1NYWA

The high resolution structures of rmlc from streptoccus suis in complex with dtdp-d-glucose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
194
structure length
194
Chain Sequence
b'NFFGKTLAARPVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGTWVDLREGETFGNTYQTVIDASKSIFVPRGVANGFQVLSDFVAYSYLVNDYWALELKPKYAFVNYADPSLDIKWENLEEAEVSEADENHPFLKDVKPLRKEDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
publication title High-Resolution Structures of RmlC from Streptococcus suis in Complex with Substrate Analogs Locate the Active Site of This Class of Enzyme
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Isomerase
total genus 51
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2003-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nywA00
1NYWA 2FMYA 4X6QB 1NZCA 3RYPA 5KHJA 1QWRA 1XRUA 2VQAA 1YFXA 1Y3TA 2BGCA 2EAAA 2F4PA 4HVQA 2B8MA 2BNMA 3FE5A 3BU7A 3SCHA 4BH9A 2XLFA 5I93A 3DN7A 3RYRA 2PHLA 3H50A 2UY8A 5KHKA 4MGYE 2IXLA 4AQ6A 3CJXA 1UIKA 3GBFA 4Q0UA 4XF0A 5F1RA 4HN1A 1UD1A 2EA7A 3B02A 3ZDSA 5BV6A 3UKVA 4AVAA 4MH0E 3DV8A 1I5ZA 4Q0QA 2Z69A 4MGIE 4HLTA 2ET1A 3D0SA 4UBHA 2D5FA 4JV4A 2EVXA 4L2NA 1ZZ9A 1XE8A 2P17A 5CVRA 1CAWB 4IETA 2Q0AA 4E2GA 4J1XA 4LUKA 5K8SA 3WW3A 2XLGA 1ZZCA 4QM9A 1GQGA 1UPIA 1CGPA 3R6SA 1ZVFA 3JZVA 3OF1A 4BIFA 1CAUA 5KHGA 1X82A 4XFBA 4HMZA 5KHIA 4MUVA 2UYBA 5I0SA 2PAEA 4XF9A 2GC1A 1CAUB 4XFIA 5LRSA 1U12A 4WBBA 2PQQA 4F8AA 4JTNA 4LTAA 2GC2A 4XFFA 4AXOA 5BPXA 3HT2A 2B5HA 1LB2A 4XFGA 3CEWA 3DL3A 3H8UA 5EZWA 5FLJA 3S0MA 3LAGA 4FAGA 1EP0A 4JVAA 3WW2A 3BPZA 2XL7A 3EBRA 3I59A 3SCGA 1J3QA 1RUOA 1EPZA 2B9UA 5FLHA 4I2OA 2GU9A 3CO2A 4CYDA 3O14A 5I8SA 1O5LA 2PAKA 1SQ4A 4XFAA 1H1IA 4DINB 3ACLA 4IEPA 2ETEA 2IXJA 4N9IA 4MV2A 4P9GA 1Y9QA 1NXMA 3FZ3A 4LA3A 4HSLA 1NE4A 4PIZA 1J3PA 1X7NA 4FT8A 4Z82A 3IDBB 1QY4A 2ZCWA 4MGKE 5FQ0A 3KSCA 5LEKA 4E2QA 3OD0A 5FCCA 3E97A 3U0ZA 3NKTA 4XFHA 4IEZA 2PTMA 4ONUA 3G7DA 3CLPA 3WW1A 4MZUA 3H9AA 5FQ0B 4PIXA 4KWJA 1OFNA 5FPZA 3KCCA 5CADA 1O4TA 2XKPA 4RD7A 3USSA 1GQHA 3ELNA 1WA4A 2Z2SB 4I02A 5JSRA 2H0VA 2I45A 4UBGA 5FLIA 2BEOA 4WZCA 5BUVA 5JR7B 3SMHA 2BYVE 4IEOA 1DZRA 2D40A 1DGWA 1SFNA 2GC3A 3CF6E 3OTFA 4HSJA 1YWKA 1HW5A 4EROA 3BALA 4E2SA 2O1QA 1Q5OA 2HKXA 2Q1ZB 3RNSA 4GULA 5I8YA 2K9ZA 4KWKA 3L2HA 3NL1A 2D5HA 1FXZA 3FWEA 1CAWA 1VJ2A 1UCXA 3RZZA 3FJSA 1DZTA 2FQPA 4H7LA 3MZHA 1IPKA 4Z07A 5AVPA 2ET7A 1YHFA 2XHKA 4ZU5A 5JCTA 3ES4A 1ZZ7A 3H7JA 4LA2A 4AQ2A 3LWCA 2MHFA 3PVBB 4D7SA 5C6CA 3N4MA 2IC1A 1FT9A 1I6XA 4HN0A 2WC2A 1RUNA 4XEZA 5I8TA 3CL1A 4QGNA 3KGZA 1ZZ6A 1LR5A 4X6RB 3PNAA 4Q0PA 1QXJA 1ZRDA 3IBMA 4UXAA 5I0RA 3VHRA 2QDRA 1YUDA 1PMIA 5I0TA 4QGMA 4QMAA 3C3VA 1O7FA 3E5XA 3GYDA 5JAXA 1YFUA 2GH2A 1RGSA 1ZRFA 5LRRA 2OYZA 1CAVB 4YNIA 3H3UA 2PYTA 1O3QA 2XGXA 4K8FA 3ETQA 3M3IA 3KMHA 3HT1A 4META 2ATFA 3NW4A 4LULA 1CAXB 3RDIA 3E6BA 2XKOA 2WFPA 2IXKA 4XFCA 2C0ZA 3S7IA 1G6NA 2ZKLA 4F7ZA 1Q43A 4HZFA 5I0UA 4ORFA 5KBFA 1EYBA 1SEFA 3LA7A 1EY2A 4J1WA 4B29A 1ZRRA 1ZREA 1YLLA 2UY9A 5BXXA 4EWDA 2Y0OA 3FFQA 2HJIA 1RC6A 3BCWA 3I54A 4BHPA 1UIJA 1OMIA 3QOPA 4TLFA 1J1LA 2QVSB 4Q0SA 1H1MA 5FPXA 1WGPA 1ZZBA 1X8MA 2BNNA 2PA7A 4LEJA 1RTVA 3M70A 5JSPA 4OLLA 1YFWA 4MX3A 1Q3EA 2PFWA 2CGPA 5KHHA 4EV0A 2PAMA 2GAUA 1J59A 2E9QA 1TQ5A 1J3RA 2IXIA 3WW4A 3LA3A 2XL9A 3IWZA 3E5QA 3H1WA 3EQEA 2O8QA 3D82A 3RYKA 3UKNA 1X8EA 3MPBA 5J48A 2GC0A 3LOIA 1LKNA 4OFGA 2H6CA 4BYYA 4ZU4A 4HVRA 4O9EA 3RPQA 4FAHA 3HIFA 5J3UA 2CV6A 4YSFA 4IERA 4Q29A 4QXKA 4EWEA 4XF4A 4IEYA 2MPFA 3BB6A 2Q30A 3E5UA 3TNPB 2IXHA 5LEJA 4A2UA 1ZNPA 4XF1A 1UW8A 2DCTA 4IEWA 5E16A 4LUMA 5E1RA 3NJZA 3EJKA 3IIAA 4YRDA 3LA2A 4I3PA 4QX5A 5J7MA 4EWAA 3MDPA 2PHDA 4KU7A 1CAVA 5BY5A 3MYXA 4WVZA 3LZZA 3OCPA 2OA2A 4IEXA 1XE7A 2XLAA 1CX4A 4AVBA 4IEVA 4KL1A 2KXLA 2H6BA 4MGZE 1RL3A 1IPJA 4LLOA 1CAXA 1ZZ8A 5JSOA 4I0AA 4L11A 2OPKA 5T3NA 3E6CC 4I09A 4IEUA 4N9HA 4R8HA 3ES1A 1O5UA 4D7TA 3DKWA 5C8WA 1L3JA 4I01A 2CAUA 2VECA 3FHIB 2QNKA 3SXWA 5HI0A 2MNGA 3UKTA 2K0GA 2CAVA 3NSTA 2UYAA 4QGLA 4I0BA 1DGRA 4PJYA 3H1MA 4AVCA 4IESA 4QM8A 1ZX5A 1WLTA 4XF3A 3SCFA 3U11A 3SHRA 4R52A 3H1YA 3E6DA 5D1IA 4FBFA 4O9GA 2N7GA 4XETA 2IXCA 3H3ZA 2GZWA 4JTOA 4KWLA 5FDBA 2Q4SA 3ST7A 5EFUA 1O3RA 3OGJA 1OI6A 4IEQA 2OZ6A 3EHKA 3I59B 4ZU7A 2QCSB 3I7DA 3IDCB 1FI2A 2QJVA 4HVOA 5I91A 3U10A 3NVCA 4PIYA 1O3SA 4YARA 2D93A 1OD5A 3HQXA 1O3TA 1QXRA 2BNOA 1VP6A 2OZJA 1JUHA 1VR3A 1ZRCA 4KU8A 3QACA 4YYOA 3EO6A 3KGLA 1V70A 3D0JA 3S7EA 4NVPA 1LRHA 2VPVA 3ROUA 3FX3A 1NE6A 1YFYA 5CU1A 1PM7A 3TNQA 4HBNA 3PLQA 3H7YA 1J58A 4Q0VA 2V09A
chains in the Genus database with same CATH superfamily
