1NZ6A

Crystal structure of auxilin j-domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function analysis of the auxilin J-domain reveals an extended Hsc70 interaction interface.
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein binding
molecule keywords Auxilin
total genus 29
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2003-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1nz6A00
2QWPB 2M6YA 4J7ZA 2DN9A 1BQ0A 4J80A 2YUAA 4IT5A 1IURA 1NZ6A 2PF4E 2Y4TA 2OCHA 1N4CA 2QWQB 3BVOA 3APOA 2CUGA 2EJ7A 1HDJA 2KQXA 2N04A 2LGWA 2CTRA 2QSAA 2CTQA 1WJZA 2CTPA 2N05A 1BQZA 3APQA 2GUZA 3UO2A 3UCSC 2QWRB 2QWNB 3UO3A 2CTWA 2GUZB 2DMXA 2YS8A 1FPOA 2LO1A 1FAFA 3AG7A 1GH6A 1XBLA 4RWUA 2L6LA 2Y4UA 2QWOB
chains in the Genus database with same CATH superfamily
2ZE7A 4ZHQA 2N74A 5CB4A 1YSCA 4JI1B 4B3TO 1SERA 4NKGB 1OZ0A 1M93A 4RO2A 3OTOO 1JVMA 3B8NA 3SR2C 2UUAB 3ZJZA 3A8TA 1NVPD 4G27B 3CHXA 4F6EA 1I94O 4FMTA 2E76B 5B5EZ 1LNQA 3LNMB 4WFHA 4DUYO 3RYCB 4NTYA 3IC7A 5HFLA 3A0RA 5KAFZ 3SDLA 1KP2A 3UO2A 1QQCA 4I4TA 1KMIZ 4UCSA 2CTWA 2M7WA 3OR6C 1XI1A 2EX3A 1B3QA 1CP9A 3FB6C 1WNSA 3JAWB 4K0KO 4LCUC 3QO7A 1SESA 3JAKA 2UUCO 3G71V 5KHIA 3JAKB 1KKCA 5L3EA 3OTFA 1L0LH 2ADQB 2CUGA 4OX9B 5JH7A 2JGDB 3ZMSA 3CRQA 1XOUA 4CH4A 3AK3A 4J7ZA 1VIBA 2F66C 2Q67A 3UT5B 1AR5A 4DV3B 4O4LB 1NKDA 3K79A 1G8MA 2ATKC 1P49A 2KKWA 5CA1A 4JI1O 4DV7O 2LFSA 1HNWB 4CBCA 2LP7A 4DR1O 1B6QA 2ZM6B 4MW8A 3W7TA 4UV9A 3FFQA 3C90A 1XREA 4JI4O 3K0DA 4MVOA 3TK1A 3CE2A 4R7CA 5KX5A 1N32B 2CDYA 3BFRA 4BIOA 2E3CA 4I55A 1IXBA 1VQNV 4DV7B 1JOYA 4YJ3A 2XASA 2XUMA 4D7TA 2Q0AA 1M57C 3QO5A 4AHCA 4WFFA 1XQ8A 1NU1H 1SQFA 1DGSA 1H2NA 5IYZB 4H13B 4UXNA 4I0XB 1E79G 2FB5A 4JI2B 4N21A 4FLWA 3T1YB 3BVOA 1MA1A 4DW1A 5KHGA 2CTQA 2YIDA 1WA8B 2WLIA 1PNKA 3K5OA 2IJKA 3JCZA 4J41A 4K0KB 1PD3A 4W4LA 2OCCC 1EN6A 3GWKC 1W0KG 1URFA 3AK2A 4XDLA 3G80A 2Q7GA 4IT5A 3I55V 1ZWIC 1HNZO 3ZCCA 2P67A 4LF8O 2HG5C 4TQFA 3I5DA 2DYSB 3ETDA 2ZT9B 2C2AA 1GRJA 2B1GA 1H8EG 1FXKA 3F5TA 2X7RB 2ZDIC 1FFTB 4J9YB 4UV8A 1IBMB 1H8HG 3L9DA 3CCVV 3UT5A 4MVZA 1IX9A 2AHZA 4JF3A 4DUZO 4KL1A 1P7GA 3MHHC 5L3CA 5EC1C 1GKFA 1I0HA 5D5QA 4X20B 1M57B 2YC0A 3U0ZA 4YHHB 2QWPB 5FPOA 3AG4C 4UFZA 2EINC 3DGEA 4YY3O 3JATA 3ZIAG 2Q6AA 1S3JA 1NJIW 1S5HC 4DO2A 3LDDA 3HB3B 3CRRA 1OHHG 2DWDC 4JZ2A 3ZRSA 4RQEA 2XAQA 3CD6V 3UM7A 1NQTA 5CMUA 3I56V 5IE9A 3DC6A 5IJ0B 4X89A 1SS3A 4QPKA 5J9PC 