1NY6A

Crystal structure of sigm54 activator (aaa+ atpase) in the active state
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
247
structure length
247
Chain Sequence
EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation of the transcriptional activator NtrC1: structural studies of the regulatory and AAA+ ATPase domains
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords transcriptional regulator (NtrC family)
total genus 66
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ny6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ny6A01
1IHUA 1P2VA 4JL8A 4Z8XA 4G5RA 2C99A 1XXHA 4XWKA 2QROA 2ZXUA 4A2WA 3QEOA 2WM9B 4MQBA 1DAHA 1QHGA 1FQJA 4HAVA 2BCGY 1KHTA 1Z6XA 2Z4RA 4HLUC 1N6HA 3CWZA 3MSXA 4B73A 3F0TA 1MH1A 3BERA 2W00A 1S1CA 1Z47A 3Q3JB 2XZOA 5JI3E 3AVVA 2OEPA 1O3YA 1XFAA 1YZGA 4LWZA 3VAAA 4ESVA 1Z08A 2VH5R 1A2KC 3BFXA 1VYTA 4ZCLA 3UKDA 2JDIA 3SBDA 2DR3A 1P60A 3ZS9A 4KLNA 3IEVA 3QBTA 3K0EA 3RSOA 3U4QB 3RRMA 3G0HA 4XSGA 1GNQA 4RJLA 4D81A 1UFQA 1MOZA 3IBYA 1JXOA 4PAOA 3IEUA 4TLBA 1RFLA 1Q3HA 4E03A 3ZH9B 1VCIA 3H86A 5CM8B 3OAAA 4QFMA 3KQKA 2IF0A 1QVRA 3NKVA 1PJRA 4E09A 5EE1A 2ZE6A 2O8DB 2YHSA 3FKSD 4G3XA 4RKEA 4URVR 4TMVA 2FGJA 2HJVA 4OKSA 2QM8A 4EPRA 1Z6GA 5D3QA 4NE2A 1TMKA 1DAKA 4D0NA 1YZLA 5FOVA 5E7JA 1GL7A 3KKOA 2V3CC 2EVWX 1KSJA 3P1JA 4ACBA 2VYFA 1A82A 2XNSA 1OIWA 5UKDA 3T15A 3DZ8A 4NCNA 3LVQE 2P6RA 3SYLA 4UXIA 4PSKA 2EU8A 2W6JA 3GJ6A 3PVSA 3CH5A 3T12A 4E5UA 2O52A 2JJ1D 2QORA 1NSTA 2R6FA 3T1OA 3PENA 3MWLA 2AHOA 4LJ9A 5A5GA 5JECA 3OFND 3Q9LA 4Q1BA 1G4AE 4R2IA 1W47A 4TL9A 4FMCB 4G0NA 1ZU5A 1FQKA 1E0AA 2KI5A 2ZSEA 4JYBA 1E96A 4URXR 3AVUA 4BQSA 3DMDA 1E2PA 1EG7A 1Q0UA 2ZANA 2WPDD 3BGWA 3LXRA 1E9EA 4Q1EA 3EARA 3QPVA 3BJIC 4D0LB 3LD9A 1AGPA 3I1FA 4RZ2A 4JJZA 2OFOA 1E98A 1G3QA 2A3RA 4MRRA 2D2EA 2F9MA 2KBFA 4KU4A 1BMFD 1KI9A 2PCJA 3Q7PA 5DI9A 2O8EB 4PR0A 3WRYC 1U9IC 4DHEA 1TTTA 3EC1A 2QMHA 2G1KA 4BZQA 3OEED 4DDTA 3V4RA 1ZD1A 2OILA 3RHFA 1ZW6A 3QG1A 4RFSA 2JASA 2GK6A 3ZIAA 4WXPA 3GLHA 2N42A 3N5CA 4DSNA 1XX6A 2Z0MA 1L7VC 2YC2C 2WTUA 2HYDA 5EE9A 2XJ9A 4DEXA 1D9XA 3ZD7A 4FCWA 4R2HA 4L4UA 1ELOA 5BN4A 1HH4A 5L8VA 1HT2E 2D7CA 2ZR7A 2Z5FA 4M22A 3V9PA 1A1VA 5JZVA 4PC7A 1RW4A 3A8TA 4HB4A 4ZV4A 1G3MA 3M1IA 4ERNA 3DL0A 4IFEA 2ZETA 3GJ5A 3Q85A 3HPQA 4W5HA 1XD9A 4Q4JA 4JSTA 5EXSA 3CF2A 1NLZA 5IHPA 4Q9LA 4YMVA 4D6PA 3AVYA 1G8HA 4JVLA 5FUYA 1NN0A 2ONKA 2CL7X 3VFDA 3K0AB 3KL4A 4PZLA 4V0MA 3W6PA 4DDWA 4I1VA 2OXCA 3NWJA 1G5PA 4KV9A 4TQUS 6Q21A 4LHYA 2ZAMA 1AN0A 1A4RA 2ERXA 3LW7A 5EZ6B 5DYIA 2B8TA 2YVUA 2FE4A 2AK2A 521PA 1Q1QA 4DLSA 1U0HC 3NC0C 4Q47A 1W2GA 4DXAA 121PA 1GUAA 4LHWA 2AN9A 3T06B 5M04A 2QNRA 1KI2A 2FU5C 3AP2A 1XTRA 1IN6A 2AWOA 4FI3C 4V03A 3KQLA 1BOFA 4QGAA 2IYZA 5F2EA 4JL5A 1GZSA 1OHHD 4TTRA 4TWZA 3C15C 5DYGA 2GK7A 2GWHA 1XD2A 2WWIA 4X8HA 4A0RA 4TLAA 2DWZB 4O3MA 2WSSA 3IIJA 2YOFA 1KNXA 4M1YA 2G3YA 4LJAA 2ZVQX 4DLYA 4LV8B 1LV7A 1U90A 1EFTA 3IDQA 3THXA 2XTNA 4QRHA 3WHLA 4LPSA 1TF5A 1JEEA 3DKVA 5EQTA 3MUFA 2ZTSA 2GCOB 3G82C 3QIAA 2O5VA 1K6MA 1UKYA 2VO1A 2J3EA 1KJZA 2ORWA 4DUGD 2REXB 1NN5A 1S9DA 4LSGA 3SNHA 4Z1MA 1XF9A 3KJGA 4KVGA 1ZM3A 1EX7A 3EZ9A 4OI1A 3ZZ0A 1JQLB 4NYIR 4O2LA 3BIFA 5KNDA 4TZ0A 1DG3A 2REBA 4BASA 1CR0A 4B32A 2CVHA 2GAAA 2IBMA 2WKQA 1GITA 3C14C 3Q5DA 4IXMA 3VR5A 1R8SA 2GEUA 1PLJA 4AWXA 4EFLA 4BEJA 2WJJA 1CJVC 5SZJA 1LY1A 5IF9A 2Q3MA 4JLPA 3EA0A 4Q19A 1U9IA 1G7CA 1E2IA 5IDVA 4F7WA 1XZQA 4MRSA 3NEJA 2O0KA 2IYYA 4RD0A 3AVOA 3DVLA 4Q1CA 1N6KA 3CX8A 4BFTA 4CIDA 3H0KA 2VBCA 4AY2A 5DN6D 3HDTA 1ZM4A 5L3SA 1XXHB 3R8FA 2I1QA 2KE5A 1Z5ZA 1X1SA 2MSEB 3RS2A 4EQ6A 3BK7A 3WYAA 4MDEA 4YXWA 4AG5A 1K5DA 2HUPA 3RVBA 2ZI6A 3AM1A 5EE5B 1QHIA 4HAWA 1MO5A 3L0OA 4Q21A 3A36A 4US1R 1E2NA 3LXXA 5CLQA 1QHSA 1TF2A 2QPTA 2F1HA 3H1TA 1RC8A 1JALA 2J7KA 4DCTA 2QPAA 3GLGA 1DBSA 2XX3A 1Q44A 3TAHA 1HA3A 4GBMA 4KITB 1OB5A 3B82A 2IUTA 1VG9B 2F1IA 3F8TA 1J99A 3IHLA 1JNYA 1W1WA 4IDPA 1BIFA 1U8ZA 1MABB 1WQ1R 4JLNA 5FBRB 1N6LA 2NTYC 4EPTA 2N46A 3GEEA 3X1WA 4RKFA 2ORVA 2FSIA 5J4LA 4WZAE 1N0VC 4DIEA 4HB0A 1E0SA 4JT4A 4IVRA 5BXQC 2EWVA 3ASYA 4TTQA 1SULA 5FBVB 1CR2A 2ZRLA 5L3RA 1OB2A 2OG2A 3VLFB 4P4SA 1N6OA 3TQCA 4M9ZA 2DPXA 3UG7A 1FMLA 3PQCA 5GADl 1XJQA 2D74A 1K8RA 3WRXC 3KFVA 3Q7QA 3AF4A 1H8HD 2GBLA 3PUXA 2O0HA 2R9VA 3K0SA 4RZUA 1SXJE 2AXNA 2ZI5A 5TARA 3S1AB 1OPXA 2GESA 3HR8A 1N5LA 4LJ5A 4UXHA 3I4LA 3LBNA 4KYIB 3WYGA 3B78A 2YOGA 3RS7A 4C0BA 2CHVA 4JJKA 2ZRCA 2ZROA 1KI1A 2IA5A 2KWIA 2PT7A 4WZBE 2QTHA 2EYUA 2OCBA 1CJKC 1X8LA 2CNWD 1WCV1 4MKHA 4POAA 4ZO4A 4TMXA 3SFZA 4D25A 3W6OA 1I4TD 4MGZR 4TL7A 4Z54A 4UNQA 5EE0A 3CWQA 3K0FA 2REOA 4DKXA 1ANKA 4ZIRB 5FPSA 4IOLA 1OIVA 4IFBA 4LRTA 4FWIB 4D4LA 3GLIB 1G16A 1MV5A 3EAQA 4JT2A 4V0ME 4DSUA 3OE7A 3TVTA 2W2TA 3ETLA 1GM5A 1F3OA 2YNMA 4BZPA 5H1YA 3CPHA 1DAEA 4A8JB 5L3VA 3NTUA 2VQSA 3VR1A 3ZZTA 3E2IA 5JRJA 2W83A 4G01B 1P9RA 2YWFA 3EPKA 5KDDA 2GEVA 1U0LA 1HE8B 2OLKA 3GD7A 4MYHA 2FEMA 3THXB 3UMSA 3ZLJA 3MJHA 4QL3A 2KJQA 1VDZA 3WHKA 5KYKA 4V02A 4M9SA 3IHWA 3WP1B 1ZIOA 2BMDA 2WIAA 3LO5A 5JEEA 2IX3A 3UANA 2RGNC 1YQTA 1Z28A 