1NYWA

The high resolution structures of rmlc from streptoccus suis in complex with dtdp-d-glucose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
194
structure length
194
Chain Sequence
NFFGKTLAARPVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGTWVDLREGETFGNTYQTVIDASKSIFVPRGVANGFQVLSDFVAYSYLVNDYWALELKPKYAFVNYADPSLDIKWENLEEAEVSEADENHPFLKDVKPLRKEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
publication title High-Resolution Structures of RmlC from Streptococcus suis in Complex with Substrate Analogs Locate the Active Site of This Class of Enzyme
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Isomerase
total genus 51
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2003-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nywA00
3E5UA 1ZRRA 1SFNA 1LKNA 2XKOA 3ES1A 4AVAA 3PVBB 2GC2A 4KU8A 5I0TA 4LUKA 4IERA 2OZ6A 2IXCA 4AVCA 1X8MA 4D7SA 1QXJA 1FI2A 1ZZ8A 2Z2SB 4IEVA 4HMZA 1UIJA 3H8UA 3H1WA 4HVQA 4IEOA 4DINB 1ZRDA 3N4MA 1LRHA 1GQGA 2QJVA 2EVXA 4MGIE 3NL1A 3BB6A 2IXHA 3ZDSA 5I93A 3EQEA 2KXLA 1RC6A 2UYBA 4HSLA 1XE7A 3CJXA 1O3SA 4IEQA 1CAVA 4MH0E 2IXKA 3LOIA 3O14A 3HIFA 1DZRA 5FLHA 3MZHA 1VJ2A 3WW2A 2OPKA 4Q0QA 2UY9A 4NVPA 2P17A 5I8TA 1G6NA 1J58A 4X6RB 3E97A 2ETEA 3KGZA 4HBNA 3IDBB 3OD0A 2HJIA 4LEJA 3UKNA 5KHKA 4Q0PA 2OYZA 2B9UA 3TNPB 3H50A 4PJYA 5JSOA 1CAUB 1JUHA 1WLTA 2WC2A 4UXAA 4WVZA 3UKVA 1UIKA 1RUOA 4LUMA 5KHGA 5F1RA 3ETQA 2MPFA 4QGLA 2H6BA 5LRSA 4HVRA 2ZCWA 4IEPA 4Q0SA 1CX4A 4LTAA 3E5XA 1O3TA 1Q5OA 2C0ZA 3B02A 1XRUA 4PIYA 3ELNA 4IEUA 4E2QA 5J3UA 4Z07A 2Q30A 2B5HA 5FQ0B 3HT1A 2XLGA 3NVCA 4KL1A 3GBFA 2XHKA 3I59A 2XL9A 1UPIA 1YHFA 2K9ZA 3NJZA 3WW1A 1I5ZA 2XGXA 4JTOA 1YUDA 3FX3A 3LWCA 2MHFA 2E9QA 4KWJA 4LULA 3D0JA 2Z69A 2GC1A 3USSA 3D0SA 2MNGA 1J3PA 1WA4A 3FFQA 3IWZA 3NW4A 3LA2A 4IEYA 3SCHA 1ZRFA 5J48A 2XL7A 5T3NA 1NYWA 2K0GA 5FLJA 4IEZA 3RDIA 2XLAA 4I02A 1Q3EA 4I01A 3OF1A 5HI0A 4A2UA 4IETA 4EV0A 3LAGA 4AQ2A 1V70A 4H7LA 2PHLA 3RZZA 4I0AA 2PAKA 2QCSB 5CADA 2XLFA 3BALA 1CAWB 5C8WA 3IDCB 2VECA 1ZVFA 3E6BA 2IXLA 3NKTA 3CL1A 4N9HA 3H7JA 2D5FA 4QM8A 1RTVA 3ES4A 4KWKA 4QM9A 4Q0UA 3ROUA 5EZWA 4MX3A 1EY2A 2GC0A 5I0RA 4E2GA 5I8YA 1J1LA 5J7MA 2F4PA 2Q1ZB 4ZU7A 2BYVE 3CO2A 3SHRA 4XF9A 4JTNA 3PNAA 3H9AA 4QGNA 4EWDA 3TNQA 5JCTA 4FT8A 4HN0A 2HKXA 1NE6A 2ET7A 4J1XA 5AVPA 1QWRA 3FWEA 3EO6A 3C3VA 2FMYA 3KMHA 4MZUA 3NSTA 3ST7A 4XFAA 4ZU5A 4L11A 3KCCA 3WW3A 1ZNPA 2V09A 4QXKA 4MGYE 3BU7A 2PFWA 2BNMA 5KHHA 2H0VA 1LR5A 1J3QA 4WBBA 1Y3TA 5I91A 1YWKA 1O5UA 5EFUA 3U11A 1CAXB 1O5LA 1SQ4A 2D40A 1O7FA 2QNKA 5BPXA 3OCPA 5KBFA 1NZCA 5C6CA 1FT9A 2PYTA 3M70A 1NXMA 3DL3A 4P9GA 4FAGA 1UCXA 5KHIA 4YSFA 4KWLA 3OTFA 3FJSA 4BHPA 1ZZ9A 1ZZ6A 3E6CC 2WFPA 3RYRA 4ONUA 1OFNA 4IEWA 3RNSA 1LB2A 4MGKE 4F7ZA 3HQXA 4TLFA 1I6XA 4EWAA 3SCFA 1U12A 2OA2A 3SMHA 3DKWA 5K8SA 5I8SA 3SCGA 1X8EA 2PTMA 4QGMA 1TQ5A 5FLIA 3H7YA 4XF1A 1X82A 2GH2A 4EROA 1IPJA 2QVSB 3KSCA 5FPZA 3LA7A 1ZRCA 4HN1A 3WW4A 4EWEA 5FQ0A 2BGCA 1Q43A 4YRDA 2PAMA 2GU9A 1IPKA 4XF3A 2IXIA 2UY8A 3EHKA 3QOPA 3RYKA 4I2OA 2BNNA 4YNIA 1PMIA 1FXZA 1QY4A 1O3RA 5KHJA 3CEWA 1CGPA 2EAAA 5E16A 1ZREA 3SXWA 5JR7B 2EA7A 3UKTA 3S0MA 5BV6A 1UD1A 4HSJA 4LA2A 5LEKA 1OI6A 4XFIA 4CYDA 1SEFA 1O4TA 2OZJA 3MPBA 5JAXA 4XF4A 4XF0A 1H1IA 1L3JA 5E1RA 3S7EA 4XFGA 1NE4A 2GAUA 2ATFA 4MV2A 1XE8A 1ZX5A 4PIZA 1CAWA 3KGLA 5CU1A 1RGSA 1ZZBA 3E6DA 1DZTA 4META 2QDRA 4I0BA 3CF6E 1DGRA 3IBMA 4N9IA 4R8HA 3OGJA 3VHRA 5FDBA 4YYOA 1YLLA 4Z82A 1VP6A 3PLQA 2VPVA 5I0SA 4WZCA 4OLLA 1CAVB 2D93A 2O1QA 3EBRA 2CV6A 4F8AA 1OD5A 2DCTA 2GZWA 4JV4A 4BIFA 2D5HA 4AVBA 3MYXA 4XETA 3E5QA 4IESA 2CAVA 5JSPA 2N7GA 3RPQA 4D7TA 5FPXA 2H6CA 1WGPA 4QMAA 3IIAA 5D1IA 2O8QA 4J1WA 3ACLA 5BUVA 3H3UA 3LA3A 3U0ZA 1J59A 4I3PA 4LA3A 3GYDA 4AQ6A 2Q0AA 3I7DA 2GC3A 1EYBA 5I0UA 3U10A 4JVAA 1VR3A 5BY5A 2IC1A 3H3ZA 3FE5A 2Q4SA 1CAUA 3QACA 1RUNA 1CAXA 4XFHA 4XFBA 3CLPA 2CAUA 2Y0OA 3S7IA 3I54A 4MGZE 2PAEA 3D82A 3FZ3A 4HLTA 3DN7A 3G7DA 3H1YA 2I45A 5LRRA 4BH9A 3BCWA 1QXRA 4QX5A 5LEJA 1GQHA 4K8FA 4ORFA 4UBGA 4X6QB 4O9GA 1X7NA 4UBHA 4O9EA 3M3IA 1YFUA 1ZZ7A 4XEZA 4GULA 3RYPA 4ZU4A 1Y9QA 3HT2A 2BEOA 4XFCA 2B8MA 4BYYA 5FCCA 4Q29A 4FBFA 4PIXA 3I59B 3LZZA 1YFXA 1YFWA 4AXOA 4KU7A 4L2NA 4HVOA 2IXJA 4LLOA 2PQQA 1O3QA 1YFYA 4IEXA 4I09A 4MUVA 5JSRA 3H1MA 2UYAA 3JZVA 3FHIB 5CVRA 4Q0VA 4B29A 2ZKLA 3R6SA 2PHDA 1OMIA 4OFGA 2ET1A 4HZFA 1J3RA 2PA7A 1HW5A 1EP0A 2FQPA 1ZZCA 4RD7A 4FAHA 4YARA 5BXXA 2BNOA 3L2HA 3MDPA 4E2SA 1EPZA 4XFFA 3BPZA 3EJKA 2CGPA 4R52A 1DGWA 1UW8A 2XKPA 1RL3A 2VQAA 3DV8A 1PM7A 1H1MA
chains in the Genus database with same CATH superfamily