4ABMA 1K4CC 1VP7A 4F6RA 2WWWA 2YXHA 5JWPA 2P06A 5BMVB 4O4HA 4J9ZB 1VQ5V 3CX5F 3DXRA 4GX2A 1Q3EA 1GN3A 2R70A 3ASNB 2UU9O 2P7TC 1BQ0A 5FLXN 3EFFK 1FXKC 3ETGA 5H2FZ 3CCMV 1GMGA 3HKEA 2ODMA 4DV0O 1V55B 4FPPA 3B09A 1S0VA 2YIBD 4O4HB 1F23A 5KMGB 1ZL8A 4CC6A 4Q20A 3VQXA 2X0LA 2P5OA 1SC5B 4HNAB 1BZKA 4HZ3A 1M1KW 2L6LA 3W7UA 1L1FA 4Z1MG 1M90W 2F43G 2YIBA 4QIWF 4DV5O 4HBNA 2UUCB 1OCCB 3HKBA 1Q5OA 2DYRC 4IHJA 3IAYA 2YS8A 1Y6XA 2OCCB 4PDMA 4B7KA 3ZHTA 1S76D 2IU0A 2Z5UA 1E1RG 5ITZA 3ZX6A 4EB6B 5IJ9B 2EIMC 4LBEC 1BS3A 3F7VC 4X62B 2F4VO 3OFNG 2Z0AA 1Z5VA 2UXBO 2YEVB 4K35A 4UB6Z 1TGOA 1YVWA 3DTUB 4NTXA 5KHHA 4FFKA 2DE0X 4HAMA 2ZR2A 1QLNA 4LFAO 5CN0A 1SA0A 2NNUA 2GTAA 3KKYA 1PKXA 5C8YB 1RM1B 4NR1A 1YITV 3L71H 4X1IA 4FLTA 1Y74A 1YXBA 4Z1VA 1CEZA 4RAIA 3OGIB 3ZMZA 2WLLA 1I5XA 4MT8A 3TXSA 4IYIA 2XAFA 2IU3A 3JARA 4DR7O 1IBLO 3BAAA 4DR5O 4DV5B 4MW3A 1Q6HA 4TWKA 4UUJC 2BSKA 4ZKIA 4MVQA 3SPJA 1QBZA 3ZEDA 3P30A 1D5NA 2AZ2A 2EIKB 4MTFA 3BY6A 1IBMO 1VQPV 4OPHA 4DYLA 1GM7A 2RJZA 4DR7B 3PJSK 5B3SC 5KHJA 1YI2V 2KSDA 3CCJV 5J2TB 2EIMB 1KD1W 2DJVA 2GBOA 3D8CA 5LMNB 4W4KA 3SJAC 2A0LA 5FNVA 2V4DA 2A06H 3UO3A 5KAIZ 4GUNA 1IBKB 3QO8A 2EINB 5B1AB 5DEDA 5LHHA 4NVPA 1A32A 2WA4A 1P4RA 3OGCC 5CA0B 3FAVB 1JX9A 3RVYA 1PP9H 5EBLC 5LMNO 1QCEA 1R6TA 2RQ6A 3Q4HA 3HR0A 2GTSA 2GUZA 3CCUV 1K5QA 3HKEB 4QGPA 4B08A 3ZHQA 1YHQV 1N34B 1IZ3A 2YEVA 3SYQA 5IJ0A 2UUBB 4X62O 1WAZA 3JSLA 1M9NA 3RFRA 4LNUA 3OR7C 1Q8IA 3STZC 2P6JA 1WP8A 4B3RB 4OGQB 4JI0B 1N33B 2YXYA 4I9WA 4F6RB 3BABA 2BOCC 3N2GB 4LF4O 2JGDA 4UCRA 2XAGA 4QJFB 3BA9A 3AG1C 1N32O 4DR2B 2OTLV 4O2BA 2CK3G 4FJCC 1VARA 3O65A 1RSOB 4AILC 5LMUO 3SYCA 4CH5A 1RM1C 5JH7B 4MSWC 2IJJA 4L87A 2JS5A 3T1YO 4JI2O 3LNNA 3CYOA 1NS1A 5B1BC 2UXDO 2Y0PA 3E8BA 4JI6O 2DN9A 2Q5ZA 4X20A 2ZNIA 3K08A 3OM3B 3CRAA 1CXZB 1VQ6V 4LF6O 5CA0A 2ILMA 3VBBA 4PD4F 4B3MO 3TCUA 4DK0A 2PI4A 2GUZB 4GKJB 5BR8O 1OJHA 3ZN0A 3C3SA 2JEUA 3BCCH 1K9MW 4JI8B 2Y4TA 4MTXA 3AG4B 2N04A 4RQFA 2R9RB 1ZTEA 3WG7C 1Q6UA 3AG2B 3OEEG 2QWNB 3K9SA 1EBOA 1H2MA 2EIJC 5LP6A 2HEPA 5J2TA 2Q9LA 2XOKG 1PNLA 1SQPH 2WPDG 2JRIA 2F23A 3H1KH 3T2MA 4X65B 3MAQA 5BY1A 3AG3B 5DN6G 3FX7A 2E5LO 1FYJA 2ITDC 1JCHA 4PI0A 3ASOC 4PJ0Z 2HKOA 2Q7EA 5LA6A 1HR0B 5BXZA 3CCLV 3JATB 2WAMA 5EIBC 2M6YA 1JPXA 4TV9A 2R9IA 4E2LA 5L3GA 1AVMA 3B2EE 4KHPB 2HJFC 4FFBB 1IBKO 4B3SB 2JK5C 4MVSA 2E75B 4AQYO 5KA6A 2D3OW 4O4JB 5L3BA 4O4LA 4GX1A 1KC8W 3H9VA 2H3OA 3K0GA 