1NYUA

Crystal structure of activin a bound to the ecd of actriib
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
92
Chain Sequence
TRECIYYNANWELERTNQSLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of an ActRIIB:activin A complex reveal a novel binding mode for TGF-beta ligand:receptor interactions
pubmed doi rcsb
molecule keywords activin receptor
molecule tags Membrane protein/hormone/growth factor
source organism Rattus norvegicus
total genus 16
structure length 92
sequence length 93
chains with identical sequence C
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2003-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1nyuA00
1VB0A 2MJ0A 2UX2A 2H8UA 1CODA 2ERAA 2OFSA 2PJYC 2N99A 2ABXA 3U73U 1FSCA 5DZ5A 1PLOA 2I9BE 2LCRA 1CTXA 4UY2C 1JE9A 3LAQU 2H7ZA 1LX5B 1H0JA 3FEVA 2MJYA 1HOYA 1COEA 1IDGA 1KL8A 4P7UA 1QM7A 1ONJA 2H64B 1CRFA 2MUOA 2J8BA 1NYSA 1RL5A 1ES7B 2CCXA 1KS6A 1ABTA 1CHVS 6EBXA 2UWRA 1DRSA 1CDRA 1KTZB 2H7ZB 3KFDE 1KC4A 1FSSB 2H64C 3NDSA 1I02A 3VTSA 4LFTA 1LJZA 1V6PA 4OM5A 5IMYC 2QJAC 4BDTB 3ERAA 3PLCA 2JVEA 1KFHA 2L5SA 1IDIA 1CREA 1CDSA 1IK8A 1CB9A 4AEAA 1QKDA 1NTXA 3NH7A 2BTXA 1IJCA 5DO6A 1LXGA 5IMTD 2CRSA 1F8UB 2HLRA 3BT2U 4XJJA 2L03A 2X8BB 2LA1A 2CDXA 2K3GA 1MAHF 2GOOB 2QC1A 1G6MA 1ZADA 2BHIA 2MJ4A 5EBXA 1CVOA 1HAAA 1B41B 1CDQA 1NEAA 1ERAA 5DU1A 1REWC 4DO8A 1NYUA 1NORA 2GOOC 1TXBA 3KFDI 3QB4B 1M9ZA 2MFAA 1JBDA 1TGXA 1TXAA 1LSIA 2CTXA 2MHYA 3NEQA 3HH7A 4BIKB 1HC9A 1FF4A 2VLWA 2HLQA 4HQPF 3EBXA 2H62C 2FD6U 3U74U 2CRTA 1F94A 1NXBA 4EY8B 1IDLA 1CCQA 1ERGA 1UG4A 1TFSA 1FASA 4ZQYA 1IDHA 1IQ9A 1HC9B 2QJBC 1IKCA 2NBTA 3EVSC 4OM4A 1CXNA 1BTEA 2H62D 1CXOA 1KBAA 2H5FA 2MUPA 1BXPA 1RGJA 1QKEA 4QTIU 1KBSA 3BT1U 1YWHA 1XT3A 1FFJA 1KU6B 1S4YA 4IYEA 4FAOE 1KXIA 1JGKA 1NTNA 4RUDA 1L4WA 1W6BA 1HAJA 1LXHA 4FAOC 1CDTA 2QJ9C 2PJYB 1MR6A 2JQPA 1KBTA 1FRAA
chains in the Genus database with same CATH superfamily