1Y9MA 1NYWA 1V6MA 2D3SA 5DUUA 1H8VA 3M3OA 1YNAA 4P9XA 3P6BA 3JBG1 2JKXA 3ZYFA 4PF5A 3QLQA 3WEZA 1XRUA 1YFXA 1Y3TA 1RUI2 2BGOA 1O4YA 4AOCA 4Y1XA 1WMFA 1SBFA 2B8MA 2WN3A 4Y20B 1MS1A 5JUVA 1R1A3 2DVFA 4IDZA 2OW4A 3AFGA 2ZEWA 4AWDA 2D97A 4ET7A 4XZPA 4FTSA 4G9SB 3ENRA 4QDSA 3GGLA 5FYCA 3H50A 2FMDA 4NE9A 2JDUA 4GH4C 2XMLA 4Q1PA 2FZ2A 1Z0HA 3ACFA 2HWE3 3O0WA 3GNEA 2WYFA 2CWSA 4N43C 4LO4B 5F1RA 2RJLA 1UD1A 1XJAA 2HEYF 3O1PA 3I3EA 3OYWA 5JMCA 1WA6X 1ULGA 2NYYA 2VC9A 3A22A 3GCXA 3P1IA 4IW3A 1EV11 1D4VB 3PTRB 2ZGRA 4NJ4A 3BPSA 2BJSA 1ZZ9A 1UYXA 3K3NA 4FP2A 1JTZX 1H2LA 1NXD1 1XE8A 3ZKUA 3EYPA 5EHDA 4X8PA 2QQUA 5FY8A 4YG6A 3UGHA 3WW3A 3OBZA 2ZX4A 5IW0A 1G9AA 5FY7A 3PVEA 5FY1A 1GQGA 1AYM2 3KB5A 1PIV1 3JD71 1JHNA 3JZVA 3W5MA 5BNOC 3OF1A 5FY9A 4IV3A 5D8AA 1URXA 1OHFA 1X82A 1ULFA 3IN9A 4ZXKA 5F37A 2QUOA 2VTXJ 4XJ8A 4NRPA 3R4UA 1HQLA 3V0BA 2I2SA 2DCJA 3H8XA 2UYBA 4OQ9A 1K42A 3WQ0A 1RUC2 4B4PA 2R0HA 4QQHA 2WAAA 1LU2A 3BIEA 2VMIA 1ASJ2 3H0OA 4F8AA 1SG3A 1W90A 1AXZA 1BJQA 4DUVA 3ACIA 3ZFFA 1NCRA 4LTAA 4NRMA 4AXOA 2NM1A 5BPXA 2G9FA 1I5PA 5T50A 3RZGA 1Q8QA 3BOPA 1L7LA 2F17A 4NPRA 4AGVA 3WHTA 1V9U1 3ZR6A 3O0VA 4B8EA 1NLRA 3DEMA 4WM7C 1UOJA 4TWTA 4C0HA 4FAGA 4NIAA 5SV5A 3VGIA 2QQOA 5JOZA 5E89A 4QPGB 1HLCA 1FATA 4M3CE 1S2KA 1HRI1 2EXIA 3OPWA 1A8DA 2GNBA 1LOAA 3LGRA 1I1EA 4YVSA 1VBA1 2WLPA 2R062 3SNMA 4HG6B 3N7MA 1H1IA 4GMP0 1AR81 3ACLA 4JHTA 1C3HA 4LQRA 1GZTA 4IEPA 3WX5A 2JKBA 5HPOA 2VZ3A 2DUPA 5GZFA 1W03A 1GFF2 2MEV3 1XB9A 3ABZA 3WOGA 5DAWA 5IK8A 1VMJA 2DUOA 1RMU2 2XVLA 2WNUB 4N9IA 3R4DB 4K9SA 4P9JA 3RJRA 1NXMA 1PK6B 5AC92 4HSLA 1K12A 2WNVA 4PIZA 4TXWA 1JOBA 5ABJA 5LA1A 4NIHA 4OCTA 3POJA 2Y6KA 2JJ6A 2V73A 2WJSA 3N35A 5F6KA 4XABA 1W9YA 4AFMA 2BVBA 2GP3A 3MW2A 2WBKA 2ZGOA 1MS9A 4LKSA 5LEKA 3TN92 4E2QA 1B35B 4RFT0 2W94A 1WCSA 4CTEA 3OD0A 5J37A 4RHV3 2NP0A 1REDA 1Z7S1 4GB32 1K3IA 2WS93 2DUQA 3ZXKA 5A6XA 4XFHA 1DLCA 2YMZA 3HMYA 2PTMA 4ONUA 5FYUA 5FQ0B 3FC0A 1LU1A 2IVJA 1BEV2 3VKNA 1GNHA 1PMHX 2ZXQA 3AKSA 1RITA 4E4ZA 1W39A 2ERFA 2Y60A 4Q4W1 5IT6A 2BWCA 2F6BA 1WA4A 1SPPB 2I74A 3THCA 4HK8A 4S2GA 3VBOB 1A8MA 4EN0A 4LK7A 5JSRA 3VBSC 1MPXA 3POFA 2OX0A 1TNFA 3G6JB 4NROA 2WWUA 5DAPA 3UGFA 4FQZA 2C26A 5I0DA 3LSEA 4W6WA 4WZCA 3DPRC 2YGMA 4DMIA 1YWKA 2FCVA 2Y0IA 1GLHA 3BALA 3MICA 3HNYM 1OKQA 1JBCA 3T08A 3WDVA 1ULPA 3MV01 4Q8LA 2JE8A 4GULA 2WT1A 3NNJA 5L7OB 1FX5A 5I8YA 3D3AA 2K9ZA 4KWKA 3L2HA 2PQSA 4XCBA 5DDJ2 2D5HA 1FXZA 3FWEA 1OLMA 2YFZA 4XYXA 5IWFA 5FYHA 3GZAA 1C8M2 4RL7A 5H9SA 3RZZA 3I2OA 4WM8C 1DHKB 3WNNA 1QJZA 4FFGA 3ZYGA 3MZHA 1IPKA 2CSGA 4XE9A 2D6KA 2PLV1 4D6RA 3H7JA 4AQ2A 4D7SA 3N4MA 2MHFA 2CNAA 3F95A 3MUZ1 3PTYA 2IC1A 5C4WA 1AL21 1UN1A 1I6XA 1NQDA 4HN0A 1QDOA 1IS4A 2BBAA 2W52A 3KF3A 1DQ5A 1BBT3 4K40A 1MZ5A 4XEZA 3VBFC 3KGZA 2BP6A 1R1A2 1XNTA 2LW8A 1OD3A 4Q0PA 2UWCA 1ZRDA 1EAH3 4K3UA 2QDRA 5GZGA 1PMIA 2GMPA 4Q4Y1 3LCPA 2VW2A 4GXLA 3E5XA 4HANA 3J7NA 5DMYA 1RUI1 4MGTA 2GH2A 3GZTB 2QBXA 1W6OB 5K0UA 5LRRA 5LY2A 3ZX7A 1WD4A 4AYUA 4RQPC 5KXEA 4TTGA 2HWE2 1CAVB 3ZN4A 1R092 4BK5A 1TEIA 1MS4A 4L92A 3BUCA 2JG9C 3I3MA 1RIRA 5C70A 2Y64A 1POV0 4FPLA 3T30A 1OQDA 2AACA 1F4AA 1GP4A 1WBFA 4CCKA 4K8RB 4XTMA 1W6NA 3NAPB 1LEDA 5C9AB 1GNYA 4FPOB 3EMRA 4OYUA 1Y43B 4OI1A 3AZYA 4B1LA 4WVMA 4IUGA 1CWPA 3HT1A 4CCJA 2FCTA 4TZDA 4DXRA 2ZHLA 4CEWA 2XWJB 4NWVA 3IDAA 2I07B 2H0BA 4QHZA 2JG8B 4QPIC 4P9IA 3VBUB 3UYJA 1E5RA 4HT1T 1NA1B 5F5QA 2IXKA 4AF9A 4LKDA 3IDEA 4IV1C 3RVHA 1DGRN 2ZMNA 5FMOS 3QBQA 1C1FA 5FXZA 3NNFA 1LOBA 2CWMA 1EV13 1V6JA 1EYBA 4GAZA 3MI8A 1O59A 3VDDA 3LA7A 4XJZA 4Y1ZA 2Q1MA 2ZGLA 4J1WA 1WLDA 1J1TA 5HCBA 4B29A 4IXLA 3WDWA 2GH8A 3D5OA 5DAQA 4EN7B 2DFCA 1ZREA 4LOSA 4BMEA 2UY9A 3V56A 5A32A 5IVVA 4EN6B 2RV9A 2PHXA 1CIYA 2JIGA 2VMFA 3FFQA 5DABA 5BXXA 5DZFA 5IVYA 4ATFA 3BCWA 1CESA 1QJU1 2XBO1 2A3WA 4GA9A 3JD73 1OMIA 4LK6A 1V6IA 2IFWA 2VJXA 5EXOA 1ALYA 2IFRA 1J1LA 3R4SA 3N9QA 1W6QA 1ASJ1 5CEHA 4A44A 4CP0A 2HWD1 1WGPA 1ZZBA 3WUDA 1RTVA 3USUB 5CBLA 5KXCA 4CXXA 3KZ4C 4OLLA 1YQ6A 4WV8A 1YFWA 4Y22B 5FIXA 1Q3EA 3SC7X 4ZY9A 3ZO0B 4A41A 1LGCA 5KHHA 4QX7A 2VW1A 5EJ1B 5FP3A 3I97A 4Y5SA 2GAUA 5KXDA 3K48A 4QHBA 4OQ8A 1TG7A 5AVAA 1MQTC 1J59A 3K51A 3C7GA 5ERLA 3AZWA 3ZFEA 3K4AA 4Y26A 1J3RA 3I8TA 2CGNA 3WW4A 2XL9A 5T5OA 1VBE3 5GLVA 2P5BA 4AEDA 1OA3A 2MEV2 3WNOA 3OEAA 1FMD1 3RYKA 4YG0A 2R32A 1IS3A 3WUCA 5GZEA 2J1UA 5A70A 4N53C 4BIOA 4N90A 4D6SA 4FP3A 1WMDA 2WA3A 3FUQA 2AEYA 4E8DA 2VQ0A 2W5FA 3AZZA 1CJDA 1XE0A 1AR93 1HXS1 2R1DA 3FFZA 4A4AA 1IOAA 2CV6A 3BYWA 4C90A 4ZZ8A 5JZGC 2XQXA 4QXKA 4RHV2 4IEYA 1GZ9A 2MPFA 2WS92 2DBNA 2JXAA 3A0KA 3AP6A 3B5LB 4N8MA 5CB7A 4COWA 1LHVA 3BB6A 3E5UA 4CDUC 3C7EA 2WO7A 4A7ZA 4EYUA 1LECA 4FOWA 3PDQA 4DQAA 3UK9A 5JXHA 3TN91 3JUUA 2VGDA 3NMBA 4XF1A 1PGL2 1ODNA 4D7YA 4BQ5A 1DZQA 1J83A 3INAA 3B93A 4LE4A 1H2KA 2D7FA 1DDLA 1RHI1 2EIDA 2G4IA 2P37A 2Y6LA 3IAQA 4HKOA 4AI0A 4YWAA 4KU7A 3T09A 1Z7S3 1RJ8A 1GSLA 1VRBA 3DYOA 2ZX2A 3THTA 3ZN6B 1NLQA 3VBHC 3FN9A 5T55A 2P34A 1GWMA 3KT4A 3LZZA 5JXJA 4W6XA 4V2VA 2OA2A 1OPMA 3OJBA 1IG0A 1K5MB 1XE7A 3OYWB 5FYMA 3TRSB 1W0PA 1OF3A 4DFSA 1D0GA 2EXKA 4AVBA 4E4SA 4AVTA 4S2FA 1LOFC 3PURA 4Q4W3 2KXLA 4KQ7A 4QXCA 1PGW2 3VBRA 2WZEA 3UJOA 4BE3A 3HJRA 1RL3A 1CD3G 1B09A 3I3DA 5BNPA 5FOJB 1LJ7A 4NHXA 4MOAA 1UMIA 4G4FA 1ZA7A 5JSOA 3MLKA 1GOHA 5BNNB 2VZVA 1JZ5A 4XBQA 5T3NA 2RS51 2Y6FA 4LT5A 3LSDA 5DQ0A 4LBKA 4C1XA 2ADDA 4N9HA 5EWSA 3M7AA 5FZ3A 1JOJA 1BBT2 2XOMA 3AXEA 4BK4A 2YBPA 4OI0A 1LULA 4IV3B 5CYYA 2R1BA 5D8AB 4W4ZA 5FYIA 2FDKA 4NHKA 5A7SA 1W6PA 1EAH2 1K45A 2A6VA 3BU0A 3UKTA 3V0BB 1TVGA 4CP2A 3Q8AA 2UYAA 4NO4A 5AFEA 3Q9OA 4JGZA 5LK7B 4PJYA 2JE9A 2VZOA 