3ZVRA 3EPJA 1TU4A 2OE2A 4PPGA 2QT0A 3FFBA 3DOFA 1JPNA 3KTAA 3MLEA 4KFTA 4FWTA 4DVGA 2WSMA 2VSFA 2SHKA 4HYYA 4MRVA 4IRUB 421PA 3VKGA 1I4DD 1KKMA 3L43A 2ZR9A 4L8GA 3VTKA 2PJZA 1P73A 2DWPA 4MRPA 2QBYB 3RRZA 1KKLA 2PZFA 2VTKA 3CONA 5TDHA 2K5UA 3QXHA 4TLDA 4TSFD 4I81A 4H9GA 1P5ZB 4M9QA 4RZ3A 3B1ZA 2WKPA 1ZCAA 3GJ8A 4Q66C 5JJLA 4HZUB 4QBHA 3R7WB 2FZLA 2BWJA 5B30A 5SZKB 3WNDA 1VG8A 5KDOA 2ZAOA 2VHUA 5FPKA 2QAJA 4X8LA 1SKQA 1G6HA 1XEWY 1ZVQA 2H5EA 2XTMA 3K0FB 4NCKA 4WBSA 4BLQA 1QG2A 3QPWA 5EZ5A 1ZYUA 3B5JA 1XMIA 2IEYA 1F60A 1VHLA 1VECA 3GLIA 2J0VA 1AQUA 3U3KA 2NIPA 3OAAD 1XD8A 2G88A 1U2RA 3NBZC 1TEVA 2G83A 4Q4LA 4S2EA 2HT6A 3B13B 4B35A 3FKSA 2BEJA 4OK6A 2B21A 1FZQA 1KJYA 1Z06A 4Q03A 4A4DA 1P72A 1C4OA 1VKJA 1COWA 2GHIA 5LD2B 5ANRB 2XGJA 5DH9A 2QAGB 2GBLC 3NG1A 3P26A 4JL6A 4Q18A 5FR1A 3ZQJA 4F93B 1KDRA 2AFHE 3LRPA 4EDHA 4BRUA 4H1UA 1FMJA 3AGQA 2R6CA 3EX7C 1N25A 4ON9A 2FMXA 5E4FA 1W49A 2EW1A 1VYVA 1XTKA 4QBIA 4IDQA 4IEIA 4XVUA 3EW9A 4JBYA 3UATA 1CR4A 5FTLA 3L0SA 4UQOA 3C4JA 3T34A 1SQ5A 4M21A 2GAOA 1LW7A 1ZUNB 3CRQA 1PLKA 4NCIA 2PJRA 3D6TB 1E9DA 4HZUA 2Q9CA 3QQ5A 4KXFB 4PSVA 1QHHB 1WE2A 1S3GA 3P20A 2KSQA 3TLXA 2BM0A 4OHZA 3PG5A 3TR5A 4PHFA 3BB3A 2FFAA 3ZDQA 1W0JD 1CBUA 4GZLA 1W4AA 5FBWB 1S3SA 4C0KA 1OKKD 1G18A 3KKPA 3BAFA 1A5TA 3THWB 4TYYA 4F91B 1T3SA 2UZIR 4B47A 3WBKA 4EPYA 1E2DA 2NO1A 4GMDA 1IN4A 3B1YA 1R8QA 5FBQB 1TAGA 2Z6VA 2ZJ5A 4WAUA 4HLUA 5BWMA 2YYZA 4GSYA 4Q02A 3NIBA 4V0LA 4US2R 2IS2A 2RH5A 4FINA 1E3MA 3MWYW 3BBPA 1W5TA 1OH7A 5AUNB 4UXJA 1FOEB 1OYYA 2DY1A 2VHTA 4WIAA 4Q5IA 5KPDA 3ZIAD 2J0UB 3HU1A 1MT0A 3TW4A 2W58A 4UKDA 5TMPA 3X1YA 1DVRA 4JLOA 1ZRHA 2FV8A 2NGRA 2V1XA 3MJRA 2ZSAA 2V6IA 4CF7A 1V5WA 2ZJZA 5EXTA 1Q20A 2RMKA 3ASZA 1E2MA 3DM9B 4O25A 5CLLA 3RYTC 4C9BA 4DC9A 3SN6A 4DCVA 2P6NA 1N6IA 3EIEA 1Q12A 4RFSB 1WMSA 5JWHA 4OBEA 3U3MA 1OXTA 1L2TA 3E5HA 2JA1A 4RD3A 4ZKEA 2XXAB 5CYPA 1P62B 2H17A 4KVAA 1NLFA 3X2SA 3KUCA 4MDFA 4BLPA 1KJWA 3B60A 2A7QA 3AKDA 5JEDA 3SQWA 3EIQA 1IAQA 3JZMA 3OEHD 4ZCMA 4XSHA 3MWKA 4TQAA 2WWXA 4A9AA 1E2EA 2UZ3A 3DKPA 4M1TA 2DCUA 5GVRA 4JVMA 2OBLA 1UEJA 5AJVB 3RSLA 3TE6A 2NG1A 4DLXA 2IF2A 1HY3A 3LV8A 3I92A 4AYXA 2EQBA 3SOPA 3D31A 4G5OA 2CBZA 4LY6A 1G8PA 1ZNXA 3SI7A 1NVUQ 2WWHA 1E0JA 4R71A 1T5IA 3RDPA 2J0SA 2E87A 4DDUA 3IIMA 1NP6A 4TYPA 1KK1A 4HZIA 4RVCA 5JMTA 2A30A 1E79D 3GPLA 1E9FA 1OHHA 2C95A 2IXGA 1TF7A 5DO9A 1XMSA 3TW8B 4DLTA 3WNBA 4NYMR 3ZZUA 3U7FB 3IBGA 3FHCB 1G3IA 3X1ZA 4PTLA 5DSZA 3BH6A 2JDID 2BKEA 2ZQ5A 2QEQA 3U7EB 2H92A 1G17A 2D4HA 4TL8A 1OT3A 4FMBB 1DAFA 3NVAA 4TLCA 4JYCA 3OF5A 3FGNA 5DGXA 4FMDF 3UMRA 1IXRC 4IOJA 2XB2A 2OSBA 2WMNB 5P21A 8OHMA 4XIGS 3KQHA 2LKCA 3CKLA 4OHVA 5G3ZA 3SR0A 4ARZA 3CX6A 1Z2CA 2ZUBA 1JEDA 2IYSA 1D9ZA 4KBFA 2HXYA 2O8CA 2PLRA 3I3SR 5F98A 4HAZA 4OYHA 1EFCA 3U61B 1CEEA 1KO8A 1Z0AA 1S8FA 2ZS8A 4RCZA 4JIMA 2BCJQ 3BFKA 5JSZA 2L0XA 2OESA 1OFIA 1ZUHA 3IIKA 3GFPA 1GAJA 3FMOB 4QG7A 1YZUA 4I99A 2DFLA 1W48A 4AI6A 4DEYA 2ANCA 4DSTA 4U7DA 2Q21A 4NPHA 4ARZB 3K1JA 1JAIA 4MRNA 1W46A 1CULC 1T8UA 2ZRJA 5DN6A 2A78A 4JLBA 1LB1B 1CLUA 2WZQA 4PAMA 3IQWA 3GLFB 1L4YA 3UPUA 2ZE5A 5B2ZA 2IYXA 3QXXA 4FW9A 5AJYA 3MWJA 3OFNA 3HWSA 3AJIB 3CR7A 1FX0B 1IY1A 3K09A 3RRYA 2ECKA 3LBIA 4GL2A 2V6ZM 4BFSA 3AP1A 2QPOA 3K8YA 3C16C 1J7KA 1E2GA 4FWHA 3LWNA 4HLQB 1QRAA 2FFQA 1ZM2A 4EJSC 5IRCD 1D2NA 1OFTA 2ZU6A 5E3HA 5KUTA 2BIFA 2RGEA 4IVQA 4OQFA 3VR4A 3WP0A 5HZHA 3TR0A 4EKDA 4ZI3A 2C5LA 2FSFA 1KIMA 1F6BA 1S4QA 4IDNA 4Q7MB 3A37A 2GDJA 2H7VA 1BMFA 1Q22A 3W90A 2YOHA 2CHGA 1CS4C 1CXZA 3LX5A 5C2JB 2G0TA 2H1LA 4B3CA 4DLRA 2FSGA 5SZIA 4F38A 2HF8A 1XCPA 2BOVA 2IS1A 2JLRA 1OH5A 3DOEA 1XPRA 1YJ5A 1E9AA 1AIPA 4GOKA 5H70A 3K70B 4IDOA 2BHRA 1GWNA 2X77A 2F6RA 2R62A 1SZPA 5C4MA 3THYA 3B9PA 1OXVA 2JJ8A 3GLHE 2GCNA 3JVVA 4BLSA 2WHXA 4LK2A 2NQ2C 2YWGA 2F9LA 1UKZA 4IOMA 1W36D 1N3BA 1II8B 5ELXA 2C8VA 1XU4A 1CTQA 4MKGA 4LRSA 5HE8A 3A6PC 1T3LA 2CL6X 2BM1A 3PV0A 1EGAA 3FWYA 3MFYA 2RGDA 3W5IA 3CZQA 2XSZA 2VSOA 3TSWA 2IYTA 5GJWC 4CZ2A 1X86B 5TV2A 3ZVNA 2GTPA 1J8YF 5CK4A 1XZPA 1JR3E 4JLJA 2JLYA 3GJ4A 2ZRHA 2IS6A 2F43A 1JJVA 1YRAA 4KJZA 4M1MA 1ZNZA 2WJGA 1IQPA 4PPQA 4HB2A 5E7IA 2OM2A 5FUXA 3AKYA 3QKTA 3W9YA 4NYIQ 1R0ZA 2VIIA 2AX4A 5JCZA 4QBFA 2QSZA 4K8OA 3I5YA 4LBYA 2ODWA 3K09C 1X6VA 3OE7D 4UJ3A 4KSCA 1DPFA 4OJKA 3EZFA 2DB3A 4M8NE 5KSZA 4P31A 2C03A 4NL4H 1PLLA 1KK0A 4AK9A 3AQ4A 4O0MA 1UM8A 1DOAA 1Z22A 1KO7A 5FL3A 1P75A 4LI0A 3LA6A 2NO7A 3KXKA 1E69A 1NI3A 1H8EA 3SJAA 3UIEA 3AVWA 1KSGA 1YR8A 3UMFA 5EP2A 2AK3A 2W2VA 4FMDB 1CJTC 4P4SB 3MRSA 2W6ID 4B3BA 4YC7A 1F2UA 4AKIA 1NIPA 3PXGA 4KHZA 4Q4HA 2BVNA 2JAQA 4QGHA 2A5GA 2D06A 5AUPB 3R8CA 3B85A 4LPKA 2PMKA 1VHTA 4Q1FA 821PA 1IN5A 4Z1MD 2O8BA 4LHVA 1XRJA 4EJSA 2X1VA 1Z0JA 2HXSA 3C8UA 3Q8XB 4YMSA 4CEIA 4ZCIA 4RD2A 3CRMA 3AVQA 1G7SA 4NHOA 2CJWA 3ZS8A 1E2QA 2G1JA 3KXLA 4CEJB 3UG6A 3LQRA 3K0AA 2WWWA 3CH4B 2V9PA 2HV8A 3GLIE 3DPUA 3CF6R 4MITA 3MD0A 2TMKA 4GOXA 3RS5A 4ACAA 1KI7A 2IXEA 3BB4A 1U94A 2WWFA 3AUXA 4LUCA 1N5JA 1EXMA 1UEIA 3NEYA 4QM7A 1VYUA 2ZRDA 1MO3A 3FMIA 3QY0A 3FDIA 1XXHE 3RAPR 5JS8A 4D4JA 2FSHA 5H8WA 