1VB0A 2MJ0A 2UX2A 2H8UA 1CODA 2ERAA 2OFSA 2PJYC 2N99A 2ABXA 3U73U 1FSCA 5DZ5A 1PLOA 2I9BE 2LCRA 1CTXA 4UY2C 1JE9A 3LAQU 2H7ZA 1LX5B 1H0JA 3FEVA 2MJYA 1HOYA 1COEA 1IDGA 1KL8A 4P7UA 1QM7A 1ONJA 2H64B 1CRFA 2MUOA 2J8BA 1NYSA 1RL5A 1ES7B 2CCXA 1KS6A 1ABTA 1CHVS 6EBXA 2UWRA 1DRSA 1CDRA 1KTZB 2H7ZB 3KFDE 1KC4A 1FSSB 2H64C 3NDSA 1I02A 3VTSA 4LFTA 1LJZA 1V6PA 4OM5A 5IMYC 2QJAC 4BDTB 3ERAA 3PLCA 2JVEA 1KFHA 2L5SA 1IDIA 1CREA 1CDSA 1IK8A 1CB9A 4AEAA 1QKDA 1NTXA 3NH7A 2BTXA 1IJCA 5DO6A 1LXGA 5IMTD 2CRSA 1F8UB 2HLRA 3BT2U 4XJJA 2L03A 2X8BB 2LA1A 2CDXA 2K3GA 1MAHF 2GOOB 2QC1A 1G6MA 1ZADA 2BHIA 2MJ4A 5EBXA 1CVOA 1HAAA 1B41B 1CDQA 1NEAA 1ERAA 5DU1A 1REWC 4DO8A 1NYUA 1NORA 2GOOC 1TXBA 3KFDI 3QB4B 1M9ZA 2MFAA 1JBDA 1TGXA 1TXAA 1LSIA 2CTXA 2MHYA 3NEQA 3HH7A 4BIKB 1HC9A 1FF4A 2VLWA 2HLQA 4HQPF 3EBXA 2H62C 2FD6U 3U74U 2CRTA 1F94A 1NXBA 4EY8B 1IDLA 1CCQA 1ERGA 1UG4A 1TFSA 1FASA 4ZQYA 1IDHA 1IQ9A 1HC9B 2QJBC 1IKCA 2NBTA 3EVSC 4OM4A 1CXNA 1BTEA 2H62D 1CXOA 1KBAA 2H5FA 2MUPA 1BXPA 4KSNA 1RGJA 1QKEA 4QTIU 1KBSA 3BT1U 1YWHA 1XT3A 1FFJA 1KU6B 1S4YA 4IYEA 4FAOE 1KXIA 1JGKA 1NTNA 4RUDA 1L4WA 1W6BA 1HAJA 1LXHA 4FAOC 1CDTA 2QJ9C 2PJYB 1MR6A 2JQPA 1KBTA 1FRAA
chains in the Genus database with same CATH topology
1VB0A 2MJ0A 2UX2A 2H8UA 1CODA 2ERAA 2OFSA 2PJYC 2N99A 2ABXA 3U73U 1FSCA 5DZ5A 1PLOA 2I9BE 2LCRA 1CTXA 4UY2C 1JE9A 3LAQU 2H7ZA 1LX5B 1H0JA 3FEVA 2MJYA 1HOYA 1COEA 1IDGA 1KL8A 4P7UA 1QM7A 1ONJA 2H64B 1CRFA 2MUOA 2J8BA 1NYSA 1RL5A 1ES7B 2CCXA 1KS6A 1ABTA 1CHVS 6EBXA 2UWRA 1DRSA 1CDRA 1KTZB 2H7ZB 3KFDE 1KC4A 1FSSB 2H64C 3NDSA 1I02A 3VTSA 4LFTA 1LJZA 1V6PA 4OM5A 5IMYC 2QJAC 4BDTB 3ERAA 3PLCA 2JVEA 1KFHA 2L5SA 1IDIA 1CREA 1CDSA 1IK8A 1CB9A 4AEAA 1QKDA 1NTXA 3NH7A 2BTXA 1IJCA 5DO6A 1LXGA 5IMTD 2CRSA 1F8UB 2HLRA 3BT2U 4XJJA 2L03A 2X8BB 2LA1A 2CDXA 2K3GA 1MAHF 2GOOB 2QC1A 1G6MA 1ZADA 2BHIA 2MJ4A 5EBXA 1CVOA 1HAAA 1B41B 1CDQA 1NEAA 1ERAA 5DU1A 1REWC 4DO8A 1NYUA 1NORA 2GOOC 1TXBA 3KFDI 3QB4B 1M9ZA 2MFAA 1JBDA 1TGXA 1TXAA 1LSIA 2CTXA 2MHYA 3NEQA 3HH7A 4BIKB 1HC9A 1FF4A 