 1XJQA 3Q5EA 1SKYE 1M34E 2VA8A 4JLKA 3AKCA 5CYOA 4C2UA 1KI9A 4OK6A 2VEDA 1TQ6A 1ZYUA 4Q7MB 4C0AC 1D9XA 3H4MA 2G3YA 3DEFA 3KXKA 3QKUA 4JSYA 1EFRD 1E79D 4WOPA 1OIWA 5KO2A 4LZZA 2ZSFA 4Q9IA 2A5JA 3KKNA 4AURA 2C03A 1M7GA 3N2IA 3HR8A 2PL3A 2ZROA 2HYDA 5JHHB 3EIQA 4K8OA 4TZ6A 3SQWA 2PLFA 5H70A 1KKLA 4FW9A 3FKSA 4HZUB 1SVIA 4IOMA 4EQ6B 4FINA 3L0PA 4TTQA 1N2CE 3DO6A 1QF9A 2ODEA 3C16C 3EX7C 4PC7A 1GP2A 4R9UC 2NO9A 4QHTA 4PAMA 1G6HA 1NVUQ 1ZD9A 4MUBA 1DS6A 5CK5A 3CIOA 3EPLA 4LC1A 2ASEA 2NG1A 4E03A 3EIEA 4A0RA 1S2MA 1NJGA 4CEIA 4ZKDA 2ZSEA 2YNMA 4KBFA 4A4DA 2YOHA 3KKQA 5CLQA 1NN5A 1ZNZA 2IHYA 2QUZA 4I99A 2BMDA 4TMTA 5G3ZA 5EP4A 4GBMA 5FPKA 3I8SA 4HLDA 4EFMA 4JVLA 4QBGB 4R7ZA 2KSQA 4M9ZA 4QGFA 2V6JA 3PIRA 2BHRA 1RRCA 4TLDA 2WWGA 2WWYA 4KHZA 2HV8A 2JA1A 3TNFA 4Q4HA 1KSGA 5HKKD 4FWDA 4CEHB 4QNRA 2EWVA 4OJKA 3A1TA 4LBWA 2GJAA 4CF7A 1IJFA 4L5BA 2J7PA 2C5LA 5LBIA 4DDVA 3SDZA 1YVDA 4YMSA 2WAYA 4TLBA 5BWMA 5JSZB 5LPNA 4UJ3A 4Q48A 5CIQA 2IXFA 1E2NA 1SVSA 2N42A 4RKFA 4MDEA 2CHVA 2XTZA 4TMKA 1KY3A 4ZDJA 1KI6B 2GXUA 2D2EA 3L0SA 3GJXC 4BECA 3GJ6A 3DHWC 3U3OA 4OHVA 3BFKA 2RGNA 4US0R 2ZSBA 4PSVA 1DEKA 1CRPA 1W44A 3B82A 2AX4A 2P6RA 1WRBA 3SBDA 2EFDB 3RRMA 1T3SA 3A58B 2AWNA 4IFBA 1ZW6A 1NP6A 4M1SA 1YR9A 4OQNA 5K8TA 1U98A 3OIWA 5AWFC 5EQTA 4D0GA 4WA7A 2BKUA 4OQFA 2WWFA 1YZUA 2F1HA 2FFQA 1NY6A 1VCIA 4JBXA 5C4GB 3QKTA 2CEAA 1E0JA 2ZR7A 3SYLA 4OI4A 1D5CA 2GJKA 2I4IA 2G0NA 2WMOB 1DG3A 1XMVA 4QNMA 5DISB 3IDQA 121PA 3X1ZA 1XD2A 5DLQC 3BC1A 4AI6A 4OQMA 3ZVRA 4YMTA 4F4CA 1N6KA 2KWIA 5DO9A 1Q1BA 1BOFA 5FBQB 4D4JA 2ZJ8A 3D8BA 1GIAA 3B9QA 4PAQA 2RB4A 1AJEA 1KI7A 4BFTA 4IW3B 3Q9LA 4AYXA 3M0EA 1OW3B 4ERNA 5CB6A 2W6IA 3AUXA 5DSZA 4C0KA 4ZPXA 3OFNA 1US8B 3KQLA 3TAHA 2O8BA 2A9KA 4FI3C 4D26A 1VYVA 3W34A 3H86A 4UXHA 2GCOA 2EW1A 3FMFA 3IQXA 4CEIB 2YINC 4E22A 4TMXA 4QGAA 2ZUBA 4A82A 2ZRBA 1ZIOA 2IYLD 4PHHA 2JIZD 1D6JA 1MV5A 1WCV1 2WV9A 2G9NA 4DSTA 4DCSA 1YZLA 4JT2A 2AK3A 3OEHD 3QI2A 4LHZA 2QORA 4QJ3A 5B58C 2F1IA 2NPIA 1G8FA 4B2LA 2ANCA 2AK2A 1W48A 2W2TA 1T91A 3ETLA 3GD7A 4MGIR 2AFIE 5L8VA 1X37A 1P7CA 2VP0A 2GVZC 3GLGA 3U4QB 3VNUA 2IA5A 4FMDF 1G8GA 2QM8A 3QKSA 4LYHA 1NVVQ 3T5DA 4KI0A 1IY1A 1KSFX 3EXAA 4PHTA 2QTFA 4FIDA 5D3MA 1WXQA 2ZE8A 1G20E 1P73A 1L8QA 4LX0A 4DLXA 2B21A 3W5JA 1L7VC 1WP9A 4PQYA 4RD1A 2YVUA 1AS3A 1OXVA 4UXJA 1S4QA 1SVWA 1KK3A 3ZJYA 4B76A 3MLEA 4UKDA 1NMZA 2XZLA 1DTSA 1CJVC 3LVQE 1AA9A 4URYR 3VKHA 1OYYA 4LK2A 3QPWA 3AF1A 1UBEA 4XTRA 3FHTA 2RCNA 1Z6XA 3IIJA 3OE7D 1C9KA 4OQLA 5CJ2A 2V54A 3X1XA 5JS8A 3MG9A 3NBZC 3AJIB 4Q03A 1E4VA 4TZ0A 1ETUA 3EARA 1KZGB 1D8TA 1MO4A 4L9SA 2QAGC 4QBHA 1Q12A 2BMFA 4B43A 1US8A 1V5WA 2X8AA 2PLRA 2ZITA 2BEJA 2BKEA 2IYXA 1AM4D 2ZRPA 1UJ2A 4KITB 1X86B 3GFOA 2BV3A 1JR3A 4JL5A 4D4KA 3VR6A 4FWIB 3IPXA 5BXQC 1N6LA 3CRMA 4DLWA 1OFHA 5KDLA 4PPNA 4NU0A 3OFND 3QG5A 4Q4AB 1W0JD 2J0UB 3C5HA 4BASA 3KQUA 1IN6A 1KKMA 1RIFA 2BBWA 4R98A 5L3VA 2H1LA 2HF9A 4P32A 3BRWD 1T4GA 3CR7A 1P62B 5FPYA 1HQYE 3GEIA 2AD1A 4MQBA 2WWXA 4XH9B 2J41A 5C1BA 2Q3FA 1E9FA 2ONJA 1VYUA 2RGAA 2HCBA 4RFSB 1QHNA 2WKQA 3OEHA 3WP0A 1E69A 1YZGA 2FU5C 2JLUA 1N6IA 1D9ZA 2PCLA 3EAQA 4C7OA 1R0WA 1Z0JA 3WRXC 3THXB 4PC2A 1MH1A 3NC0C 1XZPA 1F5NA 4MRSA 4KSBA 4XVUA 5TMPA 1I4DD 2VSOA 3C41J 5HCIA 1VCNA 1TX4B 2XEXA 3H84A 1CEEA 4JBWA 1EFUA 2BBTA 3LA6A 2ZVPX 5IT5A 3UXMA 3IEVA 4LRWA 3B7GA 2FEOA 1RYHA 2QI9C 3EASA 3PR1A 3REGA 2CNWA 3TQFA 2QP9X 2QPOA 3AVWA 2WZQA 5JEDA 4Z8XA 2VLIA 1Z8FA 2GESA 3GLHB 2J5XA 4G0NA 4DEYA 3WY9A 1XPRA 3KB2A 3RHFA 1F48A 4DUGD 2H5EA 1N6NA 4LGMA 2GZDA 4Q9KA 2F43A 3QF4B 