2B6HA 1Q3TA 2ASEA 1M7HA 1J2JA 2GZDA 2QT1A 1COWD 4URYR 4YXWD 1QHNA 2P0EA 4GITA 1FP6A 3HYRA 3SJBA 4PC1A 4PXAA 5GJBA 1UKVY 2N1BA 3ZVLA 1Z83A 2BBOA 3RABA 4P32A 4EPWA 2ZS9A 1KDPA 3ADDA 2VP6A 3LX8A 1SVSA 2BMFA 1J8MF 2JJ2A 2RGNA 4ILEA 2IL1A 4EIWA 1GSIA 4NDZA 1M6NA 1KO4A 2PL3A 4M2LA 4P4TA 3PJRA 1N6PA 3SQXA 5FPHA 3PEWA 2ZREA 1G1MA 1TQ6A 1A2BA 4GP7A 2OCYC 4DLZA 4QHTA 1OFHA 4CT4B 1G7TA 5EE3A 1VG0B 1GKUB 3U7GA 1RZ3A 3AVPA 4KFUA 2OXRA 2QG6A 2JLQA 2WOOA 1I2DA 3CNNA 1P61B 2GZAA 4UNNA 5AWFC 1QBKC 4P0TA 2QN6A 5TB5A 2DHRA 3MHVC 4A6PA 4YDSA 4OQNA 5FOUA 3PEVA 4Q01A 1JR3D 2XOKA 2A5DA 2GXSA 3PUVA 5CK5A 3RANA 3NHBA 1E32A 1EK0A 1CP2A 1H8HA 3M4YA 3FFAA 3VNUA 3WMGA 4BLOA 4ZPXA 5DHFA 1M34E 2RGGA 4KFRA 4A92A 3B2EA 2ZI7A 3VKHA 2Q9AA 4C30A 4M4SA 3FE2A 3AVXA 4LJ6A 4P33A 3KJIA 4OQLA 3QVUA 3WY9A 2O8FA 5FPYA 2B8WA 3TAUA 1SXJA 4BFWA 4EPVA 4AKEA 5KPJA 1KK3A 4K46A 2YZ2A 4CYMA 3BRWD 1QDEA 3OIUA 2CNWA 3V00A 2P65A 1K5GA 4B2LA 3HP1A 1Z3IX 1E9SA 1XNJA 4LC1A 3H2YA 1AKYA 1XEWX 3AH8A 4OI2A 4Q9JA 1OYWA 3LDAA 2R6AA 2F1RA 2OO7A 2XTZA 4B6FA 5G3YA 2H8KA 1E2FA 1ESNA 1HYQA 2O8FB 2WMOB 2O8CB 1L8QA 4XTRA 3P32A 4MYCA 4M1KA 5FUWA 1QHHA 2OAP1 2OV2A 3C41J 2BEKA 3VU9A 1IN7A 3GFTA 3IILA 3A1VA 4AURA 1ZMXA 5TY0A 1IXSB 1KGDA 1ZNWA 1RJ9A 2QP3A 3GQBA 1KI6B 2ZYUX 2EFCB 2QRZA 4JVNA 5CM9C 4K81B 1RRCA 3MG9A 1P4SA 1Z29A 3X1XA 1D6JA 1HT1E 4KO8A 1R0YA 1IJEA 4PFSA 3F3YA 3T35A 1D5CA 2FPMA 1X3SA 2VEDA 4Q4HB 1XPOA 3U7HB 2W2XA 4TMTA 3LLUA 3BORA 2FDCA 2ZJOA 1MR3F 2VP5A 3TK1A 5LBIA 2C2HA 4D80A 2IYLD 1R10A 3CB4A 4KYUA 1Y3AA 4QNRA 3QF7A 4XH9B 1KMHB 1CKEA 4PHTA 4II7A 2YKGA 1MRNA 3B1WA 2IYQA 1AQYA 4DSOA 2ZJAA 3MMPA 3X1DA 2FZ4A 1PUIA 1S1MA 5BN5A 2BC9A 5KTYA 1Z63A 1E79A 1RRPA 4C2TA 4CEIB 3EPHA 4JS0A 2WAXA 1G5TA 3TMKA 2AL7A 1CU1A 3IPYA 3CPEA 4L9SA 2AKAB 4RCYA 4ASUA 3B6EA 2ODBA 3GJ0A 3W34A 1YRBA 2IYWA 1NG1A 2ZJ2A 1DEKA 4GRAA 4LJ4A 1R5NA 1T6NA 2NMVA 5KOYA 1TU3A 1R6BX 2MSCB 2FA9A 3K9LA 1S2MA 4G5GA 3T5GA 2C9CA 3SEAA 3BOSA 1JB1A 1NY6A 1UBEA 1F2UB 2RB4A 4M1OA 3DZDA 2P67A 4PHHA 1E99A 1XP8A 3EIHA 5TVKA 3ZVMA 1XCMA 1PUJA 4US0R 4ZDWA 4E22A 2X19A 5JJKA 1UBCA 2BV3A 1Z0DA 1R0WA 1TQ2A 1NNEA 1GKIA 2QTFA 4LYJA 5D3MA 3HYTA 3G5UA 2DWQA 3W8RA 2WJIA 4MUAA 3TSOA 3NBXX 4B43A 4O2RA 3OHMA 4V0KA 4XD7A 4AYTA 2JLVA 2J87A 4IW3B 2YINC 1FUUA 3CRRA 4Q4AB 4PO8A 5JFGA 2BJVA 1OLOA 5LPNA 4JLMA 1G4UR 3BS4A 4NKRA 1KNQA 2NPFA 5J4KA 3NXSA 1NN3A 3RWMB 4DWJA 1YZKA 2Z83A 2O0JA 1GL9B 4DRZA 3AEZA 1P2TA 1KMHA 2GA8A 2ZRKA 4PO1A 4PQRA 1OF1A 4AYWA 1FFHA 4TYQA 2QGZA 4C3ZA 4ITRC 1N0UA 1ZC4A 4BE7B 3CM0A 4GMXA 4W5WA 1RPZA 3QOFA 5BN3A 1X37A 1ZINA 2VHCA 3LY5A 5JWRA 1R4AA 5B57C 3THWA 4DDVA 4Q1AA 4QC2A 5F9HA 3TJZA 3VQTA 4CEHB 1P3JA 1CR1A 1OXSC 2CL0X 2GKSA 4FMCF 4B76A 2CEAA 2RGAA 2CK3A 4LCBA 3ND9A 4Q9KA 4OHYA 4WVFA 1EESA 2ZUDA 1O87A 2BBWA 5HCIA 2QSYA 3KB1A 4EAQA 3EG5A 1TQ4A 4OK3A 5JRZA 5HR5A 1T8TA 5KHOC 2DWOA 2HF9A 3PIRA 2VF8A 1XWIA 2VP2A 3KKNA 4A15A 2BKUA 2MMGA 1SKYB 2XITA 2FWRA 4BRWA 1US8A 2IXFA 1ZP6A 2OFXA 3AKCA 5KU1A 3A58B 4B71A 2ZSFA 4CEHA 5GJCA 2GJSA 1F5NA 2G9NA 4QHSA 1PZNA 1OFUX 4HEJA 4LHXA 3A4NA 2BDTA 2VRWA 4C7OA 4HB3A 1AS0A 1Z6TA 1OV4A 3ONWA 5J40A 4AC9A 5BW8A 4W5JA 4KODA 1C1KA 2V8OA 2C78A 4HUQB 1X8JA 3R9IA 3KUDA 3H4MA 2GVZC 5JI2E 3W3ZB 2GXQA 2CVFA 4W7SA 4JLDA 5CDFE 1W4BA 2QY9A 4LV6A 2ZIAA 3QBVA 4PC3A 1FUKA 1FPMA 3FHOA 1FTSA 4LOAA 3CLVA 3T1VA 2WKRA 1LS6A 1FW6A 2QQ0A 5K8LA 4DLVA 1TEXA 5J47A 1C1YA 2JLZA 3IGFA 2ZRFA 2VP9A 3WXMA 1QF9A 1SGWA 3IQXA 1CRPA 4AKHA 1SHZA 2AKYA 4A8JA 2XSZD 2JIZD 2J59A 4URZR 3UWKA 4DT1B 2IYVA 1YU9A 3A1UA 1NVXQ 4C0LA 3PCRB 3SJZA 3EC2A 2WAYA 1X1RA 2EYQA 1UADA 1DTSA 4FN5A 3S1AA 2J5XA 4AKGA 1R7RA 4DZZA 2A5FA 1UDWA 4NMMA 3OEHA 1IJFA 4OQXA 5IK2A 4HAUA 2IYUA 2LCFA 2LWIA 5B58C 4NONA 3I61A 3ZGXA 1ETUA 3W3AA 1BS1A 1KI8A 1VMAA 1GL6A 2OBMA 2WWGA 1KY3A 1F48A 4FD2A 2ZSDA 3CIOA 2V7QD 1QZMA 1N6NA 3NDPA 4JKIA 4BFZA 2YWEA 2ZS7A 1XMVA 1C9KA 5HKKD 3D8BA 1G3UA 5FUVA 2ERYA 4Q1DA 4A0FA 1W0KD 1KTVA 5CB6A 4LZZA 4ZDKA 2QA5A 2QE7D 1VIYA 2J7PD 4NZYA 5C4GB 2DYKA 2VF7A 5EJEA 2ZYTX 3SU8A 2RCNA 3GLHB 2ZU0C 3L8ZA 2IW3A 3VR3A 3R9WA 1E2LA 2HEIA 1H8ED 1VCMA 4G5QA 4X8MA 5JHHB 2CLDX 1GFIA 1TX4B 1W4RA 4MGKR 2AXPA 3A1SA 1W5SA 1Z0KA 4Q9IA 2HCJB 4NTZA 3O8RA 2JLXA 3I73A 3LW8A 4A8JC 5L3QB 2DVWB 1NKTA 5EXXA 1S9HA 2IEZA 4M9XA 4UNPA 2FFBA 3VX3A 2CCJA 2OHFA 1Q1EA 1TADA 3L8YA 3BE4A 1SVWA 4KSBA 4OHWA 3D3QA 3BH0A 3KTAB 2KB0A 3AB3A 3HU3A 4WZ6A 1WDTA 2QU8A 2RHDA 1KSFX 4TL6A 4V0NA 1OSNA 1NKSA 1N5KA 2KBEA 2F43B 1GNRA 3F5FA 5C46F 4F92B 4URWR 1QZXA 2H57A 3UK6A 1HURA 2CHQA 1WXQA 4DBLC 4PZYA 1VTKA 1HE1C 5HE9A 4B3DA 2GF0A 1GG2A 3FOZA 4TN1A 3CRW1 3EPLA 1DS6A 3I62A 1B23P 3WNCA 4LYFA 3AF2A 1T3HA 4OJQA 1F2TA 1G64A 1SVIA 1TQDA 3K9GA 4QKQA 5JJIA 1T0HB 3CZPA 1M74A 5BQ5A 4F4JA 1KSHA 1E1QA 1EX6A 5C18A 4FCVA 4R7ZA 3NHAA 4HDOB 1U98A 3NDBB 2BBSA 3TBKA 3UWOA 1KAOA 4PPNA 4OQMA 2XZPA 4JBXA 1NVVR 4RY2A 4M1SA 3U3OA 1L4UA 1W7AA 2ANBA 3A1TA 5AUQA 5FL7A 5KSPA 1M1YE 2A2ZA 4NH0A 3SHFA 4BEBA 2J1LA 1RRFA 4DCSA 3SE0A 4MYUA 2ZI3A 1N5IA 1MO6A 1G9XA 2JJ2D 3K0CC 2J0QA 3P27A 4JLVA 2ZM5A 2GCOA 5CIWA 1YR9A 3TIFA 1XCGB 3A1WA 5HPYB 