1NY8A

Solution structure of protein yrba from escherichia coli: northeast structural genomics consortium target er115
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
97
structure length
97
Chain Sequence
MIEDPMENNEIQSVLMNALSLQEVHVSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLMEYIADNRIHAVSIKAYTPAEWARDRKLNGFLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Protein yrbA from Escherichia Coli: Northeast Structural Genomics Consortium target ER115
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Protein yrbA
total genus 14
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 1ny8A00
2MM9A 1NY8A 1V60A 2KDNA 3O2EA 2NCLA 4PUIA 4PUHA 1XS3A 2KZ0A 2DHMA 4PUGA 5LCIA 2MCQA 2MMAB 3TR3A
chains in the Genus database with same CATH superfamily
1N33C 3NI2A 4DCVA 2DPLA 3AF6A 1GPMA 4JM1A 2Y27A 3PROC 1V60A 3G7SA 3IEVA 4I9FA 3GR1A 1P4EC 4LFAC 3TUFA 1ULTA 3IEUA 3CJEA 2D1QA 2Z51A 4LE5A 5A1GA 4DV0C 5LMUC 5BSUA 5ADZA 1XNRC 1VEHA 3J80D 2CXCA 5A1IA 4LF9C 4R0MA 2M5HA 2ONFA 3LGXA 4L2ZA 5BSRA 3R44A 3RG2A 5CZVA 1WCJA 1PA4A 4KTVA 2VQEC 4JI6C 4NDNA 4DV4C 2MCQA 1O90A 2ASBA 5KEIA 4RLFA 2UUAC 3VNQA 4D4IA 1NY8A 3NPDA 3IPLA 3TQIA 3UX2A 1LQLA 4ZJZA 2QVYX 3EQ6A 1ZB8A 4NXMC 1MD9A 4L7IA 4JI8C 2MMAB 3I08A 5K85A 3S82A 5LMNC 5AE3A 1HNWC 3R9WA 1IBMC 3VNRA 3LNOA 4DR5C 4RM3A 3T1YC 2V7BA 2D1TA 2QW0X 4LFCC 2D1RA 4GXRA 4NOZA 1WF3A 1M6XA 5AE1A 4RVOA 1USPA 4EATA 4YHHC 1QWIA 3CQ2A 5A2QD 4LFBC 1UKKA 3ETCA 4GS5A 1V26A 3RV2A 2OO4A 2OBVA 1MXCA 3NYQA 5T8TA 4LF7C 4MTNA 4JI1C 2YX1A 2F4VC 1MDBA 1J5EC 3A9UA 1P4EA 1XS3A 3GR0A 2WP0C 4BC9A 4DV1C 3SO4A 1HNZC 1HR0C 4G37A 3A25A 4YY3C 4AQYC 1IBLC 5A19A 4JI7C 1YJ7A 5BSMA 3TDEA 4D4GA 5H9UA 4DR7C 3CW9A 4LF4C 4WV3A 2AYAA 2YWCA 3PBKA 1N2FA 1N32C 5K8FA 2CY1A 2E8FA 2UXBC 4R1LA 4IR7A 3T1HC 1XMOC 3O2EA 2DHMA 3NYRA 1N36C 1LCIA 4DUYC 2JNVA 1ML8A 2E8EA 1NYEA 3CQ3A 4WS9A 2QL8A 3N2QA 2HJGA 1MKYA 4OX9C 1T5HX 2P20A 1TH5A 3A9VA 1USPB 3LNVA 5AE2A 4FTFA 4LF6C 4G36A 1UWDA 1M6XC 3EERA 4PZPA 