4WFAV 4GT1A 1YTFB 4CH6A 3ETQA 2LO1A 4YJ2A 3OAAG 5B3SB 4JASA 1BGYH 5BZBA 4DR3O 1NH2D 1J5EO 1QHTA 1X59A 2HJDA 2ZE8A 2IH1C 4IIJA 4YIPA 2W0XA 1EM1A 4LF7O 1SQXH 4KUMA 3ASNC 4WBNA 4YHHO 3OMIB 3X2QB 3T1HO 4H44B 1AROP 2CH7A 3BRCA 4GKKO 1KUQA 5EYPA 3O9OA 1HP8A 1WB7A 2PGGA 4P9PA 1XMOO 1J5EB 3H1IH 4H0LB 3SJCC 4FZ0A 1ZUQA 1Y4MA 1K7DA 3C3TA 1EZJA 3VQYA 4P30A 4DUYB 3ZMVA 1XNRB 1WLEA 3CSXA 2Y69B 4I55B 1N34O 4DV6O 5F2VO 2W6IG 1UFIA 1OCCC 1ORQC 4ICGA 3E86A 4P2ZA 2V7QG 1VQ8V 1PV0A 3LSSA 5B1NA 4JAVA 5H5NA 5IYDO 1XMQO 3CCEV 4JZGA 5IY5B 2P90A 5JVDB 4KHPO 2IJHA 4J11A 3E2EA 3HKDA 4ZOLB 3ABMC 4LF4B 1AP6A 3CCRV 4LC1A 4TSFG 2VS0A 1J95A 1U97A 2DQ0A 2NLJC 4J10A 5H9CA 5BMVA 3AG2C 2EZOA 2HVJC 3KZIZ 3P3PA 5LOVA 3RGBA 3JASA 5KUKA 4X66B 5L3FA 4MVRA 1ZLZA 3OT7A 2JJ2G 4EB6A 2K9PA 2ZDIA 5IDJA 1DLBA 2QM7A 1I5YA 5LA6B 5J2UA 5CBGA 3EXAA 2WLJA 2WA3A 3ICXA 5JQGB 2ZR3A 5DM6V 4PHZA 2ZE6A 5B1BB 5B1AC 4TOIA 4X1KB 1Y67A 1BMFG 4GKJO 2A3QA 4BIZA 2UXNA 4WCEV 3R65A 3JAWA 4BWAA 4Z2WA 1VF7A 2UXCB 3SJQC 3DSQA 4GZRB 1SQVH 2YIAA 1SKVA 1XDCA 3RWRD 3QVNA 3K59A 1XHXA 4RUFA 1U96A 1S77D 4UCUA 3JCUZ 1NTKH 2IBZH 5DECA 5KMGA 1IXMA 1PPJH 5E79Z 2VWKA 3ABTA 4DV4B 4AI8A 4B3TB 4LF5O 4ZOLA 5CA3A 1SQBH 4LFBB 4IGGA 2XNDG 4HNAA 3CB2A 4PA3A 3EVKA 4WF9V 2EJ7A 3FB8C 1N36O 3D36C 1PL4A 5IYBO 3ZMTA 4MVMA 4DXWA 4J7KA 3RYFA 3LSUA 4I7ZB 1K73W 1K3EA 3W7SA 1SETA 4LP8A 3L72H 3QNEA 2QE7G 1R3KC 2LFRA 4DUZB 2HR3A 3B8MA 1VQOV 3K9AA 3FYIB 4LFBO 1I7FA 3VOUA 4PA6A 2RNBA 2IM9A 4NXNO 2JJ1G 2CTRA 2FKXA 4JI7O 4UB8Z 3ABMB 4NTWA 4BR6A 2ZXWC 3ABLB 4X64O 1S72V 1M56C 1E1QG 2A79B 3ZHSA 1Q90D 2HHHB 4FVMA 1BT8A 1JA8A 4K8ZA 4IIJB 4LWSA 3IC9A 4I0XA 5GTIZ 3NXSA 3JYCA 3NR7A 2ZE5A 3KCXA 1YJNV 3L73H 2Y48A 3QF7A 2JIZG 3K5MA 1MOFA 3K5LA 3CWBH 1Y66A 3G6BA 1AJQA 3W7XA 2HHHO 3QTCA 3OW2U 2E5LB 3Q4HB 1MSWD 5D5PA 1VF5B 3L75H 4PI2A 2QA4V 3CJHB 4DV4O 3VQVA 2HP8A 3S3XA 1L8DA 4LH6A 5K1XA 4QNHB 4DW0A 1SQQH 2Z3YA 1BL8A 1GH6A 2PY5A 4BW5A 3RYIA 1X4TA 1GO3F 1PL0A 4E4EA 2QDOA 1XL4A 1MNGA 3J80N 4DV0B 3D3QA 4KP4A 3BA8A 2WLNA 2FYUH 2JEXA 1IDSA 3SPGA 3CPWU 2WLIB 4CH3A 3ZN1A 1TAEA 4FLUA 2RMKB 5E1AC 3IJ4A 3HKDB 4MTOA 1FXVA 1S5LZ 2IH3C 1T5EA 3JSNA 1OCOB 4L8JA 2LW7A 2PZSA 3FB7C 1EN4A 3ZHUA 1TVKA 2OTJV 1HDJA 4DV3O 5CBFA 1HWYA 2LJ2A 1W59A 4PV1B 3K03A 2BCCH 3APQA 2BSKB 1THZA 4LF9B 5IWAB 5EBWC 3K57A 1YJWV 1EN5A 3AG1B 4X9QA 2Q8VA 2EULA 2KG7A 1G1XB 1ROPA 4OX9O 4TV8B 3OMAB 4TUYA 1YTFD 4C7UA 2YI9A 5KA5A 