1NY6A

Crystal structure of sigm54 activator (aaa+ atpase) in the active state
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
247
structure length
247
Chain Sequence
EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator (NtrC family)
publication title Regulation of the transcriptional activator NtrC1: structural studies of the regulatory and AAA+ ATPase domains
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 66
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ny6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ny6A01
1GKYA 5K8LA 1MO3A 3SBDA 4A4DA 3AB3A 4C0KA 3B1WA 2FE4A 1KNXA 4PAQA 3BERA 1RJ9A 2Q9CA 1HTWA 2RGDA 2B92A 2OE2A 1XEXB 1JR3A 4TL8A 4D4MA 1GFIA 1ZUNB 4F92B 1E2PA 4PPGA 1SXJD 1OSNA 4AG6A 2VBCA 1OFHA 4HAWA 5DI3A 2QNRA 2IYZA 3QQ5A 4GOKA 2JLWA 1E2IA 1M7HA 1N3BA 2IF0A 3DL0A 2JCSA 3CH4B 3OIYA 4LJ9A 4V0MA 1NMZA 4LZZA 3U3KA 5L3SA 4GDFA 1XCPA 1KI3A 2GXAA 3C4JA 1HE8B 5LB4A 4AYTA 1FQKA 1MV5A 3VLFB 4CEHA 1E2DA 1GKUB 4B76A 1VYTA 3MHVC 3REGA 4D0NA 3N2EA 3VU9A 4OQFA 2B7CA 3CW2A 1R5NA 2OT3B 1SVLA 5FH9A 1DAGA 4MYUA 4B6EA 5EE3A 1CR0A 3K0CA 4A0FA 3KTAB 5FOTA 3OE7D 2ZIAA 3M6AA 1H8EA 1YRBA 2FSGA 4DDVA 4A36A 5FOXA 1SKQA 1VECA 4GPTA 4RY2A 3AKEA 4RJLA 1ZINA 2K5UA 4B33A 1JAIA 2P5TB 4LK2A 4UNRA 1GP2A 1A4RA 1IXZA 4Q9IA 3BE4A 3FMPB 1NIJA 1EESA 2OAP1 2GJSA 1AK2A 3F8TA 3MFYA 1U9IC 4HATA 1MH1A 2BBOA 2C96A 3ZVNA 4JLAA 2Z83A 3H2YA 2F55A 3I4LA 4JJZA 4S2EA 1LV7A 4PANA 4ZKEA 5FL3A 1NKTA 3W3AA 1M74A 2ORIA 4RD4A 2F9MA 1YZUA 5JHGB 1KZGB 2ZR9A 1N6NA 3HU3A 5DIFA 4LPKA 2R9VA 3QXHA 2IEYA 3GLHA 4TTRA 1F3OA 1DTSA 4JKYA 2C99A 3RDPA 1GL6A 4EJSC 5D3MA 2PH1A 1ZM7A 2A5DA 3BAFA 4R98A 2B6HA 4JT4A 3DHWC 4QFMA 3MD0A 2CNWD 4C0HA 4NYMQ 3LFUA 2RGAA 2QMHA 4TQUS 3KX2A 1EX6A 2PCLA 1SKYB 2QPOA 2DZOB 3MMPA 3QSYA 3NBFA 3IO5A 2EQBA 2X1VA 4ACBA 3CRVA 3W5JA 2ZSDA 5JJKA 2O0HA 2BJVA 2BCGY 4OI0A 2P5SA 2QTVB 3LW8A 3EC1A 4G5QA 2WMNB 3X1ZA 1Z07A 2W6JA 5CJPA 1XXHA 4IFEA 3KXKA 3HYRA 3OESA 4JLDA 4QBHA 5FUWA 1GITA 1KI4A 3KFXA 1VCMA 1YHNA 4E07A 1OH6A 3KKQA 1UFQA 3GQBA 3G5UA 1ZBDA 4M1SA 1CJKC 2W83A 4WAUA 4YDSA 3GLHE 2D06A 2MSDB 4DCTA 3K70B 5F9HA 4NL4H 1G7RA 1NY5A 1T9HA 3GEIA 1ZW6A 2FGKA 2XOKA 4PSKA 1BOFA 1DOAA 2CEAA 1FTNA 2CHQA 2CL7X 3GJ7A 3KXLA 4RSGA 2NMVA 3KJIA 2DHRA 1Q57A 2NO1A 1TU4A 4I1SA 2Q0HA 1KK0A 3OZXA 3LDAA 2VP5A 3A1UA 4KFTA 2QBYA 3WYFA 4DLRA 3C41J 4DUGD 2J0SA 4HLDA 1CRPA 4PPQA 4LV8B 3QF4A 2QENA 3RC8A 1KKLA 3EARA 4QHSA 3K53A 4NCIA 1GDDA 4XVRA 3AF0A 3SJZA 2VP0A 1YR6A 1ZCAA 3SOPA 3IILA 3THXA 2QMOA 5HTKA 4O2RA 4Q7LA 3T12A 2WWGA 2FWRA 3DM9B 1NN3A 2J7PA 2FX3A 3UMSA 1AJEA 2WJIA 4B71A 1OXVA 1R10A 3K09A 3RS2A 1CULC 1OXSC 1N0WA 4NYJQ 4RD2A 2WJHA 1SXJB 1Q20A 4Q4HA 1QZMA 2X77A 2BBTA 4BRUA 5G40A 1QG4A 4Q01A 4HUQA 5J4KA 2O52A 1KY2A 1AGRA 2ZU6A 1IBRA 1V5WA 1ZM3A 1BS1A 3UG6A 2GVZC 4XIGS 4CEJA 4DIDA 4KXFB 3B1XA 2CMKA 4KHZA 4ZCMA 4P33A 1DG1G 4EUNA 3EZ7A 3AKDA 2J45A 4Q1BA 4L16A 1C4OA 4TSFD 2FGJA 4N3NA 2O8DB 5JECA 2TMKA 1VG9B 1W36C 3DVLA 1PZNA 1KO8A 1QHSA 1YJ5A 3B82A 3K9HA 4PHFA 1X37A 1I2DA 2IX3A 4HDOB 4K46A 3EPHA 3WNBA 3WP1B 3SS8A 4A8JB 3AVUA 3QKSB 2CE2X 1C1KA 5JWHA 2VP9A 1E0JA 3DMDA 1CR4A 3T15A 3OIWA 5FTNA 1KSHA 1MO4A 1XPRA 2RB4A 1SZPA 3A4LA 1VG1A 4HI0E 1KAOA 5JEEA 3U7FB 3VNUA 4M21A 2GDJA 1ZCBA 4YMWA 2OEPA 1XTJA 4FWDA 3W34A 1OW3B 1G8HA 4AKHA 3AJIB 4H9GA 4WOPA 4F93B 5EUMA 1D2EA 3R7WB 4NYJR 4AKGA 3DEFA 5B58C 4CT5A 2ANBA 1ZD9A 4PR0A 1DO0A 4LV5B 3WYGA 1E94E 2IT1A 1Z6GA 5LDDC 3RRYA 2HLDA 3THYB 4TQ9A 2JJ2A 1KK3A 4HB3A 3TKLA 4BZPA 2WJYA 2G1JA 2YV5A 5GJVC 2BMJA 2RGCA 2W2VA 2O5VA 4FCTA 4FWGA 2ZE5A 2VSXA 2JLSA 2WJGA 2DVWB 4KAXA 1E99A 3KQUA 3FKSD 3QY0A 5EZ6B 2ZJAA 3U6BA 5B57C 4PZZA 2J5XA 4KODA 1NLZA 2QMEA 2OM2A 5AUPB 2XEXA 4EDHA 1DAKA 3QENA 4IOJA 4DB4A 4BPBA 2F43A 4C7OB 4BRWA 1K8RA 2G88A 4GNKA 2ASEA 2BVNA 2FSHA 2RGXA 4BZQA 1E2NA 3EA5A 1M1YE 4NCNA 3MAAC 5FBQB 1LF5A 1U0JA 4DCSA 3OEEA 1KAGA 1J2JA 1JJ7A 2IYYA 5F3WB 1E2EA 5J4HA 3VR6A 4B47A 4D25A 1JBKA 1KI6B 5DH9A 4NBSA 3NIBA 1E2KA 3OFND 1G16A 3V4FA 2CLSA 4JLNA 4QRHA 2YYZA 2ZI4A 3EZFA 4IDQA 4XD7D 1W2HA 4N0DA 5CM9C 2VHUA 2W2TA 5AJYA 2HXYA 4GRAA 1XTIA 3TE6A 5LPNA 1QVRA 3K0CC 1Q1EA 3QKUA 1KDRA 2FFQA 4DLZA 2CJWA 4W5JA 2XNDA 5D3QA 2G1KA 3EAQA 3B9PA 2J3EA 5TXGA 4ZIRB 2RHMA 4OJQA 3GP8A 3U5ZB 3SDZA 2OAQ1 2DPXA 4FCWA 4E09A 2W0MA 4MRSA 4V02A 1ODFA 1TL7C 3KXIA 4WXPA 3QUSA 5EZ5A 3SJCA 1TUIA 1JB1A 1G64A 3OEHA 3KW6A 3KUCA 3LO5A 3JZAA 3IUYA 4AYXA 2GJAA 4AD8A 4QGGA 4C0BA 4ZDJA 4TQAA 2KWIA 3BGWA 2IYRA 1E79A 2W2XA 3ZVLA 2XXAB 3RRNA 2ZUCA 3AF4A 4LX0A 2LWIA 3WRYC 1GL7A 3R8CA 1QBKC 2AWNA 2W6IA 5H1YA 2ZRAA 3FE2A 2A3RA 3LBHA 2OSBA 3TH5A 2VA8A 5FOSA 3OIVA 2ZE7A 4B34A 1HEIA 1OXXK 3UKDA 2LCFA 3NH9A 2VYFA 3L82B 5EQTA 4DXAA 2AXNA 1R2QA 1VIAA 5L8VA 1G4UR 3THWA 1Q3TA 4LV6A 2N42A 3SQXA 4KSBA 2C9OA 1LS6A 5GJCA 2QA5A 3GFTA 4U00A 2OZEA 2XZOA 1E2QA 2XSZD 3ZDQA 3UXMA 2YOHA 3CB4A 4FWTA 2HF9A 2QY9A 4OHWA 1XWIA 2QP4A 3CH5A 5FOUA 3BK7A 3ZZUA 1D8TA 2OBMA 4CDGA 4P4UA 2LKCA 1HV8A 3A4NA 1Q22A 4NKRA 621PA 3AF1A 1NVVQ 1ZAKA 4Q1DA 3REFA 5IF9A 2QT1A 3V00A 4L9SA 4RFVA 1XTKA 2WSMA 1PV4A 2O8EA 