1NYUA

Crystal structure of activin a bound to the ecd of actriib
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
92
Chain Sequence
TRECIYYNANWELERTNQSLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords activin receptor
publication title Structures of an ActRIIB:activin A complex reveal a novel binding mode for TGF-beta ligand:receptor interactions
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein/hormone/growth factor
total genus 16
structure length 92
sequence length 93
chains with identical sequence C
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2003-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1nyuA00
4QTIU 1JBDA 1ERGA 2QJAC 2GOOC 2H62C 1ES7B 2CDXA 1KC4A 1MR6A 2X8BB 1IQ9A 2N99A 2MHYA 2UWRA 1IDLA 1JGKA 2CTXA 2UX2A 2I9BE 4OM5A 3PLCA 1KBAA 1KU6B 2ABXA 1UG4A 4LFTA 1NTXA 1FRAA 1KBSA 3NDSA 4RUDA 1CODA 3EBXA 4IYEA 2GOOB 2MJ0A 4P7UA 1VB0A 3NH7A 1KFHA 5IMYC 1I02A 1ERAA 2MJ4A 1YWHA 1M9ZA 1TXBA 1XT3A 2MUOA 3U74U 2CCXA 4ZQYA 1TGXA 5IMTD 2CRSA 1L4WA 2NBTA 2VLWA 1LSIA 1CDTA 2JQPA 1ABTA 1KXIA 1FSCA 3NEQA 1B41B 1KTZB 1NTNA 2H7ZA 2LCRA 2ERAA 1CTXA 4BDTB 1CB9A 4OM4A 1QKEA 1IK8A 2L5SA 2MUPA 1IJCA 1QKDA 3HH7A 4AEAA 1NYSA 3FEVA 4FAOC 3KFDE 1CXNA 1HC9A 1CVOA 1FASA 1RGJA 1TFSA 1LX5B 1KL8A 2H64B 1BTEA 1COEA 3KFDI 1CDRA 1V6PA 2H5FA 2BHIA 2H7ZB 2PJYC 3QB4B 2K3GA 1CHVS 1CDSA 1NXBA 1KS6A 2H62D 2H64C 1MAHF 2L03A 2HLRA 2QC1A 1H0JA 1HC9B 1IDGA 2MFAA 5DZ5A 1LXGA 1CDQA 2BTXA 1BXPA 1NYUA 1CRFA 1W6BA 5DU1A 5EBXA 4XJJA 2CRTA 1FF4A 1JE9A 2PJYB 1LXHA 4DO8A 1CCQA 1IDHA 1CREA 4EY8B 2QJBC 1DRSA 1PLOA 2FD6U 1TXAA 3EVSC 1IKCA 1CXOA 6EBXA 2J8BA 4FAOE 2OFSA 1ZADA 2QJ9C 2JVEA 1RL5A 4BIKB 1QM7A 3LAQU 3U73U 1REWC 3ERAA 1FFJA 1HAJA 1HOYA 2H8UA 2MJYA 4UY2C 3BT1U 1NEAA 1KBTA 1F8UB 1S4YA 5DO6A 3BT2U 4HQPF 1IDIA 1HAAA 1NORA 1LJZA 2LA1A 3VTSA 1G6MA 1FSSB 2HLQA 1F94A 1ONJA
chains in the Genus database with same CATH superfamily