4K7JA 5K7PA 1ZX5A 1R1A1 4PBPA 2A5ZA 4D0QA 2RJ2A 3HVDA 3SCFA 2BOIA 1QJEA 1NCRB 5FZ7A 1AL23 4FI9A 3SHRA 3U11A 1U5YA 3LF7A 4LO6B 2DWRA 4CU7A 3NWKA 1R1ZA 2VOTA 4JTOA 3U75A 1TMF3 5EQUA 2WWSA 1REEA 2Q4SA 4XAAA 5IVFA 2HWE1 4CPBA 1KS4A 2R7EB 4Q4Y3 4RGGA 1JZ8A 4P08A 1WUVA 2WAOA 3LPGA 5LZ6A 1OI6A 3Q8BA 4P9LA 3DECA 3T0DA 1C28A 3ZPYA 2ZHNA 5I91A 3U10A 3NVCA 1D7PM 2W68A 2OVUA 4YARA 4XJ9A 3R0RA 4YW3A 1O3TA 1UZYA 3CHXA 2FZ1A 3GBWA 3KF5A 1VP6A 1JUHA 1POQA 3VZKA 1LESA 5A33A 1EV12 1ZRCA 1FPN1 1FV2A 1UZZA 1S0BA 2VAUA 5DG1A 4E9KA 1JZ7A 3LEMA 1COV1 2Y34A 3KGLA 4QDQA 2W87A 5A7PA 1OA2A 1BYHA 2OUHA 1CJPA 1RVF3 4CSWA 3ZXLA 2WNVB 3KT7A 5ABJB 2RDNA 2E26A 4JRAA 3KCYA 3S5QA 5DPNA 4QPGC 2WLQA 3PLQA 4XC9A 3RZHA 5FZIA 4P5HA 4JGYB 1ND3A 4CXWA 3HWJA 1NT0A 3JD72 1YC61 3WQBA 2FMYA 3IZOA 4X6QB 2ZHMA 3KV5A 1NZCA 3ETPA 1QWRA 2WO1A 5FMOL 4AHXA 2EIBA 1Q8PA 3WLUA 1OXCA 2VQAA 4XUNA 5FOBB 5FBZA 4JHZA 3O7OA 3B00A 1LHNA 1M4WA 4KGGA 3VKFC 1GZCA 2QQLA 3HPNA 4P14A 4PF1A 2WNUC 3SCHA 1PK6C 2WZPP 3WVJA 3DN7A 4M0NA 5I93A 3WNPA 2Y6GA 3PJQA 3LDBA 1QJU3 2XBO3 1MVEA 2DBIA 2WZR3 5FZMA 2RVAA 2UY8A 4XMAA 2F4LA 1HRV3 3POEA 5J96B 4AQ6A 3ASIA 3CJXA 1UIKA 4FFIA 4AVSA 1B35C 3GBFA 4Q0UA 4XF0A 2OUJA 1XBFA 3WY6A 3B02A 3ZDSA 2RDQA 1VBE2 4XZUG 2XXZA 3HD8B 1PO11 2HWD3 3LEGA 4MH0E 4YW5A 3DV8A 3ZXGA 3APBA 3AKTA 4Q0QA 4DS0A 2Z69A 1BCXA 2VZUA 4IE5A 2BQPA 2W91A 4HLTA 1XSRA 5DUXA 5FREA 1QMJA 1FOD3 3D0SA 4UBHA 4KBZA 4JV4A 4L2NA 4E4DX 3DF0A 1FYUA 4N7UA 4IETA 2BU9A 1AR92 1BHGA 4E2GA 2ID4A 4LUKA 2QQMA 4AAPA 3VBOC 1JYNA 4KGQA 2NZ9A 4QM9A 3RG0A 1Q56A 4FQ4A 2RJKA 4AFCA 3ZYJB 2VTFA 2XONA 4CCLA 3R6SA 3A23A 1WW6A 1QF3A 1FMD3 1ZVFA 4V1PA 1DGWX 5JPMB 1CAUA 2VZ1A 3POSA 5C4WB 5KHGA 4MYEA 3NNLA 4BU2A 4XFBA 3F2ZA 1XNBA 2AZ5A 1UKRA 4YW2A 1GBGA 3MV11 4Y24A 4RHV1 4HMZA 4XOGA 5GM0A 5KHIA 2QQPA 5LY1A 2WS91 5L7OC 2GC1A 4AK3A 1GR3A 1HXS3 1W8WA 3ILRA 2K2SA 3MF6A 4UF0A 1W2TA 3PUHA 2HWB3 1I3HA 4INDA 1HIXA 1OLQA 4B4QA 1Z7S2 1DF0A 1E5SA 4JTNA 3FLTA 3OPZA 3ZIWA 4C91A 4XCAA 5K0UB 5FZOA 1PM4A 2GC2A 1PGL1 4LJHA 3ZXJA 5FYBA 5C5UA 3WP4A 5KC5A 4UT5A 3C7FA 5FWJA 5CKMA 1GMMA 1WW5A 3DL3A 5FLJA 3BKZA 3S0MA 3S5AA 2VY0A 1C57A 4BQ4A 4FPKA 3KHBA 3POIA 1W6NB 4Q4W2 3BTXA 4XMIA 3WW2A 2HH9A 3ZXDA 3BPZA 3I59A 5E8AA 5FZGA 3THPA 1RHI3 4AI2A 4WVMB 4QKDA 3PMEA 3MGUA 4DO0A 1RUOA 1XNDA 4M4RA 1WZXA 3B7MA 4GIQA 2WN2A 1VAVA 4CEWB 4ES8A 5FZ4A 1ULDA 5FLHA 2GU9A 2WDBA 4A7YA 4I2OA 1L7QA 4DEVA 1NUKA 2VUDA 3O14A 5I8SA 1OOPC 5LA2A 1O5LA 2PAKA 1ACCA 1PGW1 1SQ4A 1WD3A 3X29B 5LCWL 2D98A 4DINB 4PLOA 3FLRA 3VDCA 2CGOA 5A6YA 4FPYA 1UOFA 2WL1A 3RMXA 4MXVA 4V2WA 3VDDB 4MV2A 4P9GA 2ZGPA 3FZ3A 4LA3A 3NAPC 5FZ0A 5FJKA 5C9AC 1OLRA 1J3PA 1IKQA 4L99A 3KVBA 4OI2A 4Z82A 1TE1B 2ZGNA 3AVRA 3IDBB 3LE0A 1BBT1 1QY4A 4PQQA 5EJ3A 5FY4A 5A32B 2RS53 3TYJA 4YGCA 5FUPA 4HPKA 1R64A 2JG8C 2YPJA 3AJYA 3VBUC 3E97A 5FP7A 3MHZA 1AL22 3CZJA 2YU2A 1NA1C 4UAPA 2E31A 2VE1A 4LBQD 2X05A 1F8VA 1Q8SA 1W6QB 4MZUA 4RGAA 5FAXA 1DCSA 4PIXA 1KFXL 1TMF2 5C7GA 4YW6A 2XJQA 1C8NA 2ZS6B 4Q4Y2 3KCCA 5CADA 4DNYA 3BODA 4RD7A 1GQHA 3USSA 3K4ZA 2QQKA 2VOXA 3ELNA 5GLWA 4HONA 1LENA 4OZXA 1Q8VA 2HBTA 3MIEA 5A1LA 2I45A 1LHOA 4ASMB 4UBGA 5EIYB 1KD7A 4LNVA 5FLIA 4IE0A 4CP9B 2HYKA 3ECQA 3LIGA 1AXKA 2BYVE 3ZFEB 2D40A 1DGWA 2BOJA 2YU1A 1HW5A 3M2MA 4EROA 5T5JA 5IAXA 3THDA 3RFRA 2RS13 5AFBA 2SBAA 1VIWB 5CG8A 1JZ6A 1XYOA 2HKXA 1HN1A 4AVVA 5FY0A 1WW7A 4KNCA 3NL1A 3PIJA 2WINB 1CAWA 1RVF2 1VJ2A 1UCXA 2VZPA 4XDOA 3VN4A 3FJSA 3SKJE 4BOWA 2VOWA 3H8OA 1DZTA 4LPLA 2YYOA 4XTPA 3WCSA 2C1FA 2FHRA 1E5IA 2XHKA 2ARXA 1WCDJ 1PGSA 5GLTA 3WF3A 3ZYRA 3BOWA 4M4PA 3NV4A 2LUWA 2VQTA 1FPN3 1UO9A 4FTEA 2WC2A 1COV3 4LBMA 3CL1A 4QGNA 1HB3A 1ZZ6A 1JHJA 1PZ8A 4X6RB 2GNTA 5EYXA 1N3QA 1QXJA 1PO21 2J1VA 1GZWA 3AYDA 3IBMA 3ZMNA 1JW6A 3MW4A 4GZ9A 1SFPA 4EZHA 3AYEA 3KT1A 1YUDA 1DG6A 2E32A 1WLWA 1SDWA 3M3CA 2VXJA 1O7FA 1W8NA 1QJU2 2XBO2 4CEYA 2WZR2 5IFPA 2A6WA 3EXUA 1HRV2 4HETA 4LBQA 1QH6A 1YJKA 2HWC1 3WNMA 2A6YA 4DUXA 4CUBA 5EPAA 1Q8OA 2GNMA 2TUNA 4CCEA 4QX3A 2HWD2 3T3YA 3N7LA 4QPWA 4PBOA 1LGBA 4MO3M 1PZ7A 2VOVA 1OH3A 1SDDB 1W9FA 2XGXA 5T54A 2OS2A 5FZ9A 1WMXA 3JB8A 5FZFA 3AK0A 3OUJA 2Y38A 4K8FA 1KDKA 1DP0A 4B4RA 1CVNA 4ZHNA 4Y4YA 4I3GA 5HBAA 3VBRB 2ATFA 1VBE1 3RZKA 4CZSA 2Z4FA 1RXFA 2QQNA 3NW4A 1ZM1A 5FUNA 1MZ6A 4JKLA 4LITA 4W8JA 3RDIA 2VCBA 1S0EA 2DTYA 2XKOA 1PVC3 2DCZA 2JIJA 5DXDA 3S7IA 4AR2A 1DYKA 2GNDA 1G6NA 1PO13 1PMJX 2HWF1 1UY0A 3BVCA 1FMD2 3C8XA 2WQZC 5TSWA 3V64A 4IE7A 5I0UA 3VBSA 5CISA 1AR91 1IS6A 5A7NA 2OXBA 5FXVA 5CKNA 2W1UA 2EXHA 4QD2A 1SEFA 3WINE 1K5MC 4LBNA 4ZONA 2CDPA 2Q8DA 1ENQA 3VZJA 1W6PB 2DTWA 5FK7A 5DG2A 1HXS2 1NCQA 1ZRRA 5GLUA 1W05A 1RUD1 2DV9A 2HWB2 4DIQA 1YRZA 3HQRA 3JQWA 2Y0OA 3UNPA 2ZTNA 1H9WA 3RJ2X 4JGZB 3H8RA 3J7MA 2A3XA 1YQ5A 1UIJA 1D4M3 2R073 3GALA 5BNNC 2J1RA 3QOPA 1R081 4YM3A 1W2NA 2B9VA 3RI8A 5LK5A 4Q4V1 1RXGA 5FPXA 1U0AA 2BNNA 1ENXA 1RUJ1 1X8MA 2QZ3A 5A6QA 4XXPA 4YVWA 4IV3C 5C8CA 1QIQA 5D8AC 3IM0A 2CGPA 1C1LA 1RHI2 1BVVA 2A6ZA 1O8PA 2KA3A 2KR2A 1G9DA 2OQ6A 3OGSA 3Q8EA 1IPSA 4QQLA 1QDCA 3AP4A 5FMDA 5HV0A 1CPMA 1SZBA 4D8MA 4P00B 2YG0A 4QKNA 1NAEA 2DU0A 4AI9A 3I2FA 