121PA 2ZRMA 5KDOA 1VCOA 3BB3A 4JLJA 1IXRC 1T8UA 4B3CA 1KKMA 5AJZA 4DEXA 4NYIQ 4NZYA 2ERYA 1RRFA 4LYAA 1Z6YA 3U2QA 3HWSA 3BH0A 2VTKA 3HR8A 1OB2A 1E9BA 1UM8A 4GOXA 2OCYC 5FL7A 5E95A 1RRPA 3K9LA 4M9XA 3D6TB 5J4YA 1F48A 1Q12A 3AUXA 4B3DA 3SQWA 3EXAA 2FA9A 3KKPA 1W47A 2FOLA 1CTQA 3RS5A 1Q3HA 1CKEA 1XJ0A 1M8PA 4NPHA 4TMKA 1RIFA 2VPPA 1II8B 2YKGA 1HQYE 1XZPA 2R44A 3I3SR 4OJKA 4DLXA 1S2MA 4ZO4A 4CEIA 5DN6A 5KTYA 4IDNA 3K09C 3SYKA 3LNCA 2YC2C 4LI0A 3QOFA 1KMQA 3EPLA 1XCGB 3FPAA 3B60A 2R2AA 4TN1A 2GNOA 3KKNA 1NG9A 1E4VA 3P27A 1OPXA 1ZUIA 1DPFA 2KB0A 3CNOA 1KY3A 1M2OB 1NVVR 3CZQA 3JZMA 4K81B 5JMTA 4BFZA 3QG5A 1FP6A 2D7CA 3NXSA 4OKSA 5AUQA 5CDFE 2AKAB 1CR1A 1Y63A 3GD7A 3NHBA 4LCBA 2J0UA 2CCGA 4IDOA 3TQFA 5AUNB 3A8TA 3PIRA 4FXPA 4DDTA 2VQSA 4NYIR 4HAXA 3QJYA 1BIFA 1Z06A 3LH5A 4B32A 1SQ5A 2P0EA 1MT0A 4PC1A 4RCZA 3GLIA 1YU9A 1U81A 1XFAA 2G0TA 4EFNA 4YMVA 4W5WA 3TJZA 3WYAA 1JXMA 3AF3A 4FN5A 3KB2A 2ZUBA 3EPKA 2C04A 3QBTA 2ZJZA 3I5XA 1HY3A 3GJ8A 1T8TA 4GI7A 3WBJA 4Q03A 2IYXA 3AVWA 1G3MA 1KMHB 1VCIA 2GCOB 4MITA 3TGPA 3WMEA 1UBEA 2F1HA 2WWIA 2OESA 3RWMB 1KZ7B 3NG1A 2YWHA 4DLVA 4UJ3A 2HV8A 3ZS8A 4ZI2A 2DWPA 4LGMA 1Z3IX 4JIMA 3EIQA 4IOKA 5K8IA 1E9EA 3ADKA 2PLFA 4L5BA 1FX0A 1M7BA 3S1AB 2N46A 5KSPA 4MRVA 5KDLA 5HPYB 4HLUA 3SNHA 2FN4A 2ODBA 2ZR0A 1NN5A 5KU1A 1S3SA 4AWXA 4Q1CA 4DDUA 1AKYA 1XCMA 3QKTA 3WP0A 3MGCA 2GHIA 3RRZA 2QUZA 1ELOA 1Z29A 3UPUA 2ZE8A 1XEXA 3CF6R 2JJ8A 2VHJA 2A30A 4FMBB 4Q7KA 5DNYB 3LBIA 1ZNZA 5K8TA 1UKEA 4M22A 4V0KA 1NN1A 4NDZA 1YVDA 3QG1A 5CIQA 4PO1A 1W7AA 1US8A 4PQFA 5FUYA 4UNNA 3GJ6A 3C16C 3RLFA 1CRQA 1JJVA 1VHLA 2OUKA 3DKVA 4HLCA 3SHFA 3X1WA 2GF9A 2EFHB 2ZR7A 3L8ZA 4QL3A 4O3MA 3K0AB 1XD2A 4LYHA 4US2R 2NO0A 1EX7A 3LVQE 1FUUA 3RWOA 5BXQC 3U44A 1X1RA 3KZ1E 1DADA 4M9QA 1YR7A 2DFNA 4LC0A 4IEEA 1G7SA 1F2UB 1TF5A 4LYJA 1VIYA 1NJFA 2ZRCA 4R71A 1DVRA 3E70C 4M1KA 2OCPA 2PJZA 1SGWA 2FV8A 1P4SA 2CXXA 3R9XA 4OBEA 4CIDA 6Q21A 5KNBA 4LUCA 1MO5A 4LY6A 1VHTA 2F9LA 2RGGA 2G77B 3MSXA 1CXZA 4DSUA 1W36D 4BECA 2QQEA 5TB5A 3CPEA 3ZQJA 4LHZA 1P60A 4Q4AB 4OK6A 5J5CA 3QF7A 3VR4A 5J47A 4C0JA 1OLOA 5FTLA 1E1QA 3FTQA 1I4DD 1G291 3BRWD 2BJWA 1KSGA 1IHUA 2JDID 4I1OA 5KO2A 2C5LA 3Q7PA 4HB0A 2FDCA 2ZJOA 1CJTC 2H16A 1G6OA 1H8HA 3ZZ0A 4M8NE 2F1IA 3GLFB 4WA7A 5TY0A 1R0YA 2BIFA 2YWGA 4JYCA 3LBNA 1A2KC 2BKEA 4LBVA 4TLCA 2V7QA 1TADA 3BBPA 1Z0DA 4ZCLA 1IJEA 4IEIA 3NBYC 2ZRLA 4AYWA 4ASUA 2RGBA 4IRUB 3FHOA 1OB5A 4BFUA 3ADCA 4WVFA 3VR3A 1HT1E 4MUBA 3TAHA 2BKUA 4B48A 5C4GB 5JSZB 4TT3A 5ANRB 2QT0A 1N6IA 2E87A 3B78A 4C0LA 4EQ6B 1N5IA 3BXZA 2ECKA 3ND9A 3LW7A 1T3HA 3Q3JB 3C5HA 1UJ2A 1KHTA 2Q9BA 2BEJA 3EW9A 3IBYA 5DLQC 5LD2C 4O25A 1MR3F 1NBMA 1UKYA 4P4SA 4X8MA 5HKKD 3MWJA 4ZPXA 1S96A 1TQ2A 1L4YA 2P65A 4OQXA 1LB1B 5G3YA 3SI7A 3O8CA 3PG5A 2GESA 2V6ZM 2QZ4A 1Y3AA 5JI2E 3WNCA 1IN8A 1IY2A 2J0QA 1PUJA 3RS7A 3VAAA 2ZRGA 4Q7MB 4URUR 1E4YA 1A1VA 4AIIA 1VG8A 3W90A 1EFRD 1W5TA 3Q72A 3AP2A 4W7SA 1P72A 4UKDA 1T4GA 1W1WA 3U3JA 4A92A 4B73A 4ON9A 4RD6A 4C9BA 3TK1A 1FL9A 2ZJ2A 2DFKB 1IOZA 2IYSA 3B5JA 3L0OA 4NCHA 2J7KA 2WPDD 4YMSA 5CITA 3FGNA 1SVMA 1CR2A 1BYUA 1PJRA 1XEFA 5TVKA 1SKYE 4TMWA 421PA 1HE1C 3D7MA 3NH6A 1E9DA 4M53A 4M1WA 4QBIA 1NBME 3KUDA 5CK4A 5A4JA 1YZTA 2QEQA 1W48A 3DDCA 3VR5A 4PAOA 1EXMA 3VKHA 2QG6A 3BIFA 4UJ5A 5KSZA 1X8KA 1ZU4A 2ZSAA 4I81A 2V1UA 3U7HB 3PEWA 1R5BA 4QNMA 2ZYTX 1G3UA 4MYTA 3SFZA 5EUQB 4LJ6A 1E2LA 4F91B 4HDCA 2XZPA 1KDPA 2F1JA 3CLVA 5KHOC 4HUTA 4IVPA 4LPSA 3U3MA 2RCNA 3W6NA 1G3RA 2W0SA 1QHGA 3MRSA 1KK1A 1NP6A 3WMGA 4QOSA 1R5OA 1XEWY 3UK6A 2BC9A 3PUXA 1G8YA 1AS3A 1B0UA 1KI2A 2JEOA 1S0UA 1E0KA 1SVIA 1PLJA 2JLXA 1F2TB 2V8OA 4TLDA 3RHFA 3B9QA 1BH2A 1SULA 3QE0A 3TUZC 1CS4C 3BH6A 3Q85A 1RVDA 1DAIA 2FJUA 2B21A 5DGXA 4FW9A 4LBYA 1OH5A 4GMXA 3DM5A 2O8BB 1VKJA 2NPIA 4D4JA 2ZS9A 4Q9LA 4EPYA 4W9MC 2Z0MA 3IBGA 2GEVA 1K5GA 2IYWA 4D81A 1W0KD 2IXGA 1E9FA 3LAWA 1GZSA 3ZD7A 4OQMA 1SXJE 1W36B 1FTSA 4B74A 2QSYA 1ZD1A 2DFLA 3HDTA 3F0TA 4Q9HA 3SC3A 2ZS8A 2GBLA 4TYNA 2W6JD 3SJBA 3I1FA 5FOVA 1NVXQ 4EIWA 3K0FB 2G9NA 1LY1A 3R7WA 2V55B 3KDSE 1ESMA 1MABA 2VP6A 2CCKA 4TMVA 3L0IB 2GAOA 4D2IA 1PUIA 2IYQA 2NG1A 3WHKA 2ZRFA 4BLTA 4ZV4A 4HLUC 2ZPTX 4IDHA 3SJAA 2BV3A 3EZ6A 1WCV1 4JS0A 1F6BA 4HAZA 5EE5B 4A0HA 3LX5A 3C7KA 1WBBA 4Q4LA 3QPVA 3CX8A 4P32A 2FFBA 2W58A 2FMXA 3T1TA 2P3SA 1NVUQ 2HYIC 4DRZA 3K0SA 4A15A 3LVRE 2ZSEA 3QXXA 4Q48A 3GFOA 4IHQA 5EJEA 3KKOA 3MJRA 2CNWA 5BQ5A 3TUIC 2QU8A 4TMTA 2IHYA 2XB4A 4AG5A 1TQ4A 4MKFA 2AR7A 3J81k 4NCJA 1RJ9B 3EIHA 5FTJA 1Q1BA 1E96A 2AXPA 4AI6A 1R7RA 4LHWA 4CT4B 3GJ3A 4XVUA 2J7PD 4M1YA 1L4UA 2JJ1D 1TTTA 5HCNA 5DYGA 4BWYA 3M1IA 3W3ZB 3L0SA 2FPMA 4JBWA 1UAAA 4AURA 1TQ6A 1S9DA 4BFVA 1WP9A 4NYMR 3ZIAD 3QI2A 3OF5A 3OAAD 2ZSBA 3CRRA 4BEBA 1M7GA 3EG5A 5J4VA 4EKDA 1ZVQA 3ZJYA 1QF9A 5DYIA 2D3WA 4WBSA 3C15C 5EP1A 3A4MA 3U7EB 4DBLC 3PUYA 2J9RA 2JLQA 4I1VA 4ZIRA 4DUGA 1T6NA 1G5PA 2OFWA 2ZJBA 1FFHA 2AKYA 1YZNA 3HP1A 4F4CA 2NZJA 4MGYR 1XPUA 2H18A 1OHHD 5JI3E 4ESHA 3WRXC 2IEZA 2QORA 1E0SA 4QJ5A 2KBEA 2ZI3A 3SU8A 1RRCA 3PFIA 2WWWA 1P2SA 1W46A 1XBTA 2B8TA 4YMUA 4RZ2A 4D26A 3MWKA 1OIVA 