4DB4A 4URUR 4JZKA 2VP4A 5EUQB 1U81A 3QXCA 4TYWA 1ZJ6A 3VU9B 4RD1A 1J90A 2CDNA 1KI3A 1TUEA 2QENA 4KAXA 1JJ7A 3BD9A 3C5CA 4NYMQ 3U4QA 1KO5A 4TZ6A 2FF7A 5FFMA 3A4MA 2JCSA 5AK0A 1AJEA 5K8TA 3QUSA 1E6CA 1YKSA 1AA9A 3TQFA 4GZMA 1NMYA 2WWYA 4AG6A 4DLWA 2D2FA 3J81k 2Z4SA 2GJ8A 1HUQA 3IKJA 4HAYA 5DHAA 1T0JB 3TUJC 3ADBA 3AF3A 2F1JA 3PR1A 1Z0IA 4QNMA 1CRQA 4F4IA 5CJ2A 3GCGA 3OIVA 4HLDA 1G20E 3ZQ6A 1F2TB 2IWRA 1XPUA 1JR3A 2FPLA 4FCTA 2DFTA 2J45A 2XOKD 2I4IA 5FI1B 2B7BA 4A2QA 2ZRAA 2ZRGA 5JSZB 1UBFA 1FP7A 2JGNA 3PEYA 1PVOA 1SHKA 1KI4A 5L3SB 2QTVB 4I4LA 4JLKA 4WXRA 1G8GA 1Q1ZA 1WBDA 1WB9A 3DHWC 4ZIRA 1XTQA 2GJKA 2NO6A 3GEIA 2V4ZA 2WBLC 2ATXA 4LGMA 2I1VB 3C7KA 4R98A 1E94E 2ZE8A 4B3GA 1WP9A 1SXJD 3U3RA 2GETA 1NBMD 4DB2A 1E1RD 3O47A 2GJ9A 2WOJA 3FMFA 4PPFA 3OIYA 4G1UC 5DI3A 3TRFA 2PT5A 2F3RA 4LC0A 2OFWA 3SYNA 2EFDB 1DE0A 2HLDD 1UF9A 4HI0E 1EFRD 4TTPA 2ZJBA 1ZC3A 1OW3B 4IJMA 3KW6A 3ZJYA 1DAMA 1JECA 3IPXA 1SVOA 3LH5A 2C9OA 3SDZA 2HCBA 3ZD6A 4OHXA 2OCPA 3AKEA 1OH8A 1XEXA 3ADKA 4GT1A 2ZEJA 2YWHA 1B0UA 3A4LA 4QJ5A 621PA 2DZOB 5FPTA 3PUWA 5CITA 1US8B 2ZITA 3GEHA 4L9WA 4B6EA 5IT5A 4A6XA 4LBVA 2CCGA 4FWGA 1XMJA 4Q9HA 3VX4A 4TYNA 1PV4A 2C04A 4QBGB 3GFOA 4N0DA 4QM6A 2W6IA 4M1WA 4EJSB 2C98A 1ESMA 2GCPA 4MKFA 4PHGA 1U99A 2XB4A 4D26A 5CB8A 4B33A 4YMUA 1H65A 2DBYA 2CLCX 1NRJB 3NBYC 2PH1A 5FOXA 1KI6A 1NN1A 2P3SA 2J41A 3CW2A 5E95A 2FG5A 1KAGA 1NIJA 4HDQB 2ODEA 3LBHA 5H68A 4A0HA 1P6XA 1XB2A 4HUTA 1LS1A 4U5XA 1I4LD 2IHYA 4ASUD 2FN4A 3FPAA 4LHZA 2IS4A 2BMJA 1KOFA 2ZR0A 5K8UA 3QNUA 3H84A 2FFHA 4KLZA 1BKDR 2P5TB 4XOIA 4XWAA 5FH9A 4D4KA 4TQ9A 5JLJA 4TLEA 1CIPA 1SVKA 2C96A 1GRQA 1KYIA 2P5SA 3K9NA 1VCOA 2R6DA 3K9HA 3PUZA 3L82B 1HV8A 4I1UA 1W36C 2H18A 1IONA 1G7RA 2Z43A 2YC4C 2QAGA 4WA7A 3KB2A 1UKEA 2QP4A 2FX3A 5FI0B 3RLFA 4B3XA 5FTKA 4B48A 1YHNA 2XJ4A 2OUKA 3NC1C 4HUQA 1E9CA 1KO1A 3BWDD 5FR2A 2ZRMA 1EWQA 1M2OB 1GDDA 3K70D 2QI9C 4ZDIA 4Z8YA 3GLFE 3THYB 3WBJA 2MSDB 1IOZA 5CIQA 2ODNA 2OAQ1 1SXJC 4XD7D 4L15A 1GVNB 2J0UA 3CNOA 1R5BA 2GZHA 2QQEA 1W36B 3SZRA 1U0JA 5J4VA 1AGRA 1JBKA 2C77A 3QVVA 1GRRA 4LBWA 1UDXA 4TT3D 1VPLA 2F55A 4C2UA 3EZ7A 5AJWA 2GRJA 2E9SA 1V43A 3RWOA 1G3RA 1R5OA 2PEZA 2ZYVX 3B1XA 4BLRA 2W6JD 3KXIA 4GFDA 2YJTD 1JAHA 1OE0A 3BFVA 3EZ6A 3KDSE 3QXJA 3I8XA 5AJZA 4PZZA 2V55B 2WJHA 2AFIE 4YDHB 1ZCBA 2HDNB 4TMKA 1GTVA 2D7DA 2O8BB 1Q1BA 1N2CE 1VCNA 3PITA 2PZEA 2LKDA 1NLYA 4LJ7A 4PANA 3CUEF 4LYHA 2QZ4A 1DAIA 1IBRA 3SC3A 2B7CA 2WPDA 5FBLB 2R65A 1AM4D 4YONB 4EFNA 5LD2C 4I1SA 3QKRB 1XTIA 2VA8A 1LNZA 1NBME 221PA 4LBZA 1S96A 2EFEB 1JR6A 4JLAA 1P2UA 4MUBA 2ZVPX 1G19A 1QVAA 1XD2B 4IHQA 3P4XA 5C1BA 5A4JA 1TL7C 1G5RA 5JWOA 2P6UA 4L16A 2C9YA 4BUJA 1NMZA 3LFUA 2JLSA 3OEEA 2WJVA 2ZSBA 4I1OA 2VSXA 2WICA 5DNYB 1XTJA 2RHMA 1SVMA 1CF4A 4AIIA 4XVRA 2JEOA 4Z51A 2KRKA 4DJTA 3BB1A 1ZIPA 4LRWA 3CBQA 4YMWA 2G77B 4GPTA 3WMEA 3SFVA 3AGPA 1UAAA 3FTQA 3LLMA 4C0JA 1NL3A 1RJ9B 2XNDA 3N2EA 1JQJC 4LYAA 3B1VA 3CF0A 3ZYCA 3AUYA 4XWOA 2QP9X 5J5CA 1XEXB 3U3JA 2HJGA 1I2MA 2OLJA 2ZJYA 1OH6A 1G291 2YV5A 4OL0A 5CDFA 3EA5A 4CEJA 1II8A 3EASA 3QE0A 3VNVA 2F7SA 1LTQA 4GI7A 4QXAA 4RSGA 1WF3A 2A9KA 2RGXA 1RYFA 1II0A 2PX0A 1EWRA 1FNNA 4F4CA 5KSYA 5IK2D 5EP4A 3AV0B 4LJYA 3SS8A 5EXPA 3QPUA 4PQYA 4LJ8A 2V1UA 4B75A 2WV9A 1NVMA 2ZYWX 1JPJA 1G21E 1HTWA 4KBGA 4N0EA 4QGFA 3WYFA 4PSAA 2G0NA 2WVJA 2O8EA 3R20A 2V6JA 5TXGA 4EFMA 1W4CA 2JLUA 2AWNA 4A82A 4V0OA 1DO0A 4BFVA 1FL9A 1AZTA 1W0KA 2OT3B 3AP3A 1W44A 4MKIA 1ZBDA 5FTNA 1YR7A 2J7PA 2NO0A 2QE7A 3QG5A 3RNLA 3RS0A 4M0LA 1NY5A 2PCLA 5LDDC 4R9UC 4G5SA 4GOJA 3QI2A 2RGCA 2WSSD 3Q72A 1EFHA 4B44A 3O8CA 1FX0A 2XZLA 3FB4A 1ZUIA 5BYJA 3I32A 4Q7KA 1IN8A 2D3WA 2Q0HA 4WW0A 3GLGB 3EXAA 3HPRA 3VHLB 5DIFA 2GILA 1U8YA 5FTJA 4C0HA 2A5JA 2ORIA 5DLQC 1QG4A 2QUZA 4ZDJA 4QOSA 5KDLA 2IHBA 4DUGA 2GXUA 3ND8A 1TNDA 3RC8A 3U44A 4KFSA 4DT1A 1LFDB 1P7CA 1E0KA 1KMQA 2XXAA 4JVSB 5KNCA 3TNFA 4RFVA 3SJCA 1YR6A 3TUIC 3VR2A 2HYIC 3ICEA 3LQQA 2IYRA 4Q7LA 2X2FA 4FXPA 2QMOA 3AF0A 2ZRBA 4BFYA 1YE8A 1BYUA 2CLSA 4ABYA 3BXZA 3FMPB 4IEEA 4BFXA 1G6OA 2NZ8A 3U60B 1AZSC 1DADA 3T1QA 2XAUA 4B34A 1QHXA 4D2IA 3EWSA 2PMDA 1ONBA 2FH5B 4IOKA 4B2IA 3N2IA 4QHYA 3DO6A 1CJUC 5CYOA 3ICQB 1T91A 1G8FA 2PBRA 1AS2A 1RYHA 1XJCA 4Q48A 4BPBA 3L2OB 2F3TA 2QMEA 1BH2A 3VKWA 1YZQA 3U5ZB 2J46A 2R2AA 5LB4A 4HDCA 4PC2A 1QHYA 2GEDA 4HAXA 1P2SA 2VLIA 4J0QA 4TMZA 1OIXA 2JJ1A 1J70A 1E2HA 1KDOA 3NH6A 1R2QA 1KZGB 2UKDA 2HT1A 1UPTA 2AD1A 4N3NA 5FL7D 1YZNA 1LVGA 3T1TA 5KO2A 1Z6AA 2CK3D 5FOTA 2FEOA 5EP1A 2IUSA 2QMUA 1NSFA 2FOLA 4ZKDA 2H16A 4Q7JB 5EP3A 5DISB 4C7OB 3VHXA 3L0PA 5J4YA 1E9RA 1ZM9A 3GLFA 3B7GA 2ZPTX 4NBSA 3W8NA 5KNBA 2NOAA 4OK5A 3U44B 3NH9A 3REGA 4UNRA 4AD8A 3T5DA 1GKYA 4RD6A 4X8OA 3GP8A 3TGPA 3AVTA 2DZNB 2BBTA 3KQNA 4BLTA 1YZTA 5F9FA 3LAWA 1SVLA 3CNLA 2B92A 2ZJ8A 3QSYA 1GP2A 3QKSA 1IXZA 1E2JA 1ZU4A 3IUYA 4EPXA 4Q4JB 5G53C 2O8DA 2D62A 5A0FA 3HU2A 1KZ7B 4FWDA 3LNCA 4A2PA 4XJXA 1G8YA 1N0WA 2BMEA 1NVVQ 1LF0A 4CVNA 4BZXA 2ZI4A 4C0AC 3GJXC 1VG1A 4MH0R 2EFGA 4DCNA 2FNAA 3DMNA 2VP0A 1XEFA 1N6RA 2PLFA 4H1VA 5FOWA 1Z2AA 3D7MA 5K8IA 4JSYA 3KX2A 3OESA 