1DYOA 1XU1A 2ZMLA 2QTWB 1TQ5A 2IXIA 2WIIB 1S0DA 2VMDA 4DOUA 3IWZA 3H1WA 1RJ7A 3EQEA 3S57A 1NCRC 1ZYBA 4MHRA 2BTVC 3PHMA 2O8QA 4AHYA 4PLMA 4AG4A 2VW0A 3MPBA 5A33B 4RQPA 2ZJCA 4CDQA 1E5HA 2WYSA 4M3CA 4A42A 5F3EA 4PI0A 2JG9A 1UOBA 3FBYA 4XQ4A 5A3LA 3BTYA 3OSDA 3PJYA 4BYYA 4YZ1A 4NRQA 3RPQA 2AR6A 3U07A 1TNRA 5JOXA 3URFA 3HIFA 1AL0G 1F4HA 1H8TA 2RS52 3CIHA 4IERA 4Q29A 4QXHA 4BQWA 4XF4A 1UU6A 4J6GA 1RYYA 2WZ8A 3VZNA 1ND3B 2Z5WA 3NNGA 1WWYA 1KEXA 1OUSA 3JB4C 3LKJA 1KDMA 1TME1 3L9JT 3ZSKA 1G9BA 2E7AA 5FO8B 4A2UA 1ZNPA 2DCTA 4IEWA 4IV1A 4OHVA 5IJRA 4LUMA 5E1RA 1WBLA 3ZN5A 3V0AA 3VHNA 2JICA 4W65A 4YRDA 3TEYA 3HN3A 4QX5A 4UW3A 3O1MA 4OHYA 5ANNA 4AE2A 3CNAA 1AJOA 2PHDA 2WNVC 5ABJC 1AYN1 1W3VA 2VVEA 1TMF1 3LEKA 4XUPA 5IATA 4Z92B 1RB8G 1ONAA 3K75B 5FZEA 5G05L 5B2GB 4FOQA 4JGYC 5L19A 4PDWB 1V6OA 4OHWA 3OCPA 3KWVA 1IS5A 2RS12 2PN5A 4ASKA 2D43A 2B46X 3U37A 4KL1A 5JR2A 1US3A 2H6BA 3CZUA 3MIFA 4WVWA 5L36A 4CE8A 3KHCA 2OIIA 3AMMA 1HB2A 2ARCA 3WNKA 1CAXA 4NAOA 2X10A 3WXPA 1UWWA 4HOOA 5F3CA 2YPDA 4COUA 2W3JA 1D2QA 2OPKA 3MFCA 4I09A 4IEUA 3C2UA 4GMP1 4AZZA 2UURA 1JU3A 1RVF1 4R8HA 2XVKA 1FPN2 1JYVA 4NMIA 2EICA 4D7TA 2E7TA 3DKWA 2VL4A 3T1MA 1F2NA 1COV2 1L3JA 2VZSA 4I01A 3HEIA 2QNKA 4YLZA 4CUAA 3HOBA 4K20A 5FZ1A 2A6XA 2Y33A 3U4SA 2YBKA 4YW1A 3NJVA 1LEMA 3T2PA 1WKYA 2JEMA 4QKBA 4QGLA 1VE0A 1W8UA 2CY6A 5LA9A 5CFDB 4UF0B 5KWRA 1DGRA 3AMNA 1WW4A 1SBDA 2HLEA 3MIBA 4JKKA 3O5SA 1BK1A 2R0FA 3OUIA 5FZAA 3H42B 5DZEA 4S2HA 1VBB3 2DDUA 5FZOB 3BIWE 2Y26A 1LOGA 2AEZA 3H1YA 4MSVA 4Q27A 2A75A 2P3YA 5D1IA 3WP3A 4XETA 2N7GA 2WZR1 1PO23 4OZOA 1HRV1 3GZUC 5FDBA 2ILMA 5DN2A 5EFUA 3ZYBA 5FPBA 1O3RA 1BZWA 3POGA 2DVAA 5J09A 4CCOA 3EHKA 3I59B 4ZU7A 2VUJA 4LHNA 2B4KA 1KS5A 4NR1A 4AEMA 4CU8A 5DAXA 4BQ2A 4GJYA 3VKOA 1FNYA 2HWC3 1C5HA 1H2MA 2D93A 3HQXA 4MADA 1FOD1 3AP9A 1PVC2 1OVPA 4RR3A 1G7YA 5GKAC 5C3QA 2BNOA 1PO12 4TYSA 4WZFA 5K0UC 1SCSA 3FBMA 4G3YC 1DU3D 3DYMA 4E27A 2D3PA 2BFUS 3MLLA 3WQ1A 1VB2A 2DU1A 3ME2A 4KU8A 2W47A 4YYOA 1UYYA 1NX9A 4Y33A 4BA6A 5KC6A 4GWNA 4AQTA 1LRHA 1NY71 3OUHA 1IGOA 4OMCA 4RN5A 3VZOA 4AGRA 5FBJA 3FX3A 1OURA 3ZYPA 2GMEA 1CONA 2XJSA 3TNQA 3N36A 2W1QA 1LTEA 1DQ0A 4Q0VA 1A3KA 4Y20A 5GZDA 4CEWC 2V09A 2HWF3 1D4M2 2P2KA 2R072 4ZS3A 2IVIB 4HPKB 2X5IA 4A6SA 4SLIA 3CJIA 2OPWA 1QJFA 1GQPA 2VOKA 2ZX3A 3RYPA 1AXYA 3H3LA 4C0BA 2RS31 1O8SA 2HWB1 3CMGA 1H1AA 2EAAA 4OI4A 4XJUA 2BNMA 4UWDA 2VD7A 3KM5A 1OVSA 3I2KA 3BU7A 1RUD3 3VDDC 2JDHA 1QOTA 3WDXA 5FKCA 3MIDA 4DPNA 2D6PA 4CDWA 4IQPA 3WDYA 3RYRA 1H9PA 2PHLA 4ZXEA 2VG9A 1S4CA 3WG4A 1UXZA 5JXIA 2QQIA 5KHKA 4MGYE 2IXLA 1R083 4YGDA 2W1SA 4F83A 3TAYA 4HN1A 3A0NA 4Q4X3 2E6VA 1UX7A 2ZGSA 4JDNA 2VR4A 4Q4V3 4CPBD 5BV6A 2BUKA 2CYFA 3FMGA 1RUJ3 3B9IA 1UZWA 3UKVA 1I5ZA 4H3WA 2YB7A 3W5NA 3ORJA 2Q8OA 4HFSA 1W99A 1V6NA 4DXSA 1HJFA 2X09A 4WVVA 3N9OA 1PNFA 3A4UA 1STMA 2D5FA 3OBAA 4LKFA 4NHYA 3WP5A 1GV9A 4B7EA 5CVRA 1CAWB 3AC0A 5FYSA 2Q0AA 4FPHA 4J1XA 5K8SA 2UU8A 2TEPA 4Q5OA 2XLGA 1ZZCA 2D3RA 4OUMA 1GU3A 1Z78A 1A34A 5FXXA 1APNA 2ZKNA 4CU6A 4E8CA 3IPVA 1FAYA 4UW5A 3LDRA 5CNAA 3ZFEC 3OGVA 4BIFA 2DCKA 1V6LA 4FPGA 1SMVA 3RRDA 5F39A 5A80A 1UYPA 4PQ9A 1S0JA 4Z1VA 3S30A 3QCWA 5C3OA 4GWIA 3RS6A 1UNBA 1I9RA 3PUAA 4L97A 1CZTA 2VNRA 3AYCA 3OBRA 2Q1FA 3J9SA 5LRSA 2PQQA 1AX2A 1QOSA 2VQUA 2FCUA 4CEYB 3SITA 4H7MA 1XXNA 2GP5A 1QQP3 2QFEA 4XPVA 3J8F1 1TME3 4LBQB 1W0OA 4IGPA 5A6ZA 4TN7A 2OKXA 4OVEA 4QQ2A 3ZXAC 5F6LB 2B5HA 4C8DA 3WT3A 4QPGA 4M01A 2Q8CA 3UESA 1LB2A 5FPUA 4UW6A 5CZKA 3CEWA 3WF0A 4AI8A 3H8UA 1VAKA 2ZPXA 3AL5A 1OQEA 3ZFFB 1ENRA 3O0XA 2D6MA 3HAGA 2YDEA 2EALA 5CFCA 1HN0A 5ISLA 5CG9A 3EBRA 1H4HA 1CIWA 1GANA 2ARAA 2CL2A 3ZIXA 1J3QA 2RS11 4K21A 1YO8A 1EPZA 1AYN3 3DKQA 3SISA 1BMV1 2B9UA 2KM2A 3MIHA 3DYPA 2AH2A 4CYDA 5CA6A 1CX1A 5FV3A 1UY1A 3NRUA 2ETEA 1LNSA 1UZ0A 4GWMA 3VBSB 2FDFA 4KWUA 1RUH1 1OQ1A 3O1SA 4J25A 4BXSV 3KD4A 1JYCA 4YVSB 1JYXA 1Y9QA 2WRAA 3SQOA 1W8HA 1NE4A 3OBTA 1X7NA 2A73B 5FO7B 2WQ8A 5FKBA 1NCQB 1SBEA 2CHHA 3GHNA 5GJ6A 3LOBA 1ND2A 5A3MA 1CN1A 2WNOA 4U2AA 2ZCWA 3VBRC 4NIGA 4YG3A 5FQ0A 3KSCA 4GMP3 1DLLA 1W8FA 5FCCA 1VBB2 2YXSA 4YW4A 4EN9B 5A3UA 3ZFGA 3N9MA 4QB6A 1KJLA 3G7DA 2W2IA 3CLPA 1SPPA 4C1WA 1UU4A 1XYPA 5T5PA 3H9AA 1PO22 3WHUA 2VTXA 1H6XA 1UMZA 4FPJA 4KWJA 4D69A 4UFJA 4YVWB 1OFNA 5FPZA 4Q8KA 1JYIA 2YV8A 1O4TA 5C8CB 3LPFA 5FZ6A 4ATEA 1US2A 5LWBA 3SH4A 1LAJA 4I02A 1PHMA 3TEZA 1YYNA 2HWC2 2ORXA 1N1YA 2ZBJA 5F7UA 1N47A 5IVJA 2BEOA 4CDXA 3SMHA 4N7IA 4QU1A 4JGZC 3OPTA 5HXVA 4LMFA 3CF6E 3GDBA 2V4AA 2BV4A 4BPZA 3HBKA 1Q5OA 3P5BA 2DYCA 4HKWA 3KVAA 1GICA 2Q1ZB 5BNQA 5F3GA 4RQPB 4CDQB 2WUHA 1PVC1 4M3CB 1YEWA 1SLCA 2G1MA 2JG9B 3AFKA 4JKMA 4XUQA 3ZSLA 2B42B 2J1SA 2JDNA 2YUEA 2JDKA 2RM23 4AL9A 3N7KA 5IAVA 5JZGA 1MACA 1YIPA 1H8TB 1W2OA 2ET7A 2RMU3 4LBLA 4Q1RA 2HWF2 4ZU5A 4NIIA 2E63A 5JCTA 2HBUA 1ZZ7A 5C6CA 1V00A 1JN2P 4FVVA 3PUIA 4LO5B 2Y6JA 3WF2A 1FT9A 3W21A 2BFUL 1JODA 1WCKA 3MO4A 5I8TA 3DXUA 1BKZA 1OOPA 4LHLA 1NQJA 5CAZA 5FTTC 1D4M1 1ULEA 2R071 4IGQA 3UV9A 3VHRA 4GJZA 3B3QE 1RUD2 2UWAA 3V0AB 4QGMA 3WZ1A 2GN3A 4AGGA 1MEC1 1S0IA 1YFUA 2JWPA 2LRPA 5FP8A 1RGSA 3J26N 2OYZA 4E4HA 