4D3WA 3UETA 2TNFA 2YMZA 3BODA 4JGYC 5DUVA 4CEYC 2DBNA 3ENRA 5HXMA 1VAVA 1D0GA 1DYKA 5C7GA 3VDDA 5I0TA 4UFIA 4IERA 4YM3A 3PVOA 3INAA 3ZYJB 4C1XA 5FZGA 4IV3C 4UF0B 1X8MA 4ZXEA 2CWSA 2Z2SB 3VUOA 1A3KA 2BUKA 4CEWC 4Q4V1 4AK3A 5E89A 4P9LA 3ZOIA 1YQ6A 5GKAC 1UIJA 3HD8B 2ZMKA 1SLBA 1X33A 1QOTA 2XXZA 3LKJA 4IEOA 4MXVA 5T5PA 3FUOA 4QDSA 4TLGA 3V0AA 2Q5TA 3IAQA 1BBT3 4GKXA 2QJVA 4ZS3A 2EVXA 1SHWB 3VHOA 3JB4C 3BTYA 2Y33A 3BB6A 3W5NA 1OQDA 2XJQA 5I93A 1KGYA 4LBMA 4CE8A 3J26N 2HWE3 1MEC3 4YM0A 4YVWC 2KXLA 4QX1A 1HB2A 1HN0A 2B39A 3AP6A 1RVF3 2R041 2VMIA 3I2DA 4HSLA 4N53A 4NN0A 1ULEA 5EJ3A 3NWKA 4WZFA 5K0UB 1CAVA 1F5JA 4P08A 5DG1A 1VIWB 4MH0E 2ZHLA 1W8OA 3ACFA 1DZRA 3HIFA 4K7JA 5F6KA 4FPFA 1VJ2A 1ZYBA 1GNHA 1VBA2 2WQZC 2ZEWA 4QB6A 2BQPA 1W6OB 2E7TA 1CJDA 2VZOA 2GMMA 4N90A 5A80A 1LENA 1S55A 3W5MA 3L2YA 3KGZA 1OOPB 1RUE3 3IDBB 3OD0A 3VKFC 5FOBB 1K12A 5FKCA 2R071 2E63A 4K20A 1HX6A 1KRIA 1BHGA 4FPKA 1C4RA 1FV3A 3AP4A 3VZKA 1S4CA 5FPVA 4PT6A 2OYZA 1MEC2 3VBSA 1SLTA 2P1BA 2FDFA 1C3HA 1RVF2 4LKFA 1PGL2 1TMF3 3OBRA 2ZAAA 4WVZA 1E5IA 4IXLA 4N43B 1AR71 2W47A 2VOXA 3ILFA 1RXFA 4JGZA 5FFOC 4DUVA 2DURA 2JXAA 5J37A 1D2QA 2VW0A 4QQLA 1FNZA 1K5MB 3KVBA 1MVQA 1YRZA 1G9FA 4WM8A 3UJOA 3AP9A 5IVEA 5DZFA 4AVSA 1PK6A 2ZCWA 2R0HA 3OEAA 5IK7A 4FTBA 4YW4A 4CU9A 2WYSA 1DLCA 2AACA 2ZEYA 2EICA 3LQCA 1CX4A 4Q0SA 3SITA 3E5XA 3ZSLA 1UPSA 2YC4A 4OHXA 1WW4A 2JG8C 3SC7X 5KWRA 1R093 4Y33A 5FP8A 2JIGA 3B02A 3KV6A 5A7SA 1A78A 3AKPA 1LOAA 4R9DA 5DMYA 3S5AA 1UOGA 3PL0A 5L7OB 4HG6B 5J3UA 2JDAA 3KM5A 1W6PA 4U36A 3BYWA 1FPN1 2B5HA 2J1SA 5AC93 1N3OA 2D6KA 4Y4YA 1REFA 1AYM2 3GBFA 1TMF2 3VZJA 3ECQA 1BXHA 1SBEA 4RA0A 2CY6A 1IS6A 2XL9A 4AGRA 1UPIA 2K46A 2B42B 2K9ZA 2WABA 1RMU1 3KF5A 3PVNA 3RWNA 3SH3A 4W50A 4Q1RA 3VB9A 4Z2AA 3AP5A 1GU3A 4XXPA 4TN7A 2NLRA 3FX3A 3VDAA 3ZXKA 2WNUB 2RMU2 2X5IB 2E9QA 3TBDA 3OGRA 4UFKA 4OHWA 4EN8B 3D0SA 3I4IA 3KF3A 5GLUA 5ABJA 1UY3A 2OPWA 2VZPA 3FFQA 3NW4A 4JKLA 4NPLA 3ZM8A 4AI8A 4CDQB 5JMCA 1R092 2X53S 4HPKA 2ZGQA 1JZ8A 1DG6A 1JH5A 1NCQB 4IEZA 1JBCA 1XE0A 3WP3A 5JOWA 4CSWA 1JHNA 5AC92 1KS4A 1PIV3 3MEPA 4GKYA 3KV5A 2ZEXA 1PMHX 3WOGA 3WDTA 5FZBA 4BXSV 3WQ0A 2HWF1 5LB6A 1IQAA 4I0AA 4R9BA 3ZFGC 3ALQA 1KXGA 1QJU3 1UX7A 5CADA 1PVC1 3MV01 5FBJA 2ZABA 4COZA 4GWMA 3MW3A 1UY1A 2F4LA 2KA3A 3GZTB 4DEVA 2QQPA 1S0BA 3V0BA 1QQP2 1LGCA 1RUH1 3P3PA 3WXPA 3VBUA 4YG3A 1QKQA 5HBAA 1Q8PA 2UWAA 5BNQA 2HWD2 2OX0A 2ZAHA 1UF2C 2ZHKA 5C5UA 3MPPG 4QU1A 2D5FA 4NIGA 1D4M1 4MHUA 1HXS3 1KFUL 1DU3D 1ZBA3 4JAAA 1FAYA 5FYHA 3Q8AA 4UOJA 5CKQA 4LIVA 3A7QA 4GH4C 3SKJE 5FRAA 4YW7A 4MX3A 2R1BA 4C90A 1EV11 2GC0A 2LROA 4E27A 5I0RA 3WG4A 2HYKA 4XACA 2FDIA 4BK5A 1UX6A 1MZEA 2Q1ZB 2XJRA 4QHOA 3MV11 1ST8A 3SHRA 5C4WA 2BBVA 1HB4A 3P3NA 4G3YC 1UKRA 4JTNA 2ARXA 3H9AA 3MICA 1VALA 3CHXA 5L9RA 1RUD3 2UURA 3WQBA 4UW5A 1RUI2 4U2AA 4CDXB 4C91A 3N9MA 1VMFA 2OKXA 1NE6A 3MUZ1 2YPJA 3FWEA 4A44A 1CWPA 1LULA 3KMHA 3QBQA 1SPPB 4MZUA 3NSTA 4XFAA 1DQ2A 3NNLA 1GSLA 4WM7C 2JE7A 3T0AA 3WUCA 2JIJA 1C28A 1HXS2 4L11A 3KCCA 4UFHA 5JIAA 1ZBA2 3HBZA 5DUXA 4ASKA 3BTAA 2QBXA 4MGYE 3GZEA 2PFWA 1GKBA 5CFDA 2H0VA 1QU0A 2HEVF 4LE3A 5FMOS 1YWKA 1AR81 4L92A 1DGWX 4NIIA 5FKBA 5F2SA 4BQ5A 4EN9B 1SFPA 5FV3A 5JPNB 1O8PA 1W28A 2QNKA 5H9RA 1TVGA 3VBFA 4E4SA 3ZFEC 4QKBA 1FT9A 2PYTA 3M70A 4AFCA 4PHZA 1UOBA 4GMP1 1DGRN 5DQ0A 4YSFA 3ZSJA 4DRRA 4E4ZA 3WT3A 3THPA 2Y0IA 2ZGUA 3R4SA 1COV3 4BQXA 5BNPB 3RYRA 5JXJA 1OFNA 2VOWA 2CDOA 4IEWA 1A8DA 1O4YA 2MEV3 4OUEA 3MW2A 3NMBA 3HQXA 4F7ZA 4QX8A 1RUF3 5IAXA 4AGGA 1JXNA 3WEZA 4QPIA 5JWPA 3NNMA 2VR4A 4E9KA 5T5JA 4CZSA 1X8EA 4QGMA 5ISLA 3H7YA 2QQKA 4Y1UA 1NCRA 1X82A 2WNEA 4EROA 4PLNA 1VE0A 2GNBA 2RS33 4GJZA 3K3OA 1IQDC 3KSCA 5FPZA 3LA7A 3SISA 4HN1A 2WQ8A 2WNOA 1GWLA 2QE3A 1U0AA 1UOJA 4LNVA 5LY1A 2PHUA 2WLPA 4AAPA 5FXWA 5IK5A 1LAJA 4YGBA 1O91A 5FQ0A 4G9SB 4WVWA 4XCAA 1OUSA 3LB9A 4PQQA 4B1MA 3WNOA 4Q27A 1COV2 1GR3A 3EHKA 1SACA 2VW2A 3POGA 4IV1B 2XR4A 2MEV2 1HRI3 1B35C 4YNIA 1PMIA 2PHWA 4IE6A 1FXZA 4X8PA 2LW8A 3LSEA 3IZOA 1RUF2 3K2OA 5FY8A 5KHJA 4JHTA 1E5HA 2EAAA 2WRAA 5E16A 1FX5A 2P6CA 2XJTA 4ASLA 4QAWA 4LBOA 3OY8A 5L19A 4ZXKA 4JRLA 5JR7B 3UKTA 1ZBE2 3M1HA 4KGGA 5HCHA 3UGGA 2QTWB 1F35A 2BTVC 1LGNA 5DAXA 3WHTA 3AFKA 1WLDA 3GBGA 4LA2A 4RQPB 1OI6A 4XFIA 3ME2A 5BNNC 2RS32 2ES3A 2VJXA 2ZTNA 1HB1A 1QEXA 1LJ7A 2ZX0A 5JAXA 1C8M3 4XF0A 4ZONA 1DCSA 1H1IA 3GZUC 3K77A 1HKDA 2ORXA 3VDDB 4NHXA 2FCUA 1AVBA 4FQ4A 5HXVA 1TNRA 4HK8A 1POV3 2GAUA 1POQA 4WVMA 1UAIA 1XE8A 4QDRA 1FMD1 3M3QA 1HRI2 1IGOA 2RS53 3H3LA 3LDRA 3POIA 3R05A 4COWA 4Q4Y3 4FSJA 2JDKA 1RGSA 3JCIA 3MGUA 4LBQD 4BLJA 1DZTA 2PXJA 1OLQA 2D3PA 3WDYA 1PZ7A 4YGCA 4META 2ZHMA 5BYNA 3BIWE 5KXCA 5DAVA 3AFGA 3ZVXA 2VBBA 3AZWA 1SDDB 3MFCA 4UWDA 2KR2A 2CWMA 1YLLA 2A6ZA 1R64A 1LOBA 3LPGA 3M7AA 4A6OA 1VP6A 3BOPA 2F17A 3PLQA 4Y1ZA 4N53B 3THTA 4AW7A 4DMIA 1A6CA 3JD73 3QLQA 5I0SA 1CAVB 2D93A 2ZEZA 3EBRA 3CJIC 4JV4A 3SNMA 2WS93 2BVVA 5FBZA 2C6SA 4BIFA 1XC6A 1OQEA 2W1QA 5FUPA 1QGLA 4CP9A 3U75A 1PGSA 1VRBA 3AXEA 1MS1A 2JKBA 2VNVA 4NIDA 4X8NA 2ZA9A 3WVJA 4CXYA 4LOSA 4E8CA 1JOJA 4OUSA 2RS52 3OEBA 3WDUA 1WGPA 5FPXA 3N9PA 4Q4X3 3IIAA 4Q4Y2 1MQTA 2VMHA 2Y6GA 3W9AA 4J1WA 5LA0A 1W6OA 2WNVA 4RHV1 5CZKA 4CCLA 3RGBA 1MZFA 5FZLA 1XU1A 4OCTA 1OKQA 1VBC1 3VBSB 4RS5C 2Q0AA 5FMOL 4YW5A 2GC3A 1EYBA 4HFSA 5IVYA 3JD72 4AFDA 5B2GB 4NWWA 2A5ZA 4JGZB 4BQ4A 3ZPOA 1W03A 3H3ZA 1UZZA 1OFSA 2J1AA 1VB2A 3A22A 2WWUA 2XVLA 4XMIA 5C33A 4ZY9A 5LBBA 4D69A 1CAXA 5D8AA 3ZIWA 4XFHA 2JDHA 4DY5A 2CAUA 2DBIA 4RSUA 1US2A 4QXBA 3UV9A 1KITA 3I54A 2FBEA 3WDWA 1VBD3 4Q4X2 1WCSA 3KCYA 3IPVA 2Y64A 3H1YA 2W1WA 3O12A 5IFTA 4BH9A 4GMP0 