4QKQA 2XXAA 3MUFA 5L3RA 4Q4JA 1E9CA 1XNJA 3AVXA 3DKPA 1P5ZB 3DZ8A 2MMGA 1R0WA 2CLDX 2HJGA 4JL6A 4Q1FA 1I4TD 2REXB 3I92A 2A5JA 4FIDA 2ZRBA 2AK3A 5JFGA 3KQKA 3DOFA 2QN6A 4NCKA 2ONJA 5CIWA 2Y8EA 4A82A 3P1JA 4C0QC 3UMRA 5JRZA 4KITB 1SVSA 1W4RA 2NGRA 4DLWA 2H7VA 1TPZA 4MDEA 3MWLA 2BDTA 2G6BA 3RVBA 2R62A 1U98A 2IK8A 1IN5A 2RHDA 4TSFA 2FPLA 4Q1EA 2HLDD 2EYUA 2I3BA 1OFUX 1DAFA 1U94A 2I1VB 2WAXA 1G17A 3KQHA 5FBRB 4MDFA 3JVVA 3P20A 4WZAE 4G3XA 4B44A 1EFCA 1TMKA 3IIJA 4JVMA 5EXTA 3ZVMA 1XU4A 2GCPA 2HJVA 5CYOA 2AFIE 1UDXA 3CBQA 4QGFA 3GLGE 2GXQA 5SZIA 4ZI3A 4L15A 1OF1A 2NPFA 3QEJA 5FBVB 1IJFA 3VQTA 4P3YA 5HE9A 1GUAA 1N5JA 1RKBA 5FPHA 1IY0A 1K6MA 2IYTA 1KO4A 3U3OA 3TBKA 2IC5A 4YXWD 3K70C 2GXSA 1OH8A 4BLOA 1T0JB 2QPAA 4C3ZA 5DSZA 4DCVA 3X1XA 2O8CB 3ZLJA 3OEED 4G5GA 3QVVA 3UATA 721PA 1G18A 3SR0A 4Z54A 4MRRA 3MLEA 1Z63A 1B23P 3AGPA 1XDBA 5E7IA 2XJ9A 3R20A 5JS8A 4F4IA 2FU5C 4JSYA 1BMFD 3MWYW 3W8RA 2ZEJA 3PEVA 2WM9B 4UQOA 1BO6A 3GCGA 1I4LD 1Q1QA 4BLQA 4I99A 1GTVA 4D4KA 1ZNXA 4XJXA 3LXXA 4R7ZA 5B64A 2ONKA 2QTHA 2CHGA 4LOAA 4URXR 1WRBA 3FKSA 3GMTA 2QBYB 2GEUA 4IJMA 3EPJA 2JLYA 2QP9X 4GP6A 2ZU0C 1G3IA 1LFDB 3I72A 4LRWA 2ZRPA 8OHMA 4O0MA 1Z08A 3M4YA 1COWD 1D6JA 3EZ2A 1H65A 4MRNA 2R8RA 4D4LA 2WZQA 1ZYUA 3NC0C 3P32A 1P7CA 4Q1AA 4R2IA 1NVWQ 3QKRB 2WJVA 2J1LA 3T34A 4LJ5A 1R4AA 4Q47A 3A1TA 4OHVA 5A5GA 3AVOA 1P61B 1WF3A 4QJ3A 2H5EA 4Q4HB 4MA4A 1GIAA 2GWHA 4E5UA 1W4AA 2AX4A 1KO5A 3OFNA 3GLGB 3TUJC 4V0OA 4M9SA 3ZZTA 1KI1A 4XTRA 1JI0A 4BGDA 4Z51A 2IS4A 4EPTA 2LKDA 2DWZB 5IHPA 1VTKA 4CZ2A 1UBFA 3IGFA 5IT5A 1G5TA 4Z1MA 1DG3A 5M04A 2G3YA 4EPXA 4CYMA 2D7DA 1FP7A 2IA5A 1IXSB 1RC8A 5L3QB 4AKIA 1JQLB 2UKDA 2EVWX 4PQYA 2BMDA 3U60B 1U0LA 2IYVA 4CW7A 1ZNYA 4LYFA 4ZDWA 2DWOA 3FOZA 2W00A 3NWJA 4HYYA 3QBVA 3TLXA 1U8ZA 3ICEA 2GBLC 1W5SA 3EA0A 4MGIR 4RKFA 1VDZA 4JL8A 4QG7A 3BC1A 4JLVA 1P9WA 1P9RA 4HAYA 3TSOA 4CRWB 5IK2D 4Q66C 3RAPR 4JLBA 3T35A 1CF4A 3BB4A 2IF2A 2ZUDA 4RD3A 2HT1A 4B35A 1IONA 4U02A 4DDWA 1UPTA 3CX7A 5JWRA 1VG0B 2CDNA 2VH5R 1DELA 2ZRDA 2V9PA 2ODWA 1G8PA 1JALA 5A0FA 1QHNA 1XTRA 2Q3HA 2ZJYA 3CRW1 4PC7A 4PHGA 4GL2A 2REBA 1U99A 2BBWA 5FL7D 2JA1A 4IKEA 4G1UC 2P6UA 5EXXA 2V4ZA 2ZYUX 5EE0A 1W0JA 2XTMA 4TTPA 4L9WA 4RCYA 4EPVA 2AD5A 1TEVA 1Z0AA 5CDFA 5C2JB 2YVUA 2FH5B 1ZC3A 2PEYA 4U7DA 4V0NA 2AK2A 2OCAA 1U8AA 1YKSA 3SFVA 1KJYA 2VP2A 2O8FB 5CJ2A 3I73A 3O8RA 3ADBA 4ZDKA 1KGDA 2CHVA 3VHLB 3ZH9B 2A5FA 2J59A 2Z43A 3K0AA 3NVAA 4TMXA 3X1YA 1GNRA 5P21A 4JN6A 1ZIOA 2RKOA 2XITA 5KNCA 4M4SA 3DOEA 5B2ZA 1DS6A 1JAHA 1II9A 2GF0A 4UXIA 1GRNA 1FPMA 1OKKD 4JVLA 1UBCA 1Z6TA 3EWSA 1JEDA 3RS4A 2F43B 4BASA 1TF2A 1XMJA 5C4MA 4HZUB 1DBSA 2I1QA 4ZKDA 3U4QA 3RABA 1CJUC 1G7TA 1L7VC 1TU3A 2EYQA 4KVAA 1OIXA 1E98A 3FMOB 2WKPA 5TMPA 4KLZA 3C5CA 5HR5A 3U3RA 4BQSA 4WZ6A 4JT2A 2XB2A 2WVJA 5CB8A 2FZLA 1N25A 4FMDF 3ETLA 1S4QA 1P75A 3A58B 2ZRNA 3JVUA 3Q5EA 4DLUA 4ARZB 5FTMA 4GITA 4FWIB 1E6CA 2X8AA 4KU4A 1S1MA 2AN9A 1U90A 1W4CA 4PC2A 1FNMA 3GLFA 2EFDB 3GJ5A 4M1TA 2QGNA 1U9IA 2QAGA 2QL6A 1KI8A 2WJJA 5EE1A 2B7BA 2VF8A 3E5HA 2ZI6A 1NL3A 2ZI5A 1QHHA 2IWHA 4TYPA 4PO9A 5DO9A 1ZIPA 3PQCA 1KK2A 3ZS9A 4LHYA 4DEYA 1SVWA 4JBYA 4KI0A 3UWOA 2H92A 1NLFA 2Z5FA 5JSZA 1W2GA 3A6PC 1U0HC 5AWFC 4EQ6A 1YRAA 221PA 1E2GA 2NOAA 2CLCX 3VR2A 1V43A 1Z47A 1GVNB 2VRWA 4Q5IA 4A6PA 4F38A 1UADA 1J90A 1L2TA 5EXSA 1ONBA 5EP2A 2RGNA 2FF7A 2ZI7A 5C46F 3W6OA 2ZS7A 4JKIA 2YZ2A 4KLNA 2AD1A 4DCNA 4JVSB 4TL6A 3IQXA 1XTSA 2N1BA 3EWAA 2MSCB 2VO1A 2OV2A 3BD9A 1E9RA 1QHYA 1LS1A 1T3LA 4ILEA 4WW0A 4MKGA 2F3RA 3I61A 4OHYA 4B2LA 1E2MA 1YQTA 1FNNA 2CCJA 4TLEA 3VMFA 3GLFE 1AS0A 4PC3A 4DSTA 2R6AA 3A1VA 5SZJA 1AKEA 1PLKA 1KJZA 1XZQA 4KBGA 5LD2B 4TYYA 4Q21A 3AVTA 1VMAA 1VYUA 1XPOA 2ERXA 3AVPA 4TL7A 5KPDA 5L3VA 2ZRKA 4M0LA 5LB2A 1IN6A 4DLTA 4PZYA 3B7GA 1R0ZA 2CL6X 2OFXA 2GZHA 1IN4A 2GTPA 3DPUA 5KYKA 4V03A 1OV4A 2ORWA 1EFHA 2JGNA 2IBMA 3A1SA 2O8EB 2FNAA 2L0XA 1TQDA 2XJ4A 3OHMA 1Z6XA 2CK3D 4A9AA 2PMKA 3AEZA 2XTNA 4NH0A 2IXFA 1UKVY 1CP2A 1E2JA 1G8FA 4UXJA 5CK5A 4QJ4A 2IUSA 4A6XA 3ZVRA 2Z6VA 2QP3A 4RFSB 5JHHB 3FMFA 2A7QA 4TL9A 1KNQA 3QXSA 3LV8A 1M34E 3EX7C 3O8DA 5AK0A 2QE7D 3KTAA 2FFHA 5H8WA 5HE8A 3AM1A 3L0PA 4TZ6A 3GEEA 2WSSD 1T5LA 2J0VA 1GNPA 4FI3C 4RZXA 521PA 4ITRC 3VKWA 1BYIA 4YC7A 5E7MA 3T5DA 4LJAA 1QDEA 2YJTD 4EFMA 1E1RD 4II7A 4P0TA 5KPJA 3OIUA 3AH8A 1LW7A 2WWXA 3C14C 4LJ4A 3VHXA 4IW3B 3R8FA 1T91A 2GK6A 2V1XA 4BEJA 5BW8A 1Z2CA 2MMCA 3FHTA 3E1SA 2ZTSA 3K0EA 1ESNA 4MGKR 3T1VA 1M6NA 2QRNA 2ZRJA 2YHSA 4ASUD 1FUKA 1F2TA 4NTZA 1RZ3A 1F5NA 2IUUA 3W5IA 4JLPA 3ZQ6A 4C0AC 1FW6A 1KO1A 2O8BA 1ZJ6A 4A2PA 2HUPA 3IIKA 4YMTA 2OG2A 2ZVQX 2Q21A 1QRAA 1X86B 2UZ3A 3CWQA 3PEUA 3AP1A 4Q18A 3WBKA 1WMSA 4KYUA 1N6KA 1SHZA 5FPYA 2F6RA 3VX4A 4B2PA 4BFYA 1ZM4A 3T5GA 3E2IA 4OHXA 1GAJA 3MG9A 5FI0B 4H1VA 2OBNA 3AF2A 1P73A 3CONA 4MYHA 3QVUA 3QPWA 1KDOA 3AUYA 2JDIA 5HZKA 1ZD8A 4PAMA 3K0FA 3NEYA 2R6DA 2RH5A 1TF7A 2WOJA 3PENA 4EJSB 2F7SA 2JIZA 2QTFA 1HH4A 4JJKA 1JR3D 1Z28A 3BJIC 2XTZA 1HT2E 2RAPA 1II0A 1VCNA 4FMDB 3LY5A 4BFWA 2FG5A 3H4MA 4GSYA 3RRMA 2P2LA 2BMFA 4OK5A 4OL0A 2ODNA 3FWYA 