1MKYA 2WJYA 4Y0VA 2JIZA 1EFUA 2R6GA 3TSZA 4P4UA 3Q5EA 4NCHA 5B64A 4HSEA 5KSOA 3W5JA 1JXMA 1IM2A 1NBMA 4YLGA 4NP6A 5AR1A 3PEUA 2OBNA 3KJEA 3I8SA 5FTMA 1OXXK 2CJWB 3QKUA 5E7MA 1AS3A 2HLDA 4TMWA 3TVDA 2EFHB 721PA 3K0CA 1EFRA 3RS3A 3DEFA 4HLCA 2X8AA 1D8TA 1DG1G 2VHJA 4YQFA 2VL7A 4D82A 4P3YA 4IKEA 5EUMA 3DDCA 1T9HA 2V7QA 1WBBA 1MABA 2IC5A 3M6AA 4MA4A 3WMFA 1X8KA 3P4YA 1CJMA 3OIWA 4W9MC 5LB2A 1Z0FA 5DE3A 1LF5A 3VR6A 4UJ5A 5HKKA 1GOTA 3BH7A 2AR7A 4PX9A 2CCKA 5JBQA 4L5BA 1GILA 1M7GA 4MYTA 2ZE7A 4PAQA 2ZRIA 5BYKA 1YVDA 2CE7A 1P9WA 5G40A 1KY2A 3T61A 2GF9A 1IY2A 4KI0A 3QEJA 1OJLA 1Z07A 4JKYA 3MAAC 3QENA 1GRNA 3QXSA 2XEXA 4WOPA 1JI0A 1NMXA 2OZEA 3R9XA 1T5LA 3PFIA 3GMTA 2DFKB 3E1SA 2AD5A 2Q3FA 1HQCA 1KDTA 3W6NA 4IDHA 2VPPA 1UBGA 2NPIA 3EWAA 1AKEA 2EWWA 5AJXA 5J4HA 5HZKA 1AK2A 3TUZC 1TUIA 5FOSA 1XDBA 4C0SA 5GVSA 1D2EA 2NZJA 4TSFA 2FPKA 2JLWA 1RIFA 2ZUCA 3CPJB 4Q4AA 3RC3A 3KZ1E 3TKLA 3U2QA 5JCPA 1GNPA 3KKQA 2Q9BA 3O8DA 5JHGB 1KK2A 1Q57A 5CJPA 3BC1A 1RRGA 4LDJA 2FJUA 4FIDA 3B9QA 3ADCA 4NCJA 2R44A 1XJ0A 1BYIA 4IVPA 1RVDA 1W2HA 3QJYA 4D4MA 4M53A 1WRBA 3C5HA 3IO5A 2BJWA 1Q21A 3N70A 1Z8FA 1E1QD 2A5YB 1FNMA 3O8BA 2G6BA 3MGCA 2WIBA 3AF1A 3HR7A 4RD4A 4GNKA 4CGZA 2JATA 1M7BA 1XBTA 2Y8EA 2CMKA 4QGGA 4C4PA 4DLUA 4NU0A 1OXUA 5D3MB 2PX3A 1ZM7A 1SXJB 3REFA 4DIDA 1NF3A 2Q3HA 2R8RA 1D2MA 3KQUA 3THOA 3EZ2A 2GJAA 4UNSA 3I72A 3KFXA 2RKOA 1II9A 1RE0A 1BO6A 3B8HA 4RZXA 4BECA 1E4YA 4TT3A 1GIAA 1DELA 2PEYA 4JBWA 4MGYR 2OCAA 4B74A 2W0SA 5GJVC 4BFUA 1M8PA 1G41A 2ZI9A 4QJ4A 3VMFA 2QBYA 4EUNA 2QGNA 1Z6YA 2GNOA 1E9BA 2RGBA 3E70C 1UJ2A 4S35A 2CXXA 4NYJQ 4IXNA 3GLGE 4ZI2A 1ZD8A 5L3QA 3TH5A 3IO3A 4CT5A 1FTNA 1NJFA 4QJ3A 3QKSB 4MGIR 3RS4A 2ATVA 2VHQA 4NYJR 5JS7A 1DO2A 4BGDA 1NJGA 1MRSA 3GJ7A 2ZRNA 1NVWQ 2Q6TA 4U00A 3FHTA 2W0MA 3FYHA 2QL6A 2I3BA 3GJ3A 4B2PA 4E07A 2J9RA 1TPZA 3QF4B 3LVRE 1W0JA 3OZXA 2PZGA 4CDGA 4DCUA 4BWYA 4C0QC 1OKKA 2IT1A 1RKBA 1P9NA 4KCGA 3ECCA 3CX7A 3V4FA 3U6KA 1Y63A 1E2KA 4YMTA 2MMCA 3RRNA 5DI3B 1S0UA 4HATA 3SYKA 1XTSA 2DFNA 4N1AA 3FVQA 3SBEA 1U8AA 2RAPA 1ZAKA 4A0GA 1R0XA 2ZRPA 4GP6A 3CR8A 3JZAA 5G41A 4XTCS 3MCAA 1NG9A 2QRNA 1HQYE 3NBFA 3K53A 2QM7A 4A1FA 4CW7A 4A36A 5F3WB 1VIAA 3UXMA 3CO5A 4PO9A 1E1RA 2E1RA 3KJHA 4ESHA 4LV5B 1DARA 3R7WA 1SKYE 4EQ6B 3SHWA 1DAGA 1WA5A 5HCNA 1ZD9A 1MO4A 2GVDC 4Q00A 4Y0AA 2GXAA 3PUYA 1A7JA 2XNDD 3KKMA 2QAGC 3DM5A 3HJNA 4JN6A 2FGKA 1ODFA 5AUOB 3FKQA 2CE2X 2IWHA 2NO9A 3JVUA 1E4VA 2ONJA 3U6BA 2IUUA 3CRVA 2V54A 2IK8A 3I5XA 4D0GA 4B3FX 3M0EA 4PQFA 4LX0A 1ZNYA 4GDFA 5HTKA 1IY0A 1HEIA 5SZHB 4CRWB 2X2EA 2P2LA 4PC6A 4OI4A 4JMPA 4XVQA 3L0IB 4OI0A 1T4GA 3K70C 3QF4A 4U02A 4A3VB 3QKRA 2UVQA
chains in the Genus database with same CATH superfamily
2XUZA 3SC2B 5CVJA 2XWQA 7YASA 1U02A 2QROA 3GPXA 2XF8A 4A2WA 4DY4A 1K9SA 2WM9B 4MQBA 4IIJA 1Q77A 2FW0A 4CWAA 1WEHA 4GR4A 1QHGA 1WEKA 3BM5A 3SSMA 1XVLA 2H29A 5AOBA 4I5SA 5K99A 4IGFA 4HQ6A 3AMVA 4F3RA 5IVPA 2GZ2A 3KZNA 3NZEA 2FPRA 1G21A 2DLCX 1N6HA 4ZCQA 3T7IA 2OCLA 1IVNA 3CWZA 1T9AA 4B73A 3KPWA 1BFDA 1JSCA 3BERA 4Y9UA 4HGYA 1OXMA 4BBPA 1JNXX 3H2HA 1OGIA 2ZB8A 5FIUA 4ARIA 3EG9B 3GU3A 3H5NA 2HH9A 3FHJA 3NIFB 1SURA 2TMGA 3UH0A 3MAJA 1ZITA 3H2SA 1J49A 1O3YA 3TIVA 4LWZA 3V1MA 5E0OA 3VAAA 4QLBA 3KSBC 4AJHA 3VBEA 4CDMA 1JDVA 1FLDA 2VH5R 4NY1A 2X49A 2PZAA 4CQLA 3DFMA 4NH4A 3WLRA 3BFXA 1VYTA 3RHSA 4DC0A 2JDIA 1ZQ9A 4X44A 2DAIA 1P60A 3K6RA 5IXSA 4AU1A 4ABTA 2XRFA 3GPUA 2BGMA 3EE6A 3IEVA 5DBEX 2BD0A 4ZGGA 2AZMA 2VHWA 4R8VA 1Q0QA 4TZKA 3OX1A 5HA5A 4D81A 3ZHBA 1V2HE 3I4VA 2APLA 3DV2A 1JXOA 4FSHA 3FYTA 5FKJA 4BY9E 5TS3A 3PR2B 5EWJA 4JDPA 2O57A 1Y4UA 2Y1GA 1XRQA 5MFPA 1XK7A 5BSEA 3JQAD 3ILXA 1XIVA 4KQHA 1N2ZA 5LA6F 1LBEA 1PJRA 4E09A 3DBOB 3QVMA 4X20A 1ZRNA 3HJAA 2O8DB 3B5IA 1KP2A 4CKBB 4TMVA 3PIDA 2FGJA 2FW8A 1M2KA 4S05A 2QM8A 1OAOC 2ZJ7A 1I6LA 4NE2A 4YB8A 1E6EA 4J3NA 3L7IA 3HXLA 1DAKA 4D0NA 5FOVA 5E7JA 2AOVA 4GZ5A 1SXGA 1TDHA 3LK6A 4W5NA 5B3JC 3CG4A 1ZJ4A 2V3CC 4ACBA 1JLLB 4JJ4A 3UOAB 2VHVA 3CQ9A 3VNSA 1POWA 3RGSA 2YCBA 2E5LM 5IDXA 3V1LA 2GF2A 3DZ8A 4UBKA 8AT1A 4NCNA 2P6RA 1NUPA 1SM4A 1VP3A 4BZWA 3EF3A 1KA9H 4UXIA 1PV2A 3DHNA 2EU8A 3C4VA 3IAUA 3GZNB 5K6AC 1BG6A 4AY3A 1NV8A 4EELA 4CV2A 2INGX 5E9JA 3JZIA 4FK8A 3JQGA 4RVSA 1DRJA 3CVJA 4KUHA 3T1OA 2AQ8A 4MUEA 5B2EA 5JECA 4BMDA 3OFND 5BW5A 4RTNA 2VWPA 3Q9LA 1J6UA 3D8HA 2I3GA 2XA9A 1UPCA 4TL9A 3R7SA 3UQYS 2FWJA 2M1XA 1ZU5A 1FQKA 1YC2A 2Q28A 2WAOA 4G0NA 3CEAA 4M49A 1PG0A 3DFUA 1Z33A 4W4TA 1BZYA 1ZKMA 4IF6A 4KOEC 1IOWA 4KPGA 1UJ4A 1E2PA 4WY5A 1VIVA 1QP4A 5IYZA 2WPDD 4A0QA 2NU6B 4UD6A 3EEIA 4LXIA 2UZ1A 1DBWA 4MDHA 3WBFA 5FFFA 1GDTA 3HUFA 3GLQA 2ILVA 2NZ2A 1AGPA 2EKPA 3L7CA 1AXRA 3MPUA 3OFKA 4JJZA 1Q1AA 5JS1A 1H5QA 4L73A 3ADOA 2WD9A 3K20A 1L7PA 4MRRA 2D2EA 3SK0A 2KBFA 2Q50A 2O2ZA 5BWLA 2WA1A 2PCJA 3Q7PA 4GPD1 2BZGA 4IWNA 5DI9A 1VZ3A 3WRYC 4PBTA 2IQ5A 1PQYA 4UBLA 2WHEA 4HDNA 2Z56A 2JAWA 1QSGA 2BRUA 2ZKIA 3OEED 3TTWA 4TPKA 4DDTA 10MHA 1GZVA 2OILA 1T5BA 5T3YA 1ZEMA 1ZW6A 4LGCA 3QG1A 5DNAA 2Y9MB 1FJGB 2UUAM 1U3TA 4YAJA 3GLHA 3LLCA 1L7VC 1BOOA 3RG2A 5AFSA 2HYDA 3KVRA 4HGZA 