4PROC 4RVNA 4DR3C 4B3SC 2VZEA 4JI0C 3K6RA 3LAXA 2CU6A 4HPVA 4B3MC 5LCIA 1FJGC 5IFIA 2UU9C 2E7GA 1EGAA 3OTOC 3AF5A 2M5OA 4DR6C 1XRCA 3FCEA 1XRAA 4NXNC 5CZXA 3JAMD 4DV5C 1P7LA 1WH9A 4L4QA 4R1MA 4RLQA 4JI4C 4B3TC 1QM4A 4OYCA 2ZZNA 5JRHA 1JOSA 1PG4A 3A4IA 4ZLPA 4LF8C 4KHPC 5BUQA 4GKKC 2P2MA 2KZFA 2P2BA 4FUQA 4X65C 1T5DX 1L2FA 2OPLA 4PUHA 2KZ0A 2E0GA 1ZB9A 2YWBA 5IT9D 2D7VA 1IB8A 1MDFA 2UUBC 2HHHC 4XX2A 4DR4C 1IBKC 5BSTA 2XR1A 4IZ6A 3IMLA 3L8CA 4ODJA 5DV9A 4DCTA 4LF5C 4TPSB 3AY0A 2UXCC 2ZM6C 1FLOA 3UOWA 4RMNA 3B7WA 4MH4A 2QVZX 3DAYA 4DV2C 3GKUA 1HH2P 2NCLA 4X62C 2YCBA 1MXBA 5BR8C 1I94C 3GPCA 4GKJC 2WD9A 4K0BA 2VSQA 1O9TA 2P02A 3L95X 1MXAA 5BSWA 2E8CA 4OXIA 4DCSA 4U5YD 2D27A 1RG9A 2PN2A 3TR3A 2BH1X 5KYVA 2D1SA 4JYAC 3KXWA 5IWAC 2MM9A 5KYTA 3C5EA 4JI3C 3VNSA 2E5LC 1PG3A 2PROA 1K0RA 4DG9A 2D28C 4X66C 3R9XA 3UX3A 4PHTA 1O93A 4G1IA 3CW8X 2DYJA 1KKGA 4BSZA 1O92A 1PU1A 1XRBA 4X64C 4GXQA 3PESA 4JV5C 1FUGA 4BCAA 5FLXD 3ETOA 4KTTA 4ISBA 1V25A 4K0KC 5E7QA 3I07A 2P2QA 3H2TA 5T8SA 3DHVA 2P2FA 4B3RC 4DUZC 2EGTA 3LUSA 2Y4NA 4PUGA 4DR2C 2P2JA 4D56A 4DV6C 2KDNA 4PUIA 5BURA 1BA3A 2UXDC 2PT7G 3A26A 5GTDA 2Y4OA 3UZ0A 3E7XA 3J81D 1XNQC 4JI5C 3FCCA 5BUSA 1RY2A 4I9GA 1N34C 4D57A 2UUCC 3N54B 4FUTA 3UEBA 3E7WA 4DG8A 4BC7A 4DV7C 4RM2A 2JMPA 1AMUA 2BJOA 4BBYA 1VLAA 1XHJA 1HNXC 4JI2C 2VQFC 4DV3C 5BSVA 2OPLB 2ZZMA 4DCUA 2ATWA 3CQ1A 3DLPX 4DR1C 2QVXX 1XMQC
chains in the Genus database with same CATH topology
2MM9A 1NY8A 1V60A 2KDNA 3O2EA 2NCLA 4PUIA 4PUHA 1XS3A 2KZ0A 2DHMA 4PUGA 5LCIA 2MCQA 2MMAB 3TR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MM9 A;  1NY8 A;  1V60 A;  2KDN A;  3O2E A;  2NCL A;  4PUI A;  4PUH A;  1XS3 A;  2KZ0 A;  2DHM A;  4PUG A;  5LCI A;  2MCQ A;  2MMA B;  3TR3 A; 
#chains in the Genus database with same CATH topology