3QKRB 5ELXA 2F3RA 2QQ0A 4CIDA 1QHHA 1LV7A 2WJJA 4WZBE 1W4CA 1RC8A 2CK3A 1Q3HA 1XPUA 3CNOA 1E9EA 2FA9A 3PUZA 1BKDR 1S3SA 4ZKEA 4Q9HA 2O8DA 1BS1A 1Y3AA 3CLVA 1CJUC 4TLEA 2OCBA 4NCNA 4MGZR 4FMDB 2B7CA 3NBFA 5EE1A 2H17A 1R4AA 3CWQA 1XWIA 4TQUS 4CVNA 3V4FA 1BMFD 3ADBA 4FCTA 2QAGA 2L0XA 3MMPA 4DIEA 5TY0A 5CITA 5JCPA 2EYUA 1L2TA 2ZR0A 1RPZA 1OH5A 1XMJA 1GKYA 2DFNA 2JLVA 3AVUA 5FOTA 4OL0A 2B92A 2G77B 2PCJA 2FFBA 4PZYA 1TPZA 1FP6A 5FUWA 5KSYA 2F55A 4JN6A 2KJQA 2QEQA 4EUNA 1QHXA 3CWZA 3RNLA 2OM2A 4EPTA 4RFSA 4DJTA 2FZ4A 2Q9CA 1G7SA 1I4TD 3U60B 4TYYA 2FFAA 3CX7A 3CH5A 3R7WB 1VG1A 4B73A 1G3MA 1NVXQ 2FPLA 4F92B 4U00A 3SC3A 1QZXA 3I1FA 3EPKA 4B6FA 3FFAA 1TMKA 3UKDA 4EJSA 2OZEA 1K5GA 1A82A 4US1R 4TN1A 4BFSA 5HZHA 3CONA 1FNMA 4M9SA 3LXRA 2EYQA 4V02A 3DPUA 2NO1A 2IYWA 2ZUCA 1NMXA 4PXAA 1VG9B 3KKOA 2EFEB 5FUXA 1SXJC 3GLHA 4UQOA 1J99A 4QM7A 1SVKA 3R9XA 4C7OB 4UNQA 4WVFA 3UIEA 3JZAA 3CRQA 2DB3A 4C0SA 4FMBB 2QZ4A 3F5FA 1G7TA 3AB3A 3BB1A 3MCAA 2IL1A 1SXJE 1S0UA 4BGDA 2G6BA 4QJ5A 5DHFA 3B5JA 4A2QA 2LKDA 3QJYA 1XCGB 1Q1QA 2NIPA 1ZD8A 1G7RA 3TIFA 2HXSA 3JVUA 3WBJA 4MA4A 2C98A 4BZXA 3KTAB 5JBQA 1EFRA 1J8YF 1OF1A 2CJWB 2RHDA 5JWHA 4X8HA 1KZ7B 4EPRA 2JCSA 4DDWA 3AH8A 1IJEA 4DZZA 1ZIPA 1AKYA 3E2IA 1Z3IX 3LX8A 2CK3D 1ANKA 2WSMA 2GEUA 2DZNB 2A2ZA 4JKIA 2NO0A 3F8TA 4D81A 4LYJA 1RE0A 3BFVA 2FGJA 3W3AA 1OH6A 2AXPA 3PUWA 1DOAA 5FBVB 2Q3MA 1E2DA 3PCRB 4KAXA 2J46A 3K0FB 4UXIA 1GL6A 2OESA 2FWRA 5LD2B 2EFHB 3K9NA 4JIMA 3MWYW 5IDVA 5ANRB 3W6OA 3GLGE 3FMIA 4D82A 4ZO4A 5KYKA 4LHVA 8OHMA 1A5TA 2EU8A 2CCGA 1E2FA 1FX0A 3G82C 3MWKA 5FUVA 3VAAA 421PA 3IHWA 2ANBA 1XF9A 2ZVQX 4QBFA 3SU8A 3IPYA 1NKTA 3AV0B 4XWAA 4U5XA 2W2VA 3AM1A 3NIBA 2XNDA 1G8PA 4Y0VA 2X2FA 1UBFA 4DLYA 3D31A 3SEAA 4ESVA 3L8YA 1KO4A 3ZVLA 2J9RA 4MKHA 2ZJ2A 3TUIC 1JNYA 3CUEF 3P27A 1IN8A 2BJWA 2C78A 1UADA 3GEEA 1Z06A 3P32A 1DAIA 2R9VA 3J81k 1XXHE 3UMFA 1ZINA 4KYIB 4MRRA 4YMWA 1WDTA 2VSXA 4B47A 4ITRC 3T61A 3ZD7A 5JJIA 2H18A 1DBSA 2VP6A 4G5RA 2QT1A 1G3QA 2OLJA 4B3FX 4PC6A 4TMZA 4AKGA 2REXB 2G0TA 2OILA 2GCPA 2EFCB 1OXUA 1Q1ZA 4HATA 5KHOC 1JAIA 2QENA 1CR4A 3KQNA 4IRUB 1NNEA 3K8YA 1DE0A 4YXWD 4LJ7A 3LBNA 2NZ8A 4B3CA 1XU4A 3EIHA 1ZP6A 3IHLA 1K8RA 2IYSA 2CXXA 4GZLA 1GITA 1TAGA 4FN5A 1E0SA 3R20A 4JLAA 1MOZA 5L3SB 2GEVA 3KFVA 2O8FA 2P65A 3C7KA 3LNCA 1JEDA 2WTUA 1UEJA 4ABYA 4LV8B 3CRRA 3IGFA 3K1JA 2CE2X 5L3SA 4WZ6A 5EXXA 1VHLA 4FXPA 3RC3A 4F91B 1VG8A 2PT5A 4XTCS 5H1YA 3B1WA 2DWQA 1NG1A 3LBHA 4DLSA 4V0OA 1BO6A 4O2LA 1OYWA 1ZC4A 4Q9LA 2WSSD 1PLKA 4FMCF 4V0NA 2ERXA 4HAUA 2XSZA 1T6NA 1ZM7A 4QKQA 5EJEA 2YWGA 3MJHA 4Z1MD 4HLUA 2CVHA 4JLVA 3BOSA 1KO7A 5KSZA 3NBYC 4TL7A 3AUYA 4JVSB 4JL8A 4I1UA 2A5FA 2PMDA 2VTKA 1II9A 4CRWB 5BN5A 1W5SA 2ZRCA 1XTSA 2B7BA 3M6AA 1U0LA 4KV9A 3I61A 1CIPA 2FPKA 4PFSA 3U4QA 4URWR 5JI3E 1N6RA 1COWA 4U02A 5FTLA 2YOGA 1ZUHA 1G291 5EE0A 4AKHA 3DM5A 1E9SA 3FMOB 1DADA 3QG1A 2QM7A 2GF9A 1G3IA 1JQLB 1N5JA 1UBCA 1U9IA 1VYTA 2A30A 4ON9A 4DT1B 3VKGA 2DWZB 2Z4SA 5DIFA 1NLYA 2ATVA 4BUJA 5CK4A 2ONKA 3CX6A 4W5JA 5KSPA 4YMVA 5GJBA 4S2EA 1EFCA 4WIAA 3FDIA 2AXNA 2I1VB 1J8MF 221PA 1EWRA 4LPSA 3R9IA 1I4LD 4C2TA 3GLIA 4LV5B 4N0EA 2QRNA 3Q8XB 2XXAB 1E6CA 2RAPA 3AVYA 2JJ2A 2WJVA 2O0KA 4KFRA 1S1CA 4X8MA 3TKLA 3P4XA 4BLSA 4QXAA 1ZCAA 2IX3A 4DLVA 1W36B 2CLSA 3B1VA 2DBYA 1ZAKA 1JR3E 1IXSB 1GSIA 4WW0A 1N6HA 3GEHA 4ZIRA 2V1UA 1DG1G 2R6FA 4N0DA 4YXWA 621PA 3GLHE 1X8LA 2OT3B 2VL7A 3IILA 4JVNA 4JBYA 1T9HA 4B3BA 2WWIA 1U8ZA 3QEJA 4G5QA 3LO5A 3NEYA 1F2TB 3K0CA 1GWNA 2OHFA 5G41A 1G64A 2ZRLA 4HAZA 3PXGA 3V4RA 2IS2A 1KNXA 1E0KA 5KDOA 