4GCZA 4MVUA 3JD3A 1MSDA 2WLMA 3JALB 3L70H 4FLXA 2VQEO 2Q69A 4FIPC 3B4SA 2P22C 5CA1B 4QE9A 2ADPA 4TUYB 4F4LA 4U3FH 3H1JH 4JI0O 1N33O 4GX5A 3BPZA 3CC2V 1TUEB 1NBMG 5EZYB 3D36A 2XT9A 3J81N 3AEIA 3U11A 1M5IA 3AG3C 3S3WA 1D2DA 1SA0B 2Y0IA 2QR4A 2ZNJA 2GV9A 2QKSA 1AI4A 3BEHA 2ZXWB 3ABLC 4H33A 3ZRWB 3QG5A 2QKCA 1DK1A 1PNMA 2QM8A 1XNQB 4J80A 2UXDB 4CC5A 1NZ6A 4LF8B 3E89A 2XTAA 3VQWA 5IY5C 1DTOA 4O2AA 3N27A 3J7AU 4MTGA 3TETA 1XL6A 5LP6B 5IJ9A 2V1DA 3PN1A 5JJJB 1XMOB 4U3JA 3UQ8A 2A9HA 4O2BB 4IYHA 1KU9A 4DR2O 3UKMA 4I50A 3RT3C 4DV6B 1Q7YW 2D2CB 5GONA 4LF5B 4I4TB 4WFEA 2N05A 1FS0G 5LXTB 4FK5C 2AGAA 1OCOC 2ARHA 1SZXA 3JASB 3RYCA 2XAJA 4CZZA 4JI7B 3LDCA 2DW4A 1AR4A 1M4UA 2QM4A 4TV8A 5LHGA 1VEWA 1H38A 1HNXB 5EIBD 1K5SA 4X1YA 3SGIA 1ZL8B 5LGTA 4R6ZA 5LXTA 3T1HB 2DQ3A 5FNVB 4YY3B 2QTSA 4FZ1A 4JGSA 1FFXA 3CXHF 2KG7B 4B3MB 4PELA 1HR0O 4LF6B 5HFMA 4U3JB 2EJRA 2QSAA 4IL6Z 5LP6C 2CAZC 1XNQO 2EIJB 2Q68A 4ASUG 1YZBA 4TQDA 4WBNB 4P9OA 1WN7A 1Y76A 4DV2B 1V9PA 1KECA 1OCZB 3E22A 1Z5WA 3RN4A 2HLDG 1JJ2U 4KFMA 5IYZA 4JYAB 1VMGA 2H8PC 2UUAO 4B3SO 1K4DC 4LFCB 1V54B 5C93A 2R72A 2GDSA 4JAUA 1R3LC 1R1BA 4JTDB 2DWEC 2CGOA 2P4VA 2WLKA 4CS4A 2DYSC 4XBFA 4JAAA 2E74B 4XDJA 2DYRB 2QGNA 1TUBB 3SPCA 1NR7A 3RYHB 1XMQB 3CXCU 1QVGU 4X65O 2ZKOA 4N23A 4FM0A 4BAYA 4DV1B 2RN9A 1YEWA 4CS3A 1Q81W 3HKCB 1YDXA 3ABKC 4PDLA 4JI3B 1N8RW 1AILA 1VQ9V 3RYHA 4RWUA 2A7WA 2CE4A 1OCRC 3K06A 4NYKA 4R8CA 4FFBA 2WLHA 3WB1A 3MHSC 5FL7G 3TXQA 1XHZA 1BCCH 1QU7A 2UXXA 2VWJA 5IWAO 2UXBB 1YF2A 2W0FC 1H2GA 2K1EA 4OPAA 2L35A 5LBQA 1ZX3A 1H2KA 1SQGA 4DV1O 3HKBB 3G4SV 1F4MA 2QJ1A 4FM1A 1NR1A 4UVBA 1FFXB 4X88A 3KG2A 3ZHVA 2MK3A 1HNWO 2FMLA 2VQEB 1IURA 1VF6A 4YXWG 2ZIOA 5LGUA 1Q82W 1JQ0A 2G38A 3OE7G 2BTQA 4DR1B 3ABKB 3ETEA 1K33A 2JDIG 3ZS8C 2UUBO 4EEQA 2QKAA 2BTOA 4TT3G 4Q6GA 4X1YB 1YJ9V 1K92A 4U7OA 5IYCO 4BIUA 2GSMB 1IVSA 3A0HZ 3E8HA 1KBHA 1FJGB 3JD4A 3GVMA 1UJWB 1G4YB 3CC7V 2CTPA 1NT2B 1SF9A 2PI5A 4UVAA 1BSMA 1QNMA 1M56B 4PA9A 4X1IB 1GN2A 1QR8A 3FYEB 1QVFU 4LH7A 2BE3A 4B3RO 1AP5A 1CPYA 1O9HA 5LYJB 1N4CA 1RPOA 4O2AB 3WG7B 3SPIA 5B66Z 3SYAA 1LR1A 5ITZB 4FLYA 4LWSB 1MZEA 2EILC 1LUWA 3FKSG 5JQGA 3OD4A 1H2LA 2VRZA 4IHJB 2AHYA 1L0NH 4DR4O 1OV9A 3N2GA 4DV2O 2RCVA 2OT5A 1BE3H 3LUTB 1KKDA 2AW9A 1AJNA 1COWG 5JCOC 1O9GA 3GB7C 2ZCEA 1AI6A 5A2QN 5KLVH 1FXHA 1R3JC 1ZSPA 3P32A 4JV5O 1Z2GA 4K3AA 2F95B 2ZQMA 2B9ZA 3WFVA 1NTMH 1JR9A 4D7SA 2AZ0A 1N36B 1MABG 