2XJ9A 1QIKA 4LWPA 5DMXA 1N34M 5KYYA 3ZD7A 5ERXA 3MK31 4OM8A 5K2MA 3HWRA 2BFEB 1WZUA 1LI7A 2GCGA 3OKCA 1USVA 4FHGA 5ALNA 2IZ6A 2R97A 2Z5FA 3N8KA 1KEWA 1BH6A 4W9NA 5AVZA 1RW4A 3GQVA 4HB4A 4PYOA 5BV0A 3R75A 5I7WA 1G3MA 2XYGA 4GGPA 2YXBA 5ENZA 4ZT6A 1VDMA 1ULBA 3DL0A 3CNQS 2E5FA 1LDEA 4MA0A 4E21A 4P4LA 5CFMA 1UJBA 3I2JA 3CGWA 2GN8A 1VE9A 4W5HA 5TEWA 5EXSA 1QVZA 1J4AA 1NLZA 2C4VA 2X9LA 2XQVA 4D6PA 4CTJA 4YMVA 2WT9A 4ZJYA 1OILA 5FUYA 1TO1E 1NN0A 2ONKA 3R77A 4KGDA 3VKFA 2XNCA 3VFDA 4CLXA 1KEKA 3KL4A 1UWCA 2YV3A 2VDWA 3WLNA 3P9PA 1SOWA 2IXTA 5CNKA 3ZDYB 3NOVA 4E6PA 3CURA 1G5PA 3NHRA 1T2EA 3PKJA 4TQUS 3T3MB 3L8MA 3CLUD 4RNCA 5JOQA 1IWOA 4DIFA 4GQIA 2C7PA 1NW5A 2GD2A 2P2DA 5EZ6B 5DYIA 4BFCA 5BNTA 3C3BA 4QGSA 2YYYA 1A8HA 2QL9A 4BO1A 4NXMM 4CMCA 3O4HA 1DC7A 2FE4A 3HYLA 2GERA 3U6PA 2QYTA 3ICOA 2MSWA 1U0HC 5KPRA 3AM5A 3PQDA 4U3JA 4C7JA 4DLSA 3SYRA 4XARA 4FZ3A 2ZB4A 4QJBA 4DXAA 4DXHA 5HXAA 5INTA 4Z9FA 2AN9A 1AKQA 2F2TA 4H7DA 3BRSA 2FU5C 4RF5A 3NETA 4YJ2A 3AP2A 5K3OA 1K6EA 1XTRA 2R8XA 4LXTA 1IN6A 1HYGA 4IBIA 3B36A 1NYTA 3OQIB 4FI3C 3VDXA 2I1LA 3HWWA 3KQLA 3MJ5A 4P38A 3WXBA 1UMDA 1OHHD 4C14A 4QUAA 4A0RA 4TWZA 3C15C 1PHPA 2GK7A 5F33A 4DG8A 2WWIA 4TLAA 2DCMA 4UARA 4EG6A 1GUYA 1P7VA 3ABQB 3O90A 4GI2A 4M6WB 3IIJA 2H1WA 1WGNA 4HBZA 5CURA 3VO9A 3K8OE 5F12A 2YOFA 1KNXA 2IIPA 4ZALA 1D09A 4JBLA 4FBMA 1L5QA 4KOAA 4J75A 5DM4A 1BCRA 3L9WA 1EFTA 3VGPA 4L74A 2V7PA 5FEMA 5EVJA 4EF4A 3WHLA 3QFTA 3VSBA 1MEOA 1PGYA 4AAYA 4DMCA 2YICA 3IUNA 2JL1A 2GCOB 1B14A 5BO5A 2BPOA 1U3WA 2O5VA 2QD3A 3ZDXB 3KOWE 1KJZA 1Z0SA 3R8XA 2I91A 2C1EA 4NV0A 3T7KA 4WZAB 3QUQA 3KHTA 4JJ7A 1NN5A 4TROA 4LSGA 4X7PA 3ESZA 4BS9A 3UB4A 1I6KA 4CBVA 3WAGA 5KC9A 3IURA 4R3WA 1EX7A 3EZ9A 3JTMA 4OI1A 4KXUA 5L45A 4UQPA 2FEWB 3AJEA 3BIFA 3H9JA 3IS3A 5EJGA 5FLXS 1DG3A 1E1NA 2REBA 3ML1A 3CEJA 4BVJA 5IXYA 5JY1A 5DDIP 1CR0A 1D2HA 2M2IA 1ECJA 4DCMA 1TZKA 1BQ4A 2YH2A 2ZYAA 3F4KA 3AG6A 3GBSA 3OZRA 3Q5DA 1CUAA 4FKBA 4IXMA 1R8SA 3VR5A 1AHIA 4C06A 5IUKC 5CG2A 3H9UA 4FVMA 2WJJA 1CJVC 4BEJA 3II6X 1LY1A 5IF9A 1TAUA 3G7NA 1N32M 3MJCA 3S5UA 2FPWA 2OQ2A 4KZKA 3CC8A 4Q19A 1KS9A 4ZOLF 1E3WB 1NHGA 3N6VA 3LT1A 4MRSA 4CR6A 2I6QA 3G0OA 1LBQA 2IYYA 4RD0A 3STUA 3MM4A 4E12A 3DVLA 4E6EA 3SSNA 3J7BA 3CKMA 4BFTA 4MS3B 2NNLD 4O4JA 4EHFA 2OQRA 3H0KA 4LDNA 4WLOA 4TXMA 1W29A 5BSUA 2CNDA 4CETA 1LLQA 3EYWA 4AS1A 4MW5A 2KE5A 3EULA 2MSEB 1G20A 1X1SA 3TN7A 4DIOA 3D2BA 2W2KA 3DDNA 3WYAA 1OYVA 3ZCRA 2OO5C 3QFRA 2OGZA 4YXWA 2BYTA 2KHZA 5F7XA 5BWCA 2YVAA 2ZI6A 2DPMA 4BP3A 2ADFA 4OB6A 2VWQA 2H2AA 1QHIA 4CHTA 2GASA 4FYPA 5BYBA 3DL7A 3KS8A 2YR0A 4US1R 1E2NA 5CLQA 2NVUB 3G2QA 1QHSA 1RC8A 3TW0A 3QV2A 4HVTA 1ES9A 5LFAA 2OB2A 2QPAA 1DBSA 4LXGA 2XX3A 3TAHA 3UAGA 3AZOA 4XYBA 1OB5A 5T4HA 1SUPA 4YJ3F 1QBGA 1RKUA 2A9JA 4NG4A 1T6YA 1QZZA 3TOXA 1DI0A 4NZOA 5KNBH 5GP1A 4JLNA 3VV3A 3D6JA 4BGIA 4DSAA 4OA8A 1APBA 2N46A 1DDGA 2LR0A 3OICA 1F51E 1V11A 1U28C 1OZFA 4RKFA 4TX1A 1OC2A 2R60A 4UEQA 3VI3B 3TRIA 3S68A 3ZKWB 2FSIA 2VBIA 3LVBA 4MV4A 1BE0A 3MCZA 2HA0A 1WTAA 3WL4A 1DLJA 3P71T 4JT4A 5FBHA 3ASYA 1CVRA 1Z4JA 2W71A 1TB4A 4TTQA 2ZSUA 4QXQA 3VM6A 2I6SA 1L2DA 1MG5A 5ELLA 5BVHA 1OB2A 2OG2A 3VLFB 2EGUA 4G9BA 4GM0A 4UHHA 2DPXA 5B1SA 1FMLA 2C92A 1HYHA 3L0CA 1GTJ1 1Y98A 1XJQA 4G5FA 4ODIA 4ER5A 4IMIB 1ILWA 3KFVA 3LHSA 3Q7QA 4WV3A 3WRXC 5E6RB 5C32A 4AY4A 3PUXA 4H6WA 4NPAA 4L78A 3PUJA 2WYOA 3WGHA 2DPLA 3Q40A 3K0SA 2ZBRA 3U0BA 2P2SA 2ZI5A 1X42A 2RHJA 5IFKA 1NBWB 4YAGA 4LCJA 4UXHA 4DYDA 4LJ5A 3AC0A 3GYGA 1PT5A 3I4LA 3RU7A 4LMAA 3MIZA 2M98A 5HIIA 3QVSA 3FNHA 3RS7A 1LSJA 2CHVA 1Q7CA 2H1IA 4URHA 5D3KA 1KI1A 2IA5A 2KWIA 4OV6B 1PK9A 1XVUA 3FOWA 3ZWXA 2PT7A 5BP7A 4MGKE 4PZPA 1J8VA 3H2JA 1A2OA 1XC8A 1ORHA 1WCV1 4MKHA 3NYRA 5CR9A 4JGBA 4Z54A 2YUTA 3F7NA 3MUEA 4RXTA 4JI2M 5EE0A 3D2AA 3CWQA 3ES9A 4LYGA 3LCRA 4Z1OA 5IJ9A 3R6TA 1WKCA 2KHHA 2ZTDA 3AI2A 3GCXA 3HB0A 5D1NA 4E13A 5B2FA 1NAHA 4PU0A 1SBHA 4N76A 1G16A 1MV5A 1EZ1A 1M0SA 4DSUA 1BWRA 5KPTA 1IEQA 1YQUA 2J9ZB 3TVTA 3GDWA 4XUDA 4UTNA 1JW9B 3RU9A 1RYBA 2AFHB 1DAEA 1V7QA 2EGGA 1DEOA 3BMOB 1N2HA 3CPHA 2HJRA 2P69A 3LP6A 4ZGBA 3HB4X 5IMSA 5JZSA 4RBNA 2DHDA 5CDSA 3ZZTA 2REQA 3RSSA 3FKJA 4G01B 1SXHA 1N1GA 1WMDA 4I9NA 3ZWDA 5KDDA 5LVAA 3EPKA 1U0LA 1Y4SA 3ZBTA 4DQ0A 3THXB 1L1FA 5BWOA 5E7QA 4YGXB 3ZLJA 3I9V6 3MJHA 5FUQA 4PVDA 2KJQA 2QU7A 4TS1A 3RBZA 4F86A 3BDIA 4DR3M 2QG4A 3ETHA 3COZA 4M9SA 1RCFA 1T13A 3O4RA 1T4BA 3FPLA 4FFDA 3LO5A 1HJPA 3KXPA 3BX1A 3WP1B 4ARAA 1WCWA 2RGNC 1HDCA 3DE5X 4ZCRA 1GQFA 1MGPA 2N9UA 4MV8A 4XLTA 3AFGA 3FFBA 4G4SP 1PKXA 1S5PA 1DKNA 3T7AA 2AXQA 4KFTA 2R1VA 4BLUA 3OUZA 1MQ8B 2IPAB 3QWFA 1TGUA 1BDBA 2SHKA 3QBEA 3R3SA 3OY7A 5EZYA 4L8GA 1JEYB 1EJ2A 2CP8A 3VTKA 1FF9A 4NATA 5JH7F 1EB8A 1P0FA 1NPTO 2CV1A 1VE5A 4Z9XA 3RRZA 4DNPA 2D8AA 3EY9A 1CUVA 1NVKA 5TDHA 3TL3A 4TLDA 4TSFD 4I81A 3JX9A 4BNUA 4EHNA 4WZZA 1OWNA 3OT4A 4QOJA 5EJ7A 5CCBA 1EXDA 4HZUB 5JJLA 5H3HA 4XBOA 2WTXA 1FYWA 2FR8A 1T8WA 5DNEA 5E6UA 4DANA 1VLJA 4PIMA 2C8LA 3NI2A 5B30A 5GGXA 1Y34E 5A4IS 1VG8A 3VR5H 1I30A 2ZAOA 5H3CA 1P2GA 1G6HA 4BLQA 2XTMA 3L7BA 4WBSA 3QPWA 4G5YA 