2J7MA 4NHLA 2FDIA 3NO8A 1R082 1F9KA 1X50A 1XC6A 4A3XA 2RS33 4NPMA 4Q4X2 5F5AA 4Q4V2 1ND3C 1XPWA 2BDRA 1RUJ2 2W95A 2X8KA 1UPSA 3BTZA 1O3QA 2P3JA 5KR7A 1O6UA 2Q8EA 3MIGA 4NIDA 1SCRA 5FYYA 2VZTA 3KMHA 1DBNA 1DYPA 2PMWB 4RS5A 5A7OA 1QH7A 3WSOA 3AMPA 4AI1A 3SEEA 1UY4A 3OGRA 1CAXB 1SHWB 3AKQA 3LFMA 4QAWA 1POV3 2E33A 4U36A 2C0ZA 3CU7A 1RMU3 3AVSA 3VKMA 1SLTA 2ZKLA 1UY3A 2XB6C 3S6PA 4K1YA 1JYWA 3CBNA 2Z79A 3KV4A 4YGBA 1G8WA 1NG0A 1HB1A 3AM2A 3GF6A 4FO9A 4GWJA 4PDWC 3K77A 4ORFA 3TEXA 2A71A 3VKLA 4LHSA 1EY2A 3I2IA 3IMNA 2ZEXA 2AGSA 3Q8FA 3B94A 5HV4A 5F2SA 5F3IA 1S1AA 1YLLA 2ZHKA 1H0BA 1IG3A 4GH4A 4EQVA 3GXUA 4N43A 1V0AA 2ZEZA 2QDNA 1RC6A 3J4UH 3VZMA 2QQWA 1QQP2 1O4ZA 1TME2 1XNKA 3GCWA 3AL6A 2WO2A 1QJX1 3O1UA 4TLFA 2QVSB 4Q0SA 3D4KA 3L2YA 4AFBA 1H1MA 2R041 2WNEA 2XR4A 4XHBA 4IE4A 4COVA 3KS7A 2PHRA 4LEJA 1WCUA 1W8ZA 3M70A 1HKDA 1ULCA 3SH5A 1S2EA 4MX3A 1QJY1 5LA0A 2PFWA 2W46A 4EV0A 2BGPA 1CR7A 4LO8A 4LORA 2PAMA 4Z8BA 1AYN2 4XQWA 4ISQA 3J8F3 2Y8KA 3WG2A 3D8CA 5CFDC 2E9QA 2ZZJA 1UOGA 5BNOA 5K9YA 4Z2AA 1XYNA 2VVDA 3ZPOA 3T0BA 3AP7A 4RR3B 5A7WA 3N9NA 3O1OA 1PVXA 2O0OA 1X9PA 2XJRA 1JYTA 5T5LA 4RSUA 5C71A 4NN0A 3UKNA 3A7QA 2WFF1 1X8EA 3HNMA 3K2OA 1AZDA 3WCRA 5CKQA 4FFFA 3LOIA 4IGOA 4XIKA 5J48A 3M4FA 1AR61 3MLJA 1HX6A 4XJWA 5JOYA 3AYAA 2H6CA 1H6YA 1OPOA 5FZBA 5HCHA 2FDHA 2D6NA 4MGSA 3WNXA 4HVRA 4O9EA 1SFYA 4AEDB 2XQRA 3NV3A 5CIRA 3O1VA 1EUUA 4AHWA 1OC1A 5J3UA 2XDVA 5FJHA 2QQJA 1H30A 1ZA4A 1OF4A 1T2XA 3FL7A 4X8NA 3TBDA 5JIUA 4EWEA 4EE2A 1HV1A 1W2UA 2AENA 1OKOA 1IHMA 2J42A 4RYDA 5IVCA 4ZKTB 2X5IB 1WLCA 5KXBA 3CJIB 4WM7A 3JQXA 5FP9A 2Q30A 3NV2A 5B4NA 3TNPB 1RUH3 3BI3A 3PMSA 5JVVA 2BZDA 1IZ3A 1S0FA 2UWBA 2VZRA 2YY1A 2JDZA 1UW8A 3P3PA 5E16A 2HYXA 1VBB1 2W08A 2VMHA 3EJKA 1N1TA 3ZN6A 3E1F1 3LA2A 4NHMA 4JX0A 4CCNA 1R093 2VO5A 1VBC1 2O14A 4EWAA 4CDWB 2VCCA 1K5MA 3VHPA 1ZBE1 3FUOA 2LALA 1MVQA 2XPJA 1JU4A 1CPNA 5B4XA 4LOTA 2ADEA 4YM1A 2C9KA 2P3KA 3NKGA 3AMHA 1GWKA 4HKLA 5H9QA 5J98B 2HEWF 3I2DA 1QGLA 4FPEA 5K4LA 2J1TA 5BNNA 2VZQA 4IEVA 1PX3A 4JRLA 2NPIA 4B7KA 2XHNA 2PXJA 4DEQA 1L7RA 1W6MA 1AR73 1EPWA 4FCAA 1VMFA 2RM22 1FOD2 3WR0A 4I0AA 4OUEA 1LHUA 2RMU2 2PELA 5FZLA 1H2NA 1RUG1 1OUXA 5JMOA 3E6CC 2CU5A 1QOOA 4NPLA 3AXDA 3VL9A 2PHUA 3ES1A 3IPVB 5BNPB 4BLJA 4YFWA 1CZSA 3ALQA 1D0HA 1NKGA 4P5YA 1UF2C 4UFKA 5C3PA 5HI0A 1NY72 2ZZQA 2WSVA 1H4GA 3NJYA 4TLGA 3ATGA 3M8LA 5IUQA 4NOTA 4PLNA 1VBD3 3W59A 3QH7A 4RA0A 3NSTA 4BXFA 3IAPA 5ACA1 2VNGA 3DPRA 3PVOA 1YI7A 3H1MA 4CA9A 4ES9A 4YFZA 3M1HA 1GOFA 1WLTA 1UY2A 3HBZA 4Y3OA 2WA4A 1ZBA1 2RS32 1GWLA 1S0GA 2RDSA 3I3QA 4UW4A 3VZLA 4B1MA 3E6DA 4XDPA 3A21A 4FBFA 1D2SA 3IIIA 3U14A 2IXCA 3H3ZA 4P9WA 1JZ4A 1F35A 2ZX0A 5C5TA 2XJPA 2Q5TA 1RUF1 4AHZA 4WM8A 3ST7A 4CCCA 1QNWA 3DXTA 5JDBA 4H2AA 2VBBA 2BWAA 3AMQA 4ZPIA 5CFCB 3ITQA 1UX6A 4Q4X1 1NLSA 1MEC3 2YZ4A 3LB9A 4IEQA 2E53A 2V4VA 3T0AA 3IKWA 2CDOA 1YQ2A 3IDCB 5D21A 4R9DA 4PIYA 1MZEA 3OY8A 1OLME 2P4EA 3DUIA 4PT6A 3VB9A 2C5DA 2NMNA 5G04L 4CEYC 3VBFA 5FWEA 2VMEA 5A1AA 4XILA 2OZJA 4BLIA 4XUOA 1RUE1 1VB4A 1HQNA 3RSJA 1UQXA 1QHDA 5IK4A 1XOYA 1BLZA 1ZRIA 2DURA 2VH9A 1V70A 3D0JA 3RZMA 4JGYA 3LFIA 2ZGQA 1XQNA 3ZFFC 2VPVA 3D6EA 4QKFA 2VBPA 3ROUA 2C4XA 1VALA 4SBVA 5F8PA 5LB6A 3PIGA 2WSUA 5EYYA 4R9CA 2XJVA 1PM7A 1DQ4A 4UOJA 2ZOEB 4HBNA 3BTAA 2JDAA 4MXWA 4XAEA 1ND2B 2TBVA 1JZ3A 3MUY1 5F32A 1KFUL 4LO7A 4BB3A 3LQCA 2Z42A 4LBOA 4BCUA 5KHJA 3ZFGB 4BDVB 2XJTA 1VAMA 1LODA 2BGCA 2F4PA 4MGQA 4XUTA 4HVQA 3WD5A 2SLIA 3FE5A 5A3OA 3OD4A 1QQP1 3AZXA 4PCRA 1FNZA 2DVBA 4BQXA 5HCFA 1KJRA 4ITCA 2XLFA 3CDZB 3ZOIA 4BH9A 4YVSC 4QPIA 2W92A 3UL2A 4EZ4A 4F3JA 5C3RA 3POBA 1KITA 3B01A 4Y1YA 1VRH3 4JDMA 4P9YA 1QNYA 3J8F2 1NCQC 2VXRA 1UXXX 3ZSJA 2ZMKA 1QJX3 2ZAHA 3KV6A 1HB4A 4OULA 2RR11 4CDXB 2R043 2C6SA 2EA7A 1BVP1 1W8TA 1W9TA 5IK5A 3OG2A 4UFMA 1X33A 2DF7A 4AVAA 3ZR5A 2ARBA 1F5JA 1QEXA 1S55A 3KCXA 4OUSA 3GHMA 4XBNA 1QJY3 4MGIE 1UKGA 3NNMA 2B7YA 2AYHA 2ET1A 5LATA 4R9AA 3I3BA 3MF9A 1WCQA 2EVXA 1U5ZA 2OQ7A 2YBSA 3VV1A 2RDRA 2P17A 4YVWC 5JIAA 4UFHA 1BMV2 2AREA 1OH4A 3OB8A 4XBLA 1N1SA 2NMOA 5C8CC 4QU2A 3EB7A 4S2DA 4K6BA 1KGYA 1PX4A 3N9LA 1MS8A 3CQOA 2GMMA 1Y7BA 2VUAA 3GZEA 3KQRA 1UPIA 5FPAA 1CGPA 5C3SA 1DQ2A 3GJAA 2WFF3 4K1ZA 1RUH2 2JD9A 2P6HA 2ZACA 2ZX1A 5FYZA 4XQDA 4DY5A 1GUIA 1JUIA 2GALA 1AR63 1YJLA 4Y1VA 4LIUA 1XNCA 1OOPB 4MUVA 5I0SA 1GYKA 2PAEA 4XF9A 1MQTA 4CDQC 3JBG3 2ORZA 1CAUB 2P1BA 4XFIA 3V65A 4QWNA 1U12A 4WBBA 4YGEA 3PU3A 1YIFA 2A3YA 2JDPA 4MLOA 3O12A 2XUEA 3QD6A 4YM2A 3I2JA 4LR4A 5LBCA 3ZYIB 4XFFA 2QQVA 1SACA 2ZGKA 3ZKYA 1H8TC 1A78A 3HT2A 5FZHA 2V5DA 4N53A 2XG3A 4UFIA 4XFGA 5EZWA 5A3WA 3U78A 1KRIA 5JI9A 4YZ4A 1MZFA 1W3XA 2WQ4A 3LAGA 4JCKA 3NJXA 1EP0A 2JB4A 4JVAA 1VPHA 3VD4A 4BWOA 3O1RA 4D6QA 2G9ZA 2WWJA 2A1XA 2Y6HA 2FDJA 1AR72 2XL7A 5EJZB 1VBC3 1HV0A 2G9GA 4TSVA 4XXAA 5FZKA 3SCGA 3UT0A 4DY3A 4DB5A 4RS5B 1ULOA 5C4WC 1ZBE3 4GKXA 3T2OA 5IFTA 4XVHA 3CO2A 5FPLA 1YQ8A 4CDUA 2J1EA 5EV7A 1AJKA 3RMYA 4QPYA 2IUWA 5FZCA 4XFAA 3RZJA 3TWIA 3ZSMA 1AYM1 1XSQA 5LBEA 2JD4A 4URAA 2O8OA 2RM21 3GBGA 2NQYA 2YROA 5JOWA 2VM9A 4QXBA 1ENSA 2IXJA 2RMU1 2BRTA 3GJBA 5FZ8A 5A3TA 4XHXA 