1A2BA 2XZPA 1NN1A 3BXZA 4A2WA 2VF8A 2BWJA 2JLZA 2ZYTX 3PQCA 3RSLA 3B1XA 4W7SA 5B64A 3AVQA 2FPMA 3TAUA 4BLPA 3AF3A 1W4AA 4LOAA 1SVLA 3X2SA 4A6PA 3ZS9A 4TYNA 2J3EA 3A1WA 2GXSA 3WNBA 1N0UA 2W6JA 2FH5B 2K5UA 4B6EA 5TV2A 3QXSA 4RJLA 4RZXA 2QAJA 3QENA 5L3QA 2J7KA 4DRZA 2XNSA 2C9YA 1CTQA 3SOPA 2VHTA 3B1YA 1CP2A 3MFYA 3QEOA 1E98A 5FOUA 2ORIA 2OFWA 4QG7A 5BQ5A 5G53C 3K9HA 1OXTA 2BMEA 4BZQA 4Q21A 2BIFA 1UDWA 3RS7A 4ESHA 1CF4A 4AYTA 4YONB 1W0JA 4MYUA 1CU1A 5JZVA 4IOLA 4PX9A 3CO5A 5AJWA 4DLUA 4RVCA 3EC2A 4YDHB 1NBME 1W2GA 1OKKD 2KBEA 2ZS7A 1R0YA 3BB3A 5DE3A 2FE4A 3RC8A 3HYRA 2QE7D 2AN9A 4DDUA 1OFUX 2ZI7A 3W6PA 1ZUIA 2QA5A 3ZS8A 3I3SR 1H8HD 3LFUA 4DCVA 1WBDA 3T5GA 1NSTA 2WJIA 3AQ4A 3CZQA 1NIJA 2KI5A 1G5RA 1E9AA 1G8HA 1UKEA 3I92A 3AKDA 5TB5A 4CT5A 4D6PA 4F4IA 5DYIA 2N46A 2WOOA 3W8RA 5AUPB 1KY2A 3ADCA 5JECA 2YWEA 3Q5DA 2X77A 1NKSA 1LTQA 1XTKA 1P4SA 1XMIA 4BFVA 3AF0A 3HYTA 1R7RA 1CJMA 1KMQA 1FW6A 3VNVA 3HJNA 4XJXA 1A4RA 1OLOA 2BVNA 3IQWA 1KI4A 2ZRAA 1GOTA 4WXPA 5JJLA 3A1SA 3LRPA 2O8CA 5EXSA 1XX6A 5CYPA 5GADl 2XTNA 2C8VA 4M22A 4A3VB 1E96A 3JZMA 2QU8A 4LHWA 3ZZ0A 1YR7A 2HJVA 2FOLA 1WBBA 2GCOB 3L2OB 2CHQA 2HT1A 4Q1CA 1E32A 3C5CA 1E9BA 4AKEA 1Z2AA 2OBMA 1CS4C 4R2HA 3RDPA 1BYIA 1M7BA 4H1VA 1OV4A 1W0KD 4L9WA 5B30A 3OAAD 2B8WA 3QXCA 1W47A 1DAFA 2MSCB 1X8KA 1PZNA 2N1BA 1ZM9A 2XZOA 1ZNYA 3GLFE 1R5NA 2CL0X 4HDOB 4WBSA 5DN6A 2Z83A 1H65A 4MYCA 3ZVMA 2VHUA 2FN4A 1X6VA 4JJKA 3ZZUA 1G16A 1F3OA 1G17A 1P61B 1SXJA 1KHTA 1CR1A 3AVVA 3RAPR 5JCZA 4I1OA 4I4LA 3IKJA 1GDDA 1Q20A 1KYIA 4KODA 1HE8B 1G5PA 4IXMA 3FGNA 3K0EA 4Q7JB 3VTKA 3GLFA 3CPEA 4EFLA 5J47A 1VKJA 1GILA 4QJ4A 2D62A 1I2DA 3TLXA 4ZI3A 2HJGA 4TYPA 3QVUA 4PHGA 1ZU4A 2E1RA 4ASUA 5FOXA 2X2EA 4Q4JB 1Q57A 1Z5ZA 1ZM3A 3OIYA 5JEEA 1KOFA 4HAXA 2WPDD 1GM5A 1KDPA 4CW7A 2O8DB 4AC9A 1NBMD 4TL6A 4P4UA 4DSOA 1E2QA 5GJCA 4CEHA 1M1YE 2D7CA 4ILEA 4M1OA 2BM0A 3KQHA 4HEJA 3PUVA 3I62A 1XTJA 4OBEA 1D2NA 4OK5A 2FDCA 1QBKC 5L3RA 1FUKA 3B85A 3CPJB 1CRQA 2C77A 2V6IA 4DXAA 4HB3A 3IUYA 5HPYB 3QXJA 3U44B 3FB4A 3N2EA 3DM9B 4GFDA 2VYFA 4RCYA 4JLBA 1N0WA 2JAQA 4PANA 1NMYA 1KI3A 1GNRA 5HE8A 2F3TA 2J1LA 1LW7A 2OCYC 4C0BA 3EZFA 1FP7A 2QL6A 1E2KA 2FSIA 2WJHA 1YZTA 4IEIA 1Z08A 3P20A 1T0JB 1HA3A 1C4OA 1E2IA 2YC4C 1TADA 3THYB 2QPAA 4JYCA 1IY2A 4Y0AA 1JECA 3KJGA 4NYMR 3VR1A 2QBYB 4B44A 1NL3A 1XD9A 1N5IA 1N0VC 1E94E 4IFEA 1VCMA 2VHJA 3X1YA 1N6OA 3MWLA 1JR6A 3AP1A 1G4UR 1R2QA 5FBLB 1P9WA 4OHZA 2WICA 1SXJD 2VQSA 4PQRA 4A8JA 4XWKA 4W9MC 3T06B 3KX2A 3I73A 5CDFA 1ZRHA 3B1ZA 4PR0A 3ICQB 4AYWA 3W6NA 1U0JA 4JLNA 2WJGA 4N3NA 4A8JB 1G9XA 3MAAC 1WF3A 1CR0A 4JLOA 3VMFA 1E2HA 2Z4RA 1VMAA 1DO0A 3KTAA 1J7KA 1DAGA 4QL3A 1FOEB 1D2EA 2F43B 3QKRA 1H8EA 2F9LA 2PZGA 5K8IA 2PX3A 1N6PA 2PZFA 2R62A 2IT1A 4V03A 3ICEA 4URZR 1FTSA 4GI7A 4NHOA 1W4BA 2J45A 4ZCIA 1M7HA 1JPJA 1E3MA 4I1SA 4KFSA 2PJZA 3ZIAD 3RVBA 1FNNA 2H16A 1XD8A 1ZJ6A 4KLZA 5DNYB 2KE5A 5FL7D 3K09A 2C96A 2P6NA 2GXAA 2MMGA 3P1JA 4HLCA 2ZANA 2IW3A 2DR3A 3L43A 4POAA 2BMJA 1HURA 2XJ4A 2CMKA 2MSEB 2O0HA 3SI7A 3NG1A 2RGNC 1MO5A 2GA8A 4DBLC 1MT0A 4P0TA 3O8BA 4DCUA 4B3GA 1IM2A 4JJZA 4QC2A 4PSKA 3U6KA 1QDEA 5DI9A 4G01B 1P5ZB 5KPJA 2IWRA 2D4HA 1QRAA 2ZRHA 4UJ5A 4OHWA 1CXZA 3BFXA 2QBYA 3QNUA 5FR1A 4Q4JA 1U8AA 5JRZA 4OI1A 4JYBA 4HAWA 5EE9A 1LY1A 3EA5A 1G21E 1KK1A 5FOSA 1XB2A 4JLMA 3K0SA 3OIVA 5DH9A 3OEEA 5FOVA 2R6GA 4A1FA 4JLDA 1Q1EA 4I81A 1EX7A 5TARA 1NLZA 1C1KA 4IXNA 2ZE5A 3NHAA 1DAKA 3CF0A 2IS1A 4KJZA 4FCVA 4BLRA 1HY3A 1NN3A 1G18A 1GTVA 1TL7C 4B33A 2IUTA 3ZZTA 3V9PA 2IEZA 3U44A 4R2IA 2OXCA 5EZ6B 1E2GA 2HLDA 3CBQA 3EWSA 4NKRA 2CLCX 4K46A 5B57C 2QTHA 1G6OA 3R8CA 1NY5A 3ONWA 4A15A 2XITA 2D7DA 4Q1EA 2BDTA 2GHIA 4CYMA 1FUUA 3U3KA 3P26A 3C8UA 1JJVA 2W00A 4Q4AA 4DKXA 4QBIA 1JEEA 2ZSDA
