1NY8A

Solution structure of protein yrba from escherichia coli: northeast structural genomics consortium target er115
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
97
structure length
97
Chain Sequence
MIEDPMENNEIQSVLMNALSLQEVHVSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLMEYIADNRIHAVSIKAYTPAEWARDRKLNGFLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein yrbA
publication title Solution structure of Protein yrbA from Escherichia Coli: Northeast Structural Genomics Consortium target ER115
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 14
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 1ny8A00
3TR3A 4PUGA 5LCIA 4PUIA 2MMAB 1V60A 1XS3A 2DHMA 2MCQA 1NY8A 2MM9A 3O2EA 2NCLA 2KZ0A 2KDNA 4PUHA
chains in the Genus database with same CATH superfamily
1IBLC 2UXBC 3GR0A 4KTTA 1N36C 4DG8A 2KDNA 3LGXA 4U5YD 3TDEA 5BSTA 1I94C 2D7VA 4K0BA 3UOWA 5BR8C 4R1MA 1IBMC 3RV2A 4X66C 2CU6A 2QL8A 4ZLPA 3CW8X 3LUSA 4NXNC 1ULTA 3E7WA 4G1IA 3TR3A 1HNWC 2P02A 5KYVA 4DUYC 2Y4NA 1M6XA 3SO4A 2M5OA 1VEHA 1TH5A 2PN2A 4LF5C 2QW0X 1MDFA 1P4EA 2WP0C 3GKUA 1O92A 2AYAA 4FUQA 4B3RC 3A25A 3RG2A 4LFAC 4DR4C 3S82A 5BSVA 2YWCA 4JI4C 4GS5A 5IFIA 1V25A 4LF4C 4X65C 4WS9A 4ISBA 4DV2C 4RVNA 4XX2A 2F4VC 1QWIA 5BURA 4LF6C 2HJGA 2D1TA 2D1RA 4NDNA 2E5LC 3DHVA 2CY1A 4BC7A 4DR2C 3A26A 2DPLA 2XR1A 1GPMA 1WH9A 4DV5C 5BUSA 4YY3C 2OO4A 3K6RA 4MTNA 3A9VA 3N54B 2CXCA 4RLFA 1K0RA 2UUAC 2QVYX 1PG4A 2YX1A 3IEVA 4JI8C 5FLXD 3A4IA 2ATWA 3J81D 5KEIA 3CQ2A 1UKKA 1MDBA 1HNXC 2OPLA 1PA4A 2E8EA 4I9FA 3N2QA 4YHHC 2VQFC 2VSQA 4MH4A 1USPA 1P7LA 3IEUA 3LNVA 4DR7C 4B3SC 4D4GA 2MMAB 4JI5C 3GR1A 1MXBA 2ONFA 4RLQA 4DR6C 2PROA 1MD9A 4BCAA 3CQ1A 3JAMD 1J5EC 2P20A 4BBYA 3AF5A 4FTFA 4L4QA 4DV7C 1O90A 3LNOA 5BSWA 2NCLA 3R9WA 4PROC 4DV3C 1LCIA 1PG3A 5LMNC 1FJGC 3R44A 4OXIA 4BC9A 4DV1C 1RG9A 1HH2P 1XRAA 1MXCA 4JV5C 3O2EA 3B7WA 4RM3A 2V7BA 1XNRC 3PESA 3AY0A 4LF9C 3VNSA 3KXWA 1IB8A 5BSUA 4JI1C 2DYJA 2BJOA 2EGTA 4DV4C 3T1HC 1N32C 3LAXA 