4GYCB 2VQFO 3RBZA 3JD2A 3ZRXA 5LOVB 2NN4A 4LFAB 2QEXV 1FXKB 4G28B 1K34A 4HYOA 1SZTA 1GN4A 3WB0A 4JYBA 4JTCB 3MD0A 3SYPA 4ZHQB 1KQSU 1VQ7V 3E22B 4DR3B 4B7EA 4NXMO 2BTQB 2YI8A 3G6EV 1VQMV 3JALA 4LR3A 5LHIA 1K8AW 2JS3A 1DF4A 4JI4B 1N0JA 1BQZA 3WU2Z 3BHPA 3DC5A 3CC4V 5EC2C 5FPRA 1HNZB 2EILB 4QE7A 5EK0A 3SPHA 4PA7A 3SYOA 4JPRA 5GTHZ 1AR1B 1NH2B 3F5WC 4UVCA 1EZVH 1RSOA 4OXSA 2ZINA 3JARB 4JI6B 1N0NA 4ZIBA 3APOA 2CH7B 1US6A 5H6RA 1FD9A 4X66O 2IJIA 4FLZA 1H2SB 3RYIB 1LUVA 3OUFA 4WFGA 2DMXA 2X6CA 2F4VB 2W6JG 1P7BA 4NB5A 2QWOB 2HVKC 2Q4PA 3ZBHA 3F7YC 3OMNB 3G67A 5LMUB 4UCVA 4JI8O 2CGNA 2PF4E 4FM2A 3E83A 3T4DA 3WB2A 4I9QA 1QR9A 1G6UA 2ITCC 1UPGA 5CBHA 5EBMC 2OYQA 2OIEA 2ZD9A 4EFBA 1GK9A 1V54C 1ZAUA 2B1IA 3P3NA 4LFCO 3FAVA 1AI5A 2Q73A 4JYAO 1TUBA 1NVPB 2AXTZ 3HPLC 2EZPA 2DOSA 4ZI7B 3W7WA 2ETNA 4I50B 1RPRA 3R66A 2EIKC 3OEHG 4JYYA 1WB8A 1D5AA 3SJBC 1XBLA 4JYCA 1TA8A 1WA8A 2QWRB 3N2KB 2B5UA 2YUAA 5JCOA 4NXNB 3CP1A 1R6KA 1GTOA 3M99B 1I08A 3CCQV 2KB1A 4J7JA 3THOA 1DF5A 5JJNB 4MS2A 1YIJV 2RDCA 3M8AA 1W2BU 5TISZ 1RP3B 4WFBV 1K97A 4GX0A 2Q0OC 3L74H 2WLLB 2LQTA 1AB3A 1R3IC 2MW2B 1ENVA 4CS2A 5CB4B 5KHKA 3JD0A 1F7YA 1OCRB 1AI7A 3T1CA 1JMKC 4O4IB 4H37A 1S5JA 2JGUA 1EFRG 2WSSG 1XILA 3ML0A 1IBLB 1FKAO 2PYJA 4AQYB 3ASOB 3CMEV 4LF9O 3RYFB 2LGQA 4UCOA 1Q6IA 3B40A 3H1LH 1KP3A 2PTMA 3DXRB 3M7MX 1WJZA 3ZHRA 4J42A 2XAHA 1RFYA 1VQLV 3IGAC 3K5NA 2UU9B 4I5SA 1B04A 2P4KA 3RVZA 1NI8A 3ABUA 4DK1A 2F93B 4PDVA 4DRXB 4QPJA 2NR5A 1W0JG 2R9AA 3CRMA 4BW9A 1VF6C 3N2KA 2XHBA 1R6NA 3TJTA 5H6QA 4LF7B 5KUMA 3UCSC 4K8XA 1GN6A 3E8FA 4DR6B 1FJGO 4U7NA 3CEIA 1B06A 5EZYA 3JAMN 3CJHA 1Y74B 3U10A 2KQXA 3ZRWA 2YDEA 4DR5B 3MDSA 1F51A 4DRXA 2BOBC 1FPOA 3E8GA 1VQKV 4EKWA 2H94A 3HKCA 3TGUH 3ZRVA 3K58A 4YJ2B 5K1PA 4O4IA 1QLEB 2PUSA 2LW1A 3FD9A 1QLEC 2LGWA 3CMAV 1I94B 3K3WA 3CCSV 3AK1A 3OUSA 3X2QC 3LDEA 3H1HH 1GM9A 4X64B 3T4ZA 1GM8A 1XUQA 1F4NA 3EHBB 2EBOA 4RUEA 5JVDA 2OCHA 4JI3O 2QWQB 3A2FA 4FLVA 2VQFB 2UXCO 3E35A 3RW0A 4EFEA 4JI5B 4YIOA 2OWOA 1WPBA 1JFFB 1TVKB 1YCIA 1Y76B 2ZIMA 1MMMA 2X6AA 5L3DA 4PA4A 1BHAA 4G2KA 4GLXA 5EYPB 5BR8B 2YXLA 1KYOF 5IT9N 4JI5O 4R50A 2GHYA 4KXRA 3A0BZ 4ZI7A 4DR4B 1MZFA 3GWOA 4ZBMA 3K04A 5C8YA 1FAFA 4X8AA 5LL6Y 3LSQA 5KX5B 2QTOA 4LNUB 1HW7A 4YJ3B 1WPXA 4D6TH 1JJOA 1Q43A 3B77A 1SRYA 5B1OA 2X6BA 5AG2A 3OTOB 1Q86W 2PYLA 3STLC 2F1MA 1WP7A 3IFXA 2FTKA 4XDKA 2Y69C 3KCYA 4GKKB 2JVDA 1OCZC 2OIGA 1VQ4V 1BHBA 4NXMB 5GONB 1NTZH 1GAXA 2O57A 4O4JA 1V55C 5LGNA 3CS5A 4JTAB 1AJPA 2YSUB 3D3IA 5GW7A 4PDRA 1HNXO 4A5UB 5A9GA 4TV9B 1XNRO 3AG7A 1MG1A 1R73A 3CRCA 2Y4UA 4X1KA 2Q7HA 3FB5C 4UCTA 4DR6O 1KB9F 3ZMUA 2HFEC 3H01A 5J2UB 5JJEB 1XEQA 2FL4A 3JD1A 2YICA 4JV5B 1JFFA 1PM9A 5LYJA 2IW5A 2ZM6O 1P84F