chains in the Genus database with same CATH superfamily
4TM7A 2R8YA 3HXMA 2DHRA 4TRMA 4PBTA 4FD2A 2H06A 4DV7M 1CZRA 1QHIA 3HY6A 1Z5BA 1QKIA 2WM3A 4W6ZA 5IK2A 5C0OE 5F5LA 4O4HA 3O74A 2XWSA 1PGPA 2AZMA 3DL7A 3TMYA 2GHQA 1XNHA 3FOCA 3U7JA 1UKZA 3VC2A 3K16A 3OZXA 2VSFA 4ID9A 5AKXA 5A0FA 3DJYA 1XNRB 2I3BA 1M2VB 3O8OA 3TKYA 1DAOA 3SLGA 1OXXK 4KFTA 4KR2A 4G4GA 5C31A 3UQYS 4YAKA 1X1RA 1U1IA 3UK6A 1DEXA 4QYWA 1BE6A 3HBAA 3HKEB 4IO1A 3HL4A 4MR8A 1XDUA 3B6MA 2IHKA 2PGJA 1YKSA 1NIPA 2VDKB 5DTIA 3PA6A 1MRNA 3STWA 4YRSA 3GMDA 4OGFA 3UGKA 2D1YA 5CPFA 4ADSG 1V43A 4WUTA 4ES6A 1KVSA 4F84A 5HSGA 4P36A 2XDQB 2IRWA 3NPAA 1EXWA 4MGHA 2NVOA 2QN6A 2IS6A 2ZU6A 3CLUC 3HM2A 4Q1BA 1KIAA 1Y48E 1ZGBA 1JXQA 4EG8A 2O7RA 5BR4A 5SY9A 4GPZA 2W6NA 4FOSA 4N65A 2IIQA 3PX7A 5JAIA 3MRVA 4B3RM 2PQMA 3BXHA 3F7MA 2WKRA 5BY2A 1Q6YA 3GDOA 4A8PA 1RJFA 1V7ZA 1P4RA 2D4AA 4CL2A 3UUEA 1KI8A 4KXFB 3A6EA 1YZHA 2F7SA 4OYRA 3Q7EA 4DADA 3DA1A 4B4KA 5AM2A 4UMFA 1YIAA 4PSCA 3ND5A 3HJ8A 1HT2E 4ZIRB 1ORYB 3AP2A 2WSIA 4D9IA 1YH3A 4DB4A 1SD2A 2LWIA 3I53A 2OD7A 3O3MB 4UUBA 3C6ZA 3B7QA 2IUYA 3GQBA 1KORA 1PO7A 3L0BA 4LQLA 3ZCBB 2FZ5A 2H11A 4KWTA 1P9NA 1YFKA 4G0QA 4WI1A 4GO1A 5C2JB 3SZLA 1M8PA 3RUFA 3RU3A 4B3DA 2JARA 3VI4B 2BFDA 4FHCA 4IBFA 3EH2A 2XGGA 1MG5A 521PA 5CB4F 4UQLA 4HXYA 2WW8A 3O31A 4ZV9A 3TOVA 4WOKA 4LZJA 1UDXA 3VK7A 1VGRA 1WXDA 2FG6C 2ZSHA 3BKXA 4PLYA 5LNK1 1EESA 2MR5A 2BR4A 4DGQA 5AVZA 4JXZA 5FA6A 3O82A 4P86A 2V59A 3IVGA 3WB2A 1N7IA 1YE8A 4J6EA 4TKVB 4DLPA 4AG5A 2GNOA 2GJSA 4BNXA 2H65A 3GIDA 5KNLA 2L7IA 5KYTA 2F1RA 1HGXA 1MB2A 1MJHA 3D6AA 4IPTA 2M6KA 1XXHB 1Y42X 2AHOA 4UTXA 1JHRA 3BERA 5EE5B 5E95A 4OX9M 1LRKA 4RYDA 1DARA 3BMCA 4MPDA 3UAYA 4MYHA 4AIIA 4DQDA 2C7BA 1XTIA 3B6EA 4DQLA 2VHQA 5FYQA 3LW8A 4GMFA 1B00A 4KU4A 2DKFA 1K63A 4P3XA 3MUEA 4FYPA 4KQ2A 2AC4A 2GAOA 3CX4A 4GLFA 5BRNA 1O9GA 5SYAA 4B3XA 3C9PA 4G24A 5AICA 4LXGA 2VTDA 3RIEA 4ISCA 4F5YA 5J4LA 1DMRA 5M29A 2HCRA 4OXYA 4FB5A 3KR0A 1Y9JA 3KZKA 3PNSA 4JB8A 3U1VA 3SDBA 4AZ3B 1QIFA 3NT5A 3WL5A 3EPJA 1LB1B 1OA1A 2V7TA 5A0TA 1GL7A 2LXNA 4B6RA 1CD5A 5JFOA 1U7PA 1IXZA 1GQFA 2RI1A 4A0FA 1XZHA 2BEKA 1MC4A 4Y6PA 4BJ6A 5JZSA 2P9EA 4U2KA 2WMYA 1SBZA 5E6RA 2FMXA 3G9ZA 2QV7A 2QUJA 3E8XA 2C2BA 5ES3A 5FTWA 3OO1A 5KCMA 3A9CA 1LPBB 4YJDA 3T1NA 1FP4B 4MS3A 1GAJA 3UUWA 2NPFA 3E03A 3AW8A 3GROA 1MABA 2JFYA 1GKUB 4RPIA 1AZWA 4ND8B 1E3DA 1JI0A 2R7MA 2KBFA 4XD2A 3EQ7A 3FD9A 2VP2A 4YA6A 1QHHB 4KG7A 1PDVA 2QLMA 3KB1A 3ENKA 1R3DA 1II8B 2OPHA 3I9FA 3G6WA 3Q9NA 3MF4A 5GJWC 1NXWA 3D0OA 2B20A 3DWGA 1D1TA 1Z5OA 3IPLA 5EJAA 5CCEA 5IH7A 2NU8A 4RSGA 4O3FA 2EC5A 4ARUA 2IYUA 1KVTA 3GRUA 3WIVA 4RDCA 2VJAA 1THMA 2EUCA 4N7MA 5E1OA 4E7OA 2R751 3RS2A 1NXPA 4D3DA 3U13A 1CNMA 4ZICA 1V16B 3G0OA 4AS2A 3A2MA 2FZWA 3DCNA 1QUSA 2LPMA 3G6KA 1CV2A 3OHMA 4P33A 4IFIA 4ZT3A 3V42A 1I8TA 2YUTA 3HO8A 1JSCA 1M72A 4TRNA 3SWWA 3OA0A 4OAQA 3KJNA 2QMUA 1JDNA 1LI4A 1FMJA 2A3NA 1VSQA 3II6X 4KVGA 3SXUB 1HYQA 2RHRA 1JXOA 1A96A 4LRXA 1P0IA 2GH1A 4H1TA 3LVRE 3THXA 1KO5A 1EIJA 2WK1A 3WAGA 3BMNB 1BMDA 3PUYA 4ESEA 1GGEA 2UZIR 1OC4A 1CF2O 1D2AA 3KTDA 1PV4A 1GYQA 4M9XA 1YHNA 3L77A 4IGKA 3WNCA 1NXVA 2JLWA 1S8NA 5JI2E 1GXSA 4GX0A 1SUCA 2IH5A 4D98A 2C1ZA 2RHHA 3CSDA 2QRZA 1H1LB 2J3IA 2YYZA 4LZAA 1DC3A 3KDSE 2ECKA 4PLHA 3SFVA 4RVDA 3OJ0A 2CF6A 5LUBA 1Z4MA 2V6ZM 4ZYZA 5JZ9A 2B34A 5EPUA 3RR2A 2PL9A 2RG7A 4ZHSA 5KNCD 3IDZA 2DPXA 