1CIPA 1HUQA 4B3GA 1G21E 3I62A 2VSOA 1JR6A 5G41A 2EW1A 4DC9A 3EIEA 2V3CC 2PBRA 1NF3A 4BLSA 2GEDA 2C95A 1P6XA 2ZYWX 1JECA 4DHEA 2JATA 4H1UA 5HCIA 1KSFX 3QXCA 3WHLA 5TDHA 3AVYA 3PVSA 2NO9A 2QSZA 3ONWA 3Q7QA 4QBGB 5HKKA 3KQNA 2RMKA 1QVAA 2IYLD 2D74A 2NO7A 3VFDA 2Q3FA 1KO7A 3X2SA 1GRRA 5J4LA 1E3MA 1KI9A 3BFVA 1SHKA 2H17A 4KFSA 5FR2A 2ZQ5A 2WWHA 1P2TA 2FSIA 1H8ED 2REOA 5GVSA 4BLRA 1IY1A 5ELXA 4JBXA 3UANA 2VF7A 4DLYA 1US8B 1OH7A 4UNPA 5FBWB 3H84A 1Q21A 3VX3A 2P67A 5GVRA 5F98A 1EFUA 2XGJA 4LRTA 1EFRA 4LBZA 1JPJA 1SXJA 3UWKA 3B2EA 1HA3A 4C2TA 1XD2B 1R0XA 4GFDA 4RVCA 3BOSA 2ZAMA 3FFAA 4JL5A 1W44A 5AUOB 2IS6A 1Q1ZA 3U44B 1KDTA 1OFIA 3D8BA 1I2MA 3IDQA 1DAEA 4PC6A 2WPDA 3TVTA 4A3VB 3EASA 4Q9JA 2XAUA 3MCAA 4POAA 1YZLA 4KO8A 2ZJ8A 3TR5A 4AC9A 1D2MA 3EC2A 2OHFA 3CO5A 1O87A 2V54A 1OYYA 1P3JA 2G83A 1G1MA 1TAGA 1J70A 2O8DA 3FB4A 2VHQA 3LWNA 4IXNA 4R2HA 1FMJA 3R9WA 3LA6A 1XD9A 3G0HA 3NEJA 1JR3E 2V6JA 4TLAA 1AIPA 2ATVA 3V9PA 4B43A 4QM6A 3FKQA 1N5KA 1RRGA 4A8JA 4KYIB 2Q3MA 3OE7A 4D0GA 4NE2A 3IKJA 3QKSA 1E2FA 2RGEA 4PPNA 4F7WA 2BM0A 4FWHA 3UG7A 2QAGC 2IHBA 3ASYA 3PXGA 4KV9A 1LVGA 3HU2A 2WBLC 4V0ME 2IS2A 2EFEB 4LDJA 4IOLA 3CZPA 1NY6A 2EU8A 3N5CA 2UZIR 3CNLA 2P6NA 2JLVA 4M9ZA 2QROA 2R6GA 5DE3A 4G5RA 3V4RA 1AS2A 2GA8A 3IO3A 3PITA 3LD9A 5E7JA 1G5RA 3HPRA 2GRJA 5BYJA 3LLMA 4LBWA 3ECCA 1G9XA 4WXRA 5TARA 3GJ4A 4HB2A 2IYUA 1FMLA 5KUTA 1AZSC 2WIBA 4A2QA 2ZANA 2RGNC 3FYHA 2IWRA 2JAQA 1TNDA 2ZVPX 1U8YA 1EGAA 2D4HA 1GKIA 3BWDD 2XOKD 3THYA 5AJWA 3CUEF 5K8UA 4DT1B 4OI1A 5BN3A 4Y0AA 3L43A 2ZSFA 1GWNA 2IXEA 3A36A 2P6RA 3FVQA 2NZ8A 1P9NA 1W0KA 3VR1A 1WDTA 1JPNA 1ZMXA 3BORA 3O8BA 2PMDA 1XX6A 4QBFA 2ZREA 3TR0A 2ZM5A 2Z4RA 4G0NA 3TIFA 4P4SB 3AKCA 2Q6TA 2XNSA 2F1RA 2GK7A 2FSFA 2O8CA 2QM7A 4FCVA 2IW3A 1QHXA 4XWAA 2A2ZA 2BM1A 4C7OA 4DCUA 1NLYA 5F9FA 1A2BA 1KJWA 1XTQA 2GAAA 2BHRA 4UNSA 5SZKB 3I32A 4Q02A 5JLJA 2FFAA 3BH7A 1PVOA 2D2FA 1S9HA 1KI6A 4DB2A 2WTUA 2UVQA 1X6VA 5DI3B 2CVFA 3LXRA 2DWQA 4DZZA 3I5YA 2BOVA 1RE0A 1UF9A 5JWOA 5EP3A 4TTQA 2F3TA 1FZQA 3I8SA 3NDPA 3SN6A 4BZXA 3T61A 1DEKA 5L3SB 1HYQA 4HDQB 5FTKA 1Z0KA 4XSGA 2WWYA 2QI9C 3W6PA 2R65A 5JCPA 4DJTA 3LLUA 1NRJB 2PX0A 2OCBA 1Q44A 3CM0A 2DFTA 3IIMA 3WNDA 4CEHB 1E9SA 1EWRA 1ZM2A 2ZE6A 3K9NA 3VU9B 3K1JA 1N6OA 1NNEA 1Z0IA 2ZROA 3QKRA 2GXUA 1ZUHA 1G7CA 4DLSA 3TMKA 1XXHE 2JJ1A 4QGHA 5FPSA 4DVGA 1XB2A 2HYDA 2AWOA 3PUVA 4N1AA 1XEWX 3U7GA 1FOEB 2IL1A 3GLGA 4B75A 4EAQA 2Z4SA 1XJCA 3M0EA 3ZIAA 4URVR 3OAAA 1JEEA 1G19A 1IN7A 5FBLB 1AN0A 3CR8A 1LNZA 4Q9KA 2YWEA 1KIMA 1KYIA 1NSFA 3L2OB 3SBEA 2PX3A 4C0SA 3VNVA 4LWZA 4GMDA 3CKLA 3BFKA 1G20E 1PLLA 5JZVA 5UKDA 4KFUA 2IUTA 2KSQA 1E2HA 2AL7A 2XX3A 5EE9A 2C77A 2YC4C 1CLUA 1YE8A 5G53C 2QAJA 2WIAA 2OFOA 5L3QA 3GJ0A 3AP3A 4ABYA 5SZHB 1WA5A 3H1TA 3SE0A 1IAQA 1OXUA 1YZQA 1OHHA 3Q5DA 1A5TA 4FINA 2DCUA 1DE0A 3GLHB 4G01B 1VPLA 4TZ0A 2CE7A 2JJ2D 2EFGA 1XP8A 4E03A 1UKZA 4BE7B 3C8UA 3NC1C 4QM7A 2QQ0A 4NP6A 1E32A 5D3MB 5GADl 1NIPA 1D5CA 4IOMA 5LBIA 5E3HA 1T5IA 3LRPA 3QNUA 5FUXA 4DIEA 1EFTA 2ATXA 3GJXC 4BFSA 4JLKA 3IPYA 1FQJA 3B1YA 1EWQA 2J46A 2HEIA 5H70A 1DAHA 2JLUA 2E1RA 2O0KA 4A0RA 1MABB 3QPUA 5KNDA 2YNMA 1YZKA 2ZRHA 2BCJQ 2OBLA 2CVHA 2A5YB 2C78A 5CM8B 4HZIA 2KRKA 5KOYA 4BUJA 1L8QA 4I1UA 3THOA 1XXHB 4BLPA 1KSJA 3D31A 1A7JA 4PXAA 3TAUA 4IFBA 1D2NA 4PFSA 2QM8A 2PT5A 5C1BA 2O8FA 4GZLA 3IHLA 1OFTA 3NTUA 1U2RA 3D3QA 2DR3A 2HF8A 4UXHA 1S3GA 1N6PA 3ZD6A 3IQWA 1AA9A 4OI4A 1NVMA 1LTQA 1C1YA 4TYWA 1II8A 1OT3A 2XNDD 1E69A 4R9UC 3B85A 2XZLA 4NMMA 2OLJA 3ND8A 1T0HB 5J40A 2BBSA 5BN4A 4XVQA 4YXWA 1BKDR 3QF4B 3F3YA 4HZUA 1SVKA 3RC3A 1SXJC 4FD2A 1A82A 4D80A 3CNNA 4W5HA 3X1DA 2ZJ5A 3OEHD 1J8MF 2ZRIA 4EPWA 2J87A 4TLBA 3THXB 4JSTA 1Z2AA 3UIEA 1S1CA 4BFXA 4GBMA 1Z5ZA 4B3FX 4OQLA 1E79D 2FEMA 2C2HA 4CVNA 1BMFA 1GL9B 1P2UA 1X3SA 2C9YA 1ZC4A 4MUAA 4AY2A 2ODEA 2CBZA 2C8VA 5JBQA 2ZI9A 4LHVA 2VL7A 4ZDIA 2W6ID 4NU0A 4LRSA 2A9KA 4LHXA 4PQRA 4ARZA 4KFRA 4CF7A 4YDHB 3P4YA 4HUQB 5G3ZA 4XD7A 4Z1MD 4QHYA 4MRPA 3FDIA 1NG1A 3SYLA 3DO6A 4CEJB 3KJHA 2VIIA 3CF2A 2NTYC 4A8JC 3GPLA 4D82A 4XSHA 2DBYA 1Z0FA 2WHXA 4DWJA 1COWA 1CEEA 1KMHA 2GCOA 2R6FA 4JLOA 1GM5A 1RYFA 1MRNA 4V0LA 3AQ4A 4JZKA 1W4BA 4PZLA 3CF0A 1ZM9A 2A78A 1C9KA 2IS1A 4PHTA 3HPQA 3RS3A 2X2FA 1KTVA 1Z83A 4Q4JB 4URZR 4PPFA 3SHWA 5BWMA 2FPKA 2BMEA 1XMSA 2VHCA 1NMYA 1RYHA 1YR9A 3K9GA 3TRFA 2DB3A 4QHTA 4OI2A 1CJMA 1X8LA 4PSAA 3TSZA 1KI7A 5AR1A 3S1AA 3DZDA 1J8YF 3B1VA 3B6EA 4C30A 3CPJB 1R8SA 2ZXUA 2DZNB 2WICA 1Z22A 4OQNA 3GEHA 3T1QA 1UBGA 1W0JD 4ERNA 5HZHA 3A37A 4J0QA 4UNQA 4X8OA 3TQCA 2C03A 2GILA 3NHAA 4MKHA 4QGAA 3TNFA 1AQUA 4OYHA 3H0KA 4PHHA 1MRSA 1NSTA 1Z6AA 2WV9A 3T06B 1AQYA 3PV0A 3RANA 4CGZA 2H57A 3NBZC 4KBFA 2XSZA 3KB1A 4D6PA 3O47A 2VEDA 1WBDA 2D62A 4B3XA 1Z8FA 4M2LA 4A0GA 2EWVA 1GG2A 5IK2A 1OE0A 4QC2A 3QEOA 2PZGA 1EK0A 5BN5A 4MQBA 4IDPA 3NDBB 3PUWA 4GP7A 2NO6A 2QMUA 1ZNWA 2V6IA 4MGZR 5DN6D 1E0AA 1CJVC 2SHKA 1KOFA 2QPTA 4B3BA 2HCJB 4K8OA 1N0VC 2JLZA 821PA 3WXMA 4RFSA 2GCNA 1F2UA 2GETA 2YWFA 1D9XA 2EWWA 2G0NA 2OXRA 5FPTA 3CR7A 4BFTA 4E22A 2YOGA 4KVGA 1IQPA 3PR1A 3P26A 3BFXA 4HAUA 