3PDQA 2HEYF 1E5RA 3IAPA 3VD3A 4ORFA 3LIHA 2ZXQA 4KWUA 4O9GA 3M3IA 3CDZB 4IGPA 1NQDA 4LE4A 4QQ2A 1OF4A 2LRPA 4MSVA 4YVSC 1VBE1 1W6PB 1JI6A 4GULA 3RYPA 4ZU4A 3VN4A 4XC9A 3KT1A 5LK5A 2VW1A 2EIDA 5GALA 2UU8A 4N7IA 4JZRA 3U07A 3VD9A 4Q29A 1C57A 1TZOA 3LZZA 4PIXA 4AFAA 5L7OA 4MOAA 3AZVA 3B00A 1ASJ3 4AEKA 2XDVA 4DUWA 4Z8BA 3PMEA 1W8UA 2WIIB 3ZYIB 4JQTA 2WZR2 2FDJA 2Q1FA 2YGLA 4L2NA 2WZ8A 4OHVA 3SLIA 2AGSA 1QMJA 3E1F1 5JXHA 4LLOA 4CEYA 4XJ8A 1US3A 4QHZA 1VBD2 4AEJA 1FATA 1KEXA 4OHZA 3RFRA 5ABJB 5JSRA 2W68A 1DHKB 3JZVA 4V1PA 2A7AA 3FHIB 5DDJ3 4CUGA 4HPKB 4IV3A 4Q4W3 2SLIA 4RL7A 4OZOA 2ZKLA 4B29A 4XAAA 5AVAA 1BBT1 1W0NA 3APBA 3M2MA 2ET1A 4PDWC 5KR7A 4HZFA 1J3RA 4LKEA 4B8EA 2PA7A 1EP0A 2NQYA 3I3EA 4LHLA 3H0OA 3N9LA 1OQ1A 2HWE1 1MEC1 2WO3A 4K3UA 5H9SA 2BNOA 4UW6A 5BXXA 3MDPA 3PUSA 1RVF1 4RFRB 4L99A 1PGL1 4HKOA 3HNMA 4XZUG 3POFA 3WP6A 4XFFA 1CZTA 4YZ1A 3PTRB 1NOVA 4YVWA 2D7FA 2VOTA 4R52A 3V0BB 2CGPA 2VQAA 2NPIA 1CZSA 5FMDA 1PZ8A 5FZFA 1RIRA 1XYOA 2LS6A 1MPXA 1LKNA 3ES1A 3JBG2 1AR91 2J1VA 2ZPXA 4AVAA 1JOBA 2GC2A 2D6MA 4AL9A 3AVRA 4ZPIA 1YEWA 2IXCA 2CNAA 2RJLA 2P34A 4AVCA 1RUE1 1SLCA 4Q4W2 5F2WA 4GALA 3X29B 2WAAA 1OHFA 2JENA 1BVP1 4IEVA 4DOUA 4HMZA 4LORA 1Z7S3 4PQ9A 5A33A 1N1TA 3TAYA 2VVFA 3VGIA 4GWJA 4MADA 4BQ3A 1C8NA 5K7PA 1G9AA 5C4WB 1K45A 1KD7A 2ZX4A 4XHXA 4DINB 1JYVA 1TMF1 1GQGA 1Y9MA 3JU9A 1NLQA 3N9OA 4ISRA 4MGIE 3V64A 1TME3 1WLWA 2ADEA 2WR9A 4OI4A 2HWB3 5IFPA 1U5YA 1XE7A 1I5PA 3CZUA 1UNBA 2WZPP 3AL5A 1NA1C 1O3SA 4IEQA 1JUIA 5GLTA 4H2AA 2ZZQA 2VTXJ 3PJQA 3LOIA 2QZ3A 3GALA 3MIBA 3N7LA 5FPUA 2WA3A 5CG8A 2WA4A 1GBGA 1OVSA 4LO6B 5FWEA 1QJZA 4ATFA 5JZGC 3WW2A 3NV2A 3URFA 3J7MA 1U5IA 1RHI3 4Q0QA 3T1LA 1BQPA 3LGRA 4SLIA 4YW6A 5CFDB 3RG0A 4FPHA 4C0HA 1C1FA 2ADDA 2P17A 2NMNA 3HEIA 4KBZA 1YQ5A 2CL2A 1J58A 1AYN3 2XJUA 4AGVA 3TN93 3Q8CA 4IQPA 2ETEA 4HBNA 5AC91 3RZGA 2DVDA 2JG8A 4CCOA 2YBKA 4LIUA 2DCJA 4M0HA 2ENRA 3VBFB 2WKKA 2XJSA 1KFXL 5A3TA 2HWB2 3DYOA 4XPVA 3UKNA 5FREA 2B9UA 2D6LX 3TNPB 1GOFA 1AXYA 5C3SA 1WBLA 1D2SA 5JSOA 3I3MA 1VRH3 2R063 2C26A 2W0XA 3HR9A 4ZS2A 4BA6A 3TEZA 1GZCA 2C4XA 3RQ0A 1QOOA 1UIKA 1OUXA 1APNA 2Q8CA 1JYTA 4ARYA 5LASA 2G9GA 4LLFA 1YXWA 4LUMA 5KXBA 1PVXA 4CDUC 1RUOA 3PIGA 4KBBA 1VBB3 2RR11 3ETQA 4QKNA 2VY0A 3TYJA 5F1RA 4QPIB 1RHI2 1V6JA 3K3NA 2MPFA 1G8WA 1DQ0A 4P5HA 5F6LB 3TOJA 1AL23 4YW3A 4HVRA 3VLBB 3VHNA 2ZACA 5A7PA 1H8TC 3RZHA 2VXJA 5T5OA 3FHAA 2O0OA 3LEGA 2BZDA 1NCRB 2QFEA 3TN92 4AR2A 2ORZA 1PIV1 4P14A 3MIFA 4ZKTB 5FP9A 2DFBA 1XRUA 3GGLA 1DQ4A 3VL8A 1QJU1 3ELNA 5EYYA 5FP3A 2LALA 3MHZA 4E2QA 3C7FA 5FQ0B 3WDVA 1H9PA 2XLGA 5A1AA 1OBNA 3NVCA 2A3YA 5FIXA 5APAA 1VRH2 5G05L 3ZFGA 2YZ4A 1OA4A 4UW4A 4A7YA 2VMDA 3HVDA 3ZR5A 2CTVA 1YHFA 2P3YA 5F5IA 1NT0A 1OA2A 1HXS1 2XGXA 4JTOA 4OQ8A 1YUDA 1ZBA1 3MW4A 4I3GA 4BPZA 3OY8B 3U37A 5A3UA 2W2IA 1R1A1 2JE9A 3TEWA 2MHFA 4LULA 4OUMA 1O8SA 3D0JA 2Z69A 1XQNA 2J42A 2MNGA 4N43C 1HB3A 1NG0A 1WA4A 2ZX3A 3IWZA 2DTYA 4GD4A 3SCHA 1LTEA 2XJVA 5J48A 5A6ZA 2WJSA 5T3NA 4LT5A 2BOJA 2PLV3 4DXSA 2FDKA 3SEPA 3FLRA 1Q3EA 2LM3A 3MI8A 3OF1A 4I01A 4PI2A 4A42A 3O0VA 1AZDA 1ACCA 4JHZA 4CCNA 1G7YA 5FYYA 4CCCA 1RUD1 5A1FA 3I3BA 1V70A 4H7LA 4WVMB 3DPRC 3NAPC 2Y6KA 3WG2A 2WO1A 2R32A 1Q8QA 2FCVA 1IG3A 1ULDA 5CISA 3ZYBA 1CVNA 5J36A 2NN8A 1VBA3 2P5BA 3HAGA 2PHFA 3JQXA 1RXGA 4NO4A 4AEDC 2IFWA 3E6BA 3AVSA 3IM0A 2OUHA 4LBKA 3QH7A 2W94A 4RGAA 3RZKA 2WUHA 2J1TA 4IE4A 1N1SA 1H1AA 3ES4A 2W1UA 4KWKA 4Y5TA 1W2UA 5KXEA 3NNFA 5C9AC 2PLV2 1MZ5A 5IYYA 4B4PA 1EY2A 2ZHNA 5I8YA 4CTEA 2WNUC 5GM0A 2AH2A 1UZ0A 4CP9B 2A3WA 3KB5A 3CO2A 4URTA 1LU2A 2VM9A 2QUOA 1BJQA 1BEV2 2R16A 1WMFA 3GCWA 4DEQA 3ZFEA 1COV1 1R083 4OI0A 1RUC1 1WD3A 2WWJA 5DAQA 1GWMA 3I2KA 4EWDA 2MEV1 5GLVA 3R4UA 4QU2A 1KJLA 2Y6JA 5JCTA 1MQTB 3OPTA 1Z0HA 1RUF1 1V00A 2XWJB 2QQOA 4HN0A 1W2AX 3J4UH 2WNVB 4BK4A 4XUPA 3T4VA 3HPNA 3ST7A 3PJYA 4XW3A 3HQRA 3MF6A 4NOTA 5F5CA 3T1MA 4AE2A 3U4SA 2FDGA 2DVBA 2W5FA 3LDBA 2FHRA 4QXKA 4BJ0A 3DYPA 3BU7A 5GLWA 5IW0A 2RS31 1RUG1 1LR5A 1J3QA 1HQNA 1G9DA 3M8LA 4YG6A 2E7AA 5IK8A 4GB33 1AYM3 4TXWA 3J7LA 5GJ6A 1OURA 3BIEA 1ENQA 3VBRC 1CAXB 5D8AB 5GZEA 3CKHA 4Z1VA 1CX1A 4K1YA 4UI9L 5A3MA 4YZ4A 4FPLA 1SQ4A 2D6PA 1O7FA 5BPXA 1KS5A 3WHUA 1R082 5CKNA 5KBFA 3VBHC 1SLLA 1IKPA 2XONA 5CFCC 3TRSB 3IPVB 4J25A 1UY0A 1HV1A 3WNKA 2YC2A 3OTFA 3I3DA 4PBPA 2RMU3 1Y43B 2GMEA 1OA3A 4YW1A 4BHPA 3E6CC 1DQ1A 3AC0A 2OQ6A 1IS3A 1BK0A 1JN2P 4JC1A 3MF9A 2WAOA 2VZQA 1JS9A 3WZ1A 4QB1A 2XJPA 2YXSA 3GDBA 4LBJA 3A23A 2VCCA 4DIQA 3OUJA 4GA9A 4IUGA 2A6YA 4Q5OA 5IWFA 4AVTA 4EWAA 1U12A 1YYNA 2OA2A 5FZMA 3LE0A 2EIGA 1AX1A 3OYWA 3MLKA 1PX4A 4B1LA 4GB32 4OI2A 2VUCA 2VXRA 3LIGA 1C8M1 5FPAA 1XPWA 1F2NA 1MS3A 1MS0A 2WL1A 4XF1A 5FY4A 2NM1A 5BNNA 1IPJA 2QVSB 3HNBM 1GFF2 4A45A 4C8DA 1ZRCA 4JGYB 4K21A 4KGQA 1FOD2 4CEYB 1KDKA 3C7EA 1QQP3 4KMQA 3MIEA 2RS51 3KHBA 2BGCA 5A6YA 4Q4Y1 1JW6A 4IV3B 1UL9A 3ZSKA 2G4IA 2GU9A 2HWD3 2Q1MA 2Y38A 3QOPA 1S0CA 1P8JA 4Q2FA 4BQWA 2BNNA 3ZDVA 5FY0A 4QPGA 1QY4A 2VULA 3QH6A 4PLOA 2G19A 3VZOA 3OGGA 3M3OA 1DYPA 1CGPA 4RR3C 4HOOA 1EPWA 1JODA 5SV5A 1UO9A 3JD71 4XBLA 3RMXA 4DQAA 2DUPA 5FXZA 5BNPC 3LSDA 4YVWB 