4WXHA 1W49A 2QT9A 3OCJA 5B1EA 2M5ZA 1KMHB 4DA0A 3DOAA 5REQA 4EVQA 4GL4A 3L7NA 4AIRA 3KHTA 2JCXA 1W93A 3FNRA 5JASA 4OQ4A 4YREA 1PTKA 3B74A 1SHKA 3NBXX 4TWZA 5EHXA 5BOVA 3BRSA 5BW4A 1PR1A 1MO3A 5AW8A 1ZN9A 4ZAZA 2FSVC 3CCBA 4HUTA 1GGHA 1USGA 4MKFA 1SN7A 3NX4A 4XEUA 3DMNA 2EX4A 3L8CA 5K1ZA 4OVKA 4YV0A 3EVDA 3C7TA 2C0PA 2G04A 3LT1A 2V7QD 2DHDA 2ODAA 3OOSA 4YJFB 4O2BA 3VUEA 2NU7B 3AB8A 5EPEA 4FP9A 4FFSA 5M04A 3GPYA 4Z2YA 2HK9A 3V8NA 1CWUA 2QN1A 3HDTA 1PM5A 3E23A 2QU7A 4HYYA 1FUYB 3H9GA 3LV8A 4IOKA 3S6JA 3LFHA 4E5PA 2Z8ZA 3PVSA 1WVIA 3HR4A 2DGDA 3FBGA 1Q44A 4CF3A 3BB4A 2IH2A 1Q7RA 3PV0A 1YV9A 2AHRA 2ZEJA 5AW1A 1H6BA 4PLVA 5SICE 5K7SA 1BMFA 1V26A 4P81A 2NSDA 5H7XA 4NOKA 2QM3A 5DNDA 3UJDA 2QE6A 3V9AA 2C7PA 3DP9A 3LWDA 4GI1A 2CVPA 1PS8A 3CZ9A 4FZVA 4K40A 5EL0A 4BVAA 4RTKA 1F8XA 3FHJA 1YUBA 1XGKA 2CNOA 3EGEA 4M1TA 1ESNA 1JE0A 3TECE 4GKKB 2JAXA 3E05A 1GGMA 2XVAA 3R76A 4AXBA 4MVJG 4CJXA 5BW5A 2XOKD 4O4JF 5L95A 4BCCA 2ZBPA 1DINA 3BMQA 3FNEA 4LMRA 4ZCTA 2PU5A 2F00A 3E2PA 1OB5A 3AEYA 1DXQA 3F7OA 3PKIA 1T1RA 1KO1A 1DC5A 3RH0A 5HKAA 1DGBA 3ISJA 3N59A 2ORVA 4D9CA 4MV9A 1IPHA 2QW8A 4TTTS 3GZ4A 2J59A 1MQ9A 3N0XA 4L28A 4Y1EA 1EXDA 2L42A 4U1RA 4GPEA 5BNWA 4DREA 1N1EA 1AY0A 2IDKA 3UFXA 1JDJA 2CBXA 4L6CA 1GG8A 6YASA 5ILQA 2J7NA 4CQLA 4DUGA 2YIJA 2J7PD 1R4GA 2Q4RA 4DR6M 3V48A 2XUAA 3SYKA 1PHRA 1MGOA 3KBOA 2F9MA 3DE5X 4LNUA 1JB1A 4TTAA 3CWCA 4G0VA 1Z22A 4QEDA 3RSFA 4L8GA 2IXTA 4UMDA 3S99A 5KOYA 4UTRA 1RI5A 1QHFA 3LMMA 4QASA 5BSEA 2OFPA 4WHMA 3TI7A 3ANMA 1J9GA 2YWFA 3BX1A 3LK7A 2W0MA 2G28A 4UREA 5EUBA 5JFTA 3GLIB 5L8RF 2D74A 2WMDA 3PFWO 1GVNB 2ILVA 4IXWA 1ODFA 4P54A 5HG0A 4TL9A 3V76A 3SR0A 3AF5A 2IU0A 4MW5A 2QJOA 1UBJS 3IBSA 2PUCA 3TM4A 1OI4A 4YS6A 1NV9A 3VJMA 2Q5IA 5EA2A 1PL6A 1IG0A 1QC5A 1JIXA 2D00A 3W1EA 5EJ9A 5T7BA 4KQ1A 5EIXA 4QUBA 1FK8A 3ZY3A 1KU0A 1P45A 2YHSA 4OEHA 2JA2A 4EECA 1YR8A 3CF4G 2W43A 1NWHA 2Q4EA 5GJVC 1J9EA 1R9JA 2X3FA 4IIUA 3T1QA 1IBRA 5LYJB 4ZEOA 3GLQA 1OROA 4PPFA 1E7MA 1ZNWA 1YI8A 2DWPA 2IXEA 4NFHA 4PSAA 4RD2A 1DOZA 1YWGO 1HQDA 4FWHA 3K32A 3A2KA 1GJSA 1L1QA 2WYIA 2PX8A 3OMLA 5DMHA 4XXHA 1AS2A 3GFRA 4PGMA 4JEUA 1KAGA 1WU7A 2ZK7A 1UBHS 1UPTA 3NH6A 5BT9A 5IMSA 3WLNA 3M3DA 5JYBA 4JUDX 1FSFA 2V9ZA 4OBBA 5AHOA 3TPZA 3O5AA 1YSCA 4Z7OB 3ZC7B 3WWYA 3U3ZA 3EG9A 1KZ6A 3WSTA 1QQ7A 1KSHA 1Q7EA 1B7GO 1Z29A 2ID7A 2XEDA 2XV1A 2ZI9A 3QOYA 4HUQB 4J1QA 4UUNA 3T1HB 3ENNA 2HN9A 3A37A 4RZQA 2ZRJA 2GCEA 1GRCA 3L93A 4JCOA 4Q1DA 1I5RA 2R2AA 3LZCA 4CM4B 4QDTA 4M0DA 4EFNA 2Q62A 1QR2A 5I8PA 5KOHA 4DSNA 1V6CA 1Y7LA 3BRCA 1YRBA 5AI9A 3OJXA 3GXOA 1LWOA 5HIJA 3HG7A 3ED5A 4JP5A 2C7RA 4KHPM 4ITVA 4TYQA 4FJ1A 4YRAA 5TDHA 4OQXA 1EX1A 1AX9A 2Q3DA 2CE7A 3C15C 3WYDA 4E94A 4RUKA 1OZ0A 2WF9A 3UMRA 5KWJA 3CJQA 5ALGA 1EUQA 4HB4A 1FU7A 2G5PA 1GTSA 2F62A 4ALJA 5T4HA 1Q21A 2H3HA 5LA6F 2ZYDA 4U7HA 1R5JA 3JZFA 2EJVA 1U1DA 3KJHA 1J09A 5IBRA 4KPEC 4O25A 1LPMA 2R45A 1Z0ZA 2DG2A 2VDPB 2GPYA 4GH9A 1LFDB 3LFTA 2XLBA 1T5LA 2JAHA 3ELYA 4RJJA 3VH4A 4EHHA 3ZOZA 1GAEO 2G72A 4EPXA 5LZ5A 1BX1A 3FWHA 4QVGA 1UEIA 3BBZA 2ZJ3A 1W6UA 3PEVA 4PG4A 3EEIA 1ZI6A 5H3CA 1K4KA 1I1NA 1G5TA 2PWAA 4ARAA 4LNHA 1ZA1A 1IBKM 1XNQM 1XR3A 3D8TA 1T9GR 3OQHA 4OP2A 2P0EA 3ADDA 5FI5A 4RTMA 2CB9A 3D6JA 4O2AB 4Y9SA 3U3RA 4PM4A 2HHHM 2CVFA 2LVQD 3JATB 3L5KA 3UWOA 4MLCA 1MOSA 2ERCA 2PZLA 4HVTA 5J2TA 3R3XA 4OJNA 3V2HA 3SICE 4UNNA 4PXSA 1JALA 2VDWB 5FTNA 1IYZA 2G5GX 1K7XB 4QGBA 3S2SA 1V3UA 2IPLA 4BTVA 1XCJA 2ZW9A 4KT0F 3QMMA 4DHEA 4EGQA 1PQYA 2APJA 2G09A 2PZKA 4TVKA 4E33A 1DBPA 1TO2E 2GHRA 1U1EA 1YQTA 1GY8A 2G1JA 2HK8A 