4QTIU 1JBDA 1ERGA 2QJAC 2GOOC 2H62C 1ES7B 2CDXA 1KC4A 1MR6A 2X8BB 1IQ9A 2N99A 2MHYA 2UWRA 1IDLA 1JGKA 2CTXA 2UX2A 2I9BE 4OM5A 3PLCA 1KBAA 1KU6B 2ABXA 1UG4A 4LFTA 1NTXA 1FRAA 1KBSA 3NDSA 4RUDA 1CODA 3EBXA 4IYEA 2GOOB 2MJ0A 4P7UA 1VB0A 3NH7A 1KFHA 5IMYC 1I02A 1ERAA 2MJ4A 1YWHA 1M9ZA 1TXBA 1XT3A 2MUOA 3U74U 2CCXA 4ZQYA 1TGXA 5IMTD 2CRSA 1L4WA 2NBTA 2VLWA 1LSIA 1CDTA 2JQPA 1ABTA 1KXIA 1FSCA 3NEQA 1B41B 1KTZB 1NTNA 2H7ZA 2LCRA 2ERAA 1CTXA 4BDTB 1CB9A 4OM4A 1QKEA 1IK8A 2L5SA 2MUPA 4KSNA 1IJCA 1QKDA 3HH7A 4AEAA 1NYSA 3FEVA 4FAOC 3KFDE 1CXNA 1HC9A 1CVOA 1FASA 1RGJA 1TFSA 1LX5B 1KL8A 2H64B 1BTEA 1COEA 3KFDI 1CDRA 1V6PA 2H5FA 2BHIA 2H7ZB 2PJYC 3QB4B 2K3GA 1CHVS 1CDSA 1NXBA 1KS6A 2H62D 2H64C 1MAHF 2L03A 2HLRA 2QC1A 1H0JA 1HC9B 1IDGA 2MFAA 5DZ5A 1LXGA 1CDQA 2BTXA 1BXPA 1NYUA 1CRFA 1W6BA 5DU1A 5EBXA 4XJJA 2CRTA 1FF4A 1JE9A 2PJYB 1LXHA 4DO8A 1CCQA 1IDHA 1CREA 4EY8B 2QJBC 1DRSA 1PLOA 2FD6U 1TXAA 3EVSC 1IKCA 1CXOA 6EBXA 2J8BA 4FAOE 2OFSA 1ZADA 2QJ9C 2JVEA 1RL5A 4BIKB 1QM7A 3LAQU 3U73U 1REWC 3ERAA 1FFJA 1HAJA 1HOYA 2H8UA 2MJYA 4UY2C 3BT1U 1NEAA 1KBTA 1F8UB 1S4YA 5DO6A 3BT2U 4HQPF 1IDIA 1HAAA 1NORA 1LJZA 2LA1A 3VTSA 1G6MA 1FSSB 2HLQA 1F94A 1ONJA
chains in the Genus database with same CATH topology
4QTIU 1JBDA 1ERGA 2QJAC 2GOOC 2H62C 1ES7B 2CDXA 1KC4A 1MR6A 2X8BB 1IQ9A 2N99A 2MHYA 2UWRA 1IDLA 1JGKA 2CTXA 2UX2A 2I9BE 4OM5A 3PLCA 1KBAA 1KU6B 2ABXA 1UG4A 4LFTA 1NTXA 1FRAA 1KBSA 3NDSA 4RUDA 1CODA 3EBXA 4IYEA 2GOOB 2MJ0A 4P7UA 1VB0A 3NH7A 1KFHA 5IMYC 1I02A 1ERAA 2MJ4A 1YWHA 1M9ZA 1TXBA 1XT3A 2MUOA 3U74U 2CCXA 4ZQYA 1TGXA 5IMTD 2CRSA 1L4WA 2NBTA 2VLWA 1LSIA 1CDTA 2JQPA 1ABTA 1KXIA 1FSCA 3NEQA 1B41B 1KTZB 1NTNA 2H7ZA 2LCRA 2ERAA 1CTXA 4BDTB 1CB9A 4OM4A 1QKEA 1IK8A 2L5SA 2MUPA 4KSNA 1IJCA 1QKDA 3HH7A 4AEAA 1NYSA 3FEVA 4FAOC 3KFDE 1CXNA 1HC9A 1CVOA 1FASA 1RGJA 1TFSA 1LX5B 1KL8A 2H64B 1BTEA 1COEA 3KFDI 1CDRA 1V6PA 2H5FA 2BHIA 2H7ZB 2PJYC 3QB4B 2K3GA 1CHVS 1CDSA 1NXBA 1KS6A 2H62D 2H64C 1MAHF 2L03A 2HLRA 2QC1A 1H0JA 1HC9B 1IDGA 2MFAA 5DZ5A 1LXGA 1CDQA 2BTXA 1BXPA 1NYUA 