chains in the Genus database with same CATH topology
2QWPB 2M6YA 4J7ZA 2DN9A 1BQ0A 4J80A 2YUAA 4IT5A 1IURA 1NZ6A 2PF4E 2Y4TA 2OCHA 1N4CA 2QWQB 3BVOA 3APOA 2CUGA 2EJ7A 1HDJA 2KQXA 2N04A 2LGWA 2CTRA 2QSAA 2CTQA 1WJZA 2CTPA 2N05A 1BQZA 3APQA 2GUZA 3UO2A 3UCSC 2QWRB 2QWNB 3UO3A 2CTWA 2GUZB 2DMXA 2YS8A 1FPOA 2LO1A 1FAFA 3AG7A 1GH6A 1XBLA 4RWUA 2L6LA 2Y4UA 2QWOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWP B;  2M6Y A;  4J7Z A;  2DN9 A;  1BQ0 A;  4J80 A;  2YUA A;  4IT5 A;  1IUR A;  1NZ6 A;  2PF4 E;  2Y4T A;  2OCH A;  1N4C A;  2QWQ B;  3BVO A;  3APO A;  2CUG A;  2EJ7 A;  1HDJ A;  2KQX A;  2N04 A;  2LGW A;  2CTR A;  2QSA A;  2CTQ A;  1WJZ A;  2CTP A;  2N05 A;  1BQZ A;  3APQ A;  2GUZ A;  3UO2 A;  3UCS C;  2QWR B;  2QWN B;  3UO3 A;  2CTW A;  2GUZ B;  2DMX A;  2YS8 A;  1FPO A;  2LO1 A;  1FAF A;  3AG7 A;  1GH6 A;  1XBL A;  4RWU A;  2L6L A;  2Y4U A;  2QWO B; 
#chains in the Genus database with same CATH topology
 2ZE7 A;  4ZHQ A;  2N74 A;  5CB4 A;  1YSC A;  4JI1 B;  4B3T O;  1SER A;  4NKG B;  1OZ0 A;  1M93 A;  4RO2 A;  3OTO O;  1JVM A;  3B8N A;  3SR2 C;  2UUA B;  3ZJZ A;  3A8T A;  1NVP D;  4G27 B;  3CHX A;  4F6E A;  1I94 O;  4FMT A;  2E76 B;  5B5E Z;  1LNQ A;  3LNM B;  4WFH A;  4DUY O;  3RYC B;  4NTY A;  3IC7 A;  5HFL A;  3A0R A;  5KAF Z;  3SDL A;  1KP2 A;  3UO2 A;  1QQC A;  4I4T A;  1KMI Z;  4UCS A;  2CTW A;  2M7W A;  3OR6 C;  1XI1 A;  2EX3 A;  1B3Q A;  1CP9 A;  3FB6 C;  1WNS A;  3JAW B;  4K0K O;  4LCU C;  3QO7 A;  1SES A;  3JAK A;  2UUC O;  3G71 V;  5KHI A;  3JAK B;  1KKC A;  5L3E A;  3OTF A;  1L0L H;  2ADQ B;  2CUG A;  4OX9 B;  5JH7 A;  2JGD B;  3ZMS A;  3CRQ A;  1XOU A;  4CH4 A;  3AK3 A;  4J7Z A;  1VIB A;  2F66 C;  2Q67 A;  3UT5 B;  1AR5 A;  4DV3 B;  4O4L B;  1NKD A;  3K79 A;  1G8M A;  2ATK C;  1P49 A;  2KKW A;  5CA1 A;  4JI1 O;  4DV7 O;  2LFS A;  1HNW B;  4CBC A;  2LP7 A;  4DR1 O;  1B6Q A;  2ZM6 B;  4MW8 A;  3W7T A;  4UV9 A;  3FFQ A;  3C90 A;  1XRE A;  4JI4 O;  3K0D A;  4MVO A;  3TK1 A;  3CE2 A;  4R7C A;  5KX5 A;  1N32 B;  2CDY A;  3BFR A;  4BIO A;  2E3C A;  4I55 A;  1IXB A;  1VQN