1WVMA 2EEPA 2QP4A 1GUDA 3NIDB 1JJ7A 4H6VA 4DUZB 4DR6B 5H37D 2A88A 1DTEA 2IOQA 2IYYA 3VPBA 2E1PA 1P75A 2PTGA 3GLUA 3JU3A 3DT9A 2AYXA 2ODBA 3U6PA 4LWZA 3LOUA 1VKHA 3TZBA 3CNNA 3MT7A 2OR3A 5A4KA 5AXCA 3K9LA 2CN1A 3SX0A 3LE8A 4KX5A 1FZQA 5AW0A 4WNAA 2FNAA 2IY8A 1VPTA 3KOOA 1YZKA 2QW1A 3AONB 3DEZA 4KLRA 2O8FB 2DCUA 2DWCA 1BC5A 3OEYA 2DH6A 1ESEA 1W1WA 4IOJA 3ZHZA 3AUJB 4OHUA 1Z62A 1OYOA 3WISA 5F2EA 1OKKA 3DVLA 4PN7A 2G1AA 3WIOA 1FY2A 4CXMA 1C9DB 5FWXA 5JNSA 4CG3A 4DBZA 1VP9A 2X9LA 3RU2A 1KIFA 1YR6A 1R5BA 5EWLB 3VZSA 4ARZA 1PD0A 1RW4A 5I7OA 3E27A 5LXTB 3MFQA 1XKTA 1WO8A 4B3SB 3R5JA 3G49A 1W46A 4ZVOA 1HZZA 4BE7B 1L1FA 3L29A 4S24A 4RF1A 2Q07A 1K9SA 3GJSA 4KUEA 4XVRA 5F78A 1CY7A 2QG9A 3K4QA 4BFYA 2PWBA 4YMGA 3AKZA 2PUHA 5D00A 1IEXA 1Z7EA 2CZGA 4L3VA 3ZK8A 2PUAA 2Z6VA 5TEVA 1X9GA 3Q8MA 1CT9A 3MC1A 4OXRA 4TT3A 3V46A 5FULA 4AB1A 4MW9A 1RRKA 1E1CB 1Z0FA 1ZKMA 3GVXA 5E7MA 3E46A 1O54A 3WL4A 5LQJA 4YN3A 1C9YA 3H16A 3OLZA 3OU2A 3TSOA 4D4IA 4GP6A 5FTMA 5LQCA 1L7DA 2E7ZA 1X1AA 2AG1A 2IITA 5FF9A 4GAEA 3K20A 4BVFA 1EM6A 1EYZA 1JG2A 4CCWA 1E7YA 4DR2M 2XKBA 4CI9A 2R7NA 1VHTA 2OFOA 1UPCA 3QA9A 5DV9A 3TSAA 1TTTA 3ZDDA 2VQFM 4EGFA 2NM0A 2VPYA 3MJVA 2P4SA 3KE8A 1SXHA 1F2TA 4AUKA 1KJNA 4DMRA 5BN3A 5JMPA 3T3OA 4KMMA 3CB2A 2CJFA 4M21A 2PU7A 5BYKA 1PVOA 3IQEA 1MC1A 4CT4B 721PA 3ZXSA 4CKYA 2W0SA 3OX1A 2IGTA 4PG8A 3UG7A 4HNUA 4H4CA 1GNPA 2P2DA 3ETDA 5D3QA 1ORVA 3L9XA 4DRXA 5BVGB 3GA0A 1Z0KA 4J0EA 2XY4A 4TV8A 3X2EA 4BTEA 4TS3A 3A6ZA 2VJQA 3KS4A 4DC0A 2D3TA 3KD2A 1VE5A 2QL9A 4BEJA 3CKYA 1KEEB 1VRVA 1Z4NA 3E9QA 4Q9AA 2MHCA 1JFVA 1I2ZA 1ZCBA 4Y2JA 1EQAA 1OXSC 1QXSA 2VPPA 3FYHA 2ID9A 1VPDA 2B82A 1KDOA 3WKAA 3FYDA 3HEAA 3DKPA 4KOEC 2QD5A 1E3MA 4LCJA 2VK8A 3R7AA 2EFGA 3OP4A 2RGUA 5T3YA 5AJXA 1IN4A 2FVYA 2JHPA 2SECE 3HJFA 2OP1A 4W1RA 5IKMA 1RC0A 1SVNA 3ORFA 3E9YA 3ZC3A 4ER0A 1TEVA 1UH5A 3GPCA 3H5VA 4MW1A 3E4RA 4QUEA 4DV1M 1V5IA 4LA4A 3LKZA 2II6A 4L4UA 1FZTA 3WHKA 2PFSA 4OGKA 2AIRA 3CINA 3UKJA 1BD4A 3DTTA 4DW8A 3A6JA 3SP1A 1MEOA 5KBYA 3EPHA 2YVKA 4N03A 2QWXA 3HHZA 3K70D 2A5DA 4AVYA 3ZVNA 3C48A 3T7DA 4UHCA 3KL4A 1U9CA 1N5LA 1L5LA 5SZHB 2JB9A 3FNGA 3NGLA 2Q1YA 3A3KA 4HVAA 1XAIA 4JKYA 5EMLA 1YVEI 2C2XA 3U40A 4YUAA 4R2JA 1Y9EA 1E7RA 2HQOA 1A8SA 2ZSAA 1EE8A 4GP9A 4N6OA 3Q7SA 2XA9A 4HBGA 4HWOA 1E5VA 3VX4A 3D59A 1ENZA 4WFQA 4ZDKA 3WTBA 3MGGA 2XTJA 4HQNA 1Z35A 5COQA 1JSXA 3LWZA 3RABA 2C8LA 1I01A 3DTYA 1XEWY 4W5HA 4KZKA 4NHEA 3TR0A 1QP4A 3HK2A 1NYLA 4MYRA 2XB4A 4F6LA 3DKVA 3SC2A 3HHXA 2WJ4A 1WKBA 1R0KA 2RHMA 3V2GA 2QTWB 1ECGA 1TA9A 4J16A 3PDHA 2RBGA 4LRTB 1NR5A 5CFLA 1VJTA 2DNAA 3S1AA 4W5WA 2CLKB 3OLXA 3C87A 3K70C 2ASVA 4B4DA 3ICPA 2GBCA 4NONA 1G5QA 4C6TA 2UZ3A 4IMPA 1P1FA 3IP5A 5CB0A 3HEMA 3P9XA 4F38A 1RWQA 4IKPA 3T38A 1RLTA 3OCUA 1WKCA 2PMFA 3DTVD 3LQYA 4QJBA 3F46A 4XASA 5IJZA 3HNRA 2PKEA 3M4YA 1TC1A 2EERA 5CT9A 4U7FA 3J7AC 2YWJA 1Z07A 3HSSA 2NSLA 5HKOA 2C4KA 5LBTA 4P22A 4ED9A 4FJ0A 4IJFA 2X1LA 3DAHA 1FX0B 1ZM4A 2EJTA 5JXGA 2GPAA 1FIUA 5GONB 5L45A 3GMTA 3C7CB 3QLUA 1DGHA 4HPJB 5KX5F 1SEVA 5GM1A 4QYIA 3USZA 1UK9A 2NAPA 1U9ZA 2MMCA 3A1CA 3EODA 4LS3A 1R27A 1ZPDA 3O8CA 1YBMA 2EW8A 5EJCA 2PH1A 1B0PA 3P7MA 3AM4A 1SY7A 1C7RA 2R8RA 4OMFG 4WXEA 1E3IA 3NHJA 4YMLA 3QOWA 5F21A 4BVHA 1TKCA 2VH1A 1Q0HA 3GW8A 4OBWA 4H0FA 4IWYA 4DRYA 1A5SB 1UMKA 3AFOA 2AUTA 2F9FA 1KAQA 2ZI3A 1NSYA 1XQWA 1BXKA 2V1XA 3KV3O 5ALOA 3SOZA 2PUFA 2EA0A 3DDNA 3ZGNA 1UAYA 3DMGA 4KYUA 1XELA 4EW2A 1HDRA 2RBEA 1JSLA 3GBPA 1V34A 2ZAMA 1JIIA 3LUJA 3QVKA 3IP9A 3SBXA 1X1QA 3W7BA 4P8RA 2IXDA 5C1IA 1L4YA 1YFZA 5JNWA 