5BV6A 3ACHA 1IPSA 2WS91 4HSJA 3POEA 1UMHA 3JB8A 3ZMOA 2W3JA 4RFT0 3C2UA 1XYPA 3ZR6A 4HONA 2KD7A 1W2TA 1LOFC 2OZJA 5EXOA 5FO7B 4AFBA 3CJIA 4Q26A 4D6SA 5A7OA 5FY5A 5IVJA 1L3JA 1RUI3 3AYAA 4BISA 1HIXA 4O61A 4KG0A 1CJPA 3ZFFC 5ACA2 2J7MA 2QQVA 1GP4A 1NE4A 3Q9OA 4CDWC 4MV2A 2OW4A 3HJRA 4PIZA 5BNOA 1W8HA 1EAH2 1CAWA 5CU1A 5A33B 4FOQA 3D5OA 5CYYA 1ZZBA 5HCAA 1E5SA 4BWOA 1OH3A 4YZ3A 5CA6A 2QDRA 3ZKYA 2OQ7A 3CZJA 5C70A 2PN5A 1DGRA 3IBMA 1X50A 3NNGA 4R8HA 4ET7A 3OGJA 2JB8A 4CP0A 3I2GA 3GHMA 4QQOA 5FDBA 5DPNA 4YYOA 4RS5A 3B94A 3ZYPA 1F8VA 4Z82A 4CRQA 5FAXA 1V6LA 2Z42A 5EP9A 1S0JA 2VPVA 5GZGA 4XQ4A 3UL2A 4OYUA 2V4VA 2DCTA 2GZWA 4FO9A 3Q8BA 4W65A 2GP5A 4XUQA 4XDOA 1VBD1 4AVBA 1A8MA 3VZNA 5HV0A 3E5QA 4OHYA 4EE2A 4CU7A 3MUY1 5IHRA 4CPBA 4JDNA 4QXCA 4HANA 2Y6LA 4XTPA 5L9VA 1XYNA 3RPQA 3ACIA 4B7KA 5IVFA 1DDLA 3DXTA 3ZX7A 4HL0A 2JG8B 3POWA 1MS5A 2ARBA 4QPWA 5BUVA 1TNFA 3Q8EA 1WA6X 1J59A 4I3PA 2ZJCA 1LHVA 4YVSA 3O1UA 3GYDA 4QPYA 3U4XA 3RZLA 2E26A 4CCEA 3HQUA 1ASJ1 1JHJA 3P1IA 3O1OA 2VMGA 3O1PA 2Y26A 5I0UA 3W21A 4JVAA 3WY6A 5F5QA 3WSOA 4W6YA 1OLMA 1W8NA 4AI3A 2TEPA 4AI1A 4BQ2A 2Q4SA 3QACA 4NIHA 1NX9A 4FQZA 3WP4A 1UU5A 1WCKA 4FPYA 4DO0A 4XFBA 3CLPA 2VUAA 5DDJ1 3VKNA 3VHPA 1ODMA 1XNAA 2E32A 4Q4W1 2VZRA 4I0WB 3TEYA 4LHNA 4N53C 3KHCA 3D82A 4ZZ5A 5KC6A 1HJFA 4MYEA 2YROA 3OB8A 4PCRA 3T0BA 1UN1A 2LUWA 4C0BA 4FVVA 2YG0A 2XBO2 2VTXA 1ZBE3 1X7NA 1GANA 5FZ0A 3GHNA 4Y26A 1YFUA 4PDWA 2VQ0A 3T3YA 1KJRA 5FZ4A 2D3RA 4HKWA 1Y9QA 2G9FA 4LO8A 3SEEA 3SH4A 4TTGA 3ILRA 1AL0G 1PO13 4NR1A 4LK7A 4XVHA 3ZFGB 2AEZA 3O1MA 4BYYA 2ZX2A 5JUVA 1S0GA 2L9LA 1LOCA 4HXCA 1UU4A 1UMZA 2FD8A 3EMRA 1PO23 3BPSA 3A4UA 3PVEA 4Y4RA 1ULGA 4BU2A 4AXOA 4INDA 1QJY3 4AI0A 3N35A 1T2XA 4KU7A 5GZCA 4A3ZA 2JKXA 2PQSA 1Z78A 1C1LA 5EQUA 2WQ4A 4FTSA 3LEIA 1OPMA 5K9YA 1JMUB 4IEXA 5DUUA 4I09A 4MUVA 1Z7S1 3NJXA 4G4FA 4RGKA 1R1ZA 1BVVA 4AAXA 3FC0A 2JB4A 2D97A 3L9JT 4L0PA 3I8TA 1Q56A 1HLCA 3KS7A 4JKMA 4OVEA 1GP6A 2C24A 3DF0A 4OI1A 4RN5A 4WM8C 1TME1 4LQRA 4DFSA 3RRDA 1MVEA 1BCXA 1PK6C 1HJGA 4RD7A 4M3CA 4YARA 1GZ9A 1PO12 3L2HA 2ZGKA 2OT7A 4NROA 5JIUA 4E2SA 3GJAA 3DGTA 4B7EA 1O4ZA 3K4DA 5JPMB 1PO22 3POBA 3AMMA 1B09A 1PX3A 4P5YA 1BMV1 2XKPA 3IMMA 1W6QA 1QJY2 2I07B 1NA1A 2C5DA 1RHI1 2R072 4KNCA 4QX0A 2TBVA 1UYZA 4M00A 2DU1A 2OUJA 2XKOA 4WM7B 2WO7A 4KU8A 4S2FA 4WVVA 1S0DA 2VU9A 4XDPA 1AYN1 5M0TA 4LUKA 3B69A 1ND2A 1FI2A 1ZZ8A 1AR72 1YI9A 5ANNA 4HT1T 3H8UA 4FPGA 2VOVA 2H0BA 1T6GC 3SH5A 1RUJ3 4K8RB 1ZRDA 2BP6A 2VOKA 1LNSA 3QD6A 2WT1A 3D6EA 1WLCA 3ZFEB 2R061 1AF9A 4FFFA 5I0DA 3NL1A 3DUIA 1C5IA 2UWCA 3AJZA 2VAUA 3ZDSA 4YZ2A 1HQWA 3UNPA 3EQEA 2O8OA 1RC6A 4Q8LA 5FYUA 1VBB1 3T2OA 3CJXA 4Q8KA 1X36A 2Y8KA 3ZKUA 1CESA 2GN3A 2QQIA 3OPZA 1AL21 3N9NA 1SZBA 2DU0A 4BZ4A 2VL4A 1H4GA 3KV4A 4CDUA 3MZHA 1F4HA 1GICA 1D7PM 5F3EA 4O65A 5FYTA 1GLHA 1N1YA 1QJX3 4B3NA 5FMCA 4NVPA 3VBUC 3OJBA 5I8TA 1HV0A 1A34A 4OMDA 1H8TA 1W9YA 5FZ9A 1XSRA 3GXUA 3E97A 4X6RB 3R0RA 3S6PA 1CR7A 2VD7A 1AX0A 1RUJ2 3PUQA 5GZFA 2B45X 3Q8FA 1YJKA 4KH9A 3TEXA 4FPCA 4LEJA 3VKOA 1JYWA 5CB7A 2VG9A 1J84A 3NJYA 4NIAA 3WF3A 2CGOA 4AHXA 3BGAA 5KHKA 2WZR3 3NV1A 1IOAA 3H50A 4MLOA 4XURA 5KC5A 1JZ2A 1JU4A 4MVTA 2WC2A 3AL6A 3UKVA 3GNEA 1V9U3 1AHSA 2W46A 3FLTA 3WUDA 3ZN6A 1I9RA 1QJFA 2QKDA 5C8CC 5FYCA 2BERA 3U14A 4QKFA 3NJVA 3UK9A 3OYWB 1O6UA 2HWF2 2PHXA 1QJX2 4PBOA 4XUNA 2H6BA 3WQ1A 1JZ3A 2IFRA 2ILMA 2PLV1 2W9XA 4LR4A 4XBQA 1PVC2 4WV8A 2WDBA 5LY2A 3MIHA 4LTAA 2E6VA 2GNDA 4ARXA 5BNNB 2RDNA 3I2HA 3KCXA 1DBNA 4PI0A 2C0ZA 3VBOC 5FP4A 2XHNA 3UJQA 1QXPA 2D3SA 4PIYA 1GWKA 1W6NA 1BLZA 2QQLA 1SFYA 1H2LA 4IEUA 2Q30A 4AG4A 3HT1A 5IAVA 3AMHA 3NO8A 1D4M2 2ZGTA 4LOTA 1UZWA 1VBA1 1LHUA 3AYEA 3DPRA 3LD8A 2DDUA 4JGYA 4Z92B 3THCA 3JBG3 3N7JA 3NAPA 3C7GA 2DUOA 2YFZA 3T4HB 1IZ3A 3K51A 3N9QA 1V9U2 3V65A 4AQSA 3AKSA 4AVVA 3NNJA 2QQUA 5FO9B 1STMA 3OBAA 4QPGB 1EV12 1QJEA 2PHTA 4IE0A 5CIRA 4AHWA 1S2BA 1I5ZA 5CKMA 2GN7A 3IT8A 4CEWA 2VMEA 1U5XA 3LWCA 4AEDA 4D6RA 1WCDJ 1XSQA 3ACGA 3EYPA 3B01A 1ND3C 2Y6FA 1HQLA 1TE1B 2CGNA 1Q8OA 1YIFA 2B4KA 2ZZJA 4CCDA 5LZ6A 5C3QA 3WCSA 4DXZA 1J3PA 3D4KA 1IKQA 4IEYA 1Y7BA 2YY1A 1LEDA 4CCKA 5C9AA 4EZ4A 4ZHNA 1OF3A 1NYWA 2W92A 3CJIB 5FLJA 1S0IA 4QX3A 3RDIA 2XLAA 4I02A 1YQ8A 5DAPA 1R081 4QPIC 1OPOA 4D6QA 5HI0A 1YJLA 4A2UA 4NHLA 2JG9C 3WNLA 2PHLA 3RZZA 1X9PA 5A7WA 3BKZA 2WO2A 3POYA 5BNOB 4BE3A 3WP5A 2X8KA 5CAZA 2XLFA 1CAWB 4FPEA 4FI9A 3WF1A 5HCBA 1H9WA 2YUEA 5C8WA 3GCXA 3IDCB 4CUCA 5FMBA 5DG2A 1OLRA 4FOWA 5FZOA 3J7HA 1Q8VA 1DLLA 1D4VB 4BQYA 2FCTA 1KDMA 3CL1A 1IS4A 2C9AA 1XNKA 3H7JA 3H42B 4N9HA 4P9IA 4RS5B 4GB31 1AYM1 4JKKA 4R4ZA 4Y1YA 3WDXA 4BM8A 3O1RA 1JZ7A 5B4NA 2XWBB 4S2DA 2W95A 4Y22A 1YIPA 2VCMA 3PURA 1H4HA 5EZWA 2OIIA 2D6NA 2XUEA 3K46A 5A70A 2YFUA 4E2GA 4QHBA 5J7MA 4N7UA 3ZIXA 4ZU7A 4EN6B 2BYVE 3VBRA 2W52A 3B3QE 1WMEA 4NHYA 4F83A 2X10A 5F7UA 4XF9A 5F39A 3VZLA 2RMU1 2DUQA 4JDOA 1LHNA 5FOJB 3WQ7A 2ZKNA 1N3PA 4QGNA 5CFCA 4DUXA 1PHMA 5EWSA 3J8F3 4YWAA 1BK1A 1R091 1CN1A 3I2OA 3KV9A 5EHDA 4FT8A 2ET7A 1XU2A 2ZGPA 3C3VA 2FMYA 4YVSB 4LKSA 3VD5A 4S2HA 5JXIA 4ZU5A 2BGPA 4YFZA 1ENSA 3AKRA 1SBFA 4ISQA 4TSVA 2V09A 