1NYWA

The high resolution structures of rmlc from streptoccus suis in complex with dtdp-d-glucose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
194
structure length
194
Chain Sequence
NFFGKTLAARPVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGTWVDLREGETFGNTYQTVIDASKSIFVPRGVANGFQVLSDFVAYSYLVNDYWALELKPKYAFVNYADPSLDIKWENLEEAEVSEADENHPFLKDVKPLRKEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
publication title High-Resolution Structures of RmlC from Streptococcus suis in Complex with Substrate Analogs Locate the Active Site of This Class of Enzyme
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Isomerase
total genus 51
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2003-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nywA00
3UKVA 5JR7B 1YFUA 3OD0A 4CYDA 4E2QA 1G6NA 4IETA 3LOIA 4LUKA 1LR5A 4X6RB 1I6XA 3E5UA 3H50A 1NXMA 1GQHA 2OYZA 4PIYA 4Q0QA 3DL3A 3EQEA 1UIKA 4FAGA 4WVZA 3IBMA 4LEJA 1J1LA 1ZRDA 1OI6A 5CVRA 3ELNA 5LRRA 3S0MA 5I8SA 5BXXA 2UYBA 3RPQA 3E6CC 2IXCA 3E6BA 4HVOA 1SQ4A 4MH0E 4R8HA 2IXIA 1TQ5A 1H1IA 2OZ6A 4Z82A 4HVRA 1CGPA 1EY2A 1SEFA 1ZZCA 1CAXB 3RZZA 1HW5A 4FBFA 5JAXA 1XE8A 1X7NA 4PJYA 2PAKA 1LRHA 2IXLA 4IEZA 2EVXA 3ETQA 3E5QA 2MPFA 5EZWA 1OD5A 2QCSB 5C8WA 2GC3A 5T3NA 1CAWA 4XFAA 4LULA 2BGCA 5FLHA 5J3UA 2PA7A 5FPXA 1EPZA 4KU7A 5CU1A 2BNNA 3E97A 4ORFA 1U12A 1NYWA 4YSFA 4QGMA 1ZNPA 2Y0OA 5FLJA 4LA2A 4PIZA 1ZZ9A 2D5HA 5BPXA 2CAVA 4I09A 2B5HA 1DZTA 1VR3A 2E9QA 1FT9A 3H3UA 1O3TA 3LA3A 3IDCB 1CX4A 3MYXA 2K0GA 2O1QA 3BPZA 2HJIA 3DN7A 2ATFA 1RTVA 1SFNA 4L2NA 2IC1A 4F8AA 3D82A 4IEUA 3ZDSA 4YRDA 2BNMA 2GH2A 2QNKA 3H8UA 4ZU5A 4HN1A 1O4TA 2GC1A 4N9IA 3H3ZA 4ONUA 2ETEA 5I93A 2WC2A 2XL9A 3I54A 4D7SA 2UY8A 4ZU4A 3ES1A 4I01A 3LAGA 5F1RA 1VJ2A 4EWAA 2V09A 4I2OA 1PMIA 1UD1A 2Q1ZB 3USSA 1O3RA 3PNAA 4AXOA 3SCFA 1CAVB 1J58A 2CGPA 4IEVA 3I7DA 3FWEA 4X6QB 1I5ZA 5HI0A 2OA2A 1EP0A 2EAAA 3VHRA 3H1MA 4Q0VA 1UCXA 1O5UA 4K8FA 3LA2A 1XE7A 3UKTA 1UPIA 3NL1A 1FXZA 2QJVA 2VQAA 4XF3A 4EWEA 3N4MA 3SCHA 2GZWA 5JSOA 3D0SA 3S7EA 4D7TA 3HIFA 4UXAA 4RD7A 3IWZA 4O9GA 2OZJA 4QX5A 2XLAA 4Z07A 5D1IA 4XFFA 3KGZA 2XLGA 4QXKA 4MV2A 3LWCA 4YNIA 1H1MA 1YFYA 2B8MA 4IESA 2O8QA 1GQGA 1YHFA 3NKTA 4MGYE 1OFNA 2Q0AA 4MGKE 3I59B 5BUVA 3M70A 2MHFA 1EYBA 4KWJA 3U0ZA 2PHLA 5FQ0B 3OGJA 5KHKA 3MDPA 1YLLA 1CAUB 3NVCA 2OPKA 4HZFA 2D93A 3O14A 1CAXA 1YFWA 4QGLA 2GC0A 4L11A 3WW1A 4NVPA 4AQ2A 5J7MA 3EO6A 3FZ3A 3LA7A 1J59A 3PLQA 1J3QA 1DZRA 3SHRA 4O9EA 2IXHA 4EWDA 4ZU7A 3BB6A 1O3QA 4BHPA 3RYKA 2XGXA 4MX3A 4J1XA 3TNPB 2PQQA 1XRUA 4IEXA 4WBBA 4Q0SA 4HBNA 4XFHA 2C0ZA 4QM8A 3H1YA 1V70A 4AVCA 3G7DA 3R6SA 3E6DA 1QXRA 1DGWA 1NE6A 4XFIA 5K8SA 5LEKA 3LZZA 4HMZA 3UKNA 1Y3TA 3WW3A 5FDBA 4P9GA 4QGNA 4I3PA 3OTFA 2PAEA 3ES4A 4JTOA 3RYRA 2ZKLA 5I91A 2PYTA 2Z2SB 5C6CA 3RNSA 4JV4A 3S7IA 5FCCA 2D5FA 4E2GA 2XL7A 3KCCA 4XF9A 3SXWA 3E5XA 3QACA 1O7FA 2UYAA 1VP6A 3B02A 4KL1A 4YYOA 5J48A 1RUNA 3BU7A 4XETA 2HKXA 5AVPA 1OMIA 4HN0A 1JUHA 3MZHA 4QM9A 2CAUA 1RUOA 3L2HA 1J3PA 3NW4A 1ZRFA 4XFCA 3CF6E 1Q3EA 3CEWA 3U10A 2PFWA 3GBFA 1CAVA 4J1WA 5JSRA 4H7LA 4I0BA 4IEPA 2IXKA 3OCPA 4UBHA 4MUVA 4IERA 3HT2A 2H0VA 4IEWA 4GULA 2Z69A 5I0SA 1X8EA 4DINB 2D40A 1IPJA 5I0TA 3WW4A 1X82A 1YFXA 4XF4A 1NZCA 2UY9A 3C3VA 1L3JA 2VPVA 3EJKA 3KGLA 4OFGA 2PHDA 2B9UA 2QDRA 2BYVE 1IPKA 4F7ZA 2F4PA 2P17A 4Q0PA 4KWLA 1ZVFA 1O5LA 4UBGA 4QMAA 4LTAA 2PTMA 4FT8A 4MGZE 3RDIA 5JSPA 3SMHA 4LA3A 3IDBB 2XKOA 5KHIA 2CV6A 3EHKA 3SCGA 3FJSA 4HSLA 1RL3A 4BIFA 4R52A 3QOPA 1LB2A 3I59A 3BCWA 1O3SA 1QY4A 3FFQA 4YARA 5FQ0A 2GU9A 1ZX5A 5CADA 1CAUA 2XHKA 4B29A 1RGSA 5LRSA 3MPBA 2WFPA 4E2SA 5BY5A 3H7JA 1WA4A 2GC2A 3H9AA 4XEZA 3KMHA 1RC6A 3CJXA 5JCTA 3GYDA 3BALA 5LEJA 5I8YA 4N9HA 4TLFA 4IEOA 2FQPA 3ST7A 2Q4SA 1Y9QA 1ZRCA 4AVAA 2N7GA 4MGIE 1CAWB 2PAMA 5FPZA 4KU8A 5BV6A 1ZRRA 4LUMA 4FAHA 2XLFA 4HSJA 1UIJA 3CO2A 3HT1A 1FI2A 2VECA 3H7YA 5KHJA 4AQ6A 2BNOA 1J3RA 3M3IA 1PM7A 3FHIB 4META 4MZUA 5I8TA 3EBRA 3JZVA 1YUDA 2Q30A 1WLTA 3H1WA 5KBFA 5KHGA 2IXJA 4JTNA 3WW2A 4BYYA 1QXJA 5I0RA 1ZREA 2EA7A 3IIAA 5FLIA 4XFBA 3NSTA 4HLTA 4HVQA 3D0JA 1DGRA 2ET1A 1WGPA 2MNGA 5EFUA 3KSCA 4JVAA 4PIXA 2DCTA 3RYPA 1QWRA 1X8MA 4IEQA 1LKNA 5E1RA 1UW8A 4I02A 3ROUA 3FX3A 4IEYA 2XKPA 4BH9A 2KXLA 1Q43A 1ZZ7A 2ZCWA 4LLOA 1ZZ6A 2H6CA 4Q29A 5I0UA 1ZZBA 2QVSB 4EV0A 3OF1A 3TNQA 2BEOA 1Q5OA 4OLLA 2K9ZA 2I45A 4XFGA 3ACLA 3NJZA 4XF0A 2ET7A 4AVBA 5E16A 1NE4A 2GAUA 4XF1A 4KWKA 3CLPA 4Q0UA 5KHHA 4EROA 3CL1A 3DV8A 1ZZ8A 3DKWA 4WZCA 4A2UA 4I0AA 3U11A 2FMYA 3HQXA 2H6BA 3FE5A 1YWKA 3PVBB
chains in the Genus database with same CATH superfamily