2VLWA 2HLQA 4HQPF 3EBXA 2H62C 2FD6U 3U74U 2CRTA 1F94A 1NXBA 4EY8B 1IDLA 1CCQA 1ERGA 1UG4A 1TFSA 1FASA 4ZQYA 1IDHA 1IQ9A 1HC9B 2QJBC 1IKCA 2NBTA 3EVSC 4OM4A 1CXNA 1BTEA 2H62D 1CXOA 1KBAA 2H5FA 2MUPA 1BXPA 4KSNA 1RGJA 1QKEA 4QTIU 1KBSA 3BT1U 1YWHA 1XT3A 1FFJA 1KU6B 1S4YA 4IYEA 4FAOE 1KXIA 1JGKA 1NTNA 4RUDA 1L4WA 1W6BA 1HAJA 1LXHA 4FAOC 1CDTA 2QJ9C 2PJYB 1MR6A 2JQPA 1KBTA 1FRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VB0 A;  2MJ0 A;  2UX2 A;  2H8U A;  1COD A;  2ERA A;  2OFS A;  2PJY C;  2N99 A;  2ABX A;  3U73 U;  1FSC A;  5DZ5 A;  1PLO A;  2I9B E;  2LCR A;  1CTX A;  4UY2 C;  1JE9 A;  3LAQ U;  2H7Z A;  1LX5 B;  1H0J A;  3FEV A;  2MJY A;  1HOY A;  1COE A;  1IDG A;  1KL8 A;  4P7U A;  1QM7 A;  1ONJ A;  2H64 B;  1CRF A;  2MUO A;  2J8B A;  1NYS A;  1RL5 A;  1ES7 B;  2CCX A;  1KS6 A;  1ABT A;  1CHV S;  6EBX A;  2UWR A;  1DRS A;  1CDR A;  1KTZ B;  2H7Z B;  3KFD E;  1KC4 A;  1FSS B;  2H64 C;  3NDS A;  1I02 A;  3VTS A;  4LFT A;  1LJZ A;  1V6P A;  4OM5 A;  5IMY C;  2QJA C;  4BDT B;  3ERA A;  3PLC A;  2JVE A;  1KFH A;  2L5S A;  1IDI A;  1CRE A;  1CDS A;  1IK8 A;  1CB9 A;  4AEA A;  1QKD A;  1NTX A;  3NH7 A;  2BTX A;  1IJC A;  5DO6 A;  1LXG A;  5IMT D;  2CRS A;  1F8U B;  2HLR A;  3BT2 U;  4XJJ A;  2L03 A;  2X8B B;  2LA1 A;  2CDX A;  2K3G A;  1MAH F;  2GOO B;  2QC1 A;  1G6M A;  1ZAD A;  2BHI A;  2MJ4 A;  5EBX A;  1CVO A;  1HAA A;  1B41 B;  1CDQ A;  1NEA A;  1ERA A;  5DU1 A;  1REW C;  4DO8 A;  1NYU A;  1NOR A;  2GOO C;  1TXB A;  3KFD I;  3QB4 B;  1M9Z A;  2MFA A;  1JBD A;  1TGX A;  1TXA A;  1LSI A;  2CTX A;  2MHY A;  3NEQ A;  3HH7 A;  4BIK B;  1HC9 A;  1FF4 A;  2VLW A;  2HLQ A;  4HQP F;  3EBX A;  2H62 C;  2FD6 U;  3U74 U;  2CRT A;  1F94 A;  1NXB A;  4EY8 B;  1IDL A;  1CCQ A;  1ERG A;  1UG4 A;  1TFS A;  1FAS A;  4ZQY A;  1IDH A;  1IQ9 A;  1HC9 B;  2QJB C;  1IKC A;  2NBT A;  3EVS C;  4OM4 A;  1CXN A;  1BTE A;  2H62 D;  1CXO A;  1KBA A;  2H5F A;  2MUP A;  1BXP A;  1RGJ A;  1QKE A;  4QTI U;  1KBS A;  3BT1 U;  1YWH A;  1XT3 A;  1FFJ A;  1KU6 B;  1S4Y A;  4IYE A;  4FAO E;  1KXI A;  1JGK A;  1NTN A;  4RUD A;  1L4W A;  1W6B A;  1HAJ A;  1LXH A;  4FAO C;  1CDT A;  2QJ9 C;  2PJY B;  1MR6 A;  2JQP A;  1KBT A;  1FRA A; 
#chains in the Genus database with same CATH topology
 1VB0 A;  2MJ0 A;  2UX2 A;  2H8U A;  1COD A;  2ERA A;  2OFS A;  2PJY C;  2N99 A;  2ABX A;  3U73 U;  1FSC A;  5DZ5 A;  1PLO A;  2I9B E;  2LCR A;  1CTX A;  4UY2 C;  1JE9 A;  3LAQ U;  2H7Z A;  1LX5 B;  1H0J A;  3FEV A;  2MJY A;  1HOY A;  1COE A;  1IDG A;  1KL8 A;  4P7U A;  1QM7 A;  1ONJ A;  2H64 B;  1CRF A;  2MUO A;  2J8B A;  1NYS A;  1RL5 A;  1ES7 B;  2CCX A;  1KS6 A;  1ABT A;  1CHV S;  6EBX A;  2UWR A;  1DRS A;  1CDR A;  1KTZ B;  2H7Z B;  3KFD E;  1KC4 A;  1FSS B;  2H64 C;  3NDS A;  1I02 A;  3VTS A;  4LFT A;  1LJZ A;  1V6P A;  4OM5 A;  5IMY C;  2QJA C;  4BDT B;  3ERA A;  3PLC A;  2JVE A;  1KFH A;  2L5S A;  1IDI A;  1CRE A;  1CDS A;  1IK8 A;  1CB9 A;  4AEA A;  1QKD A;  1NTX A;  3NH7 A;  2BTX A;  1IJC A;  5DO6 A;  1LXG A;  5IMT D;  2CRS A;  1F8U B;  2HLR A;  3BT2 U;  4XJJ A;  2L03 A;  2X8B B;  2LA1 A;  2CDX A;  2K3G A;  1MAH F;  2GOO B;  2QC1 A;  1G6M A;  1ZAD A;  2BHI A;  2MJ4 A;  5EBX A;  1CVO A;  1HAA A;  1B41 B;  1CDQ A;  1NEA A;  1ERA A;  5DU1 A;  1REW C;  4DO8 A;  1NYU A;  1NOR A;  2GOO C;  1TXB A;  3KFD I;  3QB4 B;  1M9Z A;  2MFA A;  1JBD A;  1TGX A;  1TXA A;  1LSI A;  2CTX A;  2MHY A;  3NEQ A;  3HH7 A;  4BIK B;  1HC9 A;  1FF4 A;  2VLW A;  2HLQ A;  4HQP F;  3EBX A;  2H62 C;  2FD6 U;  3U74 U;  2CRT A;  1F94 A;  1NXB A;  4EY8 B;  1IDL A;  1CCQ A;  1ERG A;  1UG4 A;  1TFS A;  1FAS A;  4ZQY A;  1IDH A;  1IQ9 A;  1HC9 B;  2QJB C;  1IKC A;  2NBT A;  3EVS C;  4OM4 A;  1CXN A;  1BTE A;  2H62 D;  1CXO A;  1KBA A;  2H5F A;  2MUP A;  1BXP A;  4KSN A;  1RGJ A;  1QKE A;  4QTI U;  1KBS A;  3BT1 U;  1YWH A;  1XT3 A;  1FFJ A;  1KU6 B;  1S4Y A;  4IYE A;  4FAO E;  1KXI A;  1JGK A;  1NTN A;  4RUD A;  1L4W A;  1W6B A;  1HAJ A;  1LXH A;  4FAO C;  1CDT A;  2QJ9 C;  2PJY B;  1MR6 A;  2JQP A;  1KBT A;  1FRA A; 