 1N33 C;  3NI2 A;  4DCV A;  2DPL A;  3AF6 A;  1GPM A;  4JM1 A;  2Y27 A;  3PRO C;  1V60 A;  3G7S A;  3IEV A;  4I9F A;  3GR1 A;  1P4E C;  4LFA C;  3TUF A;  1ULT A;  3IEU A;  3CJE A;  2D1Q A;  2Z51 A;  4LE5 A;  5A1G A;  4DV0 C;  5LMU C;  5BSU A;  5ADZ A;  1XNR C;  1VEH A;  3J80 D;  2CXC A;  5A1I A;  4LF9 C;  4R0M A;  2M5H A;  2ONF A;  3LGX A;  4L2Z A;  5BSR A;  3R44 A;  3RG2 A;  5CZV A;  1WCJ A;  1PA4 A;  4KTV A;  2VQE C;  4JI6 C;  4NDN A;  4DV4 C;  2MCQ A;  1O90 A;  2ASB A;  5KEI A;  4RLF A;  2UUA C;  3VNQ A;  4D4I A;  1NY8 A;  3NPD A;  3IPL A;  3TQI A;  3UX2 A;  1LQL A;  4ZJZ A;  2QVY X;  3EQ6 A;  1ZB8 A;  4NXM C;  1MD9 A;  4L7I A;  4JI8 C;  2MMA B;  3I08 A;  5K85 A;  3S82 A;  5LMN C;  5AE3 A;  1HNW C;  3R9W A;  1IBM C;  3VNR A;  3LNO A;  4DR5 C;  4RM3 A;  3T1Y C;  2V7B A;  2D1T A;  2QW0 X;  4LFC C;  2D1R A;  4GXR A;  4NOZ A;  1WF3 A;  1M6X A;  5AE1 A;  4RVO A;  1USP A;  4EAT A;  4YHH C;  1QWI A;  3CQ2 A;  5A2Q D;  4LFB C;  1UKK A;  3ETC A;  4GS5 A;  1V26 A;  3RV2 A;  2OO4 A;  2OBV A;  1MXC A;  3NYQ A;  5T8T A;  4LF7 C;  4MTN A;  4JI1 C;  2YX1 A;  2F4V C;  1MDB A;  1J5E C;  3A9U A;  1P4E A;  1XS3 A;  3GR0 A;  2WP0 C;  4BC9 A;  4DV1 C;  3SO4 A;  1HNZ C;  1HR0 C;  4G37 A;  3A25 A;  4YY3 C;  4AQY C;  1IBL C;  5A19 A;  4JI7 C;  1YJ7 A;  5BSM A;  3TDE A;  4D4G A;  5H9U A;  4DR7 C;  3CW9 A;  4LF4 C;  4WV3 A;  2AYA A;  2YWC A;  3PBK A;  1N2F A;  1N32 C;  5K8F A;  2CY1 A;  2E8F A;  2UXB C;  4R1L A;  4IR7 A;  3T1H C;  1XMO C;  3O2E A;  2DHM A;  3NYR A;  1N36 C;  1LCI A;  4DUY C;  2JNV A;  1ML8 A;  2E8E A;  1NYE A;  3CQ3 A;  4WS9 A;  2QL8 A;  3N2Q A;  2HJG A;  1MKY A;  4OX9 C;  1T5H X;  2P20 A;  1TH5 A;  3A9V A;  1USP B;  3LNV A;  5AE2 A;  4FTF A;  4LF6 C;  4G36 A;  1UWD A;  1M6X C;  3EER A;  4PZP A;  4PRO C;  4RVN A;  4DR3 C;  4B3S C;  2VZE A;  4JI0 C;  3K6R A;  3LAX A;  2CU6 A;  4HPV A;  4B3M C;  5LCI A;  1FJG C;  5IFI A;  2UU9 C;  2E7G A;  1EGA A;  3OTO C;  3AF5 A;  2M5O A;  4DR6 C;  1XRC A;  3FCE A;  1XRA A;  4NXN C;  5CZX A;  3JAM D;  4DV5 C;  1P7L A;  1WH9 A;  4L4Q A;  4R1M A;  4RLQ A;  4JI4 C;  4B3T C;  1QM4 A;  4OYC A;  2ZZN A;  5JRH A;  1JOS