1CRFA 1W6BA 5DU1A 5EBXA 4XJJA 2CRTA 1FF4A 1JE9A 2PJYB 1LXHA 4DO8A 1CCQA 1IDHA 1CREA 4EY8B 2QJBC 1DRSA 1PLOA 2FD6U 1TXAA 3EVSC 1IKCA 1CXOA 6EBXA 2J8BA 4FAOE 2OFSA 1ZADA 2QJ9C 2JVEA 1RL5A 4BIKB 1QM7A 3LAQU 3U73U 1REWC 3ERAA 1FFJA 1HAJA 1HOYA 2H8UA 2MJYA 4UY2C 3BT1U 1NEAA 1KBTA 1F8UB 1S4YA 5DO6A 3BT2U 4HQPF 1IDIA 1HAAA 1NORA 1LJZA 2LA1A 3VTSA 1G6MA 1FSSB 2HLQA 1F94A 1ONJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QTI U;  1JBD A;  1ERG A;  2QJA C;  2GOO C;  2H62 C;  1ES7 B;  2CDX A;  1KC4 A;  1MR6 A;  2X8B B;  1IQ9 A;  2N99 A;  2MHY A;  2UWR A;  1IDL A;  1JGK A;  2CTX A;  2UX2 A;  2I9B E;  4OM5 A;  3PLC A;  1KBA A;  1KU6 B;  2ABX A;  1UG4 A;  4LFT A;  1NTX A;  1FRA A;  1KBS A;  3NDS A;  4RUD A;  1COD A;  3EBX A;  4IYE A;  2GOO B;  2MJ0 A;  4P7U A;  1VB0 A;  3NH7 A;  1KFH A;  5IMY C;  1I02 A;  1ERA A;  2MJ4 A;  1YWH A;  1M9Z A;  1TXB A;  1XT3 A;  2MUO A;  3U74 U;  2CCX A;  4ZQY A;  1TGX A;  5IMT D;  2CRS A;  1L4W A;  2NBT A;  2VLW A;  1LSI A;  1CDT A;  2JQP A;  1ABT A;  1KXI A;  1FSC A;  3NEQ A;  1B41 B;  1KTZ B;  1NTN A;  2H7Z A;  2LCR A;  2ERA A;  1CTX A;  4BDT B;  1CB9 A;  4OM4 A;  1QKE A;  1IK8 A;  2L5S A;  2MUP A;  1IJC A;  1QKD A;  3HH7 A;  4AEA A;  1NYS A;  3FEV A;  4FAO C;  3KFD E;  1CXN A;  1HC9 A;  1CVO A;  1FAS A;  1RGJ A;  1TFS A;  1LX5 B;  1KL8 A;  2H64 B;  1BTE A;  1COE A;  3KFD I;  1CDR A;  1V6P A;  2H5F A;  2BHI A;  2H7Z B;  2PJY C;  3QB4 B;  2K3G A;  1CHV S;  1CDS A;  1NXB A;  1KS6 A;  2H62 D;  2H64 C;  1MAH F;  2L03 A;  2HLR A;  2QC1 A;  1H0J A;  1HC9 B;  1IDG A;  2MFA A;  5DZ5 A;  1LXG A;  1CDQ A;  2BTX A;  1BXP A;  1NYU A;  1CRF A;  1W6B A;  5DU1 A;  5EBX A;  4XJJ A;  2CRT A;  1FF4 A;  1JE9 A;  2PJY B;  1LXH A;  4DO8 A;  1CCQ A;  1IDH A;  1CRE A;  4EY8 B;  2QJB C;  1DRS A;  1PLO A;  2FD6 U;  1TXA A;  3EVS C;  1IKC A;  1CXO A;  6EBX A;  2J8B A;  4FAO E;  2OFS A;  1ZAD A;  2QJ9 C;  2JVE A;  1RL5 A;  4BIK B;  1QM7 A;  3LAQ U;  3U73 U;  1REW C;  3ERA A;  1FFJ A;  1HAJ A;  1HOY A;  2H8U A;  2MJY A;  4UY2 C;  3BT1 U;  1NEA A;  1KBT A;  1F8U B;  1S4Y A;  5DO6 A;  3BT2 U;  4HQP F;  1IDI A;  1HAA A;  1NOR A;  1LJZ A;  2LA1 A;  3VTS A;  1G6M A;  1FSS B;  2HLQ A;  1F94 A;  1ONJ A; 