4GKKC 1HNZC 1N33C 3J80D 4NOZA 2ZM6C 1BA3A 3L95X 4WV3A 2E7GA 3CJEA 3AF6A 4D57A 1XMOC 2OPLB 4D4IA 2D1QA 4PUIA 1XRCA 4JI7C 3UEBA 1USPB 4D56A 2HHHC 4LFCC 1NY8A 1QM4A 3FCCA 2UXDC 3NI2A 2ZZNA 4DR5C 5AE1A 2VZEA 1HR0C 2P2MA 3T1YC 1RY2A 5IT9D 1XNQC 5LMUC 3FCEA 4DCSA 5CZVA 1M6XC 5H9UA 4ODJA 4LF8C 4DV6C 4JYAC 3DAYA 4PUGA 2D27A 1NYEA 1V60A 2M5HA 4GKJC 3IPLA 2UUBC 1O93A 3CQ3A 5IWAC 2Y27A 4RVOA 4DR1C 1XMQC 2JMPA 4ZJZA 4JM1A 1ZB8A 3VNQA 4X62C 1FUGA 1KKGA 2VQEC 4AQYC 4HPVA 5K8FA 4FUTA 4R0MA 5KYTA 4DCTA 2KZFA 2YWBA 2PT7G 2P2FA 4G37A 3UX2A 1VLAA 3GPCA 4JI6C 1EGAA 3TUFA 2UU9C 1WF3A 2QVXX 1XRBA 3I07A 1L2FA 2E0GA 3L8CA 4IR7A 2Z51A 5A19A 2OBVA 4NXMC 4B3TC 4LF7C 4DR3C 1MXAA 3UZ0A 1PU1A 5BSMA 4BSZA 3UX3A 2E8FA 2ZZMA 2P2QA 4RMNA 1JOSA 2YCBA 2UXCC 5A1IA 5JRHA 3NPDA 4JI3C 3I08A 2MCQA 1IBKC 4GXQA 4G36A 1XHJA 3PBKA 4PZPA 4EATA 3C5EA 5GTDA 2E8CA 3DLPX 1YJ7A 3IMLA 3A9UA 4K0KC 1FLOA 2WD9A 1LQLA 3CW9A 3E7XA 3H2TA 4I9GA 3ETCA 3OTOC 4DG9A 4LE5A 4DCVA 1N34C 2DHMA 4OX9C 1MKYA 5AE3A 3EQ6A 3NYRA 5E7QA 1N2FA 5T8TA 2UUCC 1P4EC 1T5HX 4KTVA 2MM9A 1ML8A 3ETOA 5BSRA 2Y4OA 1XS3A 4DV0C 2ASBA 1WCJA 2KZ0A 4TPSB 4JI2C 1V26A 5A2QD 4KHPC 1T5DX 5BUQA 4LFBC 3VNRA 5LCIA 5AE2A 4L7IA 3NYQA 4DUZC 3R9XA 4RM2A 1UWDA 4R1LA 3EERA 2QVZX 3TQIA 2D28C 2BH1X 2D1SA 1O9TA 2P2JA 5CZXA 2P2BA 4OYCA 5A1GA 4IZ6A 4PHTA 4DCUA 5DV9A 5K85A 1ZB9A 4GXRA 3G7SA 1AMUA 4PUHA 3PROC 2JNVA 4JI0C 4X64C 4B3MC 5T8SA 4L2ZA 5ADZA
chains in the Genus database with same CATH topology
3TR3A 4PUGA 5LCIA 4PUIA 2MMAB 1V60A 1XS3A 2DHMA 2MCQA 1NY8A 2MM9A 3O2EA 2NCLA 2KZ0A 2KDNA 4PUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TR3 A;  4PUG A;  5LCI A;  4PUI A;  2MMA B;  1V60 A;  1XS3 A;  2DHM A;  2MCQ A;  1NY8 A;  2MM9 A;  3O2E A;  2NCL A;  2KZ0 A;  2KDN A;  4PUH A; 
#chains in the Genus database with same CATH topology