3T3YA 1Q8QA 3UKVA 3VBFC 4FQZA 3AKQA 2DCZA 3OD0A 2PLV3 4A4AA 4CYDA 5A7PA 4ET7A 2I07B 4C90A 1FV2A 2IVIB 3JQWA 3O1UA 5JLVA 1S0CA 2ZZJA 1POV0 3AKRA 3E5UA 4FOWA 4R9AA 4Q4X2 4BPZA 4AEKA 4WV8A 3DL3A 1DCSA 1W2AX 1JUIA 3JBG1 4D0QA 3LF7A 1CESA 4QPWA 4UAPA 1JYWA 3SKVA 3WF4A 1FAYA 1S0EA 4LEJA 2CWMA 1XBFA 4COYA 4B1LA 1OI6A 4P9WA 4AVVA 1WBLA 4RR3A 4CEWB 1YQCA 1S0IA 3ELNA 5LRRA 4YZ3A 4XPVA 1UYZA 1QIQA 4BE3A 4KH9A 5LBCA 4LO4B 3AMNA 4MH0E 2WYFA 1QNYA 3KLSA 5LY1A 3EXUA 3FLPA 2OZ6A 3O1RA 1UU6A 2WN2A 4JGZC 1SEFA 1ASJ3 1ZZCA 3JBG2 1LEDA 2VUJA 4R4ZA 5EYYA 1HW5A 4MHRA 1CPNA 1ND2B 4AQSA 1XE8A 1G9BA 4FQ4A 2EXIA 2PAKA 4JDNA 4XABA 2VM9A 5JMOA 1UO9A 4FPKA 4PQQA 1ULOA 1APNA 1K5MC 2W9XA 4ISQA 1RINA 4SBVA 4CUGA 5EZWA 2ZEZA 1IS3A 1G7YA 5IAXA 5CFDB 2GC3A 3PUQA 3FMGA 5T3NA 1IG3A 1UWWA 3K77A 3OBZA 3IKWA 1UY4A 4PDWB 5LBBA 2RS51 3CIHA 2BV4A 3OY8B 5GM0A 5LBFA 1LODA 2OIIA 4BQXA 4LK7A 1GZCA 2FZ1A 4YGEA 5J3UA 2PN5A 1E57A 1WA6X 2QQKA 3KD4A 5EJ3A 1Z7S1 4LBOA 1SFPA 2EXJA 4M4PA 5FXXA 1ZNPA 1JBCA 1NCQB 4XHBA 3K4AA 1UMIA 2YU1A 4FFGA 3AKTA 2D5HA 1JOPA 1ZM1A 2J42A 4W6WA 1UF2C 3WF2A 2R32A 4I09A 1DYPA 5L9VA 1VBC3 4G9SB 2QZ2A 3AC0A 1KGYA 5DAPA 1RUH3 3H3UA 4NMIA 5JIAA 3RZJA 5K0UA 1TE1B 4OHXA 3DN7A 2ZEYA 2VUAA 2W1SA 1TVGA 2JDKA 4QPGC 4GJZA 4OQ8A 1SCRA 2X29A 4NIAA 1DFQA 1Z7S2 3CZJA 1W90A 4OI2A 4P00B 4F8AA 4IV3C 4UT5A 4YRDA 4Z92B 4PI0A 3SEEA 1N1YA 3I2HA 1O8PA 4HN1A 2TNFA 3SITA 4UFKA 1ULPA 2GC1A 2YU2A 2VZ3A 2QQLA 3AFKA 4GH4A 1R1ZA 1T6BX 3B5LB 5AC92 3WF3A 2ETEA 1US2A 3CBNA 1N1TA 2WC2A 2XL9A 4LPLA 3VBOA 1GP4A 5JDBA 1GZWA 1AR73 4ZU4A 2GN3A 5CKNA 4OCTA 4I01A 3CKHA 4DUVA 2RS11 3VD5A 3LAGA 1OVSA 5C4WA 5C3SA 1JW6A 1PMIA 3P3PA 4I2OA 4QU1A 4ARYA 2D3PA 2VOTA 3PNAA 2A3XA 4AVSA 2VBBA 5FAXA 1J58A 4DOUA 4ZS2A 4DMIA 3O1OA 1VMFA 1OOPB 5FO9B 3RZMA 1RUI3 1KXGA 3I2JA 1WMXA 3ZFFC 3OUIA 5FMDA 4JRLA 5FUPA 2VOWA 2D3SA 1RXGA 3ON7A 2YY1A 1U0AA 2C1FA 3LA2A 4HPKA 2NYYA 3SH5A 2ORZA 4XXAA 4M0NA 2RS12 1UX6A 4W50A 2ZTNA 5J98B 1U5IA 3NL1A 1DYOA 4ITCA 4Q1RA 3ZPYA 3NNMA 2F4LA 3N4MA 3HWJA 3GBWA 4EZHA 1DDLA 1AR83 4BQ1A 2W95A 3LSEA 2NPIA 3D0SA 3S7EA 4Y1VA 1U5ZA 3HIFA 4PF1A 3TOJA 4CP1A 4UXAA 2HWC1 5FZ0A 4ZXKA 1GOHA 4RL7A 3IWZA 4QX5A 4B3NA 2XLAA 2B39A 4HKWA 1G9FA 1DG6A 1GV9A 4OMCA 5C8CC 2CYFA 4QXKA 5LA1A 5DAVA 4RQPB 1HQLA 2BW8A 1LOCA 2ERFA 2VVEA 3S5QA 2QQPA 1YHFA 2HYKA 3VBSA 1VBB1 3LFIA 2JKXA 2AEZA 4LLFA 4Y22B 4Q4X3 3I59B 3ZFGB 4LHSA 5G05L 3KT1A 2HWC2 3VDAA 1ENRA 1E5RA 1H9WA 3NO8A 3VN4A 4ZKTB 5LA2A 1H4GA 2P3IA 4RS5B 1H8TC 1REEA 3WX5A 4XURA 1NCRA 2XDVA 4XZPA 5JOZA 1X33A 3POSA 2A70A 2AEYA 5LZ6A 3AMQA 1R082 4GXLA 4XJZA 1PO11 1W8TA 3LA7A 1J59A 3PLQA 2Y26A 3K46A 4AQTA 1VBB2 4LBNA 4AOCA 1GICA 1JZ8A 2GNMA 4TWTA 1OURA 3AP5A 3MIGA 2C9KA 3JBG3 2ZAAA 4RYDA 1AF9A 3N9PA 3OD4A 4IE7A 2YPJA 1JZ4A 4QX8A 3ZMNA 5APAA 1MS0A 4LBQD 5F5AA 3MUZ1 3AP6A 2PQQA 4IEXA 4WZFA 3O1MA 5KXEA 2VZRA 4QDRA 2YC4A 3H1YA 3ZO0B 5IFTA 3R0RA 3I3DA 3G7DA 3ZLIA 1QQP3 2XVKA 2D44A 3B69A 3T0AA 4BMBA 4KMQA 3PL0A 2A6WA 1QF3A 1DGWA 1NE6A 2VZTA 4OUSA 4N7IA 5A3MA 1MZ6A 2BBAA 5FV3A 5HXVA 1F2NA 5LEKA 5KWRA 2FDGA 3LZZA 3WW3A 1WLWA 3R05A 2XQXA 3BTYA 2PHTA 3BOWA 5K9YA 4FFFA 3VLBB 3OTFA 2WZEA 1YYNA 3I2DA 1GSLA 2X09A 3AMMA 4CCLA 1KD7A 1UN1A 1D0HA 1JMUB 1A6CA 2O0OA 5C6CA 4WVWA 5C9AB 4P5YA 3WOGA 3VBHA 5C3QA 5FYIA 4P9YA 5FCCA 3WD5A 3DF0A 3GZUC 1BHGA 4LKFA 2P2KA 4ATFA 4E2GA 3KWVA 2ZGUA 3VKFC 3PVNA 4BB3A 2D3RA 3E5XA 3AVRA 1XC6A 4JHTA 5HCFA 1IHMA 1ND3A 4KQ7A 2VZQA 1Z7S3 3POGA 1OMIA 3PU8A 3KB5A 4GKYA 4QU2A 5FYSA 2X5IA 5H9RA 2Q8CA 4XJUA 3T4VA 1Y7BA 1MS8A 3OGRA 3ZFEC 1J3PA 3NW4A 4KI5M 4NIIA 4CDQA 1VB4A 1HX6A 3IB3A 5F3EA 4LITA 1ZRFA 1CJDA 2JE8A 5AC93 5CFCB 1CD3G 2DUOA 3CEWA 3UETA 2PELA 3P3NA 2WBKA 4AEDA 2G9ZA 3GBFA 3IZOA 4GMP3 4MADA 4QPIB 1F4AA 1KS4A 4I0BA 3IAPA 3M3OA 2Y6GA 3A23A 1W9YA 2ZMKA 2YFZA 4OHWA 3PJQA 4Z2AA 4MUVA 1AYM1 4Y4YA 1PHMA 2Q1FA 2WO3A 2Z69A 2W08A 1X8EA 2R1DA 4LK6A 2YG0A 4DQAA 5DDJ1 4FPFA 4YG6A 5C5TA 3VDBA 1IPJA 2EIDA 5F6KA 2VU9A 1YIPA 2R071 3AJYA 1RITA 3WW4A 1X82A 1RUJ3 4NUBA 3ZYBA 1G86A 4XF4A 1DU3D 3AZVA 4XMIA 3ILNA 3SH4A 2WR9A 1W8OA 4BQWA 2DV9A 3WF0A 3VBUB 1L3JA 3KGLA 1N3PA 4OFGA 4BQ4A 2QQUA 3TYJA 1C28A 3ECQA 4AG4A 1PK6B 4AHYA 1F15A 4CEWC 2RS13 3U1XA 4F7ZA 2VJXA 4YVSB 4MGTA 2WO7A 1MQTA 2E31A 2YGLA 1AYM2 3BUCA 1GQPA 1O5LA 1QXPA 1XYNA 4LTAA 3ILRA 1PGSA 4FXKB 5FFOC 3T2TA 4CPBD 2D97A 4FT8A 1NXD1 5IVEA 1WCDJ 2JG9C 4FPLA 3VKLA 1Y9MA 5A7OA 5DDJ2 3VKNA 5JSPA 4CDUC 4Y20B 3IDBB 4W6XA 1SLCA 5IAVA 1HN1A 2R072 3KF5A 2GP3A 4B8EA 5JOWA 3EHKA 5FUNA 2ZACA 5LBEA 4FTBA 1QH7A 3FJSA 2AENA 4XHXA 2FZ2A 1GANA 1VPHA 3DPRA 4DNYA 4R52A 4CDXC 2VNVA 4Q2FA 4QQHA 4CSWA 3WHUA 1XNDA 2BU9A 1G9DA 1TME1 2RJKA 2BTVC 2VGDA 1O3SA 4RR3B 4XJ9A 1G9AA 1FMD1 2J1EA 3M3CA 4CE8A 1OUSA 2BPA2 4XIKA 4CP2A 2ADEA 4YARA 3FHQA 5DQ0A 5T54A 5JXHA 3NMBA 4PDWC 5C5UA 1FATA 3VGIA 5LRSA 2HWC3 5FZFA 5C3RA 1WW4A 2WFPA 4E2SA 4Y5Z0 5FZ6A 3J8F2 3H7JA 5ANNA 3WNMA 1WCSA 4NWWA 1S0GA 4XEZA 1LAJA 3KMHA 4FOYA 4U2AA 5FXVA 5JCTA 5A3WA 3GYDA 1PZ8A 1CWPA 3TBDA 4TLFA 1R083 2FQPA 2RS31 2Q4SA 1LOFA 1VBB3 1XYOA 2PHFA 3V64A 2JB8A 1KITA 3KV9A 3H42B 1Y9QA 2Y33A 4CVUA 3M1HA 2FDIA 1VMHA 1AX2A 3I3BA 5J96B 5JXJA 4AVAA 5KXBA 3LCPA 1WBFA 1S0DA 1GNZA 5FPZA 5BV6A 3W5MA 3VDDA 3AZZA 1PVC1 2ARCA 1IPSA 1Y9GA 2E53A 1OH3A 2P5BA 4ZXEA 1NT0A 3HT1A 5A32B 2VECA 2KA3A 5KHJA 4ZZ5A 4QHOA 1WKYA 4TLGA 2ZGPA 4J25A 2R7EB 2VOVA 4K21A 2YROA 1QJY1 2C4XA 1VBA1 3AP9A 5I8TA 2BZDA 1WCQA 4AEMA 5IATA 1DHKB 1QXJA 2XWJB 1AXYA 3VBRC 1HJFA 3GZEA 1XYPA 3PU3A 2JKBA 2RMU1 5K0UB 1KS5A 2G1MA 4XFBA 3GXUA 2VW2A 1PVC2 4B4RA 2OS2A 4Q5OA 4HVQA 3AFGA 1SLIA 1DGRA 3LDRA 4L8QA 2GDFA 4K6BA 3LSDA 4ZZ8A 3FLRA 