#chains in the Genus database with same CATH topology
 4QTI U;  1JBD A;  1ERG A;  2QJA C;  2GOO C;  2H62 C;  1ES7 B;  2CDX A;  1KC4 A;  1MR6 A;  2X8B B;  1IQ9 A;  2N99 A;  2MHY A;  2UWR A;  1IDL A;  1JGK A;  2CTX A;  2UX2 A;  2I9B E;  4OM5 A;  3PLC A;  1KBA A;  1KU6 B;  2ABX A;  1UG4 A;  4LFT A;  1NTX A;  1FRA A;  1KBS A;  3NDS A;  4RUD A;  1COD A;  3EBX A;  4IYE A;  2GOO B;  2MJ0 A;  4P7U A;  1VB0 A;  3NH7 A;  1KFH A;  5IMY C;  1I02 A;  1ERA A;  2MJ4 A;  1YWH A;  1M9Z A;  1TXB A;  1XT3 A;  2MUO A;  3U74 U;  2CCX A;  4ZQY A;  1TGX A;  5IMT D;  2CRS A;  1L4W A;  2NBT A;  2VLW A;  1LSI A;  1CDT A;  2JQP A;  1ABT A;  1KXI A;  1FSC A;  3NEQ A;  1B41 B;  1KTZ B;  1NTN A;  2H7Z A;  2LCR A;  2ERA A;  1CTX A;  4BDT B;  1CB9 A;  4OM4 A;  1QKE A;  1IK8 A;  2L5S A;  2MUP A;  4KSN A;  1IJC A;  1QKD A;  3HH7 A;  4AEA A;  1NYS A;  3FEV A;  4FAO C;  3KFD E;  1CXN A;  1HC9 A;  1CVO A;  1FAS A;  1RGJ A;  1TFS A;  1LX5 B;  1KL8 A;  2H64 B;  1BTE A;  1COE A;  3KFD I;  1CDR A;  1V6P A;  2H5F A;  2BHI A;  2H7Z B;  2PJY C;  3QB4 B;  2K3G A;  1CHV S;  1CDS A;  1NXB A;  1KS6 A;  2H62 D;  2H64 C;  1MAH F;  2L03 A;  2HLR A;  2QC1 A;  1H0J A;  1HC9 B;  1IDG A;  2MFA A;  5DZ5 A;  1LXG A;  1CDQ A;  2BTX A;  1BXP A;  1NYU A;  1CRF A;  1W6B A;  5DU1 A;  5EBX A;  4XJJ A;  2CRT A;  1FF4 A;  1JE9 A;  2PJY B;  1LXH A;  4DO8 A;  1CCQ A;  1IDH A;  1CRE A;  4EY8 B;  2QJB C;  1DRS A;  1PLO A;  2FD6 U;  1TXA A;  3EVS C;  1IKC A;  1CXO A;  6EBX A;  2J8B A;  4FAO E;  2OFS A;  1ZAD A;  2QJ9 C;  2JVE A;  1RL5 A;  4BIK B;  1QM7 A;  3LAQ U;  3U73 U;  1REW C;  3ERA A;  1FFJ A;  1HAJ A;  1HOY A;  2H8U A;  2MJY A;  4UY2 C;  3BT1 U;  1NEA A;  1KBT A;  1F8U B;  1S4Y A;  5DO6 A;  3BT2 U;  4HQP F;  1IDI A;  1HAA A;  1NOR A;  1LJZ A;  2LA1 A;  3VTS A;  1G6M A;  1FSS B;  2HLQ A;  1F94 A;  1ONJ A; 