3WW3A 4E4DX 2BDRA 4OZXA 2BNMA 5KHHA 4P00B 3THDA 4P9WA 1LHWA 4Y3OA 1Y3TA 2P3JA 1GZTA 4AHYA 5I91A 3I2FA 5T52A 1NY72 1NXD1 5FR3A 1REEA 4GXLA 1QQP1 2JICA 2P37A 5A32A 3A0KA 2IUWA 1RYYA 2A3XA 2D40A 2YB7A 5J96B 2HWD1 2E33A 5C6CA 2GNTA 3HWJA 2BWAA 3ON7A 2FZ1A 1NXMA 3DL3A 3VD4A 1LESA 1MS4A 5KHIA 3F2ZA 1OH4A 2SBAA 2D44A 2JE8A 3J8F2 4XBNA 2I74A 2PELA 1ZZ9A 2RS13 3FJSA 3GM8A 2XH6A 3AXDA 4DY3A 4GWNA 4PDWB 1V6MA 5K0UC 4MGTA 1LB2A 4AEMA 3D8CA 4BMEA 2CHHA 2WFF3 4K40A 4AWDA 1W8FA 2IWGB 1I6XA 3USUA 4H14A 5GLZA 3BI3A 4RR3A 3SCFA 5A3WA 2ZGRA 4M4PA 3SMHA 2DCYA 3ETPA 5K8SA 5I8SA 4MGSA 1GOHA 2YC0A 4AZZA 4DPNA 1FMD2 3WF2A 3BUCA 1DFQA 1PNGA 1TQ5A 2WNVC 5D2AA 1RUI1 5FY9A 2YPDA 2GH2A 3ZXAC 1OOPC 2BV4A 1H2NA 1LODA 1AR63 5FZIA 4NWVA 3OOXA 3NKGA 2AREA 1DGLA 5H9PA 1RINA 3FLPA 3UGFA 2I2SA 2VGDA 4BDVB 2HWC3 4KQ7A 1ULPA 3IKWA 4QWNA 3WW4A 2F6BA 3FBMA 2A71A 4M0NA 5F3IA 5A3NA 1DQ5A 2D98A 1Q43A 5FZKA 2RS12 1HRV3 1J83A 4MG2A 4XF3A 3I2IA 3SQOA 2UY8A 5D8AC 2KM2A 5F8PA 2R7EB 2ZGOA 4P02B 5FY1A 3RYKA 3WV6A 4I2OA 2EF6A 3OUIA 4BIOA 2WFF2 1BYHA 1ONAA 5T5LA 3OPWA 4FFHA 1S0FA 5GZDA 4M3CB 4GH4A 4FTEA 3CEWA 5LBEA 2BFUS 2WT0A 2Y60A 5IVCA 1DYOA 1CIWA 1K5MC 2RG4A 1REDA 2RJKA 2NP0A 2JDYA 3AYCA 1GOGA 2QQNA 3FUQA 1UD1A 1BEV3 2RDRA 2RJ2A 1MR5A 4Y20B 1YQCA 4EYUA 1W6QB 5LEKA 1VAMA 1NA1B 1SEFA 1O4TA 1AR62 3C8XA 3CQOA 2BVBA 4XXAA 1UMIA 1FNYA 2AYHA 2DYCA 1BKZA 3PIJA 2HWC2 4RHV2 2RDSA 3NV3A 2XB6C 2EXKA 2A1XA 3AKTA 3MLJA 3PU8A 2VO5A 2VUJA 4NJ4A 1DZQA 1G86A 4XQDA 4XTMA 3S7EA 4DZGA 5JZGB 5LA1A 1VBC2 3S57A 4AFMA 4XFGA 1HRV2 1ND2B 2P3KA 4UAPA 4XILA 4E8DA 2ATFA 3GJBA 3N7KA 3P6BA 1WMDA 4W6WA 4WM7A 3KD4A 4LO4B 3B5LB 4RYDA 1QH7A 2W91A 4YGDA 1NLSA 2ZMNA 1OD3A 1XOYA 1F4AA 2E51A 3PU3A 3PUIA 4K1ZA 2AUYA 2RHPA 1JU3A 1CZVA 4F3JA 1PGW2 1YCIA 2BJSA 2DTWA 2X5IC 4N9IA 2BU9A 2DCKA 2EAKA 4JQRA 4QD2A 4V2VA 5EJZB 2ZBJA 3C7HA 1GV9A 2VZSA 4CDQC 3TWIA 4YW2A 3C7OA 2WWSA 4OLLA 5EPAA 2O1QA 1G9BA 3ZSMA 3AMQA 2JJ6A 3HN3A 2CV6A 2IZWA 1NCQC 4QX2A 2Q8DA 5A6QA 1I1EA 2CDPA 1VBE2 2ARAA 4CDUB 2YBSA 5FYBA 4CP2A 3MYXA 1ULCA 3ZN5A 4NHMA 5IJRA 2A73B 4D94A 2CAVA 5JSPA 5FK7A 1YC61 2ZGMA 1GMMA 2Y6HA 1NAEA 1OC1A 1OKOA 2N7GA 2YU2A 4YG0A 1ZBE1 4D7TA 1L7RA 4JCKA 1H8TB 4XUTA 5C3PA 4QMAA 2C9KA 3ZYRA 1DIWA 1CPMA 1F9KA 5D1IA 1K5JA 1V6NA 4CCMA 5DZGA 1Y9GA 1PO11 1YQ2A 3H3UA 3LA3A 3PUHA 4FCAA 4CXXA 3T0DA 2E7QA 4XHBA 1W0PA 3MBWA 5JOZA 2DV9A 4M01A 5JOYA 1AR93 1LGBA 1W6MA 2VZUA 1UYPA 1VAKA 1PO21 3KQ4B 3RVHA 1KQRA 2V5YA 4XIOA 4UYBA 3D3AA 5JLVA 1FOD3 2EXHA 3U10A 2J1EA 1QJY1 4FP3A 1W9FA 1WD4A 4AHZA 1HRI1 1YNAA 4Y24A 3ZN6B 5SV8A 4PF5A 1BBT2 2JDZA 2RE9A 3U78A 4K6BA 3VL9A 5K4LA 4COVA 3FE5A 5J09A 2Z79A 5AFEA 5C3RA 2HWE2 1B35A 4YLZA 1YO8A 3K4ZA 2Y0OA 3S7IA 4R9CA 4MGZE 5F32A 1V6KA 4ATEA 1RB8G 2GDFA 4Q1PA 4Y5Z0 3FZ3A 3UT0A 4ITCA 2VC9A 3DN7A 3G7DA 4A3XA 2AZ5A 4L9BA 5AFBA 1JYIA 3BCWA 3FBYA 4CDXC 5JOXA 2B9VA 4FFIA 4YGEA 4UBGA 1LECA 4UBHA 2HLEA 1W6NB 2HH9A 2VTFA 5F5AA 4IE5A 4LBLA 1QNWA 2QQMA 5CG9A 1AR92 4XEZA 1T6BX 2GALA 3LPFA 2BEOA 1POV1 4S2GA 3DPRB 1W9SA 2BOIA 5IT6A 3NAPB 1O59A 5FXVA 1S1AA 1W90A 2VNOA 1WZXA 2C1FA 1RUE2 2W08A 1VB4A 2G1MA 4FP2A 4R9AA 4XDQA 1GZWA 2RM23 5LWBA 5ACA3 3B93A 1TEIA 1GQPA 3CNAA 4P9JA 1UXXX 1QDOA 4IDZA 4CEWB 4AEDB 1EAH3 4D0QA 4HVOA 2PMWB 1QDCA 3AM2A 5FZ1A 2ZS6B 4YPJA 2PQQA 3OD4A 1YFYA 4KI5M 2EIEA 2R49A 2VZ3A 1O3QA 1UZVA 2YU1A 4C1WA 2JDPA 5FTTC 3M3EA 3LF7A 5G04L 2UYAA 3M4FA 4QQHA 3B9IA 4LO7A 5C9AB 4Q0VA 1QH6A 1H30A 1RUJ1 1WBFA 1LEMA 1MS9A 1V6IA 1EUUA 3R6SA 2BFUL 1OMIA 4OFGA 2WSVA 5LBFA 5EIYB 2DWRA 2JDUA 3LEKA 4V2WA 4XABA 2DVGA 2E31A 2FQPA 1ZZCA 2VUDA 2CU5A 2RR13 1S2KA 5A7WB 5CBLA 2BPA2 3T08A 3LCPA 4FXGB 4Q4X1 4GZ9A 2RM22 2JD9A 3KZ4C 3RSJA 4UFMA 3ZXLA 2D43A 3ABZA 4LO5B 1GNYA 1EUTA 2YDEA 3FL7A 1SBDA 1VMHA 3NQHA 4ZZ8A 1UW8A 2W87A 5TSWA 3O1SA 5FZOB 3RWKX 5FXXA 3DV8A 3KT4A 3E5UA 3AX4A 5FWJA 3ZN4A 1ZRRA 1GNZA 1SFNA 1QJX1 2O14A 2TUNA 1F31A 5EV7A 3UESA 3H8OA 1UY2A 3PVBB 4Y1VA 3EB7A 4BQ1A 5L7OC 4DNYA 4EN0A 5A7NA 2ID4A 3ILNA 3ZMNA 5F3CA 2OZ6A 2VBPA 4Y22B 5LA9A 4L8QA 4I30A 1QXJA 4D7SA 4A41A 1YI7A 4BXFA 2Q8OA 4IV1C 3RZJA 1PNFA 3H1WA 3VBRB 4HVQA 4NAMA 2WZR1 4O7XA 5FP7A 1JTZX 1WUVA 2HBUA 2OS2A 2RR12 3N4MA 3G6JB 1LRHA 3VBHB 4A6SA 1NKGA 1RJ7A 2VVDA 4XJZA 5T55A 1R1A3 1V9U1 5CFCB 2IXHA 3HN1A 4Y1XA 1L7QA 5C5TA 5FYSA 2ZOEB 2B46X 2UYBA 5A3OA 1W9TA 4RQPC 4BOWA 1PIV2 2FDHA 1K42A 1NLRA 5E8AA 2BBAA 2IXKA 1HDKA 3O14A 1QJU2 1JOPA 3VDCA 5FLHA 5C8CA 1OVPA 3PHMA 3VDDC 5FPBA 2XBO3 3WNNA 3TB0A 5A3LA 1E57A 2OPKA 3WF0A 3BU0A 2UY9A 4IW3A 3OUHA 4D8MA 5FO8B 1XNBA 5DN2A 4LBNA 1M4WA 1G6NA 1OT5A 1W99A 2VH9A 5A32B 2VQUA 4IL7A 5FJHA 4XZPA 3VBOA 1CONA 4XIKA 1ZA4A 4FFGA 2XVKA 2HJIA 5IVVA 4Q4V3 1F5FA 3BN6A 3JBG1 5LA2A 1WWYA 3ZYGA 1TG7A 4KG8A 1R1A2 4MGQA 4Q0PA 3OBTA 4PJYA 3T09A 2Z4FA 3A0NA 3DKQA 3PUAA 1CAUB 1JUHA 1WLTA 4UXAA 2A75A 1AXZA 3I2JA 2FZ2A 1CQ9A 1BZWA 3ZXJA 5A1LA 3AZXA 3OGVA 4Y5SA 4PF1A 2XUMA 3JXSA 3RS6A 3WG1A 2BGOA 2R043 5KHGA 3USUB 2EXJA 4RR3B 3HNYM 1RUD2 1IS5A 3I97A 4RGGA 4QGLA 1ND3A 5LRSA 1W3XA 4TYSA 4IEPA 4JX0A 1RUC3 1WMXA 4EZHA 2P3IA 2LTNA 2AEYA 4H3WA 5JR2A 2DFCA 1ODNA 1CD3G 1O3TA 1Q5OA 4LBQA 1QHDA 