2D6MA 2ZGQA 3KSCA 2IFRA 3CJIC 4DS0A 1QJEA 4MVTA 3WEZA 1VRBA 1QJY2 4RHV1 1SBFA 1CIYA 1LKNA 1QGLA 3QH7A 1VBA2 3ZXGA 4WM7A 3K4DA 1OOPC 4SLIA 4I02A 3ROUA 2VVDA 2HWB1 4GWNA 2Y0IA 5C70A 3LD8A 4A7ZA 4NIDA 4GH4B 4YVWA 4ISRA 2QBXA 1ZZ7A 3FUQA 1NQDA 3VBOB 4JKLA 2VMEA 3LE0A 3W5NA 1O8SA 1GZWB 1OFSA 1RUD3 1YEWA 1EV11 3DUIA 2H6CA 2RMU2 4DRRA 3NJYA 1DGRN 2ZS6B 4CU9A 4LO6B 1W8ZA 3I2GA 4S2HA 1ZZBA 2ZEXA 1ULGA 3WP5A 5F2SA 5C4WB 1QMJA 4H14A 3FHAA 3POWA 2BEOA 2ILMA 1Q5OA 1LULA 2VD7A 2O8OA 5EYXA 1POV3 3VD3A 4RHV2 4XFGA 3ACLA 5AVAA 3OPTA 5E16A 2GAUA 2WNUA 2E26A 2ZKNA 3GJAA 3VZLA 4XF1A 4IE0A 3GHNA 1DYKA 3M4FA 4EROA 3Q8AA 4FCAA 4E4DX 1JU3A 2Y6LA 3CL1A 4MHUA 3POJA 4B1MA 2XJRA 3OGGA 1EV12 3GM8A 4XAEA 3NRUA 2JDUA 4HPKB 2E51A 4LNVA 1QNWA 4QB1A 4LO7A 3WXPA 3B3QE 2FMYA 4QT6A 1FOD1 1XSQA 5T5OA 2A3WA 2A73B 1NA1C 2W46A 5FPVA 3AB0A 3W21A 3DXUA 2XXZA 1LEMA 4XTPA 1REFA 1G9CA 1W9SA 3ACFA 3GNEA 1YFUA 4A41A 2GN7A 1G6NA 1GR3A 2PHRA 4LUKA 5T5LA 3WUCA 4C1XA 3SC7X 4COVA 1I6XA 3FBYA 3NJVA 3H50A 5C33A 1AYM3 2OYZA 4PIYA 3M2MA 1SLBA 3B93A 3EQEA 4N53C 1JTZX 4NRPA 1U5XA 1Y4WA 1UOGA 1OT5A 1R1A1 2WAAA 1J1LA 5DDJ3 2WL1A 5FTTC 1MEC2 3WY6A 2ZHKA 4MOAA 3S6PA 3A7QA 2R073 1FOD2 4XACA 5I8SA 2DVFA 2A5ZA 4CXYA 1IKQA 1LENA 2BFUL 3E6BA 3APBA 5LASA 3H8RA 2DVGA 4LQRA 1FX5A 1UAIA 5FZDA 1V00A 2A6XA 1LGNA 1LOGA 2VMHA 5FZ1A 3T0DA 2RG4A 3DGTA 5JI9A 3ACIA 1YCIA 5HCAA 4UW4A 2JWPA 2MEV1 3DKQA 1NCRB 1G8WA 4FBFA 1PX4A 4Y1YA 1R1A2 1US3A 4NAOA 1DQ1A 2IXLA 1NAEA 1WZXA 5BNPC 3BTZA 1C3HA 2VMFA 5D21A 4M0HA 3J8F3 1XSRA 4PLNA 2WN3A 3FN9A 1J83A 2XUMA 4K1ZA 5JR2A 2VVFA 3AK0A 1UXZA 3HBKA 5FY8A 2VW0A 2W2IA 3VZJA 4DXSA 1UX7A 2P37A 3MIEA 2BGCA 1ENSA 1F35A 4BJ0A 1OQEA 2MEV2 5FPXA 1F9KA 3I2FA 3BOPA 4L97A 3JU9A 3WG1A 1NG0A 5AFEA 1N47A 1GMMA 4E9KA 1CX1A 4PIZA 1ZZ9A 2Y8KA 1QOSA 5D8AA 4BIOA 5BPXA 4A6OA 5A33A 2GALA 2HLEA 1VR3A 4BK4A 2VUDA 2FDFA 4KG0A 1XNKA 4LBKA 2EIEA 1RUI1 5FP8A 1E5IA 5FY1A 1WD4A 4Q27A 4QX7A 1RJ8A 1R092 1W9FA 2KM2A 1O4ZA 1A8MA 2ZABA 3VBHB 5FREA 3C7HA 2HEYF 4UW3A 2HWE1 4QKNA 2C26A 3T09A 3ZIXA 4AFDA 4QPIC 5JXIA 1DQ6A 4ES9A 2QNKA 1WCKA 2WRAA 3H8UA 1PVC3 1DLCA 1ND3B 1W05A 4IV1A 2BWAA 4FO9A 4YGDA 1AR81 1NY71 2V5DA 3I54A 1C57A 1T2XA 4YM1A 1QJY3 2X5IB 4GALA 3UESA 1V6KA 2FCVA 4C8DA 2JDHA 4UYBA 3RRDA 1PVXA 4CZSA 1VBA3 1RUI2 4CDQB 3Q8BA 4DXZA 2V09A 3N9MA 5FMCA 1UD1A 1SMVA 4YFZA 5HV0A 3USSA 2WNVA 3LEKA 1URXA 2HWE2 5FY9A 2FDKA 2HH9A 1GWMA 4AEDB 1PMHX 2J1AA 2RMU3 2VULA 3KQ4B 3GGLA 3IMNA 3ME2A 2OXBA 3GJBA 5F2WA 1PK6C 1NLSA 5J36A 3KM5A 4YVSC 5A70A 1I5ZA 4Q4X1 3TAYA 4ASKA 5HI0A 1KFXL 3KT4A 3THDA 3WDVA 5BNNB 1QKQA 2HWD1 5CA6A 3MW2A 3NNGA 1AR82 1C1LA 1NY72 1PO22 1UCXA 1O5UA 4IXLA 5A3TA 5FOJB 4RHV3 4E4ZA 1I5PA 2PHUA 2HWF1 2E7TA 3MGUA 3UKTA 3CQOA 1BXHA 1SFYA 3B94A 2AACA 2ZA9A 2VG9A 4Y1ZA 5CISA 4A42A 2QJVA 4XUTA 4XF3A 3ZR6A 4Y24A 2RM22 1EV13 2R041 4FFHA 2TEPA 2I2SA 2VQTA 1UKRA 2J1SA 3OSDA 4RR3C 4O9GA 1AJKA 1MQTB 1ENQA 4XOGA 3POIA 4CEYC 4CTEA 1W06A 1LOAA 2HWD2 4TYSA 5F39A 1WWYA 2X10A 1FNYA 5DZFA 4DEVA 2OQ6A 3KGZA 2VZVA 1GOGA 3UL2A 4Z1VA 4YNIA 2JDNA 2XVGA 1YFYA 2B8MA 3KT7A 3QH6A 4EN8B 2HWF2 2P1BA 2P4EA 2BRTA 3HAGA 2YB7A 2YDEA 1S0FA 3DPRB 1QQP1 4MGKE 2QTWB 5JZGB 2R042 1PIV2 2VQUA 2Z79A 3NQHA 3VV1A 2H0BA 3HN1A 3HN3A 3M70A 4QHBA 1XB9A 2DTYA 1MEC3 1W0OA 2JIJA 5SV5A 5A7WB 3VBFA 5JMCA 4KWJA 1N3QA 4NO4A 1FOD3 2W0XA 3O0XA 3AYDA 1YLLA 2OPKA 4YW1A 2D93A 4QB2A 5F3CA 1GU3A 5T5PA 3POYA 4L11A 4NVPA 4AQ2A 3RG0A 3AZWA 4OUMA 3L9JT 5DXDA 2V4VA 2IXHA 1UMZA 2ZX4A 4EWDA 4ZU7A 1QQP2 5JPNB 5LCWL 1RIRA 4BHPA 3CU7A 4DPNA 1R1A3 3NV1A 4LJHA 3FLTA 2P6HA 4J1XA 4JQTA 3TNPB 5KXCA 2EXHA 1XRUA 4MXWB 1QHDA 1OC1A 1IZ3A 1MZFA 4JHZA 4XFHA 4QXCA 3NV3A 1W3VA 3URFA 4QWNA 5FIXA 4S2FA 1W8UA 5GZDA 4KBBA 1DGWX 3PTRB 5HXMA 5K0UC 1RUF1 5FZAA 1XNCA 4JGZA 1BKZA 1F5FA 1SACA 5EWSA 3VDDB 3MUY1 4QD2A 4XFIA 5KC5A 3PUIA 1QOTA 3PURA 1IQAA 5K8SA 5AC91 4N7UA 1CZSA 3A4UA 4N90A 4Q4V2 1H2LA 2MEV3 4GMP1 3VZMA 1NKGA 1K5MA 1BQPA 3I3QA 1CQ9A 4FI9A 1ZYBA 1LESA 1KJLA 4I3PA 2BOJA 1HLCA 4R9CA 4UFHA 1JZ6A 1AXZA 3C8XA 2RDQA 3UK9A 1K3IA 3ES4A 4IGQA 4JTOA 3RYRA 1AUYA 2RR11 3PHMA 2D7FA 4RGGA 4BM8A 3F2ZA 4DXRA 3VBOC 2JDYA 1RHI1 3RNSA 3VHNA 1MZ5A 1X36A 4CU7A 4AF9A 4EZ4A 2XHNA 1HV1A 1RUF2 3U4XA 2D5FA 3HMYA 5FBZA 2XL7A 2PXJA 4BQ3A 1RUJ1 4XF9A 1ULFA 1JODA 4KL1A 4YYOA 1XJAA 4FPOB 1JYNA 1JYVA 1R093 2JDAA 4AVTA 3WNXA 5LY2A 5JOYA 3ZXFA 4HN0A 4ZS3A 3AMHA 4JRAA 4F83A 2VW1A 5LB6A 2Y6JA 4WM7B 3V0BA 5M0TA 2G19A 4QXBA 5ACA2 2RR12 5CAZA 4X8PA 4YVWB 3K3OA 5KR7A 4XUPA 1RHI2 1V6OA 2XJSA 2CTVA 5LW9A 3CF6E 1YXWA 1PNFA 1Q3EA 2NQYA 4G4FA 4R9DA 5LATA 3U10A 3MW3A 1CAVA 1QH6A 1F5JA 3I2IA 4J1WA 4BLJA 1DQ5A 2QFEA 1RUJ2 1UZ0A 1CR7A 2Q8OA 5A1LA 3MO4A 4IV3A 4UBHA 3K75B 2VCBA 2PQSA 2ZGOA 4IEWA 4IGPA 2XMLA 2HWE3 1HB1A 2ZHNA 3DYOA 4DINB 2WNUB 5JPMB 5ANQA 1O91A 4NHXA 5I0TA 2BWCA 4HK9A 2VZUA 3M3QA 1YFXA 4BCUA 1NZCA 2VC9A 2UY9A 1PO23 4OUEA 3NAPA 4IUGA 3C3VA 3J7LA 3ILFA 1W2OA 3ZXEA 2VMCA 3EJKA 1KQRA 2B9UA 2OW4A 2JD9A 4AFMA 1SLTA 5A7QA 1KDMA 1IPKA 2F4PA 2K46A 1IS6A 1COV1 4Q0PA 4LBQA 2JD4A 1ZVFA 1C5HA 1HN0A 2Z5WA 4UBGA 4AGGA 2RM23 2PTMA 2W52A 1R081 4HXCA 4MGZE 5T52A 4CU6A 