4H55A 2C24A 1XU2A 4QQPA 3WQ7A 1GP5A 1VBD2 1PIV3 2WT0A 4IL7A 4M3CF 4DRRA 4GQ7A 3WF1A 3JCIA 3N7JA 4FT8A 3PU8A 1RUC1 3PL0A 4GH4B 5LASA 4AFAA 3HQUA 1RUG3 3MBWA 4MGKE 4N43B 3VBHA 5IVEA 1G9CA 1KXGA 3HNBM 3DCQA 3TB0A 1Y4WA 5L9BA 4YZ5A 2ZEYA 1QKQA 3U0ZA 5EP9A 3NKTA 3KQ4B 1YI9A 2FDGA 4IEZA 2LROA 4FXKB 1LOFA 3WW1A 1AHSA 4MVTA 1NOVA 1JH5A 4LE3A 4CP9A 1JI6A 5DUVA 1W04A 3LDKA 5ACA3 1PNGA 1CZVA 1YXWA 2XKPA 5FPVA 3AX4A 1MEC2 1U5XA 2YGLA 3VDAA 5FP4A 3AB0A 1LCLA 2Z2SB 2H0VA 5M0TA 4MHUA 5FUIA 2DVGA 2P6CA 4QT6A 1V9U3 3KV9A 4QHOA 4JZRA 4QX2A 4R4XA 4MG2A 1XNAA 1ZBA3 5BUVA 2JE7A 5JR7B 2ZA9A 3C7HA 3POYA 4IEOA 1DZRA 4NAMA 4OHZA 2GC3A 3B69A 1SFNA 2AC1A 3OTFA 3VD7A 2V5YA 4HSJA 5BNOB 2NN8A 1EUTA 1VLNA 5LW9A 4E2SA 5A7WB 2R061 2GSYA 1NZIA 1QXPA 4A45A 2O1QA 4Y1UA 3ZLIA 4BM8A 3U4XA 1RUF3 1GOGA 2R16A 1HRI3 4R4ZA 3RNSA 4A7KA 4CUCA 1POV1 1VBA3 1Y9GA 2BBVA 1RMU1 4UFLA 2V72A 3K3OA 4EN8B 3WG1A 1OBNA 1AR83 4ARYA 3BN6A 5FMCA 1T6GC 5AC91 3AKPA 3T1LA 4AEJA 1BXHA 2PHWA 2FQPA 4H7LA 4UI9L 4AQSA 3KLSA 3P3NA 2RE9A 4JDOA 2AUYA 4LIVA 4Z07A 5AVPA 1YHFA 4AAXA 1AF9A 3WDTA 1JMUB 3LEIA 3ES4A 2XVGA 4LA2A 1RUE3 3LWCA 3PVBB 3HN1A 3W58A 4GB31 3ZDVA 5FRAA 1UL9A 3FHQA 3Q8CA 4RR3C 3SLIA 1DQ1A 4WM7B 1RUNA 3K46A 2WO3A 4NWWA 1F15A 4BJ0A 3ON7A 4AI3A 4JC1A 1LR5A 1GKBA 2WABA 3PNAA 4YM0A 3N3HA 1BQPA 2KD7A 2B39A 4UXAA 5I0RA 1BEV1 3ZMOA 4O7XA 2L9LA 1IQDC 2LM3A 2XJUA 4COYA 2BPA2 2ES3A 5I0TA 2R49A 4DXTA 4QMAA 1UMHA 2YC0A 3C3VA 1VRH2 3GYDA 4XURA 5JAXA 5JLVA 1W8OA 4H14A 3WNLA 4AEDC 1ZRFA 1DIWA 5H9RA 3T2QA 4A6OA 4CCDA 1GZWB 1QJX2 4QB1A 4BISA 2EIEA 4CUGA 3M3EA 4OHXA 4UYBA 3ZXEA 2VCAA 5BYNA 4QDRA 2R042 4YNIA 5E6HA 2XUMA 3H3UA 4XDQA 1C4RA 1S2BA 3ZVXA 3I49A 5JPNB 2PYTA 1JXNA 3W20A 5C33A 2DFBA 1JOPA 2X5IC 5HCAA 3CJIC 4GKYA 3T2TA 4JAAA 1QJY2 2PHFA 2RG4A 5FYVA 4BZ4A 1YQCA 2P3IA 4FTBA 3ETQA 2HEVF 3M3IA 1AVBA 1VMHA 2BW8A 3VHOA 4META 2QE3A 1W6MB 2JDMA 5DDJ1 4YZ3A 3AKRA 3PUSA 3RWNA 4CU9A 1C8M1 1UZVA 4LULA 3FLPA 5DZGA 4FXGB 5APAA 2RR13 2BVVA 1W9SA 3WF4A 5J1XA 3E6BA 4CDWC 4XFCA 2WFPA 2J1AA 3POWA 4XIOA 4KG8A 3VD5A 3RQ0A 4F7ZA 1Q43A 1V6KA 1MS3A 4HZFA 5F2WA 1QU0A 2WFF2 4JQTA 2ZGUA 5KBFA 1SLIA 2WNUA 2PHTA 3LIHA 1AR62 1PK6A 1T6BX 1WMEA 2PLV3 4DXZA 5E88A 4RFRB 3RI9A 2WT2A 3JBG2 3M3QA 5GALA 4EWDA 2HJIA 3DPRB 1B35A 2NLRA 4RGKA 1N1VA 1LOCA 3I54A 3ILNA 4BHPA 2WR9A 2FBEA 1U5IA 4M0HA 4AW7A 3TOJA 5A7QA 4FOVA 1R091 1W28A 1W06A 1RUI3 4QX8A 2ENRA 3SEPA 2PA7A 5BNPC 4L8QA 5IHRA 3MFAA 4BQ1A 2D6OX 1BK0A 2D44A 5JSPA 5L9VA 3J7LA 1J84A 4WM8B 1IQAA 1VBC2 3VBOA 4DZGA 3SH3A 1REFA 2VVFA 2W0XA 4L0PA 3VD3A 1ZBE2 1W9WA 4PI2A 3I4IA 2R6QA 2E51A 2CTVA 4NUBA 4CRQA 3OGGA 5JXGA 4FOYA 2EIGA 3B9CA 3OY8B 2ZAAA 4LLFA 5LBBA 2JX9A 3TEWA 4Y5Z0 4A3ZA 1AR71 3LA3A 4D94A 3OEBA 3VBFB 3E5QA 5FR3A 3WV6A 5GLZA 3ACHA 3D82A 4D3WA 2YHJA 5L7OA 4B3NA 1UU5A 2QZ2A 2GC0A 4HXCA 4Y5TA 1ST8A 2VUCA 4KH9A 1LKNA 4OFGA 4I0WB 4W6YA 3IB3A 2ZABA 1PIV2 3UJQA 4IE6A 2ZGTA 3C7OA 4FPFA 4ZU4A 1K5JA 4FAHA 5CFCC 5FO9B 3NV1A 2LTNA 4GALA 4ISRA 4YSFA 1RUG2 2VMGA 3CKHA 1GNZA 1OFSA 1C5IA 1O91A 4MXWB 4O65A 5JI7A 3T4HB 2LS6A 4BMBA 4KMQA 3ILFA 4ZS2A 1AYM3 4XW3A 1VBD1 4GD4A 5FMBA 2YFUA 5JWPA 2IXHA 3JU9A 1AUYA 5LEJA 3OOXA 4AEKA 5FFOC 1DGLA 1IKPA 1AX0A 1G86A 3RZLA 4HL0A 2VMCA 3AZVA 3SKVA 1KQRA 2GDFA 5IVBA 1LHWA 1F5FA 3NJZA 3IIAA 3ZXFA 5ACA2 1RUC3 4I3PA 4PDWA 3ACGA 2VNVA 4QPIB 4XJAA 2R30A 2XWBB 3LD8A 1ASJ3 3MDPA 5J7MA 1W6OA 5GZCA 4XACA 5FXWA 2YC4A 1V9U2 4LBJA 2A7AA 5IK7A 1ZBA2 4IV1B 1CAVA 1FV3A 2FD8A 3DGTA 1A6CA 3N9PA 4LXLA 1SLLA 4QX1A 1ND2C 2YC2A 2EAKA 3MYXA 3U1XA 2JB8A 3UGGA 5BY5A 2D6LX 4WVZA 2GN7A 4PHZA 4L9BA 4ZZ5A 3BGAA 2X29A 3I2HA 4EJRA 4IEXA 1HQWA 3T4VA 2JDYA 1RUF2 4R9BA 3NAPA 3ZFGC 1OSGA 5C9AA 2XLAA 1CX4A 1HRI2 2MEV1 5L73A 3RWKX 4Y4RA 3WDUA 1UAIA 1YCIA 1VBA2 1MS5A 2WKKA 2VU9A 4MGZE 5F9TA 5J36A 1AR82 2G19A 1IPJA 2DVDA 4LLOA 4YW7A 1OT5A 1P8JA 3K4DA 4YZ2A 2JG8A 3VBUA 1E57A 1ZZ8A 3IT8A 1LOEA 2JECA 1AX1A 1RINA 4COZA 1NA1A 1G9FA 4L11A 1JS9A 1X36A 3GM8A 4FPCA 4Q26A 4KI5M 3NQHA 4URTA 2R063 5L9RA 3MPPG 1RUE2 5T52A 1X9TA 4LKEA 3ZYHA 4ASLA 4DRVA 1O5UA 5C8WA 5HXMA 4CDXC 5ANQA 2VCMA 4CP1A 5SV8A 2CAUA 2VECA 3AP5A 5CFDA 3FHIB 5FK8A 4Z2WA 4CXYA 2X53S 1MR5A 3SXWA 4CVUA 5IYYA 3UETA 5FY5A 4QX0A 2MNGA 3J7HA 5LBFA 3VLBB 4KG0A 5AC93 2OT7A 2CAVA 4QQOA 4QB2A 1CQ9A 1MQTB 3WP6A 4I0BA 1LGNA 3VDBA 2EF6A 1GP6A 4P02B 1DQ6A 4AVCA 4IESA 4QM8A 3TN93 3RGBA 2DCYA 3PUQA 3I2GA 4XF3A 1HJGA 4GB33 2QKDA 2W39A 5FZDA 4M00A 4R52A 5F5CA 1JZ2A 2A70A 4LHKA 5A3PA 1ODMA 3MEPA 4FFHA 1VRH1 2BERA 2XH6A 4O9GA 1F31A 1N3PA 4N53B 5H9PA 4YPJA 2GZWA 2ZGMA 3USUA 3ZSEA 4CCMA 1BEV3 4KWLA 4Y22A 1MS0A 4ARXA 2W1WA 3OGJA 2K46A 2OZ6A 1PZ9A 3R05A 5JZGB 2QCSB 5DAVA 3I7DA 1M06G 2JENA 1FI2A 4Q2FA 2QJVA 4HVOA 1O3SA 2RR12 3JXSA 4BQYA 2EXJA 1OD5A 1QXRA 3ZM8A 5DUWA 1OA4A 1W0NA 5D2AA 1HDKA 4CDUB 3VD9A 2VNOA 3PVNA 2IWGB 4DUWA 4O61A 2TNFA 1VR3A 1TZOA 2W9XA 3FHAA 1S0CA 4HK9A 2RHPA 3QACA 3EO6A 2VULA 4W50A 1N3OA 1SLAA 5FYTA 3S7EA 1W2AX 3VL8A 2B45X 4NVPA 3WG3A 5DDJ3 2PLV2 4FSJA 1DFQA 5F5IA 4AFDA 1C8M3 2IZWA 1EAH1 1NE6A 4JQRA 4KBBA 2E7QA 1YFYA 3AJZA 3MW3A 3QH6A 3VUOA 2VBDA 5CU1A 5A3NA 4BQ3A 4OMDA 3H7YA 4RS5C 3W9AA 2C9AA 1UYZA 3O1TA 1SLBA 1J58A 3IMMA 3VBHB 5A1FA 4I30A 2J22A 2K0GA 3HR9A