5IDVA 4TWZA 5FFMA 1O3YA 5CB6A 1OXTA 1WE2A 4HSEA 1NJGA 1NMXA 4IVQA 4XH9B 1ZRHA 5CLLA 3VKGA 2B8WA 4G5OA 3ZGXA 5KDDA 1AM4D 4FMCF 1G41A 4EFLA 4KCGA 4KJZA 3R9IA 3PEYA 1OYWA 3KJGA 3SYNA 1TEXA 3B8HA 4URWR 4Q4AA 4URYR 1K5DA 5FUVA 3DMNA 2OXCA 4QNRA 5GJBA 4TMZA 5KSYA 2CL0X 4Z8YA 2DYKA 2BWJA 2NIPA 1S8FA 1JNYA 2ANCA 2CJWB 2Q9AA 4JYBA 3W9YA 1WQ1R 1OKKA 3AVQA 4X8LA 4M1OA 1N6RA 1GRQA 2QRZA 5DISB 1X8JA 2GJ8A 5DHFA 5H68A 2C98A 1G4AE 3HU1A 2PZFA 3TW8B 2PEZA 1N5LA 1X1SA 3B1ZA 4L8GA 1G6HA 3FFBA 3PJRA 3P4XA 2HCBA 2HDNB 2OLKA 3LX8A 3TSWA 1UDWA 4Q00A 3VTKA 5CYPA 5FR1A 2PCJA 2WKQA 1GILA 2HXSA 1WB9A 2AFHE 3BB1A 3PCRB 4Q19A 3W8NA 5JEDA 2A5GA 2R6CA 1J99A 1R8QA 2E9SA 1TUEA 3FHCB 4HEJA 1E9AA 2WWFA 2QGZA 4HB4A 4D0LB 4RKEA 1EG7A 2ORVA 3F5FA 5JJLA 1ETUA 4AKEA 3U61B 4Y0VA 2VP4A 2WMOB 2ZAOA 2ZITA 1N6HA 4S35A 1D9ZA 1Z0JA 4XOIA 2GJ9A 4A2WA 4EJSA 4L4UA 3B13B 4OHZA 1QHIA 1IM2A 1XMIA 4PO8A 1QG2A 5EXPA 4C4PA 3THWB 2VHTA 2PJRA 4RZ3A 3CX6A 2ZYVX 2PLRA 1CU1A 1MOZA 1HQCA 1NKSA 1SVOA 4N0EA 4DSOA 5BYKA 1R6BX 5F2EA 4I4LA 3CWZA 4OK3A 4LC1A 4P4TA 4TYQA 3MJHA 3N2IA 3IEVA 4M1MA 1GOTA 2HT6A 1ZP6A 3U6KA 2DY1A 4WIAA 3L8YA 2KI5A 4NHOA 1RPZA 2WKRA 1NI3A 5AJXA 2YOFA 4NONA 4PSVA 4US0R 2VLIA 4LJYA 4Z8XA 1N0UA 1QZXA 3TW4A 3Q8XB 5AJVB 5FOWA 3GLIE 1MKYA 4US1R 3I8XA 3HYTA 1CBUA 1XJQA 2JLRA 2NQ2C 1DARA 2MSEB 4C2UA 4KSCA 1TX4B 1JQJC 3UMFA 3WMFA 4MKIA 3KFVA 4AK9A 2GVDC 2BEKA 1ZU5A 5JS7A 1DAMA 3A1WA 3T1OA 3LQRA 3QIAA 2GJKA 3TVDA 1W49A 1P62B 2EFCB 5DHAA 1G8GA 4RZUA 3IHWA 3NKVA 1ANKA 3AKYA 4RD1A 4LJ7A 1F60A 3Q9LA 3RSLA 2AHOA 3ADDA 4ESVA 1WXQA 4RD0A 3FMIA 1E1QD 2GZAA 3N70A 4HAVA 3RSOA 4XWKA 4JVNA 5FI1B 5FPKA 3CRQA 3G82C 1LF0A 4GZMA 1DO2A 3RYTC 1XF9A 1H8HD 4HLQB 3KKMA 4JMPA 4PTLA 1UEIA 2CK3A 3AGQA 4JLMA 5IRCD 2J41A 1AZTA 1JXOA 1OIWA 2H1LA 3HR7A 4CEIB 1XRJA 4F4JA 3H86A 3U4QB 4YONB 2V7QD 3AVVA 4B6FA 2WAYA 4B2IA 4IVRA 3WY9A 4GT1A 2GZDA 4ACAA 2KE5A 4LSGA 2D2EA 5CLQA 5JRJA 1NN0A 5E4FA 1T3SA 4MH0R 4DSNA 1G3QA 5JCZA 2X2EA 2QE7A 3EZ9A 4IXMA 4DKXA 3AV0B 5JJIA 3SEAA 4X8HA 5C18A 1Q0UA 4LJ8A 1RFLA 2WSSA 4TT3D 4A1FA 2J0UB 1MO6A 2WOOA 2YINC 3CIOA 1N6LA 1XD8A 5DI9A 2O0JA 3IPXA 2PZEA 1UEJA 4XTCS 3QXJA 1VYVA 3RNLA 1E1RA 4P31A 3GLIB 1NBMD 2FZ4A 3NBXX 1GSIA 4U5XA 2JIZD 3CPHA 4MYCA 2PT7A 4GOJA 4WZBE 2X19A 1XMVA 4YQFA 1P2VA 3BS4A 4QXAA 2OILA 4Q7JB 2I4IA 2KBFA 5GJWC 1OJLA 5EP4A 2QAGB 4FMCB 4PX9A 3SZRA 3HJNA 2VSFA 1QHHB 3KL4A 2C9CA 4ZCIA 3PUZA 3LQQA 5KSOA 2ZETA 4YLGA 2FEOA 3K70D 3ZYCA 1YZGA 2KJQA 1YR8A 3KJEA 4DT1A 1RW4A 1J7KA 4O2LA 3RS0A 3ICQB 1GNQA 1HURA 1N2CE 3GFPA 3IEUA 4XWOA 2GKSA 3ASZA 2H8KA 2JASA 3KQLA 1FX0B 4EPRA 5TV2A 2OO7A 1AGPA 3K8YA 5B30A 3CRMA 4G5SA 2PL3A
chains in the Genus database with same CATH superfamily
1KIFA 1HNXM 2KNVA 2DNAA 1KNXA 3BERA 5LQSA 2CWWA 4XB1A 1A5BB 1KPHA 4JK3A 1P5JA 1XTTA 2QNRA 3QQ5A 2JFUA 2ZPAA 2Y4NA 1VKZA 2XRFA 2G36A 2PVCA 3L29A 3H17A 3OZEA 2R97A 4ROSA 5BT9A 4D0SA 1N4AA 3NJ8A 3BWBA 1EH5A 1VECA 3BG5A 2J5BA 5KJ6A 5P8WA 4DV5B 3IX7A 4FNOA 1PD1A 2C96A 3WQBA 3RIYA 1SIOA 3ZVNA 2F8MA 1P0PA 3BUSA 3H7AA 5H4HA 1N9GB 4GMHA 1N6NA 2ST1A 4WLUA 2IH4A 2C99A 1GL6A 3RYFB 2HQ1A 1UAGA 2HBQA 1FRNA 2DPHA 4LGVA 3WJ7A 4O4JB 1JX6A 9ATCA 4TTIA 1DLJA 4N4AA 1AO3A 4L74A 1ZBDA 1GD1O 3GLHE 2O5RA 4I1RA 1ZW6A 3RGGA 1B1AA 5I01A 2Q0HA 4S2UA 3NWLA 4XVRA 3UMSA 4B71A 1R10A 4LRTB 4Q4HA 1W25A 1ORVA 5EWLA 1L7RA 4I8XA 1M67A 4RDHA 5J4KA 3EYWA 1IBRA 2EX0A 1BS1A 3AJ8A 1YLAA 1GZUA 5LR6A 1OQYA 1SELA 4Q1BA 1PKXA 2FGJA 4KBYA 3QU7A 1T8PA 1BDJA 4NABA 4A8JB 3AYXB 3ID6C 1CUXA 1T8SA 2FWJA 1WMAA 2CXOA 1KAOA 4Q15A 3ZY2A 4R0MA 1XTJA 1Z4IA 5DX0A 2PANA 4D9JA 4JY7A 2V6GA 2LZ0A 1R37A 4DYDA 4HJRA 3MCZA 2H1HA 2FEAA 1FP4B 2CLOB 1PFYA 2HLDA 1X7DA 2WJYA 5BN3B 5BORA 4FWGA 1OI3A 2ZJAA 3PWTA 4LMRA 4IF4A 4ND1A 2UYGA 2P27A 2V7UA 1JEOA 2F43A 3KZCA 1V71A 2LDBA 1M1YE 5DYWA 2C97A 4OTZA 3OEEA 2H4WA 5DH9A 3UH0A 4FUTA 1MTZA 1XDWA 4P36A 3TX2A 4HF7A 3K4QA 4MVYA 2B1IA 4DUYM 4MVCA 2Z5VA 2H5LA 4I6JA 5TXGA 4LN1A 3SDZA 3G2IA 3S7TA 5K3SA 3MRVA 4UMVA 3IUYA 3V8VA 4DUPA 2AFIB 2YV3A 4JI0M 2KWIA 1ZGJA 2MJLA 5DBFA 3RT7A 3W77A 2ZE7A 1OXXK 5D2CA 4DCOA 1I2CA 2CBXA 3DQZA 2IXTA 4U7GA 3KBBA 4D42A 3AEXA 2HF9A 1DXYA 3KRTA 3GPBA 3M6UA 1Z9BA 3HXOA 3BZWA 4B6JA 4GX2A 3IKVA 1KEEB 1Z6YA 3HWSA 4DFDA 4O2AB 1NW8A 4EHHA 3OQHA 2AT1A 4MYDA 3JQGB 3GZ4A 3ZJUA 2V7WA 4CM4A 1IQUA 4ZOLF 1UOOA 5ALGA 1C9NA 3K09C 1SXPA 1D7OA 4TN1A 3V4ZA 3KKNA 1E4VA 4CGYB 2ADFA 4NOOB 2ZUFA 3KSDO 4BP3A 4BFZA 5AUQA 3EPPA 2QZZA 2CW5A 4LCBA 5U9CA 3QJYA 2IELA 1SQ5A 1H69A 5BN1A 4OYLA 1YU9A 1SKBA 3WO0A 1TZKA 2BTQA 2WF9A 1U7ZA 5F7ZA 5D7BA 5DLDA 3EPKA 5K9ZA 3ZY5A 1R8XA 4AMBA 1VE9A 4LE0A 2HTEA 5GINE 3CKKA 4FYWA 4X97A 5CNJA 4DLVA 5IS2A 2ZG6A 3HVHA 4BXOB 4PAWA 1A8PA 5DCWA 2C1XA 1P7PA 2M6SA 1DDGA 5I7FA 1T4MA 4RDIA 5HZGA 5LMUB 2ZE8A 4G24A 5DHRA 1ZNZA 2QUAA 4M22A 2R6ZA 3MCVA 4FFRA 3WKAA 3RLFA 4NBUA 2ZYIA 2JY6B 1ZI9A 4F9FA 4Z4CA 3KQMA 1XN4A 5KEIA 2XMCA 3QV1A 5CXXA 1KETA 5A6VA 4YAEA 4IH4A 4RSHA 4Y6RA 5TX7A 4I2VA 3ZLUA 1H6CA 3D4BA 4EEZA 1J9EA 2XYGA 2R6R1 1I4DD 5F2OA 5KO2A 4LYYA 1UFOA 3FM9A 2FDCA 1CJTC 4C4OA 4M8NE 3IVGA 4LBVA 4JROA 1OB5A 