#chains in the Genus database with same CATH homology
 1VB0 A;  2MJ0 A;  2UX2 A;  2H8U A;  1COD A;  2ERA A;  2OFS A;  2PJY C;  2N99 A;  2ABX A;  3U73 U;  1FSC A;  5DZ5 A;  1PLO A;  2I9B E;  2LCR A;  1CTX A;  4UY2 C;  1JE9 A;  3LAQ U;  2H7Z A;  1LX5 B;  1H0J A;  3FEV A;  2MJY A;  1HOY A;  1COE A;  1IDG A;  1KL8 A;  4P7U A;  1QM7 A;  1ONJ A;  2H64 B;  1CRF A;  2MUO A;  2J8B A;  1NYS A;  1RL5 A;  1ES7 B;  2CCX A;  1KS6 A;  1ABT A;  1CHV S;  6EBX A;  2UWR A;  1DRS A;  1CDR A;  1KTZ B;  2H7Z B;  3KFD E;  1KC4 A;  1FSS B;  2H64 C;  3NDS A;  1I02 A;  3VTS A;  4LFT A;  1LJZ A;  1V6P A;  4OM5 A;  5IMY C;  2QJA C;  4BDT B;  3ERA A;  3PLC A;  2JVE A;  1KFH A;  2L5S A;  1IDI A;  1CRE A;  1CDS A;  1IK8 A;  1CB9 A;  4AEA A;  1QKD A;  1NTX A;  3NH7 A;  2BTX A;  1IJC A;  5DO6 A;  1LXG A;  5IMT D;  2CRS A;  1F8U B;  2HLR A;  3BT2 U;  4XJJ A;  2L03 A;  2X8B B;  2LA1 A;  2CDX A;  2K3G A;  1MAH F;  2GOO B;  2QC1 A;  1G6M A;  1ZAD A;  2BHI A;  2MJ4 A;  5EBX A;  1CVO A;  1HAA A;  1B41 B;  1CDQ A;  1NEA A;  1ERA A;  5DU1 A;  1REW C;  4DO8 A;  1NYU A;  1NOR A;  2GOO C;  1TXB A;  3KFD I;  3QB4 B;  1M9Z A;  2MFA A;  1JBD A;  1TGX A;  1TXA A;  1LSI A;  2CTX A;  2MHY A;  3NEQ A;  3HH7 A;  4BIK B;  1HC9 A;  1FF4 A;  2VLW A;  2HLQ A;  4HQP F;  3EBX A;  2H62 C;  2FD6 U;  3U74 U;  2CRT A;  1F94 A;  1NXB A;  4EY8 B;  1IDL A;  1CCQ A;  1ERG A;  1UG4 A;  1TFS A;  1FAS A;  4ZQY A;  1IDH A;  1IQ9 A;  1HC9 B;  2QJB C;  1IKC A;  2NBT A;  3EVS C;  4OM4 A;  1CXN A;  1BTE A;  2H62 D;  1CXO A;  1KBA A;  2H5F A;  2MUP A;  1BXP A;  4KSN A;  1RGJ A;  1QKE A;  4QTI U;  1KBS A;  3BT1 U;  1YWH A;  1XT3 A;  1FFJ A;  1KU6 B;  1S4Y A;  4IYE A;  4FAO E;  1KXI A;  1JGK A;  1NTN A;  4RUD A;  1L4W A;  1W6B A;  1HAJ A;  1LXH A;  4FAO C;  1CDT A;  2QJ9 C;  2PJY B;  1MR6 A;  2JQP A;  1KBT A;  1FRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...