chains in the Genus database with same CATH topology
1NYWA 1V6MA 2D3SA 5DUUA 1H8VA 3M3OA 1YNAA 4P9XA 3JBG1 4PF5A 3QLQA 1XRUA 1YFXA 1Y3TA 1RUI2 1O4YA 4Y1XA 1WMFA 1SBFA 2B8MA 4Y20B 1MS1A 1R1A3 2DVFA 2OW4A 3AFGA 4AWDA 2D97A 4XZPA 4FTSA 4G9SB 3ENRA 3H50A 2FMDA 4GH4C 4Q1PA 2FZ2A 1Z0HA 4N43C 2HWE3 3O0WA 3GNEA 2CWSA 4LO4B 5F1RA 2RJLA 1UD1A 2HEYF 3OYWA 5JMCA 1ULGA 2NYYA 1EV11 1D4VB 2ZGRA 1ZZ9A 4FP2A 1JTZX 1H2LA 1NXD1 1XE8A 4X8PA 4YG6A 3WW3A 2ZX4A 1G9AA 3PVEA 1GQGA 1AYM2 3KB5A 1PIV1 3JD71 1JHNA 3JZVA 5BNOC 3OF1A 4IV3A 5D8AA 1URXA 1OHFA 1X82A 1ULFA 3IN9A 4ZXKA 2QUOA 4XJ8A 3R4UA 1HQLA 3V0BA 2I2SA 2DCJA 2UYBA 3WQ0A 1RUC2 4B4PA 2R0HA 4QQHA 1LU2A 2VMIA 1ASJ2 3H0OA 4F8AA 1AXZA 1BJQA 3ZFFA 1NCRA 4LTAA 4AXOA 2NM1A 5BPXA 2G9FA 5T50A 1Q8QA 3BOPA 4NPRA 4AGVA 3WHTA 1V9U1 3O0VA 4B8EA 1NLRA 4WM7C 4TWTA 4C0HA 4FAGA 5SV5A 3VGIA 5JOZA 5E89A 4QPGB 1HLCA 1FATA 4M3CE 1S2KA 1HRI1 2EXIA 1A8DA 2GNBA 1LOAA 3LGRA 1I1EA 4YVSA 1VBA1 2WLPA 2R062 3SNMA 3N7MA 1H1IA 4GMP0 1AR81 3ACLA 1C3HA 3WX5A 4IEPA 2JKBA 2DUPA 5GZFA 2MEV3 1GFF2 3WOGA 5IK8A 2DUOA 1RMU2 2XVLA 2WNUB 4N9IA 3R4DB 4K9SA 4P9JA 3RJRA 1NXMA 1PK6B 5AC92 4HSLA 2WNVA 4PIZA 5ABJA 3N35A 2JJ6A 2V73A 2WJSA 4AFMA 5F6KA 2BVBA 3MW2A 2ZGOA 1MS9A 5LEKA 3TN92 4E2QA 1B35B 4RFT0 4CTEA 1WCSA 3OD0A 5J37A 4RHV3 2NP0A 1REDA 1Z7S1 4GB32 2WS93 2DUQA 3ZXKA 4XFHA 2YMZA 3HMYA 2PTMA 4ONUA 5FQ0B 3FC0A 1LU1A 1BEV2 3VKNA 1GNHA 3AKSA 1RITA 4E4ZA 1W39A 2ERFA 4Q4W1 5IT6A 2BWCA 2F6BA 1WA4A 2I74A 3VBOB 4HK8A 4S2GA 1A8MA 4EN0A 5JSRA 3VBSC 1TNFA 3G6JB 4FQZA 3LSEA 4W6WA 4WZCA 3DPRC 2YGMA 4DMIA 1YWKA 2Y0IA 1GLHA 3BALA 3MICA 1OKQA 1JBCA 3WDVA 4Q8LA 4GULA 2WT1A 5L7OB 1FX5A 5I8YA 2K9ZA 4KWKA 3L2HA 5DDJ2 2D5HA 1FXZA 3FWEA 4XYXA 5H9SA 3GZAA 1C8M2 4RL7A 3RZZA 4WM8C 1DHKB 1QJZA 3ZYGA 3MZHA 1IPKA 4XE9A 2D6KA 2PLV1 3H7JA 4AQ2A 4D7SA 3N4MA 2MHFA 2CNAA 3PTYA 2IC1A 5C4WA 1AL21 1UN1A 1I6XA 1NQDA 4HN0A 1QDOA 1IS4A 2W52A 4XEZA 1DQ5A 1BBT3 4K40A 1MZ5A 3VBFC 3KGZA 1R1A2 4Q0PA 2UWCA 1ZRDA 1EAH3 4K3UA 2QDRA 5GZGA 1PMIA 2GMPA 4Q4Y1 3LCPA 2VW2A 4GXLA 3E5XA 4HANA 1RUI1 2GH2A 3GZTB 1W6OB 5K0UA 5LRRA 3ZX7A 4AYUA 1WD4A 4RQPC 5KXEA 2HWE2 1CAVB 3ZN4A 1R092 1TEIA 1MS4A 4L92A 2JG9C 1RIRA 1POV0 4FPLA 1OQDA 1WBFA 4XTMA 1W6NA 3NAPB 1LEDA 5C9AB 4FPOB 1Y43B 4OI1A 3AZYA 4WVMA 3HT1A 4TZDA 2ZHLA 4CEWA 2XWJB 4NWVA 2I07B 2H0BA 2JG8B 4QPIC 4P9IA 3VBUB 4HT1T 1NA1B 5F5QA 2IXKA 4AF9A 3IDEA 4IV1C 1DGRN 2ZMNA 5FMOS 3QBQA 1C1FA 1LOBA 2CWMA 1EV13 1V6JA 1EYBA 3MI8A 3VDDA 3LA7A 4XJZA 4Y1ZA 2Q1MA 2ZGLA 4J1WA 1WLDA 1J1TA 5HCBA 4B29A 4IXLA 3WDWA 2GH8A 3D5OA 4EN7B 2DFCA 1ZREA 5A32A 4BMEA 2UY9A 3V56A 4EN6B 2PHXA 5BXXA 4ATFA 3FFQA 5DZFA 3BCWA 1CESA 1QJU1 2XBO1 2A3WA 4GA9A 3JD73 1OMIA 1V6IA 2IFWA 5EXOA 1ALYA 2IFRA 1J1LA 3R4SA 1W6QA 1ASJ1 4CP0A 2HWD1 1WGPA 1ZZBA 3WUDA 1RTVA 3USUB 5CBLA 5KXCA 3KZ4C 4OLLA 4WV8A 1YFWA 4Y22B 1Q3EA 3ZO0B 1LGCA 5KHHA 2VW1A 5KXDA 2GAUA 3K48A 4QHBA 1J59A 5AVAA 1MQTC 3K51A 3AZWA 3ZFEA 4Y26A 1J3RA 3I8TA 2CGNA 3WW4A 2XL9A 5T5OA 1VBE3 5GLVA 4AEDA 1OA3A 2MEV2 3RYKA 1FMD1 4YG0A 2R32A 1IS3A 3WUCA 5GZEA 4N53C 4BIOA 4N90A 4FP3A 1WMDA 2WA3A 3FUQA 2VQ0A 3AZZA 1CJDA 1AR93 1HXS1 2R1DA 3FFZA 1IOAA 2CV6A 4C90A 5JZGC 4QXKA 4RHV2 4IEYA 1GZ9A 2MPFA 2WS92 3A0KA 2JXAA 3AP6A 3B5LB 5CB7A 4COWA 1LHVA 3BB6A 3E5UA 4CDUC 4A7ZA 1LECA 4FOWA 4DQAA 3UK9A 3TN91 3JUUA 2VGDA 4XF1A 1PGL2 4D7YA 1DZQA 3INAA 3B93A 4LE4A 1H2KA 2D7FA 1DDLA 1RHI1 2G4IA 4HKOA 2P37A 4AI0A 4KU7A 1Z7S3 1RJ8A 1GSLA 3THTA 2ZX2A 3ZN6B 3VBHC 5T55A 2P34A 3KT4A 3LZZA 4W6XA 2OA2A 1OPMA 3OJBA 1K5MB 1XE7A 3OYWB 3TRSB 1W0PA 4DFSA 1D0GA 2EXKA 4AVBA 4E4SA 4AVTA 4S2FA 1LOFC 4Q4W3 2KXLA 4KQ7A 1PGW2 3VBRA 3UJOA 4BE3A 1RL3A 1CD3G 1B09A 5BNPA 5FOJB 1LJ7A 4G4FA 5JSOA 3MLKA 5BNNB 4XBQA 5T3NA 2RS51 4LT5A 3LSDA 4LBKA 4C1XA 4N9HA 5EWSA 3M7AA 1JOJA 1BBT2 3AXEA 4OI0A 1LULA 4IV3B 2R1BA 5D8AB 4NHKA 1W6PA 1EAH2 2A6VA 3UKTA 3V0BB 4CP2A 2UYAA 4NO4A 5AFEA 3Q9OA 4JGZA 5LK7B 4PJYA 2JE9A 4K7JA 5K7PA 1ZX5A 1R1A1 4PBPA 2A5ZA 3SCFA 3U11A 1NCRB 1AL23 3SHRA 1U5YA 4LO6B 2DWRA 3NWKA 1R1ZA 4JTOA 1TMF3 2WWSA 1REEA 2Q4SA 2HWE1 1KS4A 4Q4Y3 4RGGA 1WUVA 1OI6A 4P9LA 1C28A 3ZPYA 2ZHNA 5I91A 3U10A 3NVCA 2W68A 2OVUA 4YARA 4XJ9A 3R0RA 4YW3A 1O3TA 1UZYA 2FZ1A 3GBWA 1VP6A 1JUHA 3VZKA 1LESA 5A33A 1EV12 1ZRCA 1FPN1 1FV2A 1UZZA 1S0BA 5DG1A 4E9KA 1COV1 3KGLA 1OA2A 1BYHA 2OUHA 1CJPA 1RVF3 3ZXLA 2WNVB 3KT7A 5ABJB 4JRAA 3KCYA 4QPGC 2WLQA 3PLQA 4P5HA 4JGYB 1ND3A 3HWJA 3JD72 2FMYA 4X6QB 2ZHMA 1NZCA 1QWRA 5FMOL 4AHXA 1Q8PA 3WLUA 2VQAA 5FOBB 5FBZA 3O7OA 3B00A 1LHNA 1M4WA 4KGGA 3VKFC 1GZCA 4P14A 3SCHA 2WNUC 1PK6C 2WZPP 3WVJA 3DN7A 4M0NA 5I93A 3PJQA 1QJU3 2XBO3 1MVEA 2WZR3 2UY8A 4XMAA 1HRV3 5J96B 4AQ6A 3ASIA 3CJXA 1UIKA 4AVSA 1B35C 3GBFA 4Q0UA 4XF0A 2OUJA 3WY6A 3ZDSA 3B02A 1VBE2 3HD8B 1PO11 2HWD3 4MH0E 4YW5A 3DV8A 3ZXGA 3APBA 3AKTA 4Q0QA 4DS0A 2Z69A 1BCXA 2BQPA 4HLTA 5DUXA 5FREA 1QMJA 1FOD3 3D0SA 4UBHA 4JV4A 4L2NA 4E4DX 3DF0A 1FYUA 4N7UA 4IETA 4E2GA 1AR92 4LUKA 3VBOC 4KGQA 2NZ9A 4QM9A 3RG0A 1Q56A 4FQ4A 2RJKA 4AFCA 3ZYJB 3R6SA 1WW6A 1QF3A 1FMD3 1ZVFA 