3H5NA 3MMZA 5H83A 2EX1A 1S2IA 4B48A 1FJHA 4HPXB 4KQ1A 2QT0A 1SQ0A 1ZK3A 2HAKA 2PTGA 2VP3A 1BXGB 4XGNA 5KZMB 1AKUA 4X8MA 3FYCA 4NEHB 1FIUA 4UTVA 1ZK0A 4IMRA 3X1KA 3CXUA 2HWUA 1MAUA 4OQEA 3L93A 4KDRA 2V6ZM 2AW3A 2PO5A 1Y3AA 4KPFC 3K1AB 4HSGA 2P6OA 1FL9A 4ZAXA 1QVZA 2AVDA 2FP4B 5K2MA 1CR2A 4LXIA 2HV9A 2W22A 3D7MA 1YZTA 4DG5A 2QG6A 3M7GA 5J59A 4M83A 4WUVA 2VCHA 4AF7A 6ABPA 4BYGA 4X6XA 4MB2A 1PJJA 3GLUA 3V8BA 1MJFA 1NJ8A 5DASA 1AS3A 4AP5A 4MQ5A 1XRMA 5FBKA 4CODB 5AHWA 1L5RA 2Z0MA 2IYWA 1FYXA 2VZEA 1BW9A 4MS3A 1PKEA 4Q16A 2W6QA 2FTKE 3LXUX 3Q2IA 1USVA 5AVWA 1K9SA 1LV8A 1ESMA 2CCKA 3ZQ4A 1JQBA 3IEIA 1L3CA 1USIA 4NE9A 2ZSEA 2IU3A 1SM4A 4RVOA 1Y82A 4JMLA 1SCQA 1OV6A 4TV8A 1VQ1A 2E7ZA 3HI4A 1SK8A 1VMKA 2VPQA 3QOWA 3HADA 1PGNA 1AU9A 4NYMR 3QE3A 1E1LA 2RHWA 1RAHA 2HU5A 5CFPA 2OV8A 1VE3A 4JA0A 4TSKA 3HC7A 4DBLC 5IJZA 3GH1A 2NU6B 3LX6A 3G1TA 1JFFB 1MX3A 3PFIA 5K0NA 1I9GA 4IDGA 3ORFA 2C92A 4BV9A 3HSSA 3KQKA 4OGWA 3UT5A 1KC3A 1SVSA 5KNDD 1NBOA 1F9AA 2AX3A 4PCLA 1QQ7A 2G6BA 4DR3B 1CUUA 2GPTA 1GJTA 5CH5A 3IODA 2WWVD 2I66A 3OQOA 4JVMA 4IWXA 4F1JA 1V92A 3J80A 1MX5A 1SUDA 1C9MA 4WVLA 1ZN7A 5M3BA 4QE3A 5E7IA 1X7XB 5K0LA 2WJAA 1Q1QA 3LT4A 3AJAA 2DUMA 3ZDZB 1MDFA 3AR2A 3ROTA 1JSRA 1PK7A 3WL3A 4FHDA 4ER5A 1MHPA 2WG2A 4AJIA 1Z08A 4PAGA 5I7RA 5DHQA 4V3BA 1WGNA 2WJVA 3T34A 4HNVA 3ON5A 4E5UA 2OD2A 2LKDA 4ZVRA 2HIAA 5C8YA 5KINB 2PX4A 1UJMA 5L3QB 4YWHA 3R7BA 3V8QA 4BBJA 5TMDA 2W00A 3RKUA 3EA0A 2I3AA 5LXTF 4BQPA 1LXCA 4P3XA 5JH7F 1RLTA 5ITQA 4RD3A 3BDVA 2VAWA 1QHNA 4PC7A 2REBA 1ISPA 1W30A 5T64A 2MJ5B 4RCYA 2OAEA 1TTHA 2FH5B 4X45A 2GHRA 4BVAA 2OC9A 1MAWA 3ESBA 4JQOA 3QX8A 2A5FA 4JN6A 1LEHA 1JYSA 1DCMA 2A0XA 1O95D 2WQZA 3TL2A 1KVUA 3JAKB 5KPZA 3R77A 2BEVB 5C4MA 4AQDA 4ZKDA 4JUCA 1W9HA 1UPAA 4S1NA 4FYJA 3OQIB 4CLXA 5ITSA 4IR7A 4WZ6A 3FMGA 4JT2A 3DF9A 2WVJA 1ZMRA 3OZWA 4PC2A 3QWAA 2QAGA 4JJIA 4EO4A 3G8AA 1LZLA 1YDGA 4DIMA 4PO9A 1XCJA 2X8BA 3BVPA 1O5OA 1Y8QB 2KMLA 3I2GA 3ZS9A 4LHYA 3BFPA 2OQIA 5CBKA 1JDBB 5CCXA 1MJGA 3FDJA 5BSGA 1TQHA 4L0QA 4HWSA 1EP1B 3D54D 2VO1A 1LS1A 4ILEA 2BGTA 4PG6A 4FWBA 3LG2A 3DNFA 1NUPA 4DCMA 3GFVA 1DJOA 3UMBA 4R9SA 4QUDA 3A6GA 3AVPA 4K6FA 1PW7A 5FWAA 4BEWA 4BBPA 1G5FA 1TRHA 4KR6A 3OHMA 4YAUA 1VKNA 4YRDA 1T5OA 5ITUA 5ADVA 4C4SA 1H3FA 1U3FA 4FI3C 1VL0A 2OCIA 4EH1A 3HBLA 1TU0A 3GUZA 2H7XA 5CVDA 2G0AA 3HGMA 2BEWA 5A5EA 1ZWKA 3KCQA 4MR7B 1FFXA 4AIRA 2QRNA 3ROFA 2P3OA 3THGA 1NQAO 2JCVA 3K1TA 3ZLBA 4KKXB 1ZJ6A 1HZZC 2C5SA 3UOWA 1XI2A 4B2PA 4BFYA 4ZJUA 1PFUA 3GUUA 3ZNNA 4J2OA 4C76A 3H3JA 4Z0HO 2HHJA 5ELLA 2P2LA 3DL2A 3AILA 2ODNA 1XVIA 3UMGA 2FN8A 3KYDA 5IDYA 2Y1GA 2EW1A 3LBFA 2QLTA 2YXPX 3HMKA 3SIRA 4F06A 2EO2A 5C8DA 1T2VA 5EMLA 1WMEA 4ANRA 3EB9A 1GUBA 3EQZA 5EEHA 5AT1A 4C06A 2WWHA 4QLAA 4X6LA 5ELXA 4Q93A 3AR9A 2OMKA 4UNPA 3PK0A 4NV0A 4MWOA 1VL1A 1EFUA 3ZCRA 1FUIA 1XD2B 3HYNA 3PC7A 1R9JA 2Z95A 2CKMA 1T34A 4BCCA 4ZXFA 4NV1A 4MR9A 1TAGA 4IXNA 5ALEA 3G0HA 3NEJA 3T7JA 1IJKA 4B43A 3KT0A 4U3JB 4GDMA 3QVTA 1F5SA 2EX4A 1WUIS 3BF7A 4LKRA 5CXQA 4C7XA 2GA8A 2KA6B 4E2ZA 2LDXA 5IKMA 4FGUA 2JLAA 4QICA 5BPFA 4PZEA 2DWUA 5K8UA 1TH4A 4CM5A 2ZSFA 4ZXPA 3RK4A 5AI9A 4B7AA 4HKTA 3FIJA 2PMDA 2IP4A 1R2YA 3KLOA 3CO0S 2FSFA 4WN9A 1JWBB 4DR2B 3COSA 2PX2A 3MT7A 3FPLA 4PFQA 4ZT3A 1NJ6A 2XIJA 4I3FA 1WOMA 1FQWA 1MJNA 1CUYA 8AT1A 5K1ZA 5L53A 5EP3A 1DTEA 4L07A 5JD5A 3T61A 4A16A 1XTVA 2AI2A 3ESCA 4G09A 3IVXA 2Y92A 3ONVA 2GPJA 3S2YA 1M6EX 3QKRA 3G2LA 3E48A 4DWVA 3M3HA 2PS1A 3OAAA 3H5AA 2C5RA 2IIVA 2YWEA 1Q1NA 1NDUA 1KYIA 4C0SA 3EDQA 2AF4C 5JZVA 1KYTA 1WXWA 2W2PA 3O3MB 2A1TR 3P2KA 2NSLA 2R7LA 3O92A 4WTOA 2DCUA 1GPYA 3C3WA 4EZIA 3NC1C 4P9NA 1RLUA 5EHQA 3JARA 1HYGA 4GSKA 1KMMA 4BY9E 3O4GA 3WDLA 3EC7A 1KZ4A 3CV3A 1K63A 1QYDA 1L8LA 2QM8A 3ZG6A 1K7XB 1R0SA 2C5AA 1K2VN 1A7KA 1N6PA 2W2OA 1PGOA 4KO3S 4HDSB 4Y1RA 2XNDD 4EM6A 4ZYYA 3E4DA 1QLJA 2XA9A 3ZU6A 5JJCA 4FD2A 1A82A 4W5HA 5KQLA 5AVOA 4OIMA 3M89A 2GBPA 1BMFA 1ABEA 1P2UA 2OZPA 1ZC4A 4HQNA 4K9PA 2ODEA 2H4HA 3U4GA 3BIXA 2B1JA 5J2UA 2J4DA 1EUDB 1M1UA 3GT4A 4ARZA 1TO2E 3ZHSA 4XD7A 4ETIA 1X1QA 4IMIB 2NTYC 4C01A 4EABA 1U3TA 1YMVA 1G8MA 5AVQA 1BN6A 1W4BA 1Y6FA 4KRXA 2F5QA 5EEGA 5A4AA 5C0OE 2QLMA 1XTBA 2WIDA 3TRFA 1YR9A 3O38A 3EJWA 2OCGA 3W2TA 3AX6A 3DDHA 5KNCH 1GQSA 1GZDA 1I2ZA 4NESA 4YALA 1DGQA 2XUIA 3PHIA 3KEQA 5BQOA 3PD7A 1YE3A 1O94D 4AUEA 3G5MA 1ZNWA 3STXA 1Z5CA 2QPTA 2H2FA 4GXTA 1G4HA 1Y7LA 3N76A 3ZR4B 5IDVA 3JWPA 4TWZA 2ZXEA 3HHWA 1VIDA 5CLFA 3GYBA 2AFRA 4OHMA 3AWIA 1JZQA 4CKCB 3R9IA 1MZPA 4JI3B 4DV7B 1G59A 2XQJA 4YCNA 2WG1A 1C80A 1NYTA 2D2XA 2RGHA 4M1OA 1NW6A 1GRQA 3T3OA 2C98A 2HDNB 1UDWA 4Q00A 2J9FB 1B42A 3ZWVA 3WSVA 5JEDA 1KEUA 1EXVA 2XYHA 5I45A 3U61B 2QKYA 3QMVA 2ZAOA 4HR7A 1G98A 4RCVA 2VHTA 1SBZA 1JWAB 4B3TB 3CWZA 3N2IA 2IYAA 3OTIA 1E3LA 2C7OA 1P8AA 3S2EA 3GLIE 1LRJA 4BUZA 4ONEA 3E9QA 2GJKA 1TC2A 3VV2A 2OGUA 1Y8ZA 1VBFA 3PE4A 1LCIA 1WD5A 2P3QA 1T5TA 5HFJA 4N3BA 2P30A 4QPZA 1VI6A 1U7UA 1DU4A 1G6Q1 3BWVA 3GO8A 3SLGA 2GZDA 4XPIA 5JRJA 2IDMA 1NN0A 4O4JF 3CLRD 4A7PA 1TGYA 3K9QO 3JV7A 2Q1TA 3LYAA 4WZBE 3SZRA 3ZBUA 4YJ3B 1K3XA 2VSFA 5JY6A 