3ZFFA 1SDDB 1JYTA 2XKOA 3PIJA 2I74A 4B7KA 2CV6A 5KHIA 3NNJA 1W8FA 1JYCA 3C7GA 4XW3A 2ARXA 2HWD3 1TZOA 1H4HA 2VNGA 1NCRC 1RL3A 2WLQA 4WVMA 4Y1XA 3W58A 5GKAC 4CP0A 1A3KA 4UF0A 5FOBB 1HJGA 3WNPA 3ZXAC 1JHJA 2ZEWA 5A3LA 2HWF3 2Y6HA 3IMMA 4RA0A 1YIFA 1COV2 1QY4A 4LORA 3H0OA 2YC2A 4W6YA 3SH3A 2JDMA 1OVPA 1VAMA 4KNCA 2XHKA 1S2EA 3GF6A 1D7PM 2R043 3MF6A 1W99A 4GD4A 4JGYC 1PIV3 1NLRA 1RGSA 2WJSA 3VL9A 3FUOA 3GZAA 4OHYA 3C7EA 5C8CA 3MPBA 4X8NA 2QE3A 1SBEA 5T55A 3WCSA 1ULDA 1MACA 2GC2A 4NHYA 4FPHA 3TEWA 1QJZA 5FYBA 1IS5A 2NM1A 1B35C 1C1FA 1RC6A 3ACGA 3N9NA 4CCMA 1YJLA 3R4DB 4A44A 2G9FA 4N9HA 2GSYA 2AGSA 2DFCA 4IEOA 1T6GC 4PI2A 1PZ7A 3T1LA 4D3WA 2FCTA 1XNTA 3BKZA 2B46X 4UFMA 3J4UH 1HRV1 4Y5TA 2JEMA 3WNOA 3RI8A 2W1QA 2VL4A 5A3OA 1Q8VA 4JDMA 1SPPA 3ZYIB 1SDWA 2WSVA 4LR4A 5FY7A 4LUMA 4FAHA 2XLFA 3Q9OA 4HSJA 2Q5TA 1HB2A 4P5HA 3WQBA 3M7AA 5EJ1B 1RUD1 5F5CA 5F32A 3H7YA 4TTGA 1FNZA 1PMJX 4AQ6A 1J3RA 4INDA 2VMGA 3WNKA 3RFRA 3JXSA 4FOQA 1HRI3 4BOWA 4MZUA 5BYNA 2W47A 3EBRA 3A21A 3N7KA 5D8AB 5KBFA 2IXJA 4JTNA 1SZBA 2VNOA 1MVQA 4NPLA 3ZKUA 1B09A 1SG3A 2A3YA 2IFWA 1POV1 5IWFA 4BYYA 4YM3A 5I0RA 1ZREA 1HRV2 4Q4V3 2ADDA 3WF1A 2DTWA 5HV4A 2EA7A 4WM8C 2X5IC 2F6BA 3BGAA 4BQ5A 4EN7B 3MLLA 2E6VA 1BCXA 3UGHA 3LEGA 3W59A 2V4AA 3NSTA 3B00A 5J09A 1XQNA 3KHBA 3ZMOA 2W91A 4Q4W1 3GHMA 5CG8A 1RUD2 3LIGA 3N7LA 4MLOA 1W6MB 2JE7A 5A6YA 2JG8B 1UYXA 4AEDC 4PIXA 5LK5A 3RYPA 5IVFA 1RUF3 5ABJC 1H8VA 4BLIA 4CPBA 5HPOA 4TN7A 4W65A 4Y4RA 2BOIA 3OUJA 1BVP1 5FZHA 1BZWA 1WMEA 4IV1B 2JENA 4EN0A 5BNNC 3OOXA 1JN2P 2XKPA 5FZKA 2KXLA 2YHJA 4BH9A 3H8XA 3BIEA 4E8CA 2ZCWA 5EPAA 3OPWA 1ST8A 4D6QA 4F3JA 5D2AA 2RE9A 4H7MA 5E6HA 3DXTA 1LHUA 2YC0A 3OBRA 4PBOA 4Q29A 2BVVA 2QQNA 4K40A 3QCWA 5I0UA 3U07A 2QVSB 3Q8FA 3GZTB 3MV01 1UXXX 2RR13 4Q4W2 2D98A 4B4PA 5ACA3 4HFSA 4YW6A 5JXGA 1RHI3 2WNVB 2K9ZA 3GCWA 1LOEA 2J22A 2YZ4A 1WW5A 3DEMA 5CIRA 2ET7A 4AVBA 3O1SA 2ZGNA 2C24A 3MICA 1UZVA 4V2VA 1W6OA 3CLPA 5GLWA 2R062 4NR1A 5KXDA 1UL9A 3OB8A 4HKLA 4Q4Y1 5L7OB 3ZFEA 2GMMA 2VXRA 3DV8A 1S2BA 1PZ9A 3AJZA 3Q8CA 1K42A 4I0AA 3I2OA 3OEAA 4IQPA 2NMNA 3U11A 4YZ2A 3KV4A 3HQXA 3DPRC 4R9BA 2YPDA 2H6BA 2P17A 3FE5A 3U75A 3WT3A 5GZGA 3B9IA 5JZGC 1ONAA 3N9QA 4E8DA 3I49A 3C2UA 3UV9A 4DIQA 2V5YA 2XJTA 2LROA 2QQIA 2WT2A 3HPNA 3J8F1 3IAQA 4XE9A 3THTA 4E2QA 1CZVA 3JQXA 2QQVA 3ZM8A 1W6QA 4XDPA 5L9RA 1W0PA 1ND2C 1NXMA 1GQHA 4L92A 4Q0QA 4Q4Y2 4OULA 5CADA 1GYKA 1OKQA 1UIKA 2R49A 1OA2A 3MV11 4U36A 2Z42A 3BODA 5F8PA 4NE9A 4MG2A 3THCA 5CFDC 4ZONA 3WDWA 2FHRA 3NV2A 5BXXA 1OF3A 2ZGMA 3AL5A 4HVOA 4I0WB 5K4LA 1SQ4A 4QDQA 3VBFB 4R8HA 4CUBA 3HOBA 3ZSMA 4WVVA 1LOFC 2JG9A 1COV3 1H1IA 1H6YA 4N43A 4Z82A 4CDUA 1GP6A 1CGPA 2FCUA 3KCXA 3O1VA 1NCQC 4RFRB 3RZZA 5JAXA 3T0BA 4BISA 1XOYA 2JDZA 3R4UA 4PJYA 4UFJA 5DUUA 4QQPA 2VBDA 1UMHA 4CDXA 2EVXA 3TN91 3PDQA 4BU2A 4BK5A 3ETQA 1W03A 1BLZA 2VR4A 4FP2A 3DECA 2MPFA 1WUVA 4GB33 1MZEA 1OD5A 5C8WA 5FPLA 2YBPA 3LQCA 1VBE1 4O7XA 3Q8EA 2ARBA 4UFIA 1C5IA 1WCUA 1OLMA 2RDRA 2V72A 5FXWA 5GLTA 3T1MA 1CAWA 2VZPA 2ZOEB 3VZKA 2DVAA 4GWMA 4XFAA 2NZ9A 3SEPA 4PDWA 5E8AA 4DXTA 2D6PA 5FLHA 4NPRA 5GZFA 2PA7A 1VBD1 3AX4A 1EPZA 4KU7A 5F37A 1RUG1 1BK0A 5CG9A 2BNNA 3E97A 4ORFA 4XMAA 3VDCA 5LWBA 3MHZA 3ZXKA 4YSFA 2C9AA 4QGMA 5FYVA 4QQ2A 5CNAA 5FLJA 5FBJA 3TN92 1HQWA 3N7MA 5FYMA 2A6ZA 2XQRA 2CAVA 1HDKA 2B5HA 2YV8A 1BBT1 1UNBA 2D43A 2E9QA 4Y26A 1FT9A 1K5MB 3NNFA 3BPSA 4FPJA 3LA3A 1VBE2 3IDCB 1CX4A 1PX3A 3MYXA 2K0GA 1OLME 1LHNA 1YQ2A 2O1QA 1WW6A 1EAH1 4NOTA 2HJIA 4RSUA 3CZUA 5DAXA 5A7SA 3KV6A 4V2WA 2ATFA 2QQJA 3WV6A 4EYUA 5DAQA 4QX1A 1VBD2 4L2NA 4AI3A 1HRV3 1RUG2 5GLUA 3HNYM 4M3CF 3D82A 2WDBA 3PMSA 4BQ2A 5JIUA 3ZDSA 4IDZA 2BNMA 1KFUL 2GH2A 3HVDA 3T2PA 4D6SA 1O4TA 3LIHA 1F4HA 3BVCA 3LKJA 2SBAA 3WP4A 3H3ZA 1BBT2 1CPMA 3L2YA 4Y5SA 4ONUA 1EUTA 4OZXA 4FPEA 5A80A 1ZBE1 2UY8A 5FPAA 1W9TA 4MYEA 5BNOA 4UW5A 5FZ4A 5FJKA 1EAH2 2UWBA 3ES1A 3VBRA 2ZHLA 2G9GA 3WVJA 5DAWA 3NJXA 4CDWA 2B42B 1BVVA 2D6LX 2Q1ZB 3AL6A 4LKDA 3MI8A 3RSJA 1HXS1 3WP3A 1CZTA 4LE4A 4BQYA 5FZ9A 3ZDVA 5AFBA 1BYHA 5FK7A 1CAVB 4MO3M 4YM2A 3QBQA 3CJIA 2Q8EA 1YI9A 2XUEA 2GMEA 2ZPXA 4MGQA 1EP0A 1GZ9A 2Z4FA 1ZBA1 3MIDA 3H1MA 4Q4W3 3VHRA 4RQPC 2XBO1 4HG6B 1ZBE2 5E89A 1MEC1 4MSVA 4RN5A 1XE7A 2DCJA 2RDNA 3ORJA 4BA6A 4CRQA 3D8CA 4IE5A 1UPIA 1LNSA 2D6OX 3WG2A 3ZVXA 3ZFGC 2R063 2VQAA 3B9CA 1HXS2 2ZZQA 2PHXA 3NAPB 3SCHA 3IDAA 2GZWA 1UKGA 5JSOA 4AYUA 1NLQA 2D6NA 2WWUA 3BTAA 3HR9A 3OGSA 4D7TA 1VRH1 2Y38A 3AMPA 2R16A 4XJAA 4RS5C 1MR5A 4LBQB 1UZWA 1ZBA2 1SHWB 1W6PA 4Z07A 5D1IA 3I8TA 1BEV1 4XFFA 5FMOS 2XBO2 2D6KA 4AGVA 2XLGA 3WHTA 4AHZA 3WLUA 3S30A 4MV2A 4CU8A 3QD6A 5C71A 1MVEA 3LWCA 1H1MA 2RV9A 4UWDA 1UU5A 3ZFFB 1IQDC 1HIXA 3PIGA 3VBSB 1GQGA 1N1VA 4QXHA 3FC0A 3T2OA 3NKTA 1ULCA 4OI4A 2UU8A 4WVMB 1S4CA 4MGYE 3DYMA 2WKKA 4AK3A 4Q4Y3 4UF0B 5JWPA 2ZAHA 4QDSA 1YNAA 4FP3A 3MLKA 4AL9A 4DEQA 3LPGA 2QQOA 1NA1A 3SKJE 1VRH2 2P3JA 1E5HA 1H2MA 3TWIA 1J1TA 2MHFA 1SBDA 4AFAA 1C8M2 1EYBA 5EIYB 2PHLA 3USUA 3U0ZA 2A75A 4Z8BA 3J7NA 2ZGSA 3OGJA 5KHKA 1BEV2 3NVCA 1QJU1 4HZFA 1CAXA 3D3AA 1TNRA 4JCKA 4QGLA 2GC0A 2GH8A 4P9LA 5J7MA 4YG3A 4XQ4A 3IPVA 