4V1PA 1DGWX 5JPMB 1CAUA 3POSA 5KHGA 5C4WB 4MYEA 4XFBA 1XNBA 2AZ5A 1UKRA 4YW2A 1GBGA 4Y24A 4RHV1 4HMZA 4XOGA 5GM0A 5KHIA 2QQPA 2WS91 5L7OC 2GC1A 4AK3A 1GR3A 1HXS3 3ILRA 2K2SA 3MF6A 2HWB3 1I3HA 4INDA 1HIXA 1OLQA 4B4QA 1Z7S2 1DF0A 4JTNA 3FLTA 3OPZA 3ZIWA 4C91A 1PGL1 5K0UB 2GC2A 3ZXJA 5KC5A 3WP4A 1WW5A 3DL3A 5FLJA 3S0MA 2VY0A 1C57A 4FPKA 4Q4W2 1W6NB 4XMIA 3WW2A 3ZXDA 4AI2A 3BPZA 3I59A 5E8AA 3THPA 1RHI3 4WVMB 3PMEA 3MGUA 1RUOA 1XNDA 3B7MA 4GIQA 4ES8A 1VAVA 4CEWB 1ULDA 5FLHA 2GU9A 4A7YA 4I2OA 3O14A 5I8SA 1OOPC 1O5LA 2PAKA 1PGW1 1SQ4A 1WD3A 3X29B 2D98A 4DINB 4PLOA 3FLRA 2CGOA 4FPYA 2WL1A 3RMXA 4MXVA 3VDDB 4MV2A 4P9GA 2ZGPA 3FZ3A 4LA3A 3NAPC 5C9AC 1OLRA 1J3PA 1IKQA 4L99A 4OI2A 4Z82A 1TE1B 2ZGNA 3IDBB 5EJ3A 5A32B 1BBT1 1QY4A 3TYJA 2RS53 4YGCA 4HPKA 2JG8C 2YPJA 3AJYA 3VBUC 3E97A 1AL22 1NA1C 4LBQD 1F8VA 1Q8SA 1W6QB 4MZUA 4RGAA 5FAXA 4PIXA 1KFXL 1TMF2 2XJQA 1C8NA 2ZS6B 4Q4Y2 3KCCA 5CADA 4DNYA 3BODA 4RD7A 1GQHA 3USSA 2VOXA 3ELNA 5GLWA 1LENA 4OZXA 1Q8VA 3MIEA 2I45A 1LHOA 4ASMB 4UBGA 1KD7A 4LNVA 5FLIA 2HYKA 3ECQA 1AXKA 2BYVE 3ZFEB 2D40A 1DGWA 1HW5A 3M2MA 4EROA 5T5JA 2RS13 5AFBA 2SBAA 1VIWB 5CG8A 1XYOA 2HKXA 4AVVA 1WW7A 4KNCA 3NL1A 2WINB 1CAWA 1RVF2 1VJ2A 1UCXA 3VN4A 3FJSA 4BOWA 2VOWA 1DZTA 2YYOA 4XTPA 3WCSA 2C1FA 2FHRA 2XHKA 2ARXA 1WCDJ 1PGSA 5GLTA 3ZYRA 3BOWA 3NV4A 2LUWA 1FPN3 4FTEA 2WC2A 1COV3 4LBMA 3CL1A 4QGNA 1ZZ6A 1PZ8A 4X6RB 2GNTA 5EYXA 1N3QA 1QXJA 1PO21 3AYDA 1GZWA 3IBMA 3ZMNA 1JW6A 3MW4A 3AYEA 3KT1A 1YUDA 1DG6A 1WLWA 1SDWA 3M3CA 1O7FA 1QJU2 2XBO2 4CEYA 2WZR2 2A6WA 3EXUA 1HRV2 4HETA 4LBQA 1QH6A 1YJKA 2HWC1 2A6YA 1Q8OA 2GNMA 2TUNA 2HWD2 3N7LA 4PBOA 1LGBA 1PZ7A 2VOVA 2XGXA 5T54A 3JB8A 3AK0A 2Y38A 4K8FA 1KDKA 4B4RA 1CVNA 4Y4YA 4I3GA 5HBAA 3VBRB 2ATFA 1VBE1 4CZSA 3NW4A 1ZM1A 1MZ6A 3RDIA 1S0EA 2DTYA 2XKOA 1PVC3 2DCZA 5DXDA 3S7IA 1DYKA 1G6NA 1PO13 2GNDA 2HWF1 1FMD2 2WQZC 5TSWA 3V64A 3VBSA 5I0UA 1AR91 1IS6A 2EXHA 4QD2A 1SEFA 3WINE 1K5MC 4LBNA 1ENQA 3VZJA 1W6PB 2DTWA 5DG2A 1HXS2 1NCQA 1ZRRA 5GLUA 1RUD1 2DV9A 2HWB2 1YRZA 3JQWA 2Y0OA 2ZTNA 1H9WA 3RJ2X 4JGZB 2A3XA 1UIJA 1D4M3 2R073 3GALA 5BNNC 3QOPA 1R081 4YM3A 3RI8A 5LK5A 4Q4V1 5FPXA 1U0AA 2BNNA 1ENXA 1RUJ1 1X8MA 2QZ3A 4XXPA 4YVWA 4IV3C 5C8CA 5D8AC 3IM0A 2CGPA 1C1LA 1RHI2 1BVVA 2A6ZA 2KA3A 1G9DA 4QQLA 1QDCA 3AP4A 1CPMA 2DU0A 1XU1A 2ZMLA 1TQ5A 2IXIA 2WIIB 1S0DA 4DOUA 3IWZA 3H1WA 1RJ7A 3EQEA 1NCRC 1ZYBA 2BTVC 3PHMA 2O8QA 4AHYA 4PLMA 4AG4A 2VW0A 3MPBA 5A33B 4RQPA 2ZJCA 4CDQA 4M3CA 2JG9A 5A3LA 3FBYA 4XQ4A 4BYYA 3PJYA 4YZ1A 3RPQA 2AR6A 3U07A 1TNRA 5JOXA 3URFA 3HIFA 1AL0G 2RS52 1H8TA 4IERA 4Q29A 4XF4A 1UU6A 4J6GA 3VZNA 1ND3B 2Z5WA 3LKJA 3JB4C 1KDMA 1TME1 3L9JT 3ZSKA 1G9BA 2E7AA 5FO8B 4A2UA 1ZNPA 2DCTA 4IEWA 4IV1A 4OHVA 4LUMA 5E1RA 1WBLA 3ZN5A 3V0AA 3VHNA 2JICA 4W65A 4YRDA 4QX5A 4UW3A 4OHYA 4AE2A 3CNAA 1AJOA 2PHDA 2WNVC 5ABJC 1AYN1 2VVEA 1RB8G 1TMF1 4Z92B 1ONAA 5B2GB 4FOQA 4JGYC 5L19A 4PDWB 1V6OA 4OHWA 3OCPA 1IS5A 2RS12 2PN5A 2D43A 2B46X 4KL1A 2H6BA 3MIFA 4WVWA 5L36A 2OIIA 3AMMA 1CAXA 3WXPA 4COUA 1D2QA 2OPKA 3MFCA 4I09A 4IEUA 3C2UA 4GMP1 2UURA 1RVF1 4R8HA 2XVKA 1FPN2 4D7TA 2E7TA 3DKWA 3T1MA 1F2NA 1COV2 1L3JA 4I01A 2QNKA 4YLZA 4K20A 2A6XA 4YW1A 1LEMA 2JEMA 4QGLA 2CY6A 5CFDB 5KWRA 1DGRA 3AMNA 1WW4A 1SBDA 3MIBA 3O5SA 1BK1A 2R0FA 5DZEA 4S2HA 1VBB3 3BIWE 2Y26A 1LOGA 3H1YA 4MSVA 4Q27A 2A75A 5D1IA 3WP3A 4XETA 2N7GA 2WZR1 1PO23 1HRV1 3GZUC 5FDBA 2ILMA 5EFUA 1O3RA 1BZWA 2DVAA 5J09A 3EHKA 3I59B 4ZU7A 2VUJA 4LHNA 4NR1A 1KS5A 4AEMA 3VKOA 1FNYA 2HWC3 1C5HA 1H2MA 2D93A 3HQXA 5GKAC 1FOD1 3AP9A 1PVC2 4RR3A 1G7YA 2BNOA 1PO12 4TYSA 4WZFA 5K0UC 1SCSA 3FBMA 4G3YC 1DU3D 4E27A 2D3PA 2BFUS 3MLLA 3WQ1A 1VB2A 2DU1A 3ME2A 4KU8A 4YYOA 4BA6A 5KC6A 4GWNA 4AQTA 1LRHA 1NY71 3VZOA 1IGOA 4AGRA 3FX3A 3ZYPA 2GMEA 1CONA 2XJSA 3TNQA 3N36A 1LTEA 1DQ0A 4Q0VA 1A3KA 4Y20A 5GZDA 4CEWC 2V09A 2HWF3 1D4M2 2R072 2P2KA 4HPKB 2X5IA 4SLIA 3CJIA 2VOKA 3RYPA 2ZX3A 1AXYA 4C0BA 2RS31 2HWB1 1H1AA 2EAAA 4OI4A 4XJUA 2BNMA 3KM5A 3BU7A 1RUD3 3VDDC 1QOTA 3WDXA 3MIDA 4DPNA 2D6PA 4CDWA 4IQPA 3RYRA 1H9PA 2PHLA 2VG9A 3WG4A 5KHKA 4MGYE 2IXLA 1R083 4YGDA 4F83A 3TAYA 4HN1A 3A0NA 4Q4X3 2E6VA 2ZGSA 4JDNA 4Q4V3 5BV6A 2BUKA 2CYFA 3FMGA 1RUJ3 3B9IA 3UKVA 1I5ZA 4H3WA 2Q8OA 4HFSA 1V6NA 4WVVA 1PNFA 3A4UA 2D5FA 3WP5A 1GV9A 4B7EA 5CVRA 1CAWB 2Q0AA 4FPHA 4J1XA 5K8SA 2TEPA 2XLGA 1ZZCA 2D3RA 4OUMA 1Z78A 1APNA 2ZKNA 3IPVA 1FAYA 4UW5A 5CNAA 3ZFEC 4BIFA 2DCKA 1V6LA 4FPGA 1SMVA 3RRDA 4PQ9A 1S0JA 4Z1VA 3S30A 3QCWA 3RS6A 1I9RA 4L97A 3AYCA 2VNRA 3OBRA 3J9SA 5LRSA 2PQQA 1AX2A 1QOSA 4CEYB 3SITA 4H7MA 1XXNA 2QFEA 1QQP3 4XPVA 3J8F1 1TME3 4LBQB 1W0OA 4OVEA 4QQ2A 3ZXAC 5F6LB 2B5HA 3WT3A 4QPGA 4M01A 1LB2A 4UW6A 3CEWA 4AI8A 3H8UA 1VAKA 2ZPXA 1OQEA 3ZFFB 1ENRA 3O0XA 2D6MA 3HAGA 2YDEA 2EALA 5CFCA 5CG9A 3EBRA 1H4HA 1CIWA 1GANA 2CL2A 3ZIXA 1J3QA 2RS11 4K21A 1YO8A 1EPZA 1AYN3 3SISA 1BMV1 2B9UA 2KM2A 3MIHA 2AH2A 4CYDA 5CA6A 2ETEA 4GWMA 3VBSB 1RUH1 1OQ1A 3KD4A 1JYCA 4YVSB 1Y9QA 1NE4A 3OBTA 1X7NA 2A73B 5FO7B 1NCQB 1SBEA 3GHNA 5GJ6A 3LOBA 1ND2A 5A3MA 1CN1A 4U2AA 3VBRC 2ZCWA 4YG3A 5FQ0A 3KSCA 4GMP3 1DLLA 5FCCA 1VBB2 2YXSA 4YW4A 4EN9B