2AMYA 1ODIA 1N9ZA 3PKIA 4TOIA 1ZK2A 3VC1A 3BRQA 2QN1A 4BVBA 5C81A 3E81A 1RHMA 2UVDA 2CYAA 3RG8A 4P16A 4Q82A 5HKAA 4JI4M 1E58A 3OAAD 5IMBA 1Z0UA 4WLFA 1U2RA 2BISA 3HP7A 3SVZA 2G83A 4CPDA 4Q4LA 3QMMA 1OZ0A 4JC8A 1H1TA 2HT6A 2W2PA 3FAKA 2PU5A 1YBVA 3L8EA 3K0HA 4X64M 3SAVA 3AW8A 3M89A 2ZXEA 4JJIA 4TXJA 5TSDA 4B35A 4I8IA 4RL4A 2VYQA 5DX0A 4C4XA 1CHNA 3R3YA 1KMNA 4ZVTA 1B2LA 4O0LA 5JAOA 4REZA 1CV2A 3TL4X 1RI4A 3LC2O 4RSHA 4A4DA 1GQYA 1PFUA 4IIDA 3QNWA 1C4OA 1W4LA 4G8DA 1ONSA 1HGXA 2F8LA 4FEEA 1JR2A 1TCBA 1IYZA 4GSKA 3DAGA 4MAMA 4YREA 2GBLC 3M6XA 3U7QB 1Y8RA 1YTUA 2QVZX 2QJRA 4E7PA 2X9QA 3PFNA 1KDRA 3TIXB 1I01A 3O0DA 4UM8B 5KAMA 2R6CA 2FMXA 4FHZA 4QFDA 3EGXA 4R2KA 1ADCA 4RDXA 3T1YM 1WO8A 1HC7A 1XTKA 4MRAA 4QBIA 2ST1A 4ND8B 1WM1A 1ZICA 2SCUB 1YHYA 2EKFA 1CR4A 5FTLA 1TVCA 3L0SA 1E89A 3EDQA 4RV9A 3R6DA 4UQOA 4DPMA 1H85A 3Q2OA 4JROA 1LW7A 1Z45A 4PV7A 4X92A 3ZQUA 1HLPA 1KQOA 5HNKA 3KSAC 3WJAA 4DJEC 3CFYA 2LNHC 1YI1A 3FYSA 4HZUA 2VQEM 2KRUA 3QQ5A 4KXFB 3RJMA 1CUKA 1WPGA 5EVCA 3CEMA 4GX1A 4LG2A 2Q3JA 3P20A 1Q2UA 4OLFA 4PLVA 5EJFA 4AZVA 4ZU3A 5JTTA 2EQAA 5C35A 1FSSA 4ZJPA 2I71A 2GPJA 3TR5A 4K2HA 3DOJA 2FFAA 1YOVB 1N5DA 2I4MA 1GFZA 1CBUA 2WAAA 4GZLA 2VAPA 1TCVA 4OQEA 4C0KA 3RADC 1G18A 1VL8A 4NU8X 1GARA 5KHAA 4AJIA 4LY3A 1A5TA 4KQXA 2L82A 2ZM6M 4B47A 5BT9A 5KKCA 1JHVA 1KJIA 3DE6X 4P1ZA 1UPBA 1QP0A 3KOXA 2QB5A 2ZJ5A 2I3DA 5BWMA 5C4IA 5K0FA 2YYZA 2OGTA 3IUEA 4GSYA 4JGGA 4K9KA 1C3LA 4JOBA 2C83A 4RH3A 4NABA 1K6XA 5KKNB 2WYHA 3VPDA 3O8CA 3K92A 3BL8A 1FRVA 1HMPA 3GCZA 4UXJA 4QU0A 4BBJA 3TLEA 5ALVA 1QP7A 5KPDA 1QM5A 3ZIAD 3L7JA 1MT0A 2OD2A 2R00A 1IUPA 1LK0A 4XB2A 4KTVE 5FP0A 3PNLA 4YQYA 2V1XA 2P1DA 3MJRA 2V6IA 3W2HA 2WFZA 1SCJA 4CF7A 5JDCA 1YC5A 2H9IA 3MB8A 1UDAA 4OH1A 2IYPA 5EXTA 2YXPX 4LHSA 4OJMX 1PSDA 1R6TA 3GQ4A 1E7WA 2PS9A 2RMKA 3ASZA 3QVOA 4CM3A 3E53A 5C3UA 3FWZA 1XZGA 1TT5B 5G4KB 1Y7HA 3U13A 3PUIA 4YY3M 3FDJA 1M2HA 4ZREA 4BPBA 1IZZA 2MJ5B 1WMSA 5JWHA 1ADGA 2JH8A 5K1ZA 2BFFB 3QWLA 4NBWA 4RK0A 2IXDA 3GRCA 1L2TA 3E5HA 4QYMA 4RD3A 5B7NA 1P0IA 5EHZA 2PS0A 3WB2A 1F9EA 2I4OA 3OZUA 2H17A 1X74A 2QD2A 4KVAA 3KYCA 3TKYA 4AF6A 5B7PA 3MCTA 1PDOA 3ENWA 5DHQA 3T5TA 3B60A 2A7QA 3FLEA 2EP7A 4HP8A 2DENA 3W5UA 4OAPA 3ZLTA 5JEDA 5JPCA 2AKEA 3X2FA 4MCJA 4YCAA 4YCDA 3MWKA 2MJLA 1FVOA 3DZFA 2UZ3A 4N7BA 3L6RA 2WIDA 4UCFA 2VR1A 2NG1A 2GEJA 2JVJA 1M72A 1TA4A 1HY3A 2BFPA 3OZBA 3TOZA 3I01A 1SA0A 2MWMA 4CLDA 2CBZA 3BXPA 3NCTA 4RYLA 4BKQA 1I4WA 5DBGA 2NZWA 4FLEA 1NVUQ 3BTUA 5TQVA 3DAYA 3VKVA 4MWDA 5EKUA 1V5FA 2X1LA 3OZ7A 4DDUA 2XODA 5HOEA 1NP6A 4TLMB 1KBZA 3AW9A 1E9FA 3OBIA 2P2GA 3NGLA 3OCZA 3HB9A 4QLOA 3WDKA 4DLTA 3BQMB 3V46A 5GZ6A 1E59A 1MENA 4NYMR 5ALJA 2GPSA 3GFFA 3U1TA 2QUAA 1GPDG 3FR8A 2R66A 5K3CA 3JAKB 4ZYLA 2WWTA 4R81A 2ZCJA 1ZO8A 4NCBA 1G98A 1HYBA 1W8IA 3D7KA 3G7UA 4I50A 1HR0B 4WY2A 3S2IA 3DB1A 2QEQA 3N8IA 2D4HA 1UXIA 1OT3A 4FMBB 5EA2A 3OZTA 1B8NA 2HK9A 4TLCA 2NWQA 2QVBA 2O4UX 2B4QA 2FPPB 4FT4A 1TJPB 1VL5A 4FMDF 1NF2A 1IXRC 1PE0A 2BFFA 5JU6A 2ID7A 3SIRA 2OSBA 2R5FA 1UQTA 1Y9AA 1A69A 2FXIA 2P91A 3N0XA 3C98A 4DC1A 1WZIA 1E7RA 1FFSA 3FPFA 1LBIA 4NU5A 2ZUBA 1J0BA 2G7MC 4MV0A 4RWEA 1GNLA 2QSUA 2W8BA 5DLYA 4MUYA 2HXYA 4ZAGA 4F11A 3L0BA 1PGQA 3J7AC 2QDXA 4MW0A 3S0JA 3MC1A 3WLHA 3AV0A 3BHJA 3FG9A 5AMXA 1BA3A 5FJJA 3NTOA 3RYFA 2V74B 4RW0A 3USZA 4HNUA 1XTTA 4JIMA 5THQA 1X7GA 2OESA 3D0KA 1ECCA 4P7FA 1PW7A 2BGLA 1M1UA 3FMOB 1EVEA 4YAUA 2HO5A 3DMRA 3AB8A 2DFLA 3FLAA 4TWBA 3UT5A 2E6KA 3H4TA 4DSTA 1PFYA 4V1CA 4J0FA 5ECWA 4MRNA 3R7NA 1W46A 3VAZA 1QO0D 1T8UA 4UHKA 4MVJH 3ZWOA 3DD1A 1G63A 2GLUA 6GPBA 1G42A 5CCXA 2E85A 3P0IA 3IQWA 3QEAZ 1VHQA 1RDFA 2JF0A 1X7XA 1ZAEA 1DQSA 1YS7A 4NBTA 4FGLA 2H52A 1USGA 1JKFA 1KJ9A 1XAJA 2DHCA 2ZE5A 5EJ5A 3MWJA 2QAIA 3HWSA 4PYRA 3AJIB 4WNYA 2GNAA 5JR3A 3MHTA 5E6SA 3K09A 3RRYA 3VMMA 3BL5A 4BLVA 3PL5A 4GL2A 3NRCA 4LF9M 4M36A 4QUHA 3O95A 1HLGA 2QPOA 4GX0A 5ULLA 3WK8A 4EJ0A 1PL0A 4ENSA 2UXCM 1J7KA 2C4UA 1E2GA 2FN9A 1WVIA 3HC7A 1JQEA 3RT7A 3E9CA 4U2GA 5E3JA 1EBUA 1ZVKA 1OLXB 2ENWA 1D2NA 5KUTA 4E5NA 1ORIA 4CQLB 4K0KB 4HGOA 3WP0A 4NBNA 1CUDA 2XWBF 1X9HA 5JXIA 4KYTA 1KIMA 1IHPA 2JAHA 3MNFA 4H18A 3W90A 2DR2A 3JTEA 2YOHA 4A5OA 1F14A 2C8JA 4QBTA 5DOZA 5LMUM 1WHCA 1CS4C 1YKGA 2Y66A 3LX5A 5J4VA 1GKLA 3WO0A 5B53A 2G0TA 5C2JB 2H1LA 5J2TA 2ZJ6A 1Y3HA 2WZDA 3AXSA 7CATA 1GADO 1QH8B 3L6UA 1XCPA 3ZZMA 2FZVA 2JLRA 1L5LA 2IS1A 1YJ5A 5I9TA 5IAGA 1GAEO 3K70B 4GOKA 4JK3A 2X76A 4QQRA 1D6SA 5H70A 3VU1A 4OQYA 1T4CB 1W581 1UP6A 4O2AA 2BWBA 4Y6QA 5TE9A 2F6RA 3V8PA 2J3HA 3LWDA 3E46A 4Z49A 4EA9A 1NMEA 5KWIA 4IG9A 2OC4A 1YACA 2P9CA 3D4PA 3JVVA 1DEAA 4V1CB 4LYDA 4LK2A 2CC2A 3WAJA 1UKZA 4LZLA 4DR3B 1AZWA 1L5GB 1CTQA 1SZCA 4LRSA 3CGGA 3AJDA 4LFAB 1BXRA 3FWYA 4MIKA 3MFYA 1C9EA 1QMPA 4MXDA 5ADUS 1DOHA 3SYTA 1GZ4A 2P9YA 4AY5A 3B7WA 6CHYA 2PUFA 3HZRA 1CY0A 1PD1A 2FN8A 1SVUA 3LXUX 4KR7A 2FZ5A 2HSZA 3E3MA 3FCSB 5AW3A 1UR5A 1J8YF 1JR3E 4JLJA 4BP9A 3A3OA 1JJVA 4BJ5A 1YRAA 3KOXE 4M1MA 2K87A 3EFOA 7REQA 4OXXA 3KJNA 4DA8A 2C2KA 4X1OA 4YRIA 2PKRA 2BE7A 4RZSA 2L17A 3IVAA 1Z6PA 2OM2A 5FUXA 4A0SA 5JZ9A 