 1IBL C;  2UXB C;  3GR0 A;  4KTT A;  1N36 C;  4DG8 A;  2KDN A;  3LGX A;  4U5Y D;  3TDE A;  5BST A;  1I94 C;  2D7V A;  4K0B A;  3UOW A;  5BR8 C;  4R1M A;  1IBM C;  3RV2 A;  4X66 C;  2CU6 A;  2QL8 A;  4ZLP A;  3CW8 X;  3LUS A;  4NXN C;  1ULT A;  3E7W A;  4G1I A;  3TR3 A;  1HNW C;  2P02 A;  5KYV A;  4DUY C;  2Y4N A;  1M6X A;  3SO4 A;  2M5O A;  1VEH A;  1TH5 A;  2PN2 A;  4LF5 C;  2QW0 X;  1MDF A;  1P4E A;  2WP0 C;  3GKU A;  1O92 A;  2AYA A;  4FUQ A;  4B3R C;  3A25 A;  3RG2 A;  4LFA C;  4DR4 C;  3S82 A;  5BSV A;  2YWC A;  4JI4 C;  4GS5 A;  5IFI A;  1V25 A;  4LF4 C;  4X65 C;  4WS9 A;  4ISB A;  4DV2 C;  4RVN A;  4XX2 A;  2F4V C;  1QWI A;  5BUR A;  4LF6 C;  2HJG A;  2D1T A;  2D1R A;  4NDN A;  2E5L C;  3DHV A;  2CY1 A;  4BC7 A;  4DR2 C;  3A26 A;  2DPL A;  2XR1 A;  1GPM A;  1WH9 A;  4DV5 C;  5BUS A;  4YY3 C;  2OO4 A;  3K6R A;  4MTN A;  3A9V A;  3N54 B;  2CXC A;  4RLF A;  1K0R A;  2UUA C;  2QVY X;  1PG4 A;  2YX1 A;  3IEV A;  4JI8 C;  5FLX D;  3A4I A;  2ATW A;  3J81 D;  5KEI A;  3CQ2 A;  1UKK A;  1MDB A;  1HNX C;  2OPL A;  1PA4 A;  2E8E A;  4I9F A;  3N2Q A;  4YHH C;  2VQF C;  2VSQ A;  4MH4 A;  1USP A;  1P7L A;  3IEU A;  3LNV A;  4DR7 C;  4B3S C;  4D4G A;  2MMA B;  4JI5 C;  3GR1 A;  1MXB A;  2ONF A;  4RLQ A;  4DR6 C;  2PRO A;  1MD9 A;  4BCA A;  3CQ1 A;  3JAM D;  1J5E C;  2P20 A;  4BBY A;  3AF5 A;  4FTF A;  4L4Q A;  4DV7 C;  1O90 A;  3LNO A;  5BSW A;  2NCL A;  3R9W A;  4PRO C;  4DV3 C;  1LCI A;  1PG3 A;  5LMN C;  1FJG C;  3R44 A;  4OXI A;  4BC9 A;  4DV1 C;  1RG9 A;  1HH2 P;  1XRA A;  1MXC A;  4JV5 C;  3O2E A;  3B7W A;  4RM3 A;  2V7B A;  1XNR C;  3PES A;  3AY0 A;  4LF9 C;  3VNS A;  3KXW A;  1IB8 A;  5BSU A;  4JI1 C;  2DYJ A;  2BJO A;  2EGT A;  4DV4 C;  3T1H C;  1N32 C;  3LAX A;  4GKK C;  1HNZ C;  1N33 C;  3J80 D;  4NOZ A;  2ZM6 C;  1BA3 A;  3L95 X;  4WV3 A;  2E7G A;  3CJE A;  3AF6 A;  4D57 A;  1XMO C;  2OPL B;  4D4I A;  2D1Q A;  4PUI A;  1XRC A;  4JI7 C;  3UEB A;  1USP B;  4D56 A;  2HHH C;  4LFC C;  1NY8 A;  1QM4 A;  3FCC A;  2UXD C;  3NI2 A;  2ZZN A;  4DR5 C;  5AE1 A;  2VZE A;  1HR0 C;  2P2M A;  3T1Y C;  1RY2 A;  5IT9 D;  1XNQ C;  5LMU C;  3FCE A;  