1YI1A 2ZETA 4A27A 3K70D 2ID9A 3Q88A 1YR8A 1ZA2A 4Z4FA 3B52X 4UTNA 1TFUA 2GKSA 1MFPA 3DTYA 4N5MA 1EVZA 1G66A 4XIYA 1WXDA 4LS3A 5KYNA 3ZWCA 1HTWA 3C6BA 1IDOA 3P9YA 4MQEA 4BNFA 1SXJD 2YHIB 4HAWA 1NOIA 2IYZA 4R2MA 4O0LA 3CH4B 4G1VA 2PQ2A 3ETNA 4HNRA 1XCLA 1MV5A 1GKUB 2Z2KA 2FPPB 4NDNE 1O6ZA 4XWYA 2QX9A 1FTWA 4LVNA 1ID8A 4EGAA 5EFZA 2J07A 4GPBA 1AC5A 4MVJM 1ZVVA 3BE4A 1AK2A 4J16C 4L76A 2X4IA 3T3DA 1OAAA 3GAZA 4GLOA 3FI0A 3O9ZA 3DTVA 2Z8XA 2OOBA 3K7EA 1DCFA 1U3VA 4IJUA 5EA2A 2QUHA 1ZK1A 4JKYA 3FYTA 2VJPA 2IXAA 4D5EA 3T5MA 3UY4A 1C30A 4R98A 2YXLA 3G9UA 1JS1X 3GV0A 2D1QA 3ZHRA 4EI9A 3FYDA 4UOZA 3E3NA 3AZPA 5AK3A 3CRVA 4OI0A 3HDHA 3R5HA 2RGYA 3GQ4A 2Y27A 4AZWA 4DW8A 1SFRA 3HDYA 1OH6A 2DWCA 2IQ5A 3IQFA 4WAUA 1WPXA 1BOFA 3A9RA 2K7ZA 5C5DA 4NE7A 5G0UA 4IGEA 4LWQA 3SJZA 2OWDA 2CLIB 1ZR4A 2BFFA 1CQIB 3F67A 2WWGA 5KTKA 1NN3A 3GJTA 2ZJ7A 3VZQA 3IHKA 2WJHA 4I5EA 2GWRA 4IIEA 4KX3A 4OGFA 4XXHA 1VL6A 3UC9A 4DY4A 3HXMA 2NTNA 4TSFD 1CX9B 4CM3A 2IX3A 4QULA 1RTTA 4O2AF 4HCJA 2CMHA 3IQEA 3N2NA 2VQFM 2VWHA 3I2IA 2Z5GA 3UKOA 3U6SA 3WQSB 3DEFA 5B58C 3SZLA 1GG8A 2ACVA 3OZIA 4OLJA 5JISA 1KFJB 2NUAB 2VDNB 1VPTA 4WXMA 4LG1A 1EVKA 4MP6A 3QK7A 2PSDA 4OXQA 1DAKA 2B9VA 4GNKA 2QJRA 3M1YA 3LPLA 4H6PA 3IVMA 3O90A 3OFND 1G16A 5GZ3A 2WP8J 4W5JA 3AESA 4QWMA 3M5DA 2ZYGA 3GDHA 3G8YA 1KXJA 4DMUB 5EZ5A 1JB1A 3KW6A 1TH2A 3KUCA 1AHNA 4GNRA 3DKRA 1LDEA 1JKJB 4C0BA 5AI0A 1M6VB 1IOLA 5A03A 1R16A 1SUFA 4IQFA 1KEWA 1A1SA 3RM3A 2ZWIA 2VXBA 4TMFA 3INGA 3HEBA 4R40A 4C4ZA 3URKA 5FKJA 4KV7A 3DHYA 3V4PB 4TPKA 1HKHA 4FWTA 3JQBC 3LCUA 4DCCA 1UM9A 3TTTA 3F47A 3AJDA 1HV8A 4Q1DA 1TI7A 2AG6A 2O8EA 1RWNA 1DOHA 4ZCTA 3RIGA 1A8IA 1RRFA 5DEIA 1XQWA 2WEKA 1R27A 2GLXA 4FFWA 1Q17A 2HGZA 3D6FA 1TEZA 1KU6A 2PL1A 2PKQP 3CUSA 1P1CA 2VUIB 1NG9A 4B3HA 1EJBA 1M2KA 4HGZA 5F21A 2J0UA 1ND5A 2I4RA 2VQSA 2MINB 5ERGB 3QQPA 1B6RA 4XDYA 2VJKA 2V74B 3L8FA 4Q3LA 4FHZA 4N49A 1VOTA 2ZUBA 2G25A 4GI7A 3QELB 4J3NA 4IIJB 1CPYA 3U16A 4K86A 2FPSA 2FRVA 3O4RA 3IOMA 5AW4A 4KB5A 1GZ3A 4KIUA 1QFYA 4LSZA 4X62B 3E4RA 3UB2A 2E5LM 3HUEA 4HH1A 4DDUA 3QKTA 2QUZA 3PFFA 4NJEA 4CU5A 2R1VA 2ZTHA 4MCJA 1GGEA 3NJRA 4HLCA 4D1YA 4G0YA 3N7AA 2GBIA 1WCIA 4EL0A 4IEEA 3HNPA 1B2LA 4FJ0A 3LCMA 4JB2A 2CXXA 3ER9A 5TMBA 2H59A 2B9EA 1CUSA 3ZQJA 4Q4AB 1TYCA 4FKZA 3WRXA 1RP1A 3U6MA 5JE8A 2O14A 2J31A 4M0WA 3ZPXA 4BJ5A 3DLHA 3JQFA 1A2KC 4CPDA 4XOUA 2ZRLA 3EVEA 2C7BA 4BFUA 4UDYX 4JI6M 2YY6A 2JIBA 2APLA 5AKKA 1KHTA 1NQWA 2I6GA 1M8JA 1DEHA 4ZPXA 4OQXA 2A58A 1C3OA 3NHUA 2O01F 4AJOA 1L1EA 2WZCA 4KMRA 3TS1A 2MYTA 4ER7A 3HYSA 3AFNA 1ZO8A 2X9LA 3L0OA 3B5JA 1FP2A 3IV7A 421PA 4OAOA 1SC1A 2NACA 5A6SA 3HCCA 1X8KA 4FZRA 1EFPB 4E70A 3LY9A 3LCCA 3EOBI 3PEWA 1BE6A 5AIAA 4L72A 4CT0A 1DX4A 3LKDA 2PZKA 4NBNA 3W6NA 1NONA 1G3RA 2BI7A 3PUXA 2H54A 1Z59A 1JQDA 3WRVA 4W63A 3RHFA 5IX8A 3C8ZA 5TS2A 1SEPA 4C03A 5DGXA 4KIJA 4CIZA 3CN7A 2HCRA 3G59A 1VKJA 3IBGA 3LAWA 3SKVA 3CF4G 4BMCA 4O4HB 3SC3A 2KM1A 2IZZA 1J4AA 3H2IA 4Y2TA 3E9MA 5FORA 2C3YA 3EZ6A 3IRUA 2C88A 5EE5B 3TLZA 4KAFA 1TZJA 3QW4B 3QE2A 1ADGA 3NTVA 1GZHB 4Z86A 5K0CA 3TPZA 3AM4A 5KOHB 2AN3A 2BFPA 4ZQEA 2XZUA 3RTBA 4CMEC 4A8HA 3ME5A 2JLBA 5EIXA 1XNRB 3V1KA 3WS7A 4UDNA 1QRUA 2H63A 1XMQB 3EBLA 2Q62A 4CUKA 4FIZA 5LA6A 1U4NA 3IHPA 1OHHD 5BNTA 3KSAC 2J8ZA 1UIMA 1EAMA 4AWBA 1BXRA 2X9QA 3FKJA 2X8WA 4V24A 3L7YA 2DHQA 3BWMA 3DKPA 1NLMA 2P7IA 3P5SA 2CLDX 1HSOA 1FSSA 1IULA 1YQDA 3KR1A 2KZSA 3KUKA 4FDLA 1KQFA 1Q92A 3P9ZA 2EBUA 3UJ9A 4N9WA 3NTOA 1CZUA 3KQHA 4G3XA 3FNIA 5ITTA 3AI7A 3BD8A 4L15A 4HBGA 2W93A 1L4NA 3BRQA 1IJFA 2Y1DA 5DX1A 5AVUA 3FN4A 2WHPA 2IC5A 4A0QA 2IUFA 3RSSA 1MGPA 1JMVA 3C3EA 4RWEA 1PJTA 3AGPA 3R20A 1GQRA 1ZMWA 3F98A 5AI5A 4CJXA 5JYEA 2ONKA 5EJGA 1ZW1A 4LZOA 1KKUA 1BU8A 3WZ2A 2QTTA 4EENA 1D6JA 3EZ2A 3C2QA 3GQ3A 2HWWA 2AOVA 1P7CA 1XPJA 3PNYA 3HO8A 1KC1A 2QM0A 4J1NA 5AHRA 1OVMA 2UZ1B 2GQ0A 4HQRA 4M0CA 4PRKA 3OZCA 1JI0A 4MEBA 4WOKA 5IHPA 1VTKA 5JSQA 1UMBA 4RZSA 1UPXA 3CUKA 5M04A 2IA5A 3U60B 2Q4DA 3H3XA 3A0UA 1JXAA 1VXOA 5JQWA 1NU8A 4GR5A 1RXCA 1CF4A 3ADPA 3W2EA 4F1WA 1NBEA 4AZ3B 3OCZA 3RVQA 3G6WA 5LZ4A 3F3SA 3KSMA 1Z0AA 3PFWO 3LA8A 1USGA 1WP4A 1YKSA 3IB6A 2FN9A 2J59A 2IIBA 4YQEA 5KKNB 5IVIA 4YRAA 1H4SA 3T4PA 1G71A 1YHZA 4OA8A 4NK5A 5CCDA 2HSEA 1RKXA 4KVAA 1AD2A 4BQSA 4ZJPA 3F46A 5CB8A 1S4QA 4DE5A 3M83A 3I9OA 4Z9FA 4LOLA 4L02A 1P1IA 2GARA 1QHHA 5THXA 5E1OA 3Q2KA 2NSHA 1KK2A 1SVWA 4XD2A 1H2ZA 2XLJA 2D2VA 2Q5OA 5FRDA 3U1TA 1UJ6A 3IOYA 2VAMA 3FPHA 4YRKA 4LGCA 2QV0A 2ID7A 4H7HA 2XUQA 4TL6A 3EXHC 3N5KA 4DMRA 4U7TB 4ARCA 2C00A 1MC1A 4L4XA 3VTAA 1ULBA 1ZS9A 5AYVA 1VBNA 4M0LA 2Q8NA 2PKYX 2O23A 3DBLB 1XVLA 5K09A 1QKIA 1V3QE 3B3FA 4EUSA 3HB4X 4NH0A 1ICIA 4QT4A 6REQA 2JIMA 3LUJA 1P74A 5AW1A 3KEGA 2JFXA 3NNNA 1OWOA 1TGUA 1VJCA 2DKFA 3ENNA 4YYEA 3W8DA 2V1XA 1OUMA 4O8ZA 5C32A 3FHTA 2YCBA 4J0FA 3AEKA 3Q6NA 3K1ZA 3UUEA 4OHCA 4FFLA 1A69A 4QPPA 3O83A 1PCXA 4K9SA 4B3JA 4W5RA 3WWPA 1UMDB 3C3BA 3RJZA 5K99A 3GPPA 1U31A 1PZFA 3DEYX 1QYXA 4MS1A 5FI0B 2JDIA 1TECE 3ZCUA 2WOJA 1YZVA 4I4CA 1SR8A 2FMIA 4E2FA 5LKRA 1FU8A 1B3RA 3DDWA 3I62A 5DJ5A 5G41A 