3C74A 3NAMA 5KPTA 4QICA 3X3HA 3CX8A 1KEZA 2ZJ7A 3K0AB 4KE9A 4Q47A 3SYTA 4BXOA 3GQ3A 1A9QA 1IAQA 3KT8A 1WABA 3OPXA 2K9DA 3GFQA 3GZTB 1FS6A 3HA3A 2HFJA 2WHRA 3EXG1 3PITA 4FFRA 1UMCB 3RYCA 1PYOA 4QOSA 4H1WA 3WSVA 1C50A 3T94A 1AQJA 2H0RA 1Y5RA 3N6RA 4RJIA 1GKIA 4NCHA 5UKDA 2LHCA 2A9PA 4JI2B 5K3AA 1PRBA 1ADYA 3LUGA 5K2OA 1ONSA 3DOFA 5KQDA 2RGXA 3ESRA 1XRNA 2PO7A 5CXSA 1PTJC 2OUKA 4CR8A 1FFXA 2RHOA 5ILGA 1QZMA 2Y9PB 1BGVA 5MGBA 3QEAZ 2RGDA 2PNJA 2R96A 3V7UA 4UULA 1G4AE 2P5TB 5AK5A 3ZNPA 1U9IC 2NXJA 3UXHA 1T26A 4JK3A 1ILWA 2C59A 2AGVA 1P5RA 1U81A 4I19A 3L6OO 1TK9A 3F2IA 4BFUA 3UA3A 4KRFA 1OJ7A 3REOA 1L8OA 1NT2A 2VF7A 2QN2A 2V6MA 2REOA 3BF7A 4RF4A 1E58A 2ZT7A 2D1FA 1NU8A 3CUVA 1CETA 2ST1A 3Q6NA 4OB8A 2QX8A 3RBVA 2R1TA 1OD6A 4FTWA 3VLFB 2HO5A 4HYEA 4EG4A 3KLMX 1CK4A 2C7GA 4D45A 1NRXA 5LP6A 3FYSA 2J3JA 3AZPA 2PUVA 5IKXA 1H22A 2PS3A 3D8RA 1Z17A 2K0BX 3QPVA 2MINB 2PA0A 4KFUA 1BCRA 3A4NA 3PENA 3AG5A 2VP9A 2AN3A 4K6CA 3INNA 2HYIC 3G0HA 3PPIA 3G9UA 1EE2A 3CRW1 1MHPA 1CUXA 4JI1B 1SUDA 2GVDC 2BSXA 2WVAA 2ZJBA 4LWOA 2A8YA 3VR5A 4IBKA 4MSUA 4CKEB 4IV0A 4J9VA 1ZG3A 1M1XB 2I78A 2RGCA 4L8FA 1GJRA 4XRRA 3E0XA 2VN8A 3FPLA 4B6OA 4IDPA 5EEGA 2UZ1B 2JIZA 2X8BA 4CNBA 3KC2A 4B6PA 5FOQA 2Q5EA 1E9DA 1T5DX 1J9ZA 1M0WA 4IHJB 2HZ7A 2BKAA 3ZK7A 4HSGA 3VSDA 5C4IA 4EL0A 2WMNB 4BPBA 3R7WA 3V1MA 2ZG6A 2PEYA 2VSQA 4B46A 5DN6D 1JKJA 1NBMA 4M99A 2VH2A 5JNRA 1LI5A 3VGJA 5MFZA 3EEOA 3JZIA 1ZRMA 8ABPA 2P1ZA 3SJCA 5KJ1A 1FFEA 3FAZA 5BSGA 1KMHA 4NBWA 2OV8A 4JASB 1CHDA 1TYZA 2PHZA 3WLEA 5I4BA 4GPD1 5REQB 2VDRB 3CN9A 2J0QA 3RWBA 1E8NA 1O95D 1WF6A 2WU8A 3GVHA 1DNPA 4MTLA 3FWZA 5AK6A 2QSYA 3PRKE 3GLKA 4QUGA 2WHXA 2YIVX 2KLHA 1TJ4A 3PLRA 2V1CA 4LGCA 2BGKA 3ZWPA 3VDNB 3KKKA 1UDCA 2ZAIA 4GM0A 4I0WB 5CM8B 2VWQA 1EFVB 3WLHA 4BLQA 3OZAA 2IPAB 1Y8CA 4J3FA 4TKLA 1ZXLA 1VBFA 4ZJZA 4YJKA 3D0RA 2ZRNA 3HHYA 3BGDA 4X8LA 2WNIA 4GKAA 5U4QA 4HAYA 3RF7A 3OQIB 2CXNA 4G1FA 4L75A 1A1VA 4BZPA 3KUCA 3DFZA 4W7IA 2QKYA 2JZ1A 2XODA 5EZYF 1V1MA 2HQBA 5LZ2A 3V8VA 4DWJA 4DV2M 1AF7A 2FSFA 2EGGA 3GYGA 3PL5A 4KIWA 4NDZA 1J8FA 4QDZA 5E4YA 2QUBA 1J4AA 2ZUFA 5AKKA 4D9MA 4EABA 1X9IA 4WCDA 4M3NA 4D4MA 1AKMA 1WU8A 4G09A 1UOEA 4GOXA 3VYRB 4ARBA 3DBLA 4IKOA 1EP3B 2OEPA 4LF7M 3WBBA 2MSLA 2XBLA 3J81S 2H29A 3QY9A 1P4HA 4ZDWA 3VHRA 4LF9B 1G2OA 5AKIA 3FA2A 3IP1A 1V2HE 2GN6A 2RH4A 2XI4A 3KZMA 4H1UA 2NTYC 5D7BA 1JPNA 5EWLA 4ARZB 4EA6A 3JQGA 4XBOA 5FPSA 3UAGA 3HZJA 3EZ2A 4L6IA 3RK4A 3W8EA 3DMFA 1PSDA 1FXWA 5GOZA 5L4NA 2OYRA 2C97A 2IQIA 1EJ6A 1JQJC 5E3JA 3SBJA 4PAGA 1TECE 1NQAO 2HJWA 3LI2A 2Q5HA 3JYQA 4ZP1A 3QPDA 4A0HA 2DHEA 5A04A 1RQ7A 2IYQA 3C1UA 4NC6A 3LT5A 4Y2QA 4BMZA 3AQIA 1UEXC 2GEKA 3TW0A 4E2WA 1O94D 3HV0A 4F3RA 5H9VA 4I3FA 821PA 4BO8A 3JASB 4YLGA 4KNYA 3H2GA 3LXXA 4L5CA 3T6KA 5K8CA 3K9OA 1H4TA 4RTJA 3JQEA 1BJKA 3KOWE 4I50F 3T3GA 1ENPA 3ZD6A 2P9GA 3GJ3A 3RTAA 4HLNA 1UC8A 3A8TA 3LUFA 3WYBA 2HREA 1ZUNB 3M5PA 5LXTF 4X91A 3ELWA 1Z0IA 4DG9A 4HFJA 2OV2A 3OT5A 5EG5A 5LA6A 4D2IA 3NH9A 3DJFA 3RYFB 3RFVA 5BQPA 4ARIA 4DSUA 1O6CA 1JG6A 1R00A 4DNXA 4YUYA 4OB6A 5F3DA 2I6GA 5SZKB 5K0LA 4L2IB 4F3YA 1V8OA 5DT2A 4PLTA 1N2CA 1P81A 5JE8A 3WGZA 1YS9A 1DGQA 2VZLA 5THKA 1A95A 3MB8A 3W8NA 4MH0R 4RNAA 2R6AA 2O25A 4GYWA 4MKIA 2HA3A 1JHDA 2ZPTX 3MIIA 2H4WA 4NU5A 5I9MA 2XH9A 3K9BA 4AJOA 4CF5A 1BXZA 4DA9A 1NVWQ 1P2FA 1TVKB 2XRMA 4ZK6A 5JJ5A 1IDN1 1PZEA 4ZOLF 3OZEA 2NP7A 1MO6A 3L82B 4DRZA 1QJ4A 1RWMA 1IN7A 3MD9A 3FETA 3ICCA 1H23A 1ORDA 1Z25A 2E4XA 2BZ0A 3FF4A 3PVZA 1NPTO 2ZUTA 5CBKA 3CYFA 4WZAA 2E4ZA 1E2UA 4MCIA 2WI8A 4C0JA 2H0AA 4QUJA 3VK8A 