4DCS A;  5CZV A;  1M6X C;  5H9U A;  4ODJ A;  4LF8 C;  4DV6 C;  4JYA C;  3DAY A;  4PUG A;  2D27 A;  1NYE A;  1V60 A;  2M5H A;  4GKJ C;  3IPL A;  2UUB C;  1O93 A;  3CQ3 A;  5IWA C;  2Y27 A;  4RVO A;  4DR1 C;  1XMQ C;  2JMP A;  4ZJZ A;  4JM1 A;  1ZB8 A;  3VNQ A;  4X62 C;  1FUG A;  1KKG A;  2VQE C;  4AQY C;  4HPV A;  5K8F A;  4FUT A;  4R0M A;  5KYT A;  4DCT A;  2KZF A;  2YWB A;  2PT7 G;  2P2F A;  4G37 A;  3UX2 A;  1VLA A;  3GPC A;  4JI6 C;  1EGA A;  3TUF A;  2UU9 C;  1WF3 A;  2QVX X;  1XRB A;  3I07 A;  1L2F A;  2E0G A;  3L8C A;  4IR7 A;  2Z51 A;  5A19 A;  2OBV A;  4NXM C;  4B3T C;  4LF7 C;  4DR3 C;  1MXA A;  3UZ0 A;  1PU1 A;  5BSM A;  4BSZ A;  3UX3 A;  2E8F A;  2ZZM A;  2P2Q A;  4RMN A;  1JOS A;  2YCB A;  2UXC C;  5A1I A;  5JRH A;  3NPD A;  4JI3 C;  3I08 A;  2MCQ A;  1IBK C;  4GXQ A;  4G36 A;  1XHJ A;  3PBK A;  4PZP A;  4EAT A;  3C5E A;  5GTD A;  2E8C A;  3DLP X;  1YJ7 A;  3IML A;  3A9U A;  4K0K C;  1FLO A;  2WD9 A;  1LQL A;  3CW9 A;  3E7X A;  3H2T A;  4I9G A;  3ETC A;  3OTO C;  4DG9 A;  4LE5 A;  4DCV A;  1N34 C;  2DHM A;  4OX9 C;  1MKY A;  5AE3 A;  3EQ6 A;  3NYR A;  5E7Q A;  1N2F A;  5T8T A;  2UUC C;  1P4E C;  1T5H X;  4KTV A;  2MM9 A;  1ML8 A;  3ETO A;  5BSR A;  2Y4O A;  1XS3 A;  4DV0 C;  2ASB A;  1WCJ A;  2KZ0 A;  4TPS B;  4JI2 C;  1V26 A;  5A2Q D;  4KHP C;  1T5D X;  5BUQ A;  4LFB C;  3VNR A;  5LCI A;  5AE2 A;  4L7I A;  3NYQ A;  4DUZ C;  3R9X A;  4RM2 A;  1UWD A;  4R1L A;  3EER A;  2QVZ X;  3TQI A;  2D28 C;  2BH1 X;  2D1S A;  1O9T A;  2P2J A;  5CZX A;  2P2B A;  4OYC A;  5A1G A;  4IZ6 A;  4PHT A;  4DCU A;  5DV9 A;  5K85 A;  1ZB9 A;  4GXR A;  3G7S A;  1AMU A;  4PUH A;  3PRO C;  2JNV A;  4JI0 C;  4X64 C;  4B3M C;  5T8S A;  4L2Z A;  5ADZ A; 
#chains in the Genus database with same CATH homology
 3TR3 A;  4PUG A;  5LCI A;  4PUI A;  2MMA B;  1V60 A;  1XS3 A;  2DHM A;  2MCQ A;  1NY8 A;  2MM9 A;  3O2E A;  2NCL A;  2KZ0 A;  2KDN A;  4PUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...