4BQQA 5SY4A 1JECA 1O6FA 4DJ5X 2X76A 1PNRA 3ONWA 3Q7QA 4J0DA 3E9RA 3RASA 3CLTD 4PLWA 5FO0A 4YCMA 2D4AA 5FBWB 1ZFNA 2CZGA 3BSSA 4II2A 1Z4JA 1JPJA 1K86A 3D9QX 1YAHA 4Y6LA 4GFDA 5C81A 2Z4TA 1I2MA 4KPUB 2XAUA 5A9SB 3V6MA 4UFPA 2OV1A 2VHQA 5JLAA 1JR3E 4K3VA 3IKJA 2WI8A 5MFZA 2HK8A 3GBVA 2IS2A 4OFXA 5ALYA 4CQMA 3CFYA 2WSIA 2PZLA 1PJBA 4B9AA 4TYMA 3IO3A 4Y9TA 3HPRA 3VI4B 1VDMA 4DA9A 1AZSC 2YASA 2JAQA 1PJAA 3WGNA 2GZMA 4EHIA 4W7HA 1K92A 4CTMA 2VPXA 5J2TF 2YZGA 3REOA 2IXEA 2OHIA 1KQNA 3ESZA 2Q1XA 2QD1A 3ILSA 3RTDA 2QM7A 2LH0A 4X41A 1R4MA 3R76A 1MQSA 4G5XA 5F52A 2JHFA 5K0EA 4R4JA 5JLJA 1JV2B 3AETA 2FFAA 5E2BA 7MDHA 1PVOA 3SF0A 4EX6A 2WTUA 1A4XA 4A8PA 1X6VA 2RH8A 5DI3B 2WP0A 5HTOA 4J94A 1FZQA 1G20A 4QFBA 2WVAA 4IF6A 3OE4A 5T8KA 4DJTA 2PX0A 2DFTA 1ZM2A 2VCEA 1WZNA 3F3KA 1G7CA 1RBZA 1CUFA 1WUHS 2CD9A 3H4JA 3ZIAA 3E18A 4R1NA 4IDFA 4Q9KA 3SBEA 5AKGA 1HR0M 1N1DA 1QS0A 4EFKA 2HL7A 2PVSA 3CINA 3DJYA 3VRHA 2CE7A 4QM7A 4XWWA 3W4JA 2IZ5A 1JA1A 3PA8A 1QHFA 4BFSA 1JR2A 3MBOA 1V3VA 2GM5A 4R81A 8ATCA 1EWQA 1X39A 1DAHA 2P77A 4X5OA 1Y3IA 5BVGB 1E6KA 3IT1A 2FPGB 3UJ7A 4PXAA 1GAQA 3H04A 4FZVA 2JFFA 5L9AA 3HJAA 1C1YA 1JHYA 4R9UC 3GP3A 5CB0A 1HT0A 1IY8A 1M0EA 1BKDR 1CW2B 1EZ1A 3VH2A 1J8MF 1U2SA 3IQZA 4MO2A 5IDXA 1NF2A 4IL5A 1GL9B 4DDHA 5BSTA 2VK2A 2LVOC 1NA5A 1TUBB 5G3ZA 4NULA 4WCFA 1YL6A 3UNXA 3HSYA 4D82A 3GY0A 3F6EX 2WHXA 1UFVA 2H0AA 2J3QA 1O9GA 3VUFA 3DOAA 1IEXA 3U4IA 2HXGA 3T5TA 2CLHB 2X2FA 2VHVA 1TH3A 3C4VA 1FMCA 3PQFA 3K2QA 4WURA 1PEYA 5CD9A 4QRIA 3QYPA 2ODQA 3UGQA 1V5FA 4R9NA 4GC5A 3P0IA 3NHLA 2H57A 4MCHA 2VEDA 2EWVA 4DMMA 3MERA 2IP2A 1Z88A 3GT7A 1H9AA 1TLFA 3QA3E 5DOZA 2HCJB 2P2GA 3R7NA 3GT3A 2CNKA 2QYHA 3LWBA 3KQPA 1IPFA 3BMQA 3T0GA 1PK9A 4EYQA 1QVVA 1OXTA 4HSEA 2PMBA 1Y8RB 1AM4D 3JD3A 4YJ3F 3NDIA 2C2XA 3KJGA 2H00A 4OLAA 3L7BA 2KZUA 5KSYA 1YZFA 2CL0X 1N6RA 4WNAB 4B5KA 3T1HM 2XIQA 1P31A 1UDAA 3TSWA 1REQB 4GL4A 3PSHA 3FCCA 1N5OX 1R8QA 4XUGB 3NHSA 5B4VA 3H9BA 3ZC3A 1N6HA 2HFKA 4M87A 1TK3A 3FVTA 3H9JA 3CKMA 1FK8A 3GA5A 3MBIA 4UVDA 1JE1A 1XROA 2FUEA 4DV1M 1YB2A 4PSVA 2ZBEA 2VYND 5I47A 2PRZA 5E3JA 3VC3A 4R16A 1YVPA 4C2UA 1JIIA 1L5NA 5TRTA 2Y20A 2BZGA 3LGAA 2PSSA 4J7CA 1ANKA 5E1DA 1R9NA 3E21A 4DMKA 3N70A 3RSOA 3W2GA 4G4SO 3AINA 2Q6OA 2HMAA 1PUXA 5FI1B 4KQGA 5HNKA 1VFPA 4AU1A 3OQJA 2CK3A 4JLMA 1N5DA 5DM4A 3AY0A 3R6DA 4YONB 2V7QD 3QVMA 2FPIB 3TDNA 4ENVA 1F14A 4X93A 5CDYA 1PTJA 2QN3A 2G76A 4JWKA 5BSHA 2VAPA 2H4XA 2DAPA 4U5XA 1ML4A 3ZW9A 4Y8VA 5ICEA 4YRBA 1QLHA 1XJWA 4IKPA 4DN6A 1QIFA 2JUJA 1O4WA 4ZAYA 4DV0B 3ZDBA 1JQ3A 1EFVB 3BMOB 1KZHA 3K8YA 4HH3C 2HQRA 3ZBPA 4IICA 4EY8A 4FEAA 4ZCSA 4BX8A 2A8YA 6ADHA 2VUUA 2BHNA 4DV4B 2Z7JA 4JZYA 4D9HA 1A71A 2R6HA 1MEEA 4E0BA 4GAEA 2J09A 1TLTA 4V3CA 1V41E 5ALIA 2LPMA 2IP1A 3PL1A 4R31A 2WTMA 1LK0A 4KQKA 4OJMX 1VYTA 3N2KB 3ZK9A 5FOTA 2QZ9A 3O31A 4ZVQA 3I6MA 1SKQA 3ZDFA 2P4EA 5ALRA 3FMPB 4S2EA 3UGJA 3H0EA 2LUOA 3D1LA 2CFSA 1Q0SA 4EAAA 3D6VA 4IM7A 2M98A 4TSRA 1V34A 3DDZX 1DT3A 4FFVA 2WYWA 4NXMB 1B8PA 4TZKA 1ZD3A 5JG7A 4JLDA 2FZWA 5I7SA 1RLIA 4M1SA 4ZQBA 2OV3A 2I7VA 4LDQA 1JPUA 2CL7X 1SU4A 1D4AA 4ZOAA 3LDAA 4ZMRA 1OLSA 5EUCA 3F5MA 3PNLA 5C37A 2A0UA 1KU0A 5LQUA 3UBTA 1KJQA 1NJ1A 1PZEA 3HFSA 4O2RA 3ELBA 1FU4A 1CVLA 1DHTA 1OXVA 5CVEA 1D0VA 4NYJQ 1D2HA 3PYMA 4FEGA 4Q7QA 1JHAA 4RPCA 3OKCA 4YCLA 1R18A 4P33A 5EZYA 3PRKE 3EZ7A 5DBOA 1FBNA 1XF1A 4X61A 1Z34A 1RM3A 2O8DB 5BPHA 3BMNB 2VZ8A 1QHSA 3EPHA 1W85A 1E0JA 4N3AA 4QGBA 2WSFF 1MO4A 2IHZA 4IIBA 1XPRA 3D8UA 3A4LA 3HSKA 1R6TA 3MGAA 2J3JA 3DL4A 4AKGA 4N01A 1L3IA 3G5TA 2D5LA 2JZ1A 2JGJA 2BMJA 2O5VA 1LWOA 2IOFK 3QY0A 1PSDA 3A7DA 1YJXA 1JQEA 4YAKA 4KODA 2PJUA 3ZW7A 1XZDA 4DB4A 2G88A 5IYZB 3EUFA 4RTJA 1A88A 1QCDA 4QIHA 1RQLA 1PR4A 4D25A 1D7AA 3AK4A 3SAJA 1L7NA 2VJMA 3HVUA 1ZGGA 4F45A 3FSGD 4IIJF 2QTMA 1XTIA 1GCIA 3VO2A 1KDRA 3D6HA 1G8KA 5D3QA 3RYIA 3B3JA 2J3EA 2RHMA 2C3PA 3QVKA 2W0MA 1I14A 1NUUA 4PYLA 4Q3AA 4CDMA 1RAFA 5TQ0A 1LPBB 3DTNA 2ZB2A 4GKAA 4TQAA 3BGWA 1Z5GA 3AUFA 2FCAA 1GO2A 3LLCA 2Z1NA 3RRFA 3PQ6A 2DP4E 4EYSA 4CM9A 2ALJA 4J8PA 4RKYA 5TT0A 2GPSA 1SVNA 1NVKA 4H6XA 5EPUA 4F5EA 2HU7A 4QWWA 5SV2A 2K2QB 3FBWA 2HNAA 2Q2OA 2N47A 1P6QA 1MT3A 2YOHA 4NVRA 1PS8A 2QY9A 2E3JA 3PNOA 3GMDA 3GFGA 3LTNC 1V8DA 1Q1GA 3ILYA 3MJCA 1PV4A 4JLJA 1IXRC 4XEHA 4EGSA 5JO0A 1I3CA 1HNNA 4WH0A 5E95A 3D6TB 2RJOA 4UC0A 5BOSA 1D0IA 4QDOA 1ODCA 5JPDA 1N34B 4GBED 1K4YA 1R6UA 3RS5A 5BRJA 4JP1A 4KYVA 3VDRA 3OF2A 3EGVA 1B43A 5LLDA 1W5EA 3KAPA 4G0WA 3P9KA 5JMTA 3CZQA 1U63A 1FP6A 3NXSA 4IDEA 2GPBA 2VPYA 1Y63A 2ZVDA 3TQFA 4BMVA 4OXKA 4NFSA 1Z06A 5KTRA 3EGCA 4PC1A 4UEJA 1JXMA 1E0DA 1KDZA 3O74A 3IA2A 3T4EA 1LA2A 1M73E 2BMWA 1DRUA 1J24A 3WMEA 4UVHA 2DJ5A 3DT6A 4GKKM 2HSDA 4DTIA 2AEFA 4UHHA 4KHPB 4RUKA 5JFOA 4QXQA 3DXZA 3RROA 5CW2A 1EM6A 3IUQA 2FPOA 4BV2A 1SHLA 1E5TA 5DSTA 2C2GA 3ZE0B 3ECSA 2A30A 4IQGA 2DOKA 5CYGA 2NNWB 1TEHA 4YAOA 5B4TA 4NDZA 4UD2A 3FD9A 3L8ZA 1RWWA 2NO0A 1EX7A 4M76B 3U44A 4EO9A 2AYXA 4P80A 5EOVA 1CDDA 3AW8A 2ZWAA 3EXG2 1DXQA 3B6MA 4BGUA 4MI1A 4UW9A 4Y0NA 3L8GA 5I7WA 2R79A 2XA1A 1BE0A 3H5WA 3N2GB 3HABA 1NNJA 1FFDA