5C8CB 3EO6A 4N53A 5DUWA 5FZ8A 2OVUA 3J9SA 1J3QA 1DZRA 1RVF1 1CIWA 4NHMA 3SHRA 4O9EA 2DBNA 4URAA 3ZPOA 3ZYJB 3KCYA 2OKXA 2VTXA 4LHLA 3ZN5A 4KBZA 2WWSA 3AYAA 3H3LA 5HCHA 4CCOA 2XOMA 1R091 5C9AC 5FP7A 1BJQA 2VCCA 4HBNA 4K9SA 5B4NA 4CCNA 2C0ZA 3FFZA 4QM8A 3E1F1 1QJU2 3LEIA 4NRMA 2ZMNA 1W0NA 2WQ4A 3FL7A 3R6SA 1SPPB 3K51A 4GKXA 2GNTA 2BP6A 4XCAA 1QXRA 2XVLA 4L99A 3P6BA 1ULEA 2XJPA 4M3CA 1PNGA 2P3KA 3WG4A 1RVF2 2NLRA 2ZGTA 2LUWA 5FXZA 4HMZA 3UKNA 2JG8C 1Y3TA 2GNDA 5FPUA 1WD3A 5BNPA 4QGNA 2WQ8A 3ZSJA 1QU0A 4AAXA 2PAEA 3HEIA 4CCEA 4IV1C 5JI7A 3TN93 2WUHA 1H6XA 1JZ7A 5CFCC 2PYTA 2AC1A 2Z2SB 4PLOA 2FMDA 1UYPA 4K8RB 4JV4A 4LIUA 4XQDA 3KV5A 3S7IA 4M00A 4ZHNA 1A78A 1OXCA 5FPBA 1VBE3 3OBTA 3RWNA 1UQXA 2EIGA 4QKDA 3AYEA 4NIGA 3RS6A 1KDKA 3KCCA 4M01A 4AI9A 3SXWA 1VAVA 4M3CE 1FV3A 1O7FA 2KR2A 5J48A 3NWKA 1IKPA 2ZBJA 3AP7A 1PO21 1GNYA 5DPNA 1Z78A 2Q1MA 1NOVA 4FPGA 4AWDA 4H3WA 1JYXA 3PUAA 4LHKA 4FSJA 1VBD3 1SCSA 4YPJA 1RUG3 5AVPA 4YW3A 2BFUS 5FUIA 1AL21 1JUHA 1Q56A 2IUWA 3MZHA 3ZSEA 3WZ1A 2OPWA 4CCJA 1RUOA 4IL7A 1TEIA 4GZ9A 4DFSA 4YW2A 3ZXDA 2RM21 5L7OC 3VBUC 1AR61 1BBT3 3CHXA 1YJKA 4AHXA 4H2AA 1OSGA 5A6QA 1RUNA 5CYYA 4PF5A 5DUVA 2PFWA 4QX3A 1EAH3 1ALYA 3OJBA 4HOOA 1AZDA 4IEPA 4COZA 4XUOA 5JUVA 4QPIA 1AYN2 2BERA 1YQ5A 1JHNA 2H0VA 3U78A 1QJX3 4RGAA 3BIWE 3MFAA 4COUA 1AL22 3G6JB 2WLPA 2D40A 4UOJA 1V0AA 3A0KA 1GLHA 1NQJA 4R4XA 1OH4A 3WG3A 4ASLA 4E4HA 1AR62 1Q8SA 1C8NA 3ZFEB 1PIV1 3OG2A 1UY3A 5IW0A 3ZYRA 1MS5A 1ZBE3 3I2KA 4L0PA 4LBLA 4XBQA 4CCDA 3V0AA 5DZEA 3UJOA 2QDRA 1L7QA 5H9PA 4CXWA 2JJ6A 4BZ4A 2ID4A 4QB6A 4Y33A 3GALA 1W8NA 1HXS3 4YVSA 2NP0A 3ZN6A 3VUOA 3SMHA 5A1AA 3DCQA 4LA3A 4D8MA 3PMEA 4GA9A 4CUCA 1W6QB 3ZXJA 3MFCA 4Y20A 5EQUA 4XTMA 1ZBA3 3O0VA 2WA3A 2AZ5A 3BI3A 1D4M1 1VALA 2DDUA 4HETA 4BIFA 4C0BA 1FPN3 1MS9A 2XBO3 5FWJA 1LB2A 1SLLA 3HJRA 4QX2A 5DUXA 3ZN4A 1UY0A 1RUC2 2G4IA 1LHOA 3BCWA 5DG1A 5EP9A 5IK4A 5FZCA 4JZRA 4JKKA 3ITQA 1HB4A 3FFQA 2WNOA 2ZX0A 5FQ0A 1ZA7A 1HRI1 2WNEA 1CAUA 2HBUA 1F8VA 1I9RA 4B29A 4CEYA 1JZ3A 5A3PA 1RB8G 3N36A 4XDQA 5GJ6A 5T50A 4BMEA 3TEZA 1VRH3 1YI7A 2NN8A 2JG9B 5CB7A 2FDHA 2VZ1A 2WS93 1AR91 1C8M3 3K48A 1WA4A 4N43B 2WZR1 3AP4A 4Q4V1 4CDUB 3RGBA 5A6ZA 4UFLA 1D4M2 3RZKA 1BEV3 3I3MA 2HYXA 4K7JA 2WT0A 1OQDA 4BXFA 5E88A 1QDCA 5LEJA 5EJZB 4CDXB 2JE9A 2VZSA 2W92A 4B7EA 4E4SA 1KJRA 3N3HA 4GWIA 2DVDA 4QHZA 4FPYA 4GWJA 4BWOA 3D5OA 1QOOA 1W8WA 1D0GA 1HRI2 3UNPA 3JUUA 4DO0A 1ZRCA 2DUPA 4JKMA 2N7GA 1CAWB 2DUQA 3HQUA 3KQRA 2XH6A 2EAKA 4NAMA 2FD8A 5T5JA 3WQ7A 1JZ2A 4JX0A 1AR92 3CO2A 1GOFA 3RZGA 2WZR2 5A7NA 2W1UA 5L73A 2BNOA 2XWBB 1QJU3 4V1PA 1UZYA 3M3IA 3WDXA 1W3XA 3MF9A 3PUSA 5A32A 1QEXA 5I0DA 1V6NA 3RQ0A 3ATGA 2ARAA 5IYYA 4FTSA 3FHIB 1X50A 4META 5ACA1 4GH4C 4OYUA 1RUE1 2Q30A 5KHGA 1LU1A 1JI6A 1R64A 3IT8A 5FZ3A 1RVF3 3RJRA 1EUUA 5B4XA 3SLIA 4A45A 1D2SA 2XG3A 3WDTA 2CGNA 5SV8A 1H0BA 4GIQA 3AZXA 5FLIA 4QPYA 3ZSKA 5C4WC 2O14A 2BGPA 2VZOA 5FP9A 2AR6A 4HLTA 1X9TA 2RS52 3D0JA 4CP9A 3QLQA 3IDEA 4XYXA 5EFUA 3WCRA 2W5FA 2GP5A 4JVAA 2GMPA 1LGCA 2DCTA 2J7MA 2QQWA 1QWRA 3EB7A 1X8MA 3K2OA 4IEQA 5FZLA 5F3GA 4L9BA 4OHVA 3MBWA 4NRQA 5FZOA 1RUE2 5E1RA 2YGMA 1OPOA 4EQVA 3AM2A 1X9PA 4XDOA 2VOXA 1OBNA 1VAKA 1Y43B 4BDVB 2CGOA 4QPGA 3POEA 2WT1A 1Q43A 1BK1A 4OHZA 1JZ5A 4HKOA 2IZWA 2VCAA 5GZEA 1TNFA 1W8HA 2K2SA 4FTEA 5BNOB 1AHSA 5IUQA 3VBRB 2TUNA 3ENRA 2J1VA 3OEBA 4CDWB 1HB3A 4LXLA 1OQ1A 3TNQA 3NAPC 4LBJA 4OQ9A 3ALQA 3VHOA 1DP0A 1OLQA 3J26N 1M06G 3SISA 2I45A 3AVSA 3NJZA 4XF0A 3CJIB 1NE4A 4YFWA 4QQLA 3O7OA 2RJ2A 5FP3A 2EF6A 4OVEA 2HEVF 3I97A 1H2NA 1AXKA 1AYN3 1YC61 3BN6A 1W2NA 4LHNA 3KHCA 2R1BA 2JB4A 5FR3A 4DZGA 3VKOA 3O1PA 2WIIB 2YXSA 2Q8DA 4AI1A 5FYYA 1AL23 4Z2WA 3VBSC 1S2KA 1UOFA 1ZZ8A 4G3YC 4O61A 4A2UA 1OPMA 3OYWA 2WFF1 3AKSA 2JDPA 3OBAA 4YZ4A 2HBTA 4S2GA 3K4ZA 1YO8A 1AR63 3PVBB 4QKBA 3WDYA 1L7RA 3VZOA 5FYZA 3UGGA 3I4IA 5DABA 5L36A 1W28A 5JR7B 1CN1A 5FZGA 4NPMA 1Z0HA 1GWKA 3DYPA 4TSVA 3RMXA 4I3GA 4IETA 4NHKA 3LOIA 5H9SA 1LR5A 2LS6A 4X6RB 4GB31 1W6PB 3EMRA 5FO7B 4A6SA 1JOJA 4KGGA 3SCFA 4LOSA 5DN2A 2ZX3A 3C7FA 4FOVA 1RYYA 3ZX7A 4FAGA 4ES8A 2RDSA 5L9BA 1GZTA 4WVZA 4XIOA 2X05A 3RI9A 2XPJA 3IBMA 4AI2A 3MIFA 4JAAA 1ZRDA 4AGRA 4AE2A 4IE6A 3T08A 2WFF2 5CVRA 2UURA 3S0MA 4W4ZA 2WAOA 2UYBA 3MLJA 4J6GA 3I3EA 3RPQA 4A3ZA 4JC1A 4PQ9A 3E6CC 2IXCA 3N7JA 3ZYHA 4QX0A 1NA1B 2Y60A 3TB0A 4EE2A 1DZQA 2XB6C 1RUC3 3ZYPA 3USUB 4GB32 4AR2A 2IXIA 4DY5A 5IVBA 1TQ5A 2F17A 4HVRA 4N8MA 2W68A 1EY2A 3NV4A 5IK7A 5J1XA 1CAXB 4XAAA 3TRSB 4AW7A 2AUYA 1OA4A 3AZYA 3ETPA 1CONA 1RMU1 1VIWB 1X7NA 3IN9A 1LRHA 3IPVB 1WMDA 4N53B 4IEZA 4P02B 1GKBA 2JXAA 4K3UA 1W04A 5FWEA 2OUJA 5IVVA 3WNNA 1W39A 3E5QA 1D4M3 3NNLA 2QCSB 4QQOA 2FDJA 1I3HA 1H8TA 1W6NA 2VCMA 1ODNA 4HONA 5FY4A 4NWVA 5CKQA 2VAUA 1UY1A 3VBHC 2VUCA 4LULA 4JGYA 3U4SA 2VBPA 3ABZA 4PCRA 5DZGA 5F3IA 1SLAA 3PTYA 2WO1A 3AKPA 1W2UA 2ZGLA 4PHZA 2AREA 4MGSA 2BVBA 3UGFA 4YG0A 4Q26A 5CU1A 3W20A 3INAA 1U12A 1NYWA 3M8LA 3WQ1A 1RMU2 1XPWA 1ND3C 2J1UA 4M3CB 2Y0OA 3O12A 3LB9A 4M4RA 1B35A 3SQOA 1OD3A 2VY0A 3UYJA 4LA2A 4K20A 5A33B 4YW5A 2W94A 1AR93 1DGLA 1PO12 4CCKA 5C7GA 2WZR3 3C7OA 5IVJA 