1URXA 2XOMA 1ZA7A 5D21A 3WF4A 2ZGNA 2CSGA 4Q4V2 4A7ZA 4CA9A 1SLIA 4CVUA 4CCJA 5IVBA 4Z07A 1H2MA 2JG9A 4AQTA 3ZFFB 5DZEA 3DYMA 3AYDA 3VBSC 4CPBD 2VBDA 1UY4A 2R073 4CDWB 3N36A 4KL1A 1W39A 3LDKA 3ZO0B 2ARCA 1POV0 3POSA 2XHKA 3IDEA 1RUG3 2VZTA 3I59A 3HOBA 2YHJA 3B9CA 1PM4A 3S5QA 4JGZC 2VVEA 2X05A 4GH4B 5JI7A 4D7YA 2R042 3NJZA 3JQWA 3WW1A 1W04A 4A7KA 1AJOA 1AR73 3CMGA 5ANQA 1GP5A 4HK9A 2HWB1 3FN9A 4KWJA 4YZ5A 4SBVA 3N3HA 2GMPA 2NMOA 2V5DA 1RUC2 2GC1A 4NE9A 3USSA 1N47A 3WG3A 1NY71 4ASMB 4IE7A 2WT2A 3LA2A 4BLIA 1ZRFA 5IATA 3VD7A 3WLUA 1DQ6A 2XL7A 4MXWA 1ULOA 4YM1A 5B4XA 4XJUA 2K0GA 1V6OA 4FXKB 3HMYA 2HYXA 4Y20A 2GSYA 3MIDA 5DABA 5EYXA 3T2TA 2JD4A 2A6XA 3CU7A 4IETA 3U1XA 4EV0A 3ORJA 1AXKA 3IMNA 5J1XA 3LAGA 4AQ2A 3J8F1 2BRTA 4LPLA 2PAKA 2QCSB 3B7MA 1RUG2 3BALA 5JZGA 5FZEA 1FPN3 5LCWL 2V72A 3J7NA 3TN91 2OVUA 2XPJA 5JXGA 4YM2A 1UKGA 1H2KA 3O5SA 1W0OA 1PMJX 1X9TA 2VECA 1ZVFA 4NRMA 1VMJA 1SG3A 2IXLA 3NKTA 4LHSA 4W6XA 2Z5WA 1W9WA 4UW3A 3ZXDA 2JDNA 4EN7B 5C3OA 1RMU3 1MS8A 3H8RA 4QM8A 4DB5A 1RJ8A 1RTVA 4NAOA 3WR0A 3DXUA 5ABJC 2Y34A 1VRH1 3PTYA 2DVAA 4QM9A 4QPGC 4R4XA 3VZMA 1XJAA 4LITA 5FY7A 4Q0UA 5E6HA 3ROUA 4UF0A 5LATA 2HBTA 3RI8A 4ES9A 2VZ1A 3VDBA 3V0AB 3UYJA 2GP3A 4LXLA 5A6XA 1RITA 5FZCA 4E4HA 1J1LA 1W2OA 2F4PA 3M3CA 3GBWA 3K75B 2CYFA 3LEMA 4CXWA 2RS11 3AZYA 3AZZA 4GWIA 4MO3M 4QDQA 2P6HA 3J9SA 3PNAA 1W3VA 3ITQA 2RDQA 3MLLA 4NUBA 2NZ9A 1FPN2 2QDNA 5HPOA 3W58A 1JYNA 3TNQA 2JEMA 1H0BA 2WFF1 1ZRIA 1C8M2 3AMPA 5FZ6A 3W59A 5JI9A 2HWF3 1H6XA 4PLMA 2HKXA 2ERFA 3AMNA 4J1XA 1PVC3 1QWRA 5AVPA 3EO6A 3IN9A 5K0UA 1SMVA 1LHOA 1RMU2 3O1VA 3S30A 1VPHA 1W6MB 1Q8SA 1UYYA 1S0EA 2VMFA 1WW5A 4H55A 1RUH3 4QQPA 4XYXA 1LCLA 3LFIA 4LKDA 4DS0A 1ZNPA 5FUNA 1SLAA 4Z2WA 1DF0A 1ULFA 3ZXGA 3WINE 2YBPA 3IIIA 3MFAA 4DXRA 4WBBA 1AR61 1LOGA 2WN2A 2P2KA 3ZYHA 3CBNA 1D4M3 2A6VA 5L73A 3T2PA 2HWC1 3RMYA 1O5UA 1JYCA 1UXZA 5EFUA 3U11A 4HETA 1O5LA 3IDAA 2XVGA 1OOPA 5HV4A 1B35B 5C4WC 1HRV1 5FZ8A 3OCPA 2WLQA 1EV13 2FMDA 4JRAA 5FZ3A 1NZCA 3SKVA 3JUUA 1SDWA 4P9GA 5H9QA 4FAGA 1UCXA 3LFMA 4KWLA 2WS92 3AP7A 1ZM1A 1ZZ6A 3RJ2X 2VNGA 5FYIA 2VMCA 5FYZA 2WFPA 4XE9A 1JYXA 4ONUA 1H8VA 2NYYA 2EIBA 4N43A 3RNSA 1OSGA 4WM8B 3ZPYA 1PGW1 5FUIA 2J1RA 2WBKA 1PK6B 3ASIA 4MGKE 4XUOA 4TLFA 5T54A 1RUH2 3WNPA 1FV2A 3KT7A 1BEV1 2BW8A 3RZMA 4BB3A 1K5MA 5CFDC 3DKWA 5JDBA 3SCGA 1GZWB 1AUYA 1ALYA 5HCFA 4LHKA 2PTMA 1OXCA 5F9TA 4GAZA 5FLIA 1Y4WA 3ZXEA 2VNRA 4YFWA 2WSUA 3MO4A 3WCRA 2G9ZA 1UQXA 2AR6A 2B7YA 3KVAA 2JDMA 4BCUA 3BTXA 3K48A 1AR83 3VBFC 4AYUA 4W4ZA 4EWEA 4YRDA 2PAMA 5FZHA 3OGSA 1SCSA 4QT6A 5CNAA 4CU8A 1F15A 1IPKA 2IXIA 3A21A 1W8TA 2W39A 4GMP3 3O0XA 3ZYFA 5ERLA 1WCQA 1OLME 2E53A 5FK8A 2D6OX 1O3RA 4H7MA 2ZMLA 1W8ZA 3ZLIA 1C5HA 2GNMA 4DRVA 1UZYA 1NZIA 4XJAA 4NMIA 2YV8A 3SXWA 1ZREA 1UYXA 2WNUA 5DUWA 1GUIA 4UT5A 2X5IA 2EA7A 3FFZA 4W8JA 2VZVA 3S0MA 3V56A 4BMBA 4HKLA 4COYA 2QQJA 3P5BA 3O7OA 2XMLA 1NCRC 4LMFA 4CDQA 4CYDA 5FZ7A 4P9XA 4XJ9A 4NPMA 1U5ZA 4CP1A 3MPBA 1DP0A 5KXDA 1AR82 5LW9A 1NCQA 3O0WA 4XF4A 3AKQA 4QX7A 1IHMA 2PHRA 1H6YA 2RV9A 2VCBA 5E1RA 2J1UA 1ASJ2 4NRQA 5FZDA 5JMOA 2QQWA 3BTZA 4AOCA 3CIHA 4EJRA 3H8XA 4FPOB 3VBUB 1ZX5A 2R1DA 3RJRA 1W05A 3KGLA 4XCBA 4TWTA 3EXUA 1WW6A 2Q8EA 3E6DA 2EXIA 3GF6A 1QOSA 4I0BA 2DF7A 1FOD1 2R0FA 2RVAA 3CF6E 2IVJA 1SCRA 3DCQA 4UFJA 5DDJ2 3LOBA 3KLSA 4GJYA 3R4DB 1UOFA 5DXDA 3VHRA 5BNOC 3PMSA 1V0AA 1LU1A 1UWWA 3DEMA 3GZAA 2GH8A 3VBHA 3K4AA 4WZCA 4QB2A 2EALA 3BVCA 3WNMA 4L97A 1OD5A 4MHRA 3WD5A 4F8AA 5C8CB 5IK4A 2D5HA 2K2SA 4NPRA 5LK7B 4XETA 1I3HA 4IESA 4M3CE 1JZ4A 1XXNA 4M4RA 1N3QA 5L36A 3F95A 1PZ9A 4EQVA 2H6CA 4A4AA 4NHKA 3W20A 1IG0A 1K3IA 4QKDA 1ENRA 1XNTA 3VBOB 4FOYA 1NQJA 2O8QA 4CDXA 3ACLA 3VKMA 1FMD3 1QIQA 3U0ZA 2WINB 1CIYA 4AI2A 1ND2C 4LA3A 1SPPA 2DVFA 3KWVA 5FPLA 4M3CF 2RM21 2XQXA 4AQ6A 2X09A 5F37A 5ACA1 3I7DA 1Z7S2 2YGMA 4GQ7A 4B4RA 3DECA 3VV1A 3I49A 1GYKA 4NRPA 4COUA 3FMGA 1UU6A 4GIQA 1VR3A 1EAH1 1WKYA 4FOVA 5BY5A 1LOEA 2IC1A 4P9YA 4XJWA 4CUAA 2BWCA 2UWBA 1NUKA 1TME2 3BOWA 1RUNA 1CAUA 1N1VA 2WZEA 2XQRA 1MACA 4AI9A 1ND3B 1J1TA 1W06A 3POJA 3HBKA 5FYVA 1VLNA 2PAEA 4J6GA 3ATGA 5L9BA 4ES8A 4QXHA 4HLTA 2W1SA 1WCUA 3NRUA 1JZ5A 2I45A 5LRRA 1FYUA 1XBFA 2IVIB 1MQTC 4LBQB 2HEWF 1QXRA 1D0HA 4QX5A 3QCWA 5A3PA 1GQHA 3FHQA 4K8FA 5LEJA 1BMV2 2R30A 4X6QB 5BNPA 1W2NA 1S2EA 4O9EA 2ZGSA 1WW7A 2WYFA 3MIGA 3OG2A 1JZ6A 1G9CA 1ZZ7A 5J98B 2AC1A 2ZX1A 4FPJA 2QZ2A 2JG9B 4XAEA 3NV4A 4OQ9A 4CUBA 3HT2A 2YYOA 2P4EA 4AF9A 1LOFA 1XB9A 1AYN2 2VE1A 4XFCA 3UGHA 2B8MA 5C71A 5FCCA 4RHV3 5FZAA 4FBFA 3I59B 5FJKA 3WNXA 1YFXA 3IB3A 4XOGA 2XG3A 1VBC3 3ZFFA 2A70A 5F3GA 3I3QA 4CDWA 1YFWA 2OXBA 2VCAA 5A7QA 1AX2A 3N7MA 3T2QA 1L7LA 2IXJA 2J22A 5DAWA 2R062 1M06G 4IGOA 1QF3A 1CPNA 1XNDA 4OMCA 5CEHA 3H1MA 4K9SA 5FYMA 4CU6A 4JDMA 2A6WA 2ZGLA 3AB0A 4MXWB 5CVRA 4B4QA 4URAA 1AJKA 1VBB2 3AK0A 2DCZA 3T30A 2PHDA 3VKLA 4TZDA 4IV1A 1QNYA 1MZ6A 1AL22 2JECA 2WN3A 1W8WA 1HW5A 5E88A 5IUQA 4LK6A 4FAHA 3OBZA 3ZXFA 4LJHA 2JX9A 3O1TA 4IGQA 4OULA 5EJ1B 2V73A 4XMAA 2X29A 3RI9A 2JWPA 3WX5A 1ENXA 1EPZA 1VBE3 3OSDA 3BPZA 3EJKA 1HN1A 2AENA 3KQRA 5LBCA 4XQWA 3ZSEA 3AJYA 5T50A 1DGWA 4DXTA 1XNCA 1RL3A 4RQPA 2R6QA 2VQTA 2XBO1 4N8MA 5JVVA 4UFLA 1PM7A 2V4AA 1H1MA