#chains in the Genus database with same CATH homology
 4QTI U;  1JBD A;  1ERG A;  2QJA C;  2GOO C;  2H62 C;  1ES7 B;  2CDX A;  1KC4 A;  1MR6 A;  2X8B B;  1IQ9 A;  2N99 A;  2MHY A;  2UWR A;  1IDL A;  1JGK A;  2CTX A;  2UX2 A;  2I9B E;  4OM5 A;  3PLC A;  1KBA A;  1KU6 B;  2ABX A;  1UG4 A;  4LFT A;  1NTX A;  1FRA A;  1KBS A;  3NDS A;  4RUD A;  1COD A;  3EBX A;  4IYE A;  2GOO B;  2MJ0 A;  4P7U A;  1VB0 A;  3NH7 A;  1KFH A;  5IMY C;  1I02 A;  1ERA A;  2MJ4 A;  1YWH A;  1M9Z A;  1TXB A;  1XT3 A;  2MUO A;  3U74 U;  2CCX A;  4ZQY A;  1TGX A;  5IMT D;  2CRS A;  1L4W A;  2NBT A;  2VLW A;  1LSI A;  1CDT A;  2JQP A;  1ABT A;  1KXI A;  1FSC A;  3NEQ A;  1B41 B;  1KTZ B;  1NTN A;  2H7Z A;  2LCR A;  2ERA A;  1CTX A;  4BDT B;  1CB9 A;  4OM4 A;  1QKE A;  1IK8 A;  2L5S A;  2MUP A;  4KSN A;  1IJC A;  1QKD A;  3HH7 A;  4AEA A;  1NYS A;  3FEV A;  4FAO C;  3KFD E;  1CXN A;  1HC9 A;  1CVO A;  1FAS A;  1RGJ A;  1TFS A;  1LX5 B;  1KL8 A;  2H64 B;  1BTE A;  1COE A;  3KFD I;  1CDR A;  1V6P A;  2H5F A;  2BHI A;  2H7Z B;  2PJY C;  3QB4 B;  2K3G A;  1CHV S;  1CDS A;  1NXB A;  1KS6 A;  2H62 D;  2H64 C;  1MAH F;  2L03 A;  2HLR A;  2QC1 A;  1H0J A;  1HC9 B;  1IDG A;  2MFA A;  5DZ5 A;  1LXG A;  1CDQ A;  2BTX A;  1BXP A;  1NYU A;  1CRF A;  1W6B A;  5DU1 A;  5EBX A;  4XJJ A;  2CRT A;  1FF4 A;  1JE9 A;  2PJY B;  1LXH A;  4DO8 A;  1CCQ A;  1IDH A;  1CRE A;  4EY8 B;  2QJB C;  1DRS A;  1PLO A;  2FD6 U;  1TXA A;  3EVS C;  1IKC A;  1CXO A;  6EBX A;  2J8B A;  4FAO E;  2OFS A;  1ZAD A;  2QJ9 C;  2JVE A;  1RL5 A;  4BIK B;  1QM7 A;  3LAQ U;  3U73 U;  1REW C;  3ERA A;  1FFJ A;  1HAJ A;  1HOY A;  2H8U A;  2MJY A;  4UY2 C;  3BT1 U;  1NEA A;  1KBT A;  1F8U B;  1S4Y A;  5DO6 A;  3BT2 U;  4HQP F;  1IDI A;  1HAA A;  1NOR A;  1LJZ A;  2LA1 A;  3VTS A;  1G6M A;  1FSS B;  2HLQ A;  1F94 A;  1ONJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...