2AEFA 3UYKA 5HJ2A 3O38A 3W3AD 2XUKA 3QX3A 4RF4A 1EGVB 1M2OA 2ZBGA 3R5FA 2WM2A 4RV4A 4YV2A 5ADHA 4UHFA 5LOVF 5JCZA 4JEHA 4QBFA 3GL9A 4MLZA 4M0MA 3PYXA 2DAGA 1ULAA 4P84A 1S2DA 3FPHA 1HO3A 3VGJA 5A2GA 1I33A 2UZ1B 1CY4A 1PJLA 2C54A 1FTGA 2AE2A 2YJ4A 5AVXA 3A6HA 3F9IA 1I0ZA 1L5MA 3TLMA 4DWOA 5KSZA 4BMVA 1D6MA 4GVLA 4XPIB 5K3AA 2JJQA 1KK0A 1PJ2A 3M83A 1E6WA 3HYSA 2R4EA 2ZTCA 4DADA 3LK7A 1Z22A 3GDGA 3RJZA 2M9MA 1P75A 4LI0A 4D9GA 3BXFA 1N2GA 1AO0A 2NO7A 2YV1A 1JTEA 1VC2A 4GHWA 5DEOA 1NI3A 5DHRA 3AVWA 3L7OA 4UFNA 4FFOA 3AU8A 3UMFA 3E9MA 2AK3A 2W2VA 3M6MD 3RVSA 1E3EA 3VTFA 3VV2A 4B3BA 2HHHB 4LCEA 4OVZB 4N3BA 1AF4A 4XUEA 4FFPA 4AKIA 3K32A 1CG6A 3EVTA 4EUSA 3PXGA 1H2ZA 3UBTA 1UP4A 4Q24A 4EVSA 5I6DA 2QUHA 2BGWA 2JAQA 4QGHA 4II3A 2D06A 5EJ9A 4ZVMA 3R8CA 3CWCA 1CUUA 2I8LA 2PMKA 3AL0C 2EC5A 3D4NA 3UVEA 5K2OA 4Z1MD 3DQZA 2Q45A 1UANA 2QRLA 1HLDA 3DEHA 5B7QA 1GCAA 3AEUA 4B6QA 4D8TA 5K3EA 1CQPA 1L4NA 4LHVA 4EM6A 4DV4M 4L57A 3KZVA 3OSUA 3C8UA 4YMSA 4ETNA 1ZXBA 1I1OA 4CEIA 4FQ8A 1BKYA 3NHWA 4RD2A 4ZCIA 5LNK6 2GEBA 2G9QA 3SEQA 1HNZM 2E21A 3DGFC 2CUNA 2O48X 1K8QA 4OXKA 1DXHA 2G1JA 3I9FA 4X3OA 5AJTA 1CDEA 3CH4B 1RZRA 2C59A 3CF6R 4Y1EA 1LJ8A 3RS5A 3X1JA 3S1SA 3PNKA 2F64A 2RIPA 3DW3X 3E0QA 3JQBC 1PQUA 3ZD8A 1TFUA 2ZT6A 4D6YA 2I33A 1SCAA 3BB4A 4H3SA 1Z4KA 3FNQA 1SPBS 1V8BA 3AUXA 1KEVA 3FZQA 3HFRA 3QSGA 2W37A 1UEIA 2RAVA 4IDDA 4Y7DA 4QM7A 1CUJA 4MJXA 3BMXA 4Z7OB 5EWJB 5AVKA 1HLFA 1QC5A 3QY0A 1MV8A 5EXDA 3GNQA 2NYVA 1FIUA 1I10A 1EMDA 4F9EA 5JS8A 4F1JA 4RETA 1BEEA 1Q3TA 1ZIDA 2JNWA 3BA6A 4FFVA 2OXTA 1YFJA 3HK2A 1A9XB 1J2JA 1M7HA 1QOZA 1H42A 2LTAA 3L8GA 2F1OA 2PWYA 2QT1A 3ZWBA 2V7XA 4J7UA 4URYR 1RWMA 2XHEA 1NDQA 4CKBA 5ESWA 3BWEA 3LGXA 1QIFA 4NMWA 5IDWA 2N1BA 3K9CA 4W1SA 3RABA 3J81S 4EPWA 1KDPA 1QZTA 1J8MF 2FQYA 1F9AA 2QL5A 4GOND 2XMSA 1RMQA 3PX7A 4O2BF 3DV0A 3U9LA 2YFYA 4CKEB 1G9TA 4OM7A 3W7BA 2DZDA 4ML3A 1XB2B 5KCMA 3SQXA 1VFNA 1Z36A 3HBLA 2AC4A 3P4UA 4OX9B 4I8DA 4AULA 4WJZA 4GP7A 1MT3A 1KQPA 2WU8A 3NVMB 4QHTA 3D0RA 4Z7JA 5JAPA 3SZMA 3CN7A 2DQSA 2VXCA 3IPCA 3RIXA 1GKUB 4PM4A 3RKSA 2GLXA 4KFUA 4AKTA 5J1TB 3FOCA 3UV6A 3I9NA 3CNNA 4MQ5A 1P61B 2GZAA 3RF6A 4IVNA 3J80S 3A05A 1YRQA 1CE8A 2HM7A 1NM5C 4HZGA 3KJXA 1SH7A 3M2TA 2JIDA 1ZI6A 2QN6A 3AO0B 2DHRA 2NVBA 4C3VA 4HADA 2B2XA 5FOUA 3PEVA 4H4EA 4Q01A 2B5OA 3BWCA 1W9MA 2RC6A 1XZMA 3PUVA 2YV4A 4RVHA 5JATA 3CMMA 4MQMA 1E32A 1J22A 4ISCA 4Z4GA 1WWKA 3ECAA 1Q0ZA 3FFAA 3N8DA 1EVQA 1QC5B 1NHGC 3GK3A 4I14A 4JELA 4BLOA 2FWAA 3MXTA 1C7ZA 4DQXA 1XKXA 5DHFA 3DAOA 4ZZ0A 1PK8A 4NEQA 3SMPA 2RGGA 3ROEA 4QVIA 2GHQA 3LYAA 2GEFA 1A88A 2LVPC 3IEXA 1VGVA 4OQPA 4JEUA 2O8FA 2BFBA 3W68A 4ZVQA 5JUWA 3I04M 2HZBA 4BNMA 2DAKA 5KPJA 1KK3A 3A14A 4F46A 4UU7A 2QTGA 1DXOA 4JC5A 3OIUA 4Z53A 2P65A 4HGPA 1AX9A 3K1YA 1I5RA 2BI7A 4B2LA 3H05A 4R8LA 4YRMA 5THXA 1BS9A 2OFPA 3H2YA 3OPMA 2PGOA 5CNMA 4ZVVA 3IMGA 1XVVA 3AH8A 4OI2A 3MBOA 1RADA 3P2JA 2RHTA 1R0KA 4DR5B 4OFZA 4BNJA 1E2FA 1GHTA 2WMOB 3PP8A 3ZW9A 4B3MM 2NSYA 2GD1O 4MYCA 4QQFA 2OV2A 3C41J 4A6DA 1Q3CA 1NNI1 1XTPA 2BEKA 1Z73A 4IHJA 1U5BB 3FCYA 1BWPA 3O92A 3ROPA 5C80A 1CIJA 3GFTA 3UY4A 5LZ4A 5IT4A 5BY2A 1CEXA 1GSOA 1JIIA 1KGDA 2C88A 1RJ9A 5TY0A 3FZEA 1NM5A 5CM9C 2OENG 5EHGA 5KYWA 3FH0A 4K81B 2PR7A 4NDNE 3COVA 1B1AA 2B0JA 2WKSA 5C8VA 1R0YA 1NXTA 1Y1QA 4R1TA 3WJ7A 5C7IO 3M9WA 5IM5A 3U7HB 1SU8A 4GICA 3REQB 3EYAA 4Q34A 4TMTA 4F5EA 1M5TA 2O2SA 3P2EA 3KB8A 3TK1A 1GPAA 4NECA 2O7VA 2C2HA 2GGSA 2IYLD 3BWXA 3CB4A 4QO8A 3LVWA 1Y3AA 1ID8A 1I8TA 2WF8A 2O3JA 5KC8A 3V6LA 4OBBA 5DMHA 1UT8A 1CVLA 1LDGA 1MRNA 2Q6LA 3FWKA 4H4CA 4ZC1A 2HHHM 4EMUA 2RAFA 1LRJA 5KTYA 1U6KA 4C2TA 3O75A 1MA3A 4RMIA 2BSQA 3ZCBB 3WRVA 5F64A 1F0YA 4F9TA 3WSWA 1T6ZA 3IPYA 5B3LA 1ISJA 4AWBA 1J2TA 3B6EA 3HBFA 4CTMA 1FFDA 2CVQA 2BTQA 3PJDA 5DGIA 1NG1A 2YIVX 4JQCA 1TF0B 2L2DA 3A6KA 5TPZD 1FZTA 1C4KA 4X9XA 3I4CA 4GRAA 3LOQA 1B6RA 1R5NA 2WY2D 3HEBA 2NMVA 3H8VA 4M6WA 5KOYA 3RK0A 1S2MA 2R47A 4ZVRA 2C9CA 1ACMA 1Z39A 2UUOA 3HKCA 1LX6A 3NU1A 4Q6WA 1ZGCA 2QUIA 1JB1A 3KYIB 3CTPA 4CM7A 4X65B 4TSKA 4D9IA 2WSYB 4CFYA 1SQGA 4GPEA 3MOSA 3TAXA 4PHHA 3TTUA 1XP8A 3ZVMA 2JCYA 1KBQA 3O4JA 4KXQA 5H7XA 4HAOA 1KEUA 3BF8A 2BMVA 3MA0A 3AFHA 2OCKA 3VU0A 1VL6A 1XV5A 4Z3OA 3CEPB 5TQ0B 3W4IA 2X19A 3W9SA 2CKMA 2AS0A 3GVIA 3LVFO 4FDLA 4E22A 9ABPA 4YAKA 1R0WA 4D8YA 1NNEA 2BL4A 3HYTA 1PT6A 1TTPB 4OATA 4UVEA 4F4HA 3K4HA 2OYSA 3HA7A 1IC6A 4U7WA 1I80A 4B43A 2W42A 1XRLA 5B5SA 2J87A 1EH5A 5LU9A 4A16A 5LPNA 3REQA 4JLMA 5IPFA 5BYAA 1UMCA 4NKRA 4Q39A 2R6JA 4Y2GA 1NN3A 4DWJA 1YZKA 1UXHA 3D8TA 3SX2A 3TLKA 4A7PA 2WB2A 5JFOA 3BA1A 3VNRA 2ZZNA 2O0JA 2WNIA 3M3PA 3AEZA 1Z59A 2GA8A 2B35A 4PO1A 4PQRA 2Q3LA 4ZXFA 1V9CA 2FF5A 2P9JA 4PW0A 3B1KA 3MMXA 1Y9ZA 4U6SA 5CH8A 5EL0A 2QGZA 2H1FA 4JH0A 1ZHFA 4LECA 4PNEA 1NX6A 4JP3A 2FSUA 3TCXB 4YT8A 1ZRMA 3HBNA 4BMOB 5IKPA 5ALPA 4GMXA 3KELA 1RPZA 1VI5A 3AU9A 5JWRA 4AP9A 3WIDA 3J2PB 4QT0A 4Q1AA 3WQRA 2XVZA 3VQTA 4DDVA 3THWA 4CEHB 5U1PA 3SS7X 1U8CB 2CL0X 3P8ZA 4FMCF 2XVXA 3MCUA 4I08A 4I50B 4RQAA 1YVUA 2RGAA 2CK3A 4LCBA 4GPBA 1GGVA 3C6MA 3H1PA 4LNHA 4Q9KA 4B7XA 1XZIA