2PV0A 1DJNA 1M73E 3THOA 5HRCA 1F9AA 2VDVE 2ZBEA 3MJ4A 4EUKA 1PJJA 3BAZA 2SNIE 5FL3A 4RF2A 1VCHA 4YIKA 3UPUA 5C7OO 2JBAB 1WCIA 4II2A 4NMLA 3GARA 1SMKA 2DFKB 4Q7LA 5HZKA 4LZWA 2GK4A 4C0LA 1IXRC 5KNDA 1CS0A 2NQ2C 3BCRA 2O9JA 1CUUA 3JTMA 3DKRA 4ZT2A 2QSZA 3HPQA 1YZVA 4NYJR 1GZHB 2RG1A 5BN5B 3RJTA 3C14C 1RKBA 5JO9A 3ZQ6A 1PFUA 3W2TA 3ZZNA 1FS5A 2FZEA 4UBJA 2GGSA 2VJBA 3QJ5A 4EKEA 3HCWA 1HYGA 3WO1A 5DW3A 1HQCA 1Q14A 2IZ1A 3FRJA 1M6VA 5I8WA 4LYAA 4ZRDA 1KJ8A 3P0RA 2ZXEA 2AI2A 1TFRA 5FFMA 4BQSA 2B1GA 1T4DA 1JHOA 3AI7A 1G2IA 3QBVA 5JSHA 2V55B 2W2MA 3VR5D 3NWPA 1EA7A 3CXUA 3CLHA 4LTNA 3M2PA 2X42A 1A5ZA 1U0TA 2N47A 2WWTA 2HBZA 3DB1A 4G1VA 2VJOA 3USES 4DV5B 2XAAA 4R1NA 1Y80A 2VNIA 3V1TC 4DAOA 1PDOA 4WASA 4TRJA 3KKPA 3KT0A 2XE4A 2D6FA 1AGRA 3KPUA 1H94A 1P3Y1 2QQEA 1N3YA 3UOWA 1Z3CA 4AJIA 3UBMA 2KW0A 2ZYWX 4JLWA 4ZVMA 2XCLA 3WK6A 5D01A 3DKKA 4ND2A 2ZQ5A 3RRYA 4UNPA 3HDQA 4MIYA 5JVDB 3S7ZA 3RU9A 1A4UA 3WI7A 4NJOA 5AQEA 1NUHA 1SQ5A 4K26A 3PEWA 3LMKA 5CDYA 4PHFA 1HEUA 4LJ5A 3T7CA 3VDUA 5LYYA 1ZK1A 3QWIA 3VAYA 2RGGA 5GWXA 2XF8A 4DGSA 3MNFA 4CEJA 3O9MA 2ZUDA 3SHOA 3K73O 1C9JA 2CB0A 1JNXX 1U02A 3NKVA 4D9KA 5CG2A 1NN0A 1RKVA 1V33A 4DLTA 2X7JA 1U4SA 1KHHA 1QRTA 3WWZA 5JQWA 1K88A 3NANA 4ZYWA 4U7PB 2CYBA 2DKOA 5ALDA 3LLSA 4NOMA 5HWSA 4WRRA 1KI9A 2V96A 2HU8A 2XE6A 3HRKA 4OK6A 2IEGA 1JDBB 1TJ3A 1P4AA 4Q7MB 4C0AC 5A9SA 3G79A 3H4MA 3C6XA 3REQB 1Q15A 5A6SA 2JL1A 3LVVA 1R0RE 2R48A 2Q6IA 2SICE 5EKSA 1OIWA 5C35A 4LZZA 3FTFA 2JLAA 5KO2A 4Q9IA 2R00C 2BWBA 2X86A 3RVRA 3KKNA 1ZD4A 3E81A 1THZA 2C03A 3U0BA 1N2ZA 4Q9DA 1N2JA 3HR8A 4Y2VA 5TPWA 4KR7A 2B4QA 1U3UA 2ZROA 2QB5A 2HYDA 5AW5A 5H9WA 5HIIA 3UT0A 5JHHB 1BW9B 3AHGA 3K2QA 4IIGA 4DF3A 4F9TA 3SQWA 2PLFA 4C05A 2ZYIA 3I6IA 1KKLA 2ONZA 3UZUA 1C14A 2R1UA 3E3OA 4GNRA 4IOMA 4EQ6B 1SCJA 3EAFA 4XFDA 4KPUB 1QYRA 3GQBB 4UCQA 3OTOB 4TOIA 4JVOA 4S0ZA 2O1XA 3P0EA 3HWX1 4GPBA 3AHIA 2HA5A 1GCGA 2ODEA 3DO6A 1QGUB 2HMUA 4C4RA 2EL9A 4PC7A 2V0CA 4JBHA 4G97A 4Q9NA 4R9UC 1LLCA 3PBKA 4MUJA 4PAMA 5CJJA 3DBRB 3WQHA 1LBSA 7AT1A 1HYEA 4EHLA 2ORED 4GVXA 1TTEA 4H3KB 4B4WA 4OXKA 4E03A 4A0RA 3L0ZA 3PXCX 4KNVA 3QX7A 1NJGA 1CUAA 5DHPA 1BXRB 2VUHB 2O2GA 3P0HA 4KBFA 4WFJA 3IEXA 4G4SP 5CLQA 5G3ZA 1ZNZA 2IHYA 2QUZA 4I99A 2BMDA 4WA8A 5HMMA 4GD3Q 1I7PA 5FPKA 4JJ8A 2ACWA 3QVLA 3GPDG 3LC0A 4HLDA 3OIGA 5KAMA 1CJBA 4Q05A 2PRKA 1F2DA 2V6JA 3EUFA 3GJRA 3IAM1 1UWKA 1Z5NA 2BHRA 3G89A 2PSDA 4FLFA 1MORA 1XZGA 1K7CA 1OBVA 3GQVA 1PR0A 2REQB 1YO6A 2F5NA 1KSGA 3U7RA 3GQ4A 2YASA 5I7SA 5J1TB 1JEJA 1ZK2A 2CUZA 2GJAA 3IUEA 5BW6B 1V48A 5DZSA 1PFGA 1TJNA 3ITKA 1XZ8A 3N07A 3UWDA 1YVDA 3BF8A 3L8EA 4IQ4A 4X5OA 1W9MA 1SCDA 4KWHA 2OP0A 1XALA 1NU6A 4GI2A 5CIQA 3ZY5A 1FRFS 2IXFA 3GIWA 4MDEA 1U8FO 4YNBA 3IC5A 4ZU3A 1CB0A 1CUZA 3R1IA 4H7IA 3SEZA 3ZLVA 3KQQA 1KI6B 4BECA 2D2EA 3L0SA 2C88A 3GJXC 2MYNA 3HUEA 5F64A 1O6GA 1T35A 2J09A 4RK7A 3GJ6A 3IT2A 1GZ3A 1HBJA 3H0EA 2GN9A 3BSWA 1JIQA 4PSVA 3JPWA 1CRPA 2Y27A 3MUOA 3TQOA 1WRBA 3W06A 2J30A 2OO5C 3H6KA 1M2KA 3RRMA 3TNDA 3UENA 3CKMA 3FN4A 4GEWA 1KYVA 1T3SA 2XMSA 1TM5E 4HJRA 4OKNA 2AWNA 2XWJI 1A77A 1KEWA 1OTHA 4IFBA 1WPXA 3VVCA 2B83A 2RI0A 3L79A 3G2IA 5IASA 4XK8F 1C7YA 1AMOA 3W2HA 5H59A 4MQFB 4RANA 2R0IA 3AJAA 4WKBA 4I55B 4DEVA 5IVPA 4YWJA 4WA7A 1Q1NA 1XQ9A 3UW3A 1UBOS 5A5FA 3I4CA 4POOA 3PC3A 3SY8A 3WLTA 1XAHA 2DH5A 2JC3A 5C4GB 4I55A 4QWWA 2Z5VA 1BJTA 2GRAA 3ED1A 3FLEA 4LMAA 3BCHA 4U7TB 2BKLA 1XMVA 3JQ9C 2YIDA 1CZKA 4U2GA 3CJRA 4UVIA 1HYHA 3IDQA 121PA 2J3MA 4M83A 4QUAA 3S2GA 2DHCA 3BGSA 4GI3A 1CVRA 4DY6A 2RDMA 4JV5M 5ERXA 3AEUB 3CUTA