3P1IA 3POBA 1QJFA 2B9VA 1DZTA 5BNPB 2ZX2A 1O3TA 4LIVA 3FBMA 4CDQC 3A0NA 2E7AA 3BPZA 3GBGA 3LOBA 1S0BA 5DG2A 3N9OA 3LPFA 1KRIA 1RTVA 1SFNA 2VH9A 2RVAA 1VMJA 4FVVA 2YMZA 1A8DA 2IC1A 1H1AA 1U5YA 4HANA 1OLRA 1LU2A 1AL0G 2W39A 4IEUA 4YWAA 1ENXA 5IK8A 1STMA 2LW8A 4ZU5A 2R061 2RS53 4N9IA 1L7LA 1NUKA 2A6VA 2LTNA 3X29B 5F6LB 4UW6A 5HCBA 4TZDA 3PUHA 5I93A 4YZ5A 5FK8A 1VB2A 1YRZA 4Y1UA 3A22A 4D7SA 5JOXA 5L19A 2DYCA 2RHPA 2Y64A 4LKSA 2QKDA 2VTXJ 1RUE3 2VQ0A 3CMGA 2WO2A 4MXVA 3MPPG 3MEPA 4WM8A 3ZOIA 2W3JA 5F1RA 1VJ2A 2CHHA 4EWAA 5FRAA 1QDOA 3BU0A 5F7UA 4RFT0 1O3RA 5LA9A 3MW4A 5FZEA 4AXOA 3VZNA 4XJWA 1MQTC 1MPXA 2CGPA 2W1WA 1XNBA 1M4WA 3I7DA 3FWEA 4IEVA 2WZPP 4X6QB 1DLLA 2TBVA 4YGBA 2OA2A 2EAAA 5ABJA 3TEXA 5FMBA 3SNMA 5H9QA 4AZZA 4Q0VA 5C3PA 2EICA 1DQ4A 1S55A 4P14A 1S1AA 4K8FA 5BNNA 2UWAA 4P9JA 2FBEA 1JXNA 3IM0A 5IT6A 2DFBA 3O5SA 2BDRA 3PVEA 5JVVA 2BGOA 1K12A 2B45X 2DU1A 1D2QA 5IFPA 1FXZA 3POFA 4EWEA 2ZXQA 2VOKA 4BXSV 5FY0A 1S0JA 2WQZC 1UPSA 3EYPA 4C1WA 5A1FA 2CDPA 4XUNA 4ATEA 3V0AB 4YM0A 2XJQA 1REDA 3T4HB 1H30A 4RD7A 1RXFA 2QZ3A 2OZJA 3CNAA 4YZ1A 2A1XA 5G04L 3VD7A 1AX0A 4CA9A 1UYYA 3RZLA 3ZN6B 3WR0A 5A6XA 3GDBA 5DMYA 3IIIA 4IESA 4AFCA 4D94A 2O8QA 3RVHA 4LE3A 1UY2A 4XBLA 1FYUA 2OUHA 2EXKA 4UI9L 4XQWA 4N43C 3UT0A 2DCKA 4P9XA 4NN0A 5ERLA 4CEWA 5GZCA 5GALA 3RJ2X 1OFNA 2EALA 2E63A 2Q0AA 2J1RA 2XJUA 3OGVA 2A71A 1LHVA 4KWUA 2ENRA 1PGW1 2LALA 5IJRA 3ZIWA 5BUVA 5JZGA 2YBKA 1GP5A 1HQNA 3WNLA 4NROA 1OKOA 2WFF3 2GNBA 1WMFA 2V73A 5FQ0B 2WYSA 5F5QA 5A7WA 3MDPA 1CAUB 3VDDC 1A34A 1DBNA 2RJLA 2X8KA 5EHDA 2X53S 3O14A 4CEYB 1ND2A 1YFWA 3WW1A 2ES3A 2JIGA 1JS9A 1Q8PA 2QDNA 2VXJA 3LEMA 3K3NA 2W87A 3FZ3A 4AI8A 4HK8A 1BMV1 1UU4A 4OZOA 1P8JA 3OUHA 3W9AA 1JOBA 3BB6A 2WWJA 4XUQA 1O3QA 2WA4A 5CFDA 3KVBA 1XE0A 3RYKA 4AHWA 4DY3A 2WINB 1PGW2 1V6IA 2WZ8A 1N3OA 2XGXA 4Q8LA 2P6CA 4MX3A 5FZIA 3UJQA 3OY8A 4CUAA 4Q8KA 4WBBA 1H9PA 1TME2 4Q0SA 1UOJA 2OQ7A 4CCCA 1O4YA 3LDKA 1FMD2 4MXWA 4JGZB 1V70A 4AVCA 3PJYA 1IGOA 4XCBA 2CWSA 3JD71 1LJ7A 3E6DA 4GJYA 2A7AA 2L9LA 4D69A 1NCQA 1BMV2 5FKCA 4I30A 4O65A 3T2QA 5IVCA 5FP4A 2VE1A 4S2DA 3ZYFA 5FDBA 3U14A 1LOBA 4WM7C 4P9GA 3T30A 4A7YA 1HKDA 1IOAA 3H8OA 1RMU3 4YVWC 3ZXLA 2C6SA 2DF7A 1DIWA 1CVNA 3AXEA 1LGBA 4D7YA 2ZKLA 3N35A 2C5DA 4LO8A 1PO13 1QJX1 1O59A 2B7YA 5IVYA 4C91A 4NJ4A 5I91A 1PGL1 5ISLA 2RS32 1WLDA 4PBPA 3HQRA 3NKGA 2R6QA 2IVJA 5FMOL 2ZMLA 1GUIA 3CDZB 5BNOC 4LMFA 3JD72 4YW4A 5J37A 1ACCA 1ODMA 5FZMA 5A3UA 4OMDA 3QACA 1LTEA 2UYAA 3B02A 1VP6A 5GLZA 4PLMA 4CDWC 4CP9B 5B2GB 1TMF1 5F9TA 1D4VB 1TG7A 3BU7A 4LO5B 2E32A 4QAWA 3WP6A 4XETA 1XNAA 2WNUC 2HKXA 3WDUA 3V0BB 5FZOB 1LECA 4QM9A 2SLIA 2CAUA 1XXNA 3L2HA 1V9U1 1V6MA 4DUXA 3P5BA 2VMDA 1QJX2 4HT1T 4QPGB 1POQA 1PGL2 4XFCA 3RWKX 4COWA 3VKMA 4EN9B 5BNQA 4HL0A 5CEHA 4JDOA 4K1YA 4DB5A 2PLV1 1CJPA 2UWCA 4IV3B 4P9IA 5JSRA 4H7LA 1MS4A 1LHWA 2IXKA 3OCPA 1OOPA 1TMF2 1FPN1 4IERA 1XU1A 4NHLA 3VHPA 3VL8A 5FZ7A 4OI1A 3HT2A 4GULA 3ZYGA 2CU5A 3WQ0A 5I0SA 2XONA 1V9U2 2P3YA 3KS7A 2VNRA 2B4KA 2OX0A 1JH5A 2HWB2 4ZY9A 4B4QA 4XBNA 4GAZA 3KVAA 5CBLA 2VPVA 1NZIA 2PLV2 5FYHA 5TSWA 4H55A 2PHDA 2WS91 1C8M1 2CDOA 3JCIA 2DU0A 4IGOA 2JICA 2R0FA 4KGQA 2BYVE 3F95A 3OYWB 5K7PA 1FPN2 3OPZA 4KWLA 3VD4A 2YYOA 3J7MA 5A3NA 4PT6A 4ZPIA 2DWRA 1ASJ1 4GMP0 4QMAA 5FO8B 3HNBM 3S57A 3R4SA 3RDIA 3ACHA 4RQPA 3BTXA 1DQ2A 4XILA 2BJSA 5HBAA 2VMIA 5FKBA 4XC9A 1H2KA 2DURA 3SCGA 2J1TA 4HSLA 1VLNA 4Y22A 3VB9A 4W8JA 3QOPA 2PMWB 3I59A 3ZFGA 4Q1PA 5FY5A 2WS92 4RGKA 4AI0A 3S5AA 3KZ4C 1DF0A 4KG8A 1HV0A 5FJHA 3JB4C 3THPA 3MIBA 3LFMA 5C3OA 4DRVA 2GU9A 1ASJ2 1GNHA 1ZX5A 1NX9A 2BUKA 2XR4A 3HNMA 4RS5A 1LCLA 4AAPA 3O1TA 3B7MA 4LBMA 2BBVA 1OA3A 1K5JA 2CNAA 1DQ0A 4E27A 4OI0A 2NMOA 3KF3A 1GWLA 2R0HA 5BY5A 2KD7A 2WSUA 3H9AA 5CZKA 1C4RA 5F5IA 1VBC1 2ZGRA 1RUH1 1O6UA 2AYHA 3CJXA 1K45A 5D8AC 3BALA 5EV7A 2LM3A 5I8YA 3PVOA 5GLVA 5KC6A 2XJVA 3J7HA 3ZSLA 3ST7A 3U37A 5LA0A 1OHFA 1OUXA 1IS4A 4LT5A 2VTFA 2A6YA 4NIHA 1H8TB 1W6NB 2VO5A 1PM4A 3JB8A 4MGIE 2PAMA 4C0HA 4YGCA 4KU8A 2CSGA 1ZRRA 2LRPA 2ZGKA 5LK7B 3RMYA 4JGYB 4XVHA 2QQMA 1UIJA 1TME3 1W9WA 2AH2A 1FI2A 2HEWF 4A3XA 2YFUA 1W2TA 1VBC2 4URTA 1FMD3 3O0WA 1RUH2 5CKMA 4A7KA 4AFBA 4Y3OA 3LGRA 4YW7A 1VE0A 1PM7A 2EIBA 3RZHA 1AR71 1B35B 1MS3A 1E5SA 1YUDA 3JZVA 1WLTA 3H1WA 3ASIA 3WW2A 2E7QA 4FXGB 3M3EA 4XJ8A 5FYTA 2Y6FA 2ZX1A 3ZKYA 5C9AA 2DCYA 1OF4A 1KEXA 2JX9A 3IIAA 2HWB3 2QUOA 1F31A 1V6LA 2E33A 2PHWA 2P34A 4YLZA 4EN6B 1AYN1 2R30A 4DUWA 4CXXA 2WNVC 2JECA 3ZR5A 4IE4A 2ET1A 1WGPA 3HBZA 5FZBA 2MNGA 3D6EA 2IWGB 2RS33 1YQ6A 2DBIA 4JQRA 2Y34A 1AR72 1W6MA 3B01A 3JD73 2JG8A 4IW3A 4LKEA 1XU2A 2DVBA 1UW8A 1Q8OA 1J84A 1JU4A 3VD9A 4EJRA 3FX3A 4IEYA 1MS1A 3WINE 5FYUA 4LLOA 5CFCA 1ZZ6A 1I1EA 2CY6A 2YUEA 1IG0A 3LDBA 3N9LA 1GFF2 4WM8B 3V56A 3V65A 1AJOA 4EV0A 5IHRA 3OF1A 3MIHA 2YBSA 4D6RA 3TEYA 1AVBA 2Y6KA 5EXOA 2BQPA 4GQ7A 1ZRIA 1UZZA 2WABA 4OLLA 4AEJA 5FYCA 2ZHMA 1YQ8A 4LOTA 2ZJCA 3AXDA 2CL2A 1W6OB 1UOBA 5ABJB 2OT7A 1JYIA 1TMF3 1WLCA 4KWKA 5KHHA 4Q0UA 4P08A 1ZA4A 3AYCA 4XXPA 3HD8B 1GBGA 1N1SA 4QKFA 4ARXA 1RJ7A 4FPCA 3WUDA 1RUC1 5L7OA 3VBUA 1AX1A 3D4KA 3DKWA 5IK5A 4TXWA 1V6JA 4WZCA 4XZUG 1PK6A 1EPWA 1V9U3 3WSOA 3BYWA 4FFIA 3GCXA 4ASMB 2ORXA 1YWKA 1WW7A