chains in the Genus database with same CATH topology
4D3WA 2TNFA 2YMZA 3BODA 4JGYC 5DUVA 4CEYC 3ENRA 1VAVA 1D0GA 1DYKA 3VDDA 5I0TA 4IERA 4YM3A 3PVOA 3INAA 3ZYJB 4C1XA 4IV3C 1X8MA 2CWSA 2Z2SB 3VUOA 1A3KA 2BUKA 4CEWC 4Q4V1 4AK3A 5E89A 4P9LA 5GKAC 1UIJA 3HD8B 2ZMKA 1SLBA 1X33A 1QOTA 3LKJA 4IEOA 4MXVA 5T5PA 3FUOA 3V0AA 2Q5TA 1BBT3 4GKXA 2QJVA 2EVXA 3VHOA 3JB4C 3BB6A 1OQDA 2XJQA 5I93A 4LBMA 3J26N 2HWE3 1MEC3 4YM0A 4YVWC 2KXLA 2B39A 3AP6A 3I2DA 1RVF3 2R041 2VMIA 4HSLA 4NN0A 4N53A 1ULEA 5EJ3A 3NWKA 4WZFA 5K0UB 1CAVA 1F5JA 5DG1A 1VIWB 4MH0E 2ZHLA 3HIFA 1DZRA 4K7JA 5F6KA 4FPFA 1VJ2A 1ZYBA 1GNHA 1VBA2 2WQZC 2BQPA 1W6OB 2E7TA 1CJDA 4N90A 2GMMA 1LENA 1S55A 3L2YA 3KGZA 1OOPB 1RUE3 3IDBB 3OD0A 3VKFC 5FOBB 2R071 2E63A 4K20A 1HX6A 1KRIA 4FPKA 1C4RA 1FV3A 3AP4A 3VZKA 2OYZA 1MEC2 3VBSA 1SLTA 1C3HA 1RVF2 1PGL2 1TMF3 3OBRA 2ZAAA 4WVZA 4IXLA 4N43B 1AR71 2VOXA 3ILFA 4JGZA 5FFOC 2DURA 2JXAA 5J37A 1D2QA 2VW0A 4QQLA 1FNZA 1K5MB 1MVQA 1YRZA 1G9FA 4WM8A 3UJOA 3AP9A 5DZFA 4AVSA 1PK6A 2ZCWA 2R0HA 5IK7A 4FTBA 4YW4A 3SITA 4Q0SA 1CX4A 3E5XA 3ZSLA 1UPSA 4OHXA 5KWRA 1WW4A 2JG8C 1R093 3B02A 1A78A 3AKPA 1LOAA 4R9DA 5L7OB 5J3UA 3KM5A 1W6PA 4U36A 1FPN1 2B5HA 5AC93 1N3OA 2D6KA 4Y4YA 1REFA 1AYM2 3GBFA 1TMF2 3VZJA 3ECQA 1BXHA 1SBEA 4RA0A 2CY6A 1IS6A 2XL9A 4AGRA 1UPIA 2B42B 2K9ZA 1RMU1 3PVNA 3RWNA 3SH3A 4Q1RA 3AP5A 4XXPA 3ZXKA 2NLRA 3FX3A 2WNUB 2RMU2 2X5IB 2E9QA 4OHWA 4EN8B 3D0SA 3I4IA 5GLUA 5ABJA 3FFQA 4CDQB 3NW4A 5JMCA 4AI8A 1R092 2X53S 4HPKA 2ZGQA 1DG6A 1JH5A 1NCQB 4IEZA 1JBCA 3WP3A 5JOWA 1JHNA 5AC92 1KS4A 1PIV3 3MEPA 4GKYA 3WOGA 3WDTA 3WQ0A 2HWF1 1IQAA 4I0AA 4R9BA 3ZFGC 3ALQA 1KXGA 1QJU3 5CADA 1PVC1 2ZABA 4COZA 4GWMA 3MW3A 2KA3A 3GZTB 2QQPA 1S0BA 3V0BA 1QQP2 1LGCA 1RUH1 3P3PA 3WXPA 3VBUA 4YG3A 1QKQA 5HBAA 1Q8PA 2UWAA 5BNQA 2HWD2 2ZAHA 1UF2C 2ZHKA 3MPPG 2D5FA 1D4M1 1HXS3 1KFUL 1DU3D 1ZBA3 4JAAA 1FAYA 4GH4C 5FRAA 5KXBA 4MX3A 2R1BA 4C90A 1EV11 2GC0A 4E27A 5I0RA 3WG4A 2HYKA 1UX6A 1MZEA 2Q1ZB 2XJRA 3SHRA 5C4WA 2BBVA 3P3NA 4G3YC 1UKRA 4JTNA 2ARXA 3H9AA 3MICA 1VALA 1RUD3 2UURA 4CDXB 4UW5A 1RUI2 4U2AA 4C91A 1NE6A 2YPJA 3FWEA 1LULA 3KMHA 3QBQA 4MZUA 3NSTA 4XFAA 1DQ2A 1GSLA 4WM7C 2JE7A 3WUCA 1C28A 1HXS2 4L11A 3KCCA 5JIAA 1ZBA2 3HBZA 5DUXA 3BTAA 4MGYE 2PFWA 1GKBA 5CFDA 2H0VA 1QU0A 2HEVF 4LE3A 5FMOS 1YWKA 1AR81 4L92A 1DGWX 4EN9B 5JPNB 2QNKA 5H9RA 3VBFA 4E4SA 3ZFEC 1FT9A 2PYTA 3M70A 4AFCA 4GMP1 1DGRN 4YSFA 3ZSJA 4DRRA 4E4ZA 3WT3A 3THPA 2Y0IA 2ZGUA 3R4SA 1COV3 5BNPB 3RYRA 1OFNA 2VOWA 4IEWA 1A8DA 1O4YA 2MEV3 3MW2A 4F7ZA 3HQXA 1RUF3 4AGGA 1JXNA 4QPIA 5JWPA 4E9KA 5T5JA 4CZSA 1X8EA 4QGMA 3H7YA 4Y1UA 1NCRA 1X82A 2WNEA 4EROA 4PLNA 2GNBA 2RS33 3KSCA 5FPZA 3LA7A 3SISA 4HN1A 2QE3A 1U0AA 4LNVA 2PHUA 2WLPA 5IK5A 4YGBA 1O91A 5FQ0A 4G9SB 4WVWA 3LB9A 4Q27A 1COV2 1GR3A 3EHKA 1SACA 2VW2A 4IV1B 2MEV2 1HRI3 1B35C 4YNIA 1PMIA 2PHWA 1FXZA 4X8PA 3LSEA 1RUF2 5KHJA 2EAAA 5E16A 1FX5A 2XJTA 4ASLA 4LBOA 3OY8A 5L19A 4ZXKA 4JRLA 5JR7B 3UKTA 1ZBE2 3M1HA 4KGGA 3WHTA 2BTVC 1LGNA 3AFKA 1WLDA 3GBGA 4LA2A 4RQPB 1OI6A 4XFIA 3ME2A 5BNNC 2RS32 2ES3A 2ZTNA 1LJ7A 2ZX0A 5JAXA 1C8M3 4XF0A 3GZUC 1H1IA 1HKDA 3VDDB 1AVBA 4FQ4A 5HXVA 1TNRA 4HK8A 1POV3 2GAUA 4WVMA 1UAIA 1XE8A 1FMD1 3M3QA 1HRI2 1IGOA 2RS53 3R05A 4COWA 4Q4Y3 4FSJA 3MGUA 1RGSA 3JCIA 4LBQD 4BLJA 1DZTA 1OLQA 2D3PA 3WDYA 1PZ7A 4YGCA 4META 2ZHMA 5BYNA 3BIWE 5KXCA 3AFGA 3ZVXA 3AZWA 3MFCA 2CWMA 1YLLA 2A6ZA 3M7AA 1LOBA 4DMIA 1VP6A 3BOPA 3PLQA 4Y1ZA 3THTA 4N53B 4AW7A 1A6CA 3JD73 3QLQA 5I0SA 1CAVB 2D93A 3EBRA 3CJIC 4JV4A 3SNMA 2WS93 2BVVA 5FBZA 4BIFA 1OQEA 1QGLA 1PGSA 3AXEA 1MS1A 2JKBA 4X8NA 2ZA9A 3WVJA 5FPXA 1JOJA 4OUSA 2RS52 3WDUA 1WGPA 4Q4X3 3IIAA 4Q4Y2 1MQTA 2VMHA 3W9AA 4J1WA 1W6OA 2WNVA 4RHV1 1MZFA 1XU1A 1OKQA 1VBC1 3VBSB 4RS5C 2Q0AA 5FMOL 4YW5A 2GC3A 1EYBA 4HFSA 3JD72 4AFDA 5B2GB 4NWWA 2A5ZA 4JGZB 3H3ZA 1UZZA 1OFSA 1VB2A 4XMIA 5C33A 2XVLA 4D69A 1CAXA 5D8AA 3ZIWA 4XFHA 4DY5A 2CAUA 4RSUA 3UV9A 1KITA 3I54A 2FBEA 3WDWA 1VBD3 4Q4X2 1WCSA 3KCYA 3IPVA 3H1YA 3O12A 4BH9A 4GMP0 2HEYF 4ORFA 4O9GA 3M3IA 4LE4A 1NQDA 4QQ2A 4YVSC 4MSVA 1VBE1 1W6PB 4GULA 3RYPA 4ZU4A 3VN4A 3KT1A 5LK5A 2VW1A 5GALA 2UU8A 4N7IA 3U07A 4Q29A 1C57A 4PIXA 3LZZA 4AFAA 5L7OA 3AZVA 3B00A 1ASJ3 4AEKA 4Z8BA 3PMEA 2WIIB 3ZYIB 2WZR2 2YGLA 4L2NA 4OHVA 3SLIA 2AGSA 1QMJA 4LLOA 4CEYA 4XJ8A 4AEJA 1VBD2 1FATA 4OHZA 5ABJB 5JSRA 2W68A 1DHKB 3JZVA 4V1PA 2A7AA 3FHIB 5DDJ3 4HPKB 4IV3A 4Q4W3 2SLIA 4RL7A 4B29A 2ZKLA 5AVAA 1BBT1 3APBA 3M2MA 2ET1A 4PDWC 4HZFA 1J3RA 4B8EA 2PA7A 1EP0A 2NQYA 4LHLA 5L73A 3H0OA 3TB0A 1OQ1A 2HWE1 1MEC1 4K3UA 5BXXA 5H9SA 2BNOA 4UW6A 4BIOA 3MDPA 1RVF1 4L99A 1PGL1 4HKOA 3WP6A 4XFFA 4YZ1A 4YVWA 1NOVA 2CGPA 2D7FA 4R52A 3V0BB 2VQAA 2NPIA 1PZ8A 1RIRA 1XYOA 3JBG2 1LKNA 3ES1A 4AVAA 1AR91 2ZPXA 2GC2A 2D6MA 2IXCA 2CNAA 2RJLA 2P34A 4AVCA 1RUE1 1SLCA 4Q4W2 4GALA 3X29B 1OHFA 2JENA 1BVP1 4IEVA 4DOUA 4HMZA 1Z7S3 4PQ9A 5A33A 1N1TA 3TAYA 2VVFA 3VGIA 1G9AA 1C8NA 5K7PA 5C4WB 1KD7A 2ZX4A 4XHXA 4DINB 1TMF1 1GQGA 3JU9A 3V64A 4ISRA 4MGIE 1TME3 1WLWA 4OI4A 2HWB3 1U5YA 1XE7A 