A;  1PG4 A;  3A4I A;  4ZLP A;  4LF8 C;  4KHP C;  5BUQ A;  4GKK C;  2P2M A;  2KZF A;  2P2B A;  4FUQ A;  4X65 C;  1T5D X;  1L2F A;  2OPL A;  4PUH A;  2KZ0 A;  2E0G A;  1ZB9 A;  2YWB A;  5IT9 D;  2D7V A;  1IB8 A;  1MDF A;  2UUB C;  2HHH C;  4XX2 A;  4DR4 C;  1IBK C;  5BST A;  2XR1 A;  4IZ6 A;  3IML A;  3L8C A;  4ODJ A;  5DV9 A;  4DCT A;  4LF5 C;  4TPS B;  3AY0 A;  2UXC C;  2ZM6 C;  1FLO A;  3UOW A;  4RMN A;  3B7W A;  4MH4 A;  2QVZ X;  3DAY A;  4DV2 C;  3GKU A;  1HH2 P;  2NCL A;  4X62 C;  2YCB A;  1MXB A;  5BR8 C;  1I94 C;  3GPC A;  4GKJ C;  2WD9 A;  4K0B A;  2VSQ A;  1O9T A;  2P02 A;  3L95 X;  1MXA A;  5BSW A;  2E8C A;  4OXI A;  4DCS A;  4U5Y D;  2D27 A;  1RG9 A;  2PN2 A;  3TR3 A;  2BH1 X;  5KYV A;  2D1S A;  4JYA C;  3KXW A;  5IWA C;  2MM9 A;  5KYT A;  3C5E A;  4JI3 C;  3VNS A;  2E5L C;  1PG3 A;  2PRO A;  1K0R A;  4DG9 A;  2D28 C;  4X66 C;  3R9X A;  3UX3 A;  4PHT A;  1O93 A;  4G1I A;  3CW8 X;  2DYJ A;  1KKG A;  4BSZ A;  1O92 A;  1PU1 A;  1XRB A;  4X64 C;  4GXQ A;  3PES A;  4JV5 C;  1FUG A;  4BCA A;  5FLX D;  3ETO A;  4KTT A;  4ISB A;  1V25 A;  4K0K C;  5E7Q A;  3I07 A;  2P2Q A;  3H2T A;  5T8S A;  3DHV A;  2P2F A;  4B3R C;  4DUZ C;  2EGT A;  3LUS A;  2Y4N A;  4PUG A;  4DR2 C;  2P2J A;  4D56 A;  4DV6 C;  2KDN A;  4PUI A;  5BUR A;  1BA3 A;  2UXD C;  2PT7 G;  3A26 A;  5GTD A;  2Y4O A;  3UZ0 A;  3E7X A;  3J81 D;  1XNQ C;  4JI5 C;  3FCC A;  5BUS A;  1RY2 A;  4I9G A;  1N34 C;  4D57 A;  2UUC C;  3N54 B;  4FUT A;  3UEB A;  3E7W A;  4DG8 A;  4BC7 A;  4DV7 C;  4RM2 A;  2JMP A;  1AMU A;  2BJO A;  4BBY A;  1VLA A;  1XHJ A;  1HNX C;  4JI2 C;  2VQF C;  4DV3 C;  5BSV A;  2OPL B;  2ZZM A;  4DCU A;  2ATW A;  3CQ1 A;  3DLP X;  4DR1 C;  2QVX X;  1XMQ C; 
#chains in the Genus database with same CATH homology
 2MM9 A;  1NY8 A;  1V60 A;  2KDN A;  3O2E A;  2NCL A;  4PUI A;  4PUH A;  1XS3 A;  2KZ0 A;  2DHM A;  4PUG A;  5LCI A;  2MCQ A;  2MMA B;  3TR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...