chains in the Genus database with same CATH topology
3UKVA 1Q8QA 3VBFC 4FQZA 3AKQA 2DCZA 3OD0A 2PLV3 4CYDA 2I07B 4C90A 1FV2A 3JQWA 5JLVA 1S0CA 2ZZJA 1POV0 3AKRA 3E5UA 4FOWA 4R9AA 4Q4X2 4BPZA 4AEKA 4WV8A 3DL3A 3JBG1 1JUIA 1CESA 1FAYA 1S0EA 4LEJA 2CWMA 4COYA 1OI6A 4P9WA 4AVVA 1WBLA 4RR3A 4CEWB 1S0IA 3ELNA 5LRRA 4YZ3A 4XPVA 4BE3A 4KH9A 4LO4B 3AMNA 4MH0E 1QNYA 3KLSA 3EXUA 3FLPA 2OZ6A 1UU6A 4JGZC 1SEFA 1ASJ3 1ZZCA 3JBG2 1LEDA 2VUJA 4R4ZA 5EYYA 1HW5A 1CPNA 1ND2B 4AQSA 1XE8A 1G9BA 4FQ4A 2EXIA 2PAKA 4JDNA 4FPKA 1APNA 1K5MC 4ISQA 1RINA 4SBVA 5EZWA 1IS3A 1G7YA 5CFDB 2GC3A 3FMGA 5T3NA 3IKWA 4PDWB 2RS51 3OY8B 5GM0A 1LODA 2OIIA 1GZCA 2FZ1A 4YGEA 5J3UA 2PN5A 1E57A 3KD4A 5EJ3A 1Z7S1 4LBOA 2EXJA 1ZNPA 1JBCA 1NCQB 4XHBA 3AKTA 2D5HA 4W6WA 1ZM1A 1UF2C 2R32A 4I09A 1DYPA 1VBC3 4G9SB 2QZ2A 1RUH3 3H3UA 5JIAA 5K0UA 1TE1B 4OHXA 3DN7A 2VUAA 4QPGC 1SCRA 2X29A 1DFQA 1Z7S2 4OI2A 4F8AA 4IV3C 4YRDA 4Z92B 1N1YA 4HN1A 2TNFA 3SITA 2GC1A 3AFKA 4GH4A 1R1ZA 3B5LB 5AC92 2ETEA 3VBOA 1N1TA 2WC2A 2XL9A 5JDBA 1GZWA 1AR73 4ZU4A 2GN3A 4I01A 2RS11 3LAGA 5C4WA 1JW6A 1PMIA 3P3PA 4I2OA 2D3PA 3PNAA 2A3XA 4AVSA 5FAXA 1J58A 4DOUA 4DMIA 1OOPB 5FO9B 1RUI3 1KXGA 3ZFFC 4JRLA 2VOWA 2D3SA 2YY1A 1U0AA 2C1FA 3LA2A 4HPKA 2NYYA 3SH5A 4XXAA 4M0NA 2RS12 1UX6A 2ZTNA 5J98B 1U5IA 3NL1A 4ITCA 4Q1RA 3ZPYA 3N4MA 3HWJA 3GBWA 1AR83 4BQ1A 3LSEA 2NPIA 3D0SA 3S7EA 4Y1VA 1U5ZA 3HIFA 3TOJA 4CP1A 4UXAA 2HWC1 4ZXKA 4RL7A 3IWZA 4QX5A 4B3NA 2XLAA 2B39A 4HKWA 1G9FA 1DG6A 1GV9A 5C8CC 2CYFA 4QXKA 4RQPB 1HQLA 2BW8A 1LOCA 2ERFA 2VVEA 2QQPA 1YHFA 2HYKA 3VBSA 1VBB1 4LLFA 4Y22B 4Q4X3 3I59B 3ZFGB 3KT1A 2HWC2 1ENRA 1H9WA 3NO8A 3VN4A 4ZKTB 1H4GA 2P3IA 4RS5B 1H8TC 1REEA 3WX5A 1NCRA 4XZPA 5JOZA 1X33A 3POSA 2A70A 3AMQA 1R082 4GXLA 4XJZA 1PO11 3LA7A 1J59A 3PLQA 2Y26A 4AQTA 1VBB2 4LBNA 1GICA 2GNMA 4TWTA 3AP5A 3MIGA 3JBG3 2ZAAA 1AF9A 3OD4A 2YPJA 3ZMNA 1MS0A 4LBQD 3AP6A 2PQQA 4IEXA 4WZFA 5KXEA 3H1YA 3ZO0B 3R0RA 3G7DA 4BMBA 1QQP3 2XVKA 2D44A 3B69A 2A6WA 1QF3A 1DGWA 1NE6A 4OUSA 4N7IA 5A3MA 1MZ6A 5HXVA 1F2NA 5LEKA 5KWRA 3LZZA 3WW3A 1WLWA 3R05A 2PHTA 3BOWA 5K9YA 3VLBB 3OTFA 1YYNA 3I2DA 1GSLA 3AMMA 1KD7A 1UN1A 1D0HA 1A6CA 2O0OA 5C6CA 4WVWA 5C9AB 3WOGA 3VBHA 4P9YA 5FCCA 3WD5A 3DF0A 3GZUC 2P2KA 4ATFA 4E2GA 2ZGUA 3VKFC 3PVNA 2D3RA 3E5XA 5HCFA 1IHMA 1ND3A 4KQ7A 1Z7S3 1OMIA 4GKYA 3KB5A 4QU2A 5H9RA 2X5IA 4XJUA 1Y7BA 1MS8A 3ZFEC 1J3PA 3NW4A 4CDQA 1VB4A 1HX6A 1ZRFA 1CJDA 5AC93 5CFCB 1CD3G 2DUOA 3CEWA 2PELA 3P3NA 4AEDA 3GBFA 4GMP3 4QPIB 1KS4A 4I0BA 3M3OA 2ZMKA 4OHWA 3PJQA 4MUVA 1AYM1 4Y4YA 1PHMA 2Z69A 2W08A 1X8EA 2R1DA 4DQAA 5DDJ1 4FPFA 4YG6A 1IPJA 5F6KA 2VU9A 1YIPA 2R071 3AJYA 1RITA 3WW4A 1X82A 1RUJ3 1G86A 4XF4A 1DU3D 3AZVA 4XMIA 3ILNA 3SH4A 2DV9A 3VBUB 1L3JA 3KGLA 1N3PA 4OFGA 3TYJA 1C28A 3ECQA 4AG4A 1PK6B 4AHYA 4CEWC 2RS13 4F7ZA 4YVSB 1MQTA 2YGLA 1AYM2 1O5LA 1XYNA 1QXPA 4LTAA 3ILRA 1PGSA 4FXKB 5FFOC 3T2TA 4E4SA 2D97A 4FT8A 1NXD1 1WCDJ 2JG9C 4FPLA 3VKLA 5JSPA 5DDJ2 3VKNA 4CDUC 4Y20B 3IDBB 4W6XA 1SLCA 2R072 4FTBA 4B8EA 5JOWA 3EHKA 2ZACA 1QH7A 3FJSA 2AENA 4XHXA 2FZ2A 1GANA 3DPRA 4DNYA 4R52A 4CDXC 4Q2FA 4QQHA 3WHUA 1XNDA 1G9DA 1TME1 2RJKA 2BTVC 2VGDA 1O3SA 4RR3B 4XJ9A 1G9AA 1FMD1 3M3CA 2BPA2 4XIKA 4CP2A 4YARA 5T54A 4PDWC 1FATA 3VGIA 5LRSA 2HWC3 1WW4A 2WFPA 4E2SA 4Y5Z0 3J8F2 3H7JA 1WCSA 4NWWA 1S0GA 4XEZA 3KMHA 4FOYA 4U2AA 5JCTA 3GYDA 1PZ8A 3TBDA 4TLFA 1R083 2FQPA 2RS31 2Q4SA 1LOFA 1VBB3 1XYOA 2PHFA 3V64A 1KITA 1Y9QA 3M1HA 1AX2A 5J96B 4AVAA 5KXBA 3LCPA 1WBFA 1S0DA 1GNZA 5FPZA 5BV6A 3VDDA 3AZZA 1PVC1 2E53A 3HT1A 5A32B 2VECA 2KA3A 5KHJA 2ZGPA 2VOVA 4K21A 2YROA 1QJY1 1VBA1 3AP9A 5I8TA 4AEMA 1DHKB 1QXJA 2XWJB 1AXYA 3VBRC 1XYPA 2JKBA 2RMU1 5K0UB 1KS5A 4XFBA 2VW2A 1PVC2 4B4RA 4HVQA 3AFGA 1SLIA 1DGRA 4L8QA 2GDFA 4K6BA 3LSDA 3FLRA 2D6MA 2ZGQA 3KSCA 2IFRA 3CJIC 4DS0A 4MVTA 1QJY2 4RHV1 1SBFA 1LKNA 1QGLA 3QH7A 1VBA2 3ZXGA 4WM7A 1OOPC 4SLIA 4I02A 3ROUA 2VVDA 2HWB1 4GWNA 2Y0IA 4A7ZA 4GH4B 4YVWA 4ISRA 1ZZ7A 3FUQA 1NQDA 3VBOB 1DDLA 1GZWB 1OFSA 1RUD3 3DUIA 1EV11 4DRRA 2H6CA 2RMU2 1DGRN 2ZS6B 4LO6B 4S2HA 1ZZBA 1ULGA 3WP5A 5C4WB 1QMJA 4H14A 3POWA 2BEOA 2ILMA 1Q5OA 1LULA 2O8OA 5EYXA 1POV3 4RHV2 4XFGA 3ACLA 5AVAA 5E16A 2GAUA 2WNUA 2ZKNA 3VZLA 4XF1A 3GHNA 1DYKA 3M4FA 4EROA 4FCAA 4E4DX 3CL1A 2XJRA 3OGGA 1EV12 4HPKB 2E51A 4LNVA 1QNWA 4LO7A 3WXPA 3B3QE 2FMYA 4QT6A 1FOD1 5T5OA 2A3WA 2A73B 1NA1C 3AB0A 1LEMA 4XTPA 1REFA 1G9CA 3GNEA 1YFUA 2GN7A 1G6NA 1GR3A 2PHRA 4LUKA 5T5LA 3WUCA 4C1XA 4COVA 1I6XA 3FBYA 3H50A 5C33A 1AYM3 2OYZA 4PIYA 3M2MA 1SLBA 3B93A 3EQEA 4N53C 1JTZX 1U5XA 1R1A1 5DDJ3 1J1LA 5FTTC 2WL1A 1MEC2 3WY6A 2ZHKA 3S6PA 2R073 1FOD2 5I8SA 2DVFA 2A5ZA 1IKQA 1LENA 2BFUL 3E6BA 3APBA 2DVGA 1FX5A 1UAIA 1V00A 2A6XA 1LGNA 1LOGA 2VMHA 3DGTA 5JI9A 1YCIA 5HCAA 4UW4A 2MEV1 1NCRB 1G8WA 4FBFA 4Y1YA 1R1A2 1DQ1A 2IXLA 5BNPC 1C3HA 4M0HA 3J8F3 4PLNA 2XUMA 4K1ZA 2VVFA 3AK0A 2VW0A 3VZJA 2P37A 3MIEA 2BGCA 1ENSA 1OQEA 2MEV2 5FPXA 1F9KA 3BOPA 4L97A 3JU9A 3WG1A 1NG0A 5AFEA 1N47A 4E9KA 4PIZA 1ZZ9A 5D8AA 1QOSA 4BIOA 5BPXA 5A33A 2GALA 1VR3A 