2WZPP 1NA1C 1O3SA 4IEQA 1JUIA 5GLTA 2ZZQA 3PJQA 3LOIA 2QZ3A 3GALA 3MIBA 3N7LA 2WA3A 5CG8A 2WA4A 1GBGA 4LO6B 4ATFA 1QJZA 5JZGC 3WW2A 3NV2A 3URFA 1U5IA 1RHI3 4Q0QA 3T1LA 1BQPA 3LGRA 4SLIA 5CFDB 3RG0A 4FPHA 4C0HA 1C1FA 2P17A 2NMNA 2CL2A 1J58A 1AYN3 2XJUA 4AGVA 3TN93 4IQPA 2ETEA 4HBNA 5AC91 2DVDA 2JG8A 2DCJA 4M0HA 2ENRA 3VBFB 2WKKA 2XJSA 1KFXL 2HWB2 4XPVA 3UKNA 5FREA 2B9UA 2D6LX 3TNPB 1AXYA 1WBLA 1D2SA 5JSOA 1VRH3 2R063 2W0XA 3HR9A 4BA6A 1GZCA 3RQ0A 1QOOA 1UIKA 1APNA 2G9GA 4LLFA 1YXWA 4LUMA 1RUOA 1PVXA 4CDUC 3TYJA 4KBBA 1VBB3 2RR11 3ETQA 5F1RA 2VY0A 4QPIB 1RHI2 1V6JA 4P5HA 2MPFA 1G8WA 1DQ0A 5F6LB 3TOJA 1AL23 4YW3A 4HVRA 3VLBB 3VHNA 2ZACA 1H8TC 5T5OA 2O0OA 3TN92 2QFEA 1NCRB 1PIV1 4P14A 3MIFA 2DFBA 1XRUA 1DQ4A 3VL8A 1QJU1 3ELNA 5EYYA 4E2QA 2LALA 5FQ0B 3WDVA 1H9PA 2XLGA 3NVCA 2A3YA 1VRH2 3ZFGA 2YZ4A 1OA4A 4UW4A 4A7YA 2CTVA 1YHFA 1OA2A 1HXS1 2XGXA 4JTOA 1YUDA 1ZBA1 3MW4A 4I3GA 4BPZA 3OY8B 1R1A1 2JE9A 2MHFA 4LULA 4OUMA 3D0JA 2Z69A 1XQNA 4N43C 2MNGA 1NG0A 1WA4A 2ZX3A 3IWZA 2DTYA 3SCHA 1LTEA 2XJVA 5J48A 2WJSA 5T3NA 4LT5A 2PLV3 3FLRA 1Q3EA 2LM3A 3MI8A 3OF1A 4I01A 3O0VA 1AZDA 1G7YA 1RUD1 1V70A 4H7LA 4WVMB 3DPRC 3NAPC 3WG2A 2R32A 1Q8QA 1ULDA 1CVNA 5J36A 2NN8A 1VBA3 3HAGA 2PHFA 3JQXA 4NO4A 4AEDC 2IFWA 3E6BA 3IM0A 2OUHA 4LBKA 3QH7A 4RGAA 1N1SA 1H1AA 3ES4A 4KWKA 1W2UA 5KXEA 5C9AC 2PLV2 1MZ5A 4B4PA 1EY2A 2ZHNA 5I8YA 4CTEA 2WNUC 5GM0A 2AH2A 2A3WA 3KB5A 3CO2A 4URTA 1LU2A 2QUOA 1BJQA 1BEV2 2R16A 1WMFA 3ZFEA 1COV1 1R083 4OI0A 1RUC1 1WD3A 4EWDA 2MEV1 5GLVA 3R4UA 4QU2A 1KJLA 5JCTA 1MQTB 1Z0HA 1RUF1 1V00A 2XWJB 4HN0A 3J4UH 2WNVB 3ST7A 3PJYA 4XW3A 3MF6A 4NOTA 3T1MA 4AE2A 2DVBA 2FHRA 4QXKA 3BU7A 5GLWA 2RS31 1RUG1 1LR5A 1J3QA 1HQNA 1G9DA 3M8LA 4YG6A 2E7AA 5IK8A 4GB33 1AYM3 5GJ6A 1ENQA 3VBRC 1CAXB 5D8AB 5GZEA 4Z1VA 4K1YA 5A3MA 4YZ4A 4FPLA 1SQ4A 2D6PA 1O7FA 5BPXA 1KS5A 3WHUA 1R082 5KBFA 3VBHC 1SLLA 1IKPA 5CFCC 3TRSB 3IPVB 1HV1A 3OTFA 4BHPA 4PBPA 2RMU3 1Y43B 2GMEA 1OA3A 4YW1A 3E6CC 1DQ1A 1IS3A 1JN2P 4JC1A 3MF9A 3WZ1A 2XJPA 2YXSA 4LBJA 4GA9A 4EWAA 2A6YA 4AVTA 1U12A 1YYNA 2OA2A 2EIGA 1AX1A 3OYWA 3MLKA 4GB32 4OI2A 2VXRA 1C8M1 2WL1A 1F2NA 1MS3A 1MS0A 4XF1A 5BNNA 2NM1A 1IPJA 2QVSB 1GFF2 1ZRCA 4JGYB 4K21A 4KGQA 1FOD2 4CEYB 1KDKA 1QQP3 3MIEA 2RS51 2BGCA 4Q4Y1 1JW6A 4IV3B 1UL9A 3ZSKA 2G4IA 2GU9A 2HWD3 2Q1MA 2Y38A 3QOPA 1S0CA 4Q2FA 2BNNA 4QPGA 1QY4A 2VULA 3QH6A 4PLOA 3VZOA 3OGGA 3M3OA 1DYPA 1CGPA 4RR3C 1EPWA 5SV5A 3RMXA 3JD71 4XBLA 4DQAA 2DUPA 5BNPC 3LSDA 4YVWB 5BV6A 2WS91 4HSJA 3JB8A 3ZMOA 4RFT0 3C2UA 1XYPA 1LOFC 2OZJA 5EXOA 5FO7B 4AFBA 3CJIA 4Q26A 1L3JA 1RUI3 3AYAA 1HIXA 4KG0A 1CJPA 3ZFFC 5ACA2 1NE4A 3Q9OA 4CDWC 4MV2A 2OW4A 4PIZA 5BNOA 1EAH2 1CAWA 5CU1A 5A33B 4FOQA 3D5OA 1ZZBA 5HCAA 4BWOA 4YZ3A 5CA6A 2QDRA 2PN5A 1DGRA 3IBMA 1X50A 4R8HA 3OGJA 4CP0A 3GHMA 4QQOA 5FDBA 4YYOA 4RS5A 3B94A 3ZYPA 1F8VA 4Z82A 4CRQA 5FAXA 1V6LA 2Z42A 1S0JA 2VPVA 5GZGA 4XQ4A 3UL2A 2DCTA 2GZWA 4FO9A 4W65A 1VBD1 4AVBA 1A8MA 3VZNA 3E5QA 4OHYA 4JDNA 4HANA 4XTPA 1XYNA 3RPQA 4B7KA 1DDLA 3ZX7A 4HL0A 2JG8B 3POWA 1MS5A 2ARBA 5BUVA 1TNFA 1J59A 4I3PA 2ZJCA 1LHVA 4YVSA 3GYDA 4QPYA 3U4XA 1ASJ1 2VMGA 2Y26A 5I0UA 4JVAA 3WY6A 5F5QA 4W6YA 4AI3A 2TEPA 4AI1A 2Q4SA 3QACA 4FQZA 3WP4A 1UU5A 1WCKA 4FPYA 4XFBA 3CLPA 2VUAA 5DDJ1 3VKNA 3VHPA 4Q4W1 4I0WB 4LHNA 4N53C 3D82A 5KC6A 4MYEA 2YROA 4C0BA 4PCRA 1UN1A 2LUWA 4FVVA 2XBO2 1ZBE3 1X7NA 1GANA 3GHNA 4Y26A 1YFUA 4PDWA 2VQ0A 1KJRA 2D3RA 4HKWA 1Y9QA 2G9FA 4LO8A 3SH4A 3ILRA 1AL0G 1PO13 4NR1A 3ZFGB 4BYYA 2ZX2A 1S0GA 1LOCA 1UU4A 1UMZA 1PO23 3A4UA 3PVEA 1ULGA 4AXOA 4INDA 1QJY3 4AI0A 3N35A 4KU7A 5GZCA 1Z78A 1C1LA 2WQ4A 4FTSA 1OPMA 5K9YA 4IEXA 5DUUA 4I09A 4MUVA 1Z7S1 4G4FA 1R1ZA 1BVVA 3FC0A 3L9JT 2D97A 3I8TA 1Q56A 1HLCA 3KS7A 4OVEA 3DF0A 4OI1A 4WM8C 1TME1 4DFSA 3RRDA 1MVEA 1BCXA 1PK6C 4RD7A 4M3CA 4YARA 1GZ9A 1PO12 3L2HA 2ZGKA 5JIUA 4E2SA 3DGTA 4B7EA 1O4ZA 5JPMB 1PO22 3AMMA 1B09A 1BMV1 2XKPA 1W6QA 1QJY2 2I07B 1NA1A 2C5DA 1RHI1 2R072 4KNCA 2TBVA 4M00A 2DU1A 2OUJA 2XKOA 4WM7B 4KU8A 4S2FA 4WVVA 1S0DA 2VU9A 1AYN1 4LUKA 3B69A 1ND2A 1FI2A 1ZZ8A 1AR72 1YI9A 4HT1T 3H8UA 4FPGA 2VOVA 2H0BA 1T6GC 3SH5A 1RUJ3 1ZRDA 2VOKA 3QD6A 2WT1A 3D6EA 1WLCA 3ZFEB 2R061 1AF9A 3NL1A 3DUIA 1C5IA 2UWCA 3AJZA 3ZDSA 4YZ2A 1HQWA 3EQEA 2O8OA 1RC6A 4Q8LA 1VBB1 3CJXA 4Q8KA 1X36A 1CESA 2GN3A 3OPZA 1AL21 2DU0A 4BZ4A 1H4GA 4CDUA 3MZHA 1GICA 1GLHA 1N1YA 1QJX3 4B3NA 4NVPA 3VBUC 3OJBA 5I8TA 1HV0A 1H8TA 4X6RB 3E97A 3R0RA 3S6PA 1CR7A 1AX0A 1RUJ2 5GZFA 2B45X 1YJKA 4KH9A 3VKOA 4FPCA 4LEJA 5CB7A 2VG9A 4AHXA 2CGOA 5KHKA 2WZR3 3NV1A 1IOAA 3H50A 4MLOA 5KC5A 4MVTA 2WC2A 3UKVA 3GNEA 1V9U3 1AHSA 3WUDA 3FLTA 3ZN6A 1I9RA 2QKDA 5C8CC 3UK9A 3OYWB 2HWF2 2PHXA 3WQ1A 1QJX2 4PBOA 2H6BA 2IFRA 2ILMA 2PLV1 4LR4A 4XBQA 1PVC2 4WV8A 3MIHA 4LTAA 2E6VA 2GNDA 5BNNB 3KCXA 1DBNA 2C0ZA 3VBOC 3UJQA 1QXPA 2D3SA 4PIYA 1W6NA 1SFYA 1H2LA 4IEUA 2Q30A 4AG4A 3HT1A 3AMHA 3NO8A 1D4M2 2ZGTA 3AYEA 1VBA1 1LHUA 4Z92B 3DPRA 4JGYA 3JBG3 3N7JA 3NAPA 3TBDA 2DUOA 1IZ3A 3K51A 3V65A 1V9U2 4AQSA 4AVVA 3AKSA 5FO9B 4QPGB 1EV12 5CIRA 2PHTA 4AHWA 1S2BA 1I5ZA 2GN7A 3IT8A 4CEWA 1U5XA 3LWCA 4AEDA 1WCDJ 3B01A