4KG0A 1XNKA 4LBKA 1RUI1 1WD4A 4Q27A 1RJ8A 1R092 2KM2A 1O4ZA 1A8MA 2ZABA 3VBHB 5FREA 2HEYF 4UW3A 2HWE1 3ZIXA 4AFDA 4QPIC 1DQ6A 4ES9A 2QNKA 1WCKA 3H8UA 1PVC3 1ND3B 4IV1A 2BWAA 4FO9A 4YGDA 1AR81 1NY71 3I54A 1C57A 4YM1A 1QJY3 2X5IB 4GALA 1V6KA 4CZSA 3RRDA 1PVXA 1VBA3 1RUI2 4CDQB 4DXZA 2V09A 1UD1A 1SMVA 4YFZA 3USSA 2WNVA 1URXA 2HWE2 4AEDB 2RMU3 3SCFA 2VULA 3ME2A 3IMNA 1PK6C 1NLSA 5J36A 3KM5A 4YVSC 1I5ZA 4Q4X1 3TAYA 5HI0A 1KFXL 3KT4A 3WDVA 5BNNB 5CA6A 1QKQA 2HWD1 3MW2A 1C1LA 1AR82 1NY72 1PO22 1UCXA 1O5UA 4IXLA 5FOJB 4RHV3 4E4ZA 2PHUA 2HWF1 2E7TA 3MGUA 3UKTA 1BXHA 1SFYA 3B94A 2ZA9A 2VG9A 4Y1ZA 2QJVA 4XF3A 4Y24A 2RM22 1EV13 2R041 2TEPA 2I2SA 1UKRA 4RR3C 4O9GA 1AJKA 1MQTB 1ENQA 4XOGA 4CEYC 4CTEA 2HWD2 1LOAA 4TYSA 1FNYA 5DZFA 3KGZA 3UL2A 4Z1VA 4YNIA 2XVGA 1YFYA 2B8MA 3KT7A 3QH6A 4EN8B 2HWF2 3HAGA 2YDEA 1S0FA 3DPRB 1QQP1 4MGKE 5JZGB 2R042 1PIV2 3VV1A 2Z79A 2H0BA 3HN1A 3M70A 4QHBA 2DTYA 1MEC3 1W0OA 5SV5A 3VBFA 5JMCA 4KWJA 1N3QA 4NO4A 1FOD3 2W0XA 3O0XA 3AYDA 1YLLA 2OPKA 4YW1A 2D93A 5T5PA 3POYA 4L11A 4NVPA 4AQ2A 3RG0A 3AZWA 4OUMA 3L9JT 5DXDA 2IXHA 1UMZA 2ZX4A 4EWDA 4ZU7A 1QQP2 5JPNB 1RIRA 4BHPA 3CU7A 4DPNA 1R1A3 3NV1A 3FLTA 4J1XA 3TNPB 5KXCA 2EXHA 1XRUA 4MXWB 1QHDA 1IZ3A 1MZFA 4XFHA 3NV3A 3URFA 4S2FA 5GZDA 4KBBA 1DGWX 5K0UC 1RUF1 1XNCA 4JGZA 1BKZA 1F5FA 1SACA 5EWSA 3VDDB 4QD2A 4XFIA 5KC5A 1QOTA 1IQAA 5K8SA 5AC91 4N7UA 3A4UA 4N90A 4Q4V2 1H2LA 2MEV3 4GMP1 3VZMA 1K5MA 1BQPA 1M06G 1CQ9A 1ZYBA 1LESA 1KJLA 4I3PA 1HLCA 4R9CA 1AXZA 3UK9A 3ES4A 4JTOA 3RYRA 1AUYA 2RR11 3PHMA 2D7FA 4RGGA 4BM8A 3VBOC 1RHI1 3RNSA 3VHNA 1MZ5A 1X36A 4AF9A 1HV1A 1RUF2 3U4XA 2D5FA 3HMYA 5FBZA 2XL7A 1RUJ1 4XF9A 1ULFA 4KL1A 4YYOA 4FPOB 1R093 4AVTA 3WNXA 5JOYA 3ZXFA 4HN0A 3AMHA 4JRAA 4F83A 2VW1A 4WM7B 3V0BA 5ACA2 2RR12 5CAZA 4X8PA 4YVWB 1RHI2 1V6OA 2XJSA 2CTVA 3CF6E 1YXWA 1PNFA 1Q3EA 2NQYA 4G4FA 4R9DA 3U10A 3MW3A 1CAVA 1QH6A 1F5JA 4J1WA 4BLJA 1DQ5A 2QFEA 1RUJ2 1CR7A 2Q8OA 4IV3A 4UBHA 2ZGOA 4IEWA 2HWE3 2ZHNA 4DINB 2WNUB 1O91A 5I0TA 2BWCA 4HK9A 3M3QA 1YFXA 4BCUA 1NZCA 2UY9A 1PO23 3NAPA 3C3VA 3ZXEA 3ILFA 3EJKA 1KQRA 2B9UA 2OW4A 4AFMA 1SLTA 1KDMA 1IPKA 2F4PA 1IS6A 1COV1 4Q0PA 4LBQA 2JD4A 1ZVFA 1C5HA 2Z5WA 4UBGA 4AGGA 2RM23 2PTMA 2W52A 1R081 4MGZE 5T52A 3ZFFA 2XKOA 5KHIA 2I74A 4B7KA 2CV6A 1JYCA 4XW3A 2ARXA 2HWD3 4WVMA 2VNGA 1H4HA 1NCRC 1RL3A 2WLQA 4Y1XA 3W58A 4CP0A 5GKAC 5FOBB 1A3KA 3ZXAC 5A3LA 2HWF3 4RA0A 1YIFA 1COV2 1QY4A 3H0OA 4W6YA 3SH3A 1VAMA 4KNCA 2XHKA 3GF6A 3WVJA 2R043 3MF6A 4JGYC 3VL9A 5JPMB 1PIV3 1NLRA 1RGSA 2WJSA 3FUOA 3GZAA 4OHYA 5C8CA 3MPBA 4X8NA 2QE3A 1SBEA 5T55A 3WCSA 1ULDA 1MACA 2GC2A 4FPHA 1QJZA 1IS5A 2NM1A 1B35C 1C1FA 1RC6A 1YJLA 3R4DB 2G9FA 4N9HA 2GSYA 2AGSA 2DFCA 4IEOA 1T6GC 1PZ7A 3T1LA 4D3WA 2B46X 3J4UH 1HRV1 2JEMA 3RI8A 1Q8VA 4JDMA 3ZYIB 1SDWA 2WSVA 4LR4A 4LUMA 4FAHA 2XLFA 3Q9OA 4HSJA 2Q5TA 4P5HA 3M7AA 1RUD1 3H7YA 1FNZA 4AQ6A 1J3RA 4INDA 2VMGA 4FOQA 1HRI3 4BOWA 4MZUA 5BYNA 3EBRA 3N7KA 5D8AB 5KBFA 2IXJA 4JTNA 2VNOA 1MVQA 4BYYA 1B09A 2A3YA 4YM3A 2IFWA 1POV1 5I0RA 1ZREA 1HRV2 4Q4V3 2DTWA 2EA7A 4WM8C 2X5IC 2F6BA 4EN7B 3MLLA 2E6VA 1BCXA 3W59A 3NSTA 3B00A 5J09A 1XQNA 3ZMOA 4Q4W1 3GHMA 5CG8A 1RUD2 4MLOA 3N7LA 1W6MB 2JE7A 2JG8B 4AEDC 4PIXA 5LK5A 3RYPA 1RUF3 5ABJC 1H8VA 4BLIA 4W65A 1BVP1 1BZWA 1WMEA 4IV1B 2JENA 4EN0A 5BNNC 1JN2P 2XKPA 4BH9A 2KXLA 2YHJA 2ZCWA 4F3JA 2RE9A 4H7MA 1LHUA 2YC0A 3OBRA 4PBOA 4Q29A 2BVVA 4K40A 3QCWA 5I0UA 3U07A 2QVSB 3GZTB 4B4PA 2RR13 4Q4W2 5ACA3 2D98A 4HFSA 1RHI3 2WNVB 2K9ZA 1LOEA 2YZ4A 1WW5A 5CIRA 2ET7A 4AVBA 2ZGNA 3MICA 1W6OA 3CLPA 5GLWA 2R062 4NR1A 5KXDA 1UL9A 5L7OB 4HKLA 4Q4Y1 3ZFEA 2GMMA 2VXRA 3DV8A 1S2BA 1PZ9A 3AJZA 4I0AA 4IQPA 2NMNA 3U11A 4YZ2A 3HQXA 3DPRC 4R9BA 2H6BA 2P17A 3FE5A 3WT3A 5GZGA 3B9IA 5JZGC 1ONAA 3C2UA 3UV9A 2V5YA 2XJTA 2WT2A 3J8F1 3THTA 4E2QA 4XE9A 3JQXA 1W6QA 1W0PA 1ND2C 1NXMA 1GQHA 4L92A 4Q0QA 4Q4Y2 4OULA 1GYKA 1OKQA 1UIKA 2R49A 1OA2A 4U36A 2Z42A 3BODA 5CFDC 3WDWA 2FHRA 3NV2A 5BXXA 2ZGMA 4HVOA 4I0WB 1SQ4A 3VBFB 4R8HA 3ZSMA 4WVVA 1LOFC 2JG9A 1COV3 1H1IA 4N43A 4Z82A 4CDUA 1CGPA 3KCXA 1NCQC 3RZZA 5JAXA 2JDZA 3R4UA 4PJYA 5DUUA 4QQPA 4CDXA 2EVXA 3TN91 3ETQA 4FP2A 2MPFA 1WUVA 4GB33 1MZEA 1OD5A 5C8WA 1VBE1 2ARBA 5GLTA 1C5IA 3T1MA 1CAWA 2ZOEB 3VZKA 2DVAA 4GWMA 4XFAA 2NZ9A 4PDWA 5E8AA 2D6PA 5FLHA 4NPRA 5GZFA 2PA7A 1VBD1 3AX4A 1EPZA 4KU7A 1RUG1 5CG9A 2BNNA 3E97A 4ORFA 4XMAA 3ZXKA 4YSFA 2C9AA 4QGMA 4QQ2A 5CNAA 5FLJA 3TN92 1HQWA 3N7MA 2A6ZA 2CAVA 1HDKA 2B5HA 2YV8A 1BBT1 2D43A 2E9QA 4Y26A 1FT9A 1K5MB 4FPJA 3LA3A 1VBE2 3IDCB 1CX4A 3MYXA 2K0GA 4RSUA 1LHNA 2O1QA 1WW6A 1EAH1 4NOTA 2HJIA 2ATFA 3WV6A 1VBD2 4L2NA 4AI3A 1HRV3 1RUG2 5GLUA 4M3CF 3D82A 3PMSA 3ZDSA 2BNMA 1KFUL 2GH2A 1O4TA 3LKJA 2SBAA 3WP4A 3H3ZA 1BBT2 1CPMA 3L2YA 4ONUA 4OZXA 4FPEA 1ZBE1 2UY8A 4MYEA 5BNOA 4UW5A 1EAH2 2UWBA 3ES1A 3VBRA 2ZHLA 2G9GA 4CDWA 2B42B 1BVVA 2D6LX 2Q1ZB 3RSJA 3WP3A 3MI8A 1HXS1 4LE4A 5AFBA 1BYHA 1CAVB 4YM2A 3QBQA 3CJIA 1YI9A 2GMEA 2ZPXA 1EP0A 1GZ9A 3MIDA 1ZBA1 4Q4W3 3H1MA 3VHRA 4RQPC 2XBO1 1ZBE2 5E89A 1MEC1 4MSVA 1XE7A 2DCJA 4BA6A 4CRQA 3D8CA 3WG2A 1UPIA 2D6OX 3ZVXA 3ZFGC 2R063 2VQAA 3B9CA