V;  4DV7 B;  1JOY A;  4YJ3 A;  2XAS A;  2XUM A;  4D7T A;  2Q0A A;  1M57 C;  3QO5 A;  4AHC A;  4WFF A;  1XQ8 A;  1NU1 H;  1SQF A;  1DGS A;  1H2N A;  5IYZ B;  4H13 B;  4UXN A;  4I0X B;  1E79 G;  2FB5 A;  4JI2 B;  4N21 A;  4FLW A;  3T1Y B;  3BVO A;  1MA1 A;  4DW1 A;  5KHG A;  2CTQ A;  2YID A;  1WA8 B;  2WLI A;  1PNK A;  3K5O A;  2IJK A;  3JCZ A;  4J41 A;  4K0K B;  1PD3 A;  4W4L A;  2OCC C;  1EN6 A;  3GWK C;  1W0K G;  1URF A;  3AK2 A;  4XDL A;  3G80 A;  2Q7G A;  4IT5 A;  3I55 V;  1ZWI C;  1HNZ O;  3ZCC A;  2P67 A;  4LF8 O;  2HG5 C;  4TQF A;  3I5D A;  2DYS B;  3ETD A;  2ZT9 B;  2C2A A;  1GRJ A;  2B1G A;  1H8E G;  1FXK A;  3F5T A;  2X7R B;  2ZDI C;  1FFT B;  4J9Y B;  4UV8 A;  1IBM B;  1H8H G;  3L9D A;  3CCV V;  3UT5 A;  4MVZ A;  1IX9 A;  2AHZ A;  4JF3 A;  4DUZ O;  4KL1 A;  1P7G A;  3MHH C;  5L3C A;  5EC1 C;  1GKF A;  1I0H A;  5D5Q A;  4X20 B;  1M57 B;  2YC0 A;  3U0Z A;  4YHH B;  2QWP B;  5FPO A;  3AG4 C;  4UFZ A;  2EIN C;  3DGE A;  4YY3 O;  3JAT A;  3ZIA G;  2Q6A A;  1S3J A;  1NJI W;  1S5H C;  4DO2 A;  3LDD A;  3HB3 B;  3CRR A;  1OHH G;  2DWD C;  4JZ2 A;  3ZRS A;  4RQE A;  2XAQ A;  3CD6 V;  3UM7 A;  1NQT A;  5CMU A;  3I56 V;  5IE9 A;  3DC6 A;  5IJ0 B;  4X89 A;  1SS3 A;  4QPK A;  5J9P C;  4ABM A;  1K4C C;  1VP7 A;  4F6R A;  2WWW A;  2YXH A;  5JWP A;  2P06 A;  5BMV B;  4O4H A;  4J9Z B;  1VQ5 V;  3CX5 F;  3DXR A;  4GX2 A;  1Q3E A;  1GN3 A;  2R70 A;  3ASN B;  2UU9 O;  2P7T C;  1BQ0 A;  5FLX N;  3EFF K;  1FXK C;  3ETG A;  5H2F Z;  3CCM V;  1GMG A;  3HKE A;  2ODM A;  4DV0 O;  1V55 B;  4FPP A;  3B09 A;  1S0V A;  2YIB D;  4O4H B;  1F23 A;  5KMG B;  1ZL8 A;  4CC6 A;  4Q20 A;  3VQX A;  2X0L A;  2P5O A;  1SC5 B;  4HNA B;  1BZK A;  4HZ3 A;  1M1K W;  2L6L A;  3W7U A;  1L1F A;  4Z1M G;  1M90 W;  2F43 G;  2YIB A;  4QIW F;  4DV5 O;  4HBN A;  2UUC B;  1OCC B;  3HKB A;  1Q5O A;  2DYR C;  4IHJ A;  3IAY A;  2YS8 A;  1Y6X A;  2OCC B;  4PDM A;  4B7K A;  3ZHT A;  1S76 D;  2IU0 A;  2Z5U A;  1E1R G;  5ITZ A;  3ZX6 A;  4EB6 B;  5IJ9 B;  2EIM C;  4LBE C;  1BS3 A;  3F7V C;  4X62 B;  2F4V O;  3OFN G;  2Z0A A;  1Z5V A;  2UXB O;  2YEV B;  4K35 A;  4UB6 Z;  1TGO A;  1YVW A;  3DTU B;  4NTX A;  5KHH A;  4FFK A;  2DE0 X;  4HAM A;  2ZR2 A;  1QLN A;  4LFA O;  5CN0 A;  1SA0 A;  2NNU A;  2GTA A;  3KKY A;  1PKX A;  5C8Y B;  1RM1 B;  4NR1 A;  1YIT V;  3L71 H;  4X1I A;  4FLT A;  1Y74 A;  1YXB A;  4Z1V A;  1CEZ A;  4RAI A;  3OGI B;  3ZMZ A;  2WLL A;  1I5X A;  4MT8 A;  3TXS A;  4IYI A;  2XAF A;  2IU3 A;  3JAR A;  4DR7 O;  1IBL O;  3BAA A;  4DR5 O;  4DV5 B;  4MW3 A;  1Q6H A;  4TWK A;  4UUJ C;  2BSK A;  4ZKI A;  4MVQ A;  3SPJ A;  1QBZ A;  3ZED A;  3P30 A;  1D5N A;  2AZ2 A;  2EIK B;  4MTF A;  3BY6 A;  1IBM O;  1VQP V;  4OPH A;  4DYL A;  1GM7 A;  2RJZ A;  4DR7 B;  3PJS K;  5B3S C;  5KHJ A;  1YI2 V;  2KSD A;  3CCJ V;  5J2T B;  2EIM B;  1KD1 W;  2DJV A;  2GBO A;  3D8C A;  5LMN B;  4W4K A;  3SJA C;  2A0L A;  5FNV A;  2V4D A;  2A06 H;  3UO3 A;  5KAI Z;  4GUN A;  1IBK B;  3QO8 A;  2EIN B;  5B1A B;  5DED A;  5LHH A;  4NVP A;  1A32 A;  2WA4 A;  1P4R A;  3OGC C;  5CA0 B;  3FAV B;  1JX9 A;  3RVY A;  1PP9 H;  5EBL C;  5LMN O;  1QCE A;  1R6T A;  2RQ6 A;  3Q4H A;  3HR0 A;  2GTS A;  2GUZ A;  3CCU V;  1K5Q A;  3HKE B;  4QGP A;  4B08 A;  3ZHQ A;  1YHQ V;  1N34 B;  1IZ3 A;  2YEV A;  3SYQ A;  5IJ0 A;  2UUB B;  4X62 O;  1WAZ A;  3JSL A;  1M9N A;  3RFR A;  4LNU A;  3OR7 C;  1Q8I A;  3STZ C;  2P6J A;  1WP8 A;  4B3R B;  4OGQ B;  4JI0 B;  1N33 B;  2YXY A;  4I9W A;  4F6R B;  3BAB A;  2BOC C;  3N2G B;  4LF4 O;  2JGD A;  4UCR A;  2XAG A;  4QJF B;  3BA9 A;  3AG1 C;  1N32 O;  4DR2 B;  2OTL V;  4O2B A;  2CK3 G;  4FJC C;  1VAR A;  3O65 A;  1RSO B;  4AIL C;  5LMU O;  3SYC A;  4CH5 A;  1RM1 C;  5JH7 B;  4MSW C;  2IJJ A;  4L87 A;  2JS5 A;  3T1Y O;  4JI2 O;  3LNN A;  3CYO A;  1NS1 A;  5B1B C;  2UXD O;  2Y0P A;  3E8B A;  4JI6 O;  2DN9 A;  2Q5Z A;  4X20 A;  2ZNI A;  3K08 A;  3OM3 B;  3CRA A;  1CXZ B;  1VQ6 V;  4LF6 O;  5CA0 A;  2ILM A;  3VBB A;  4PD4 F;  4B3M O;  3TCU A;  4DK0 A;  2PI4 A;  2GUZ B;  4GKJ B;  5BR8 O;  1OJH A;  3ZN0 A;  3C3S A;  2JEU A;  3BCC H;  1K9M W;  4JI8 B;  2Y4T A;  4MTX A;  3AG4 B;  2N04 A;  4RQF A;  2R9R B;  1ZTE A;  3WG7 C;  1Q6U A;  3AG2 B;  3OEE G;  2QWN B;  3K9S A;  1EBO A;  1H2M A;  2EIJ C;  5LP6 A;  2HEP A;  5J2T A;  2Q9L A;  2XOK G;  1PNL A;  1SQP H;  2WPD G;  2JRI A;  2F23 A;  3H1K H;  3T2M A;  4X65 B;  3MAQ A;  5BY1 A;  3AG3 B;  5DN6 G;  3FX7 A;  2E5L O;  1FYJ A;  2ITD C;  1JCH A;  4PI0 A;  3ASO C;  4PJ0 Z;  2HKO A;  2Q7E A;  5LA6 A;  1HR0 B;  5BXZ A;  3CCL V;  3JAT B;  2WAM A;  5EIB C;  2M6Y A;  1JPX A;  4TV9 A;  2R9I A;  4E2L A;  5L3G A;  1AVM A;  3B2E E;  4KHP B;  2HJF C;  4FFB B;  1IBK O;  4B3S B;  2JK5 C;  4MVS A;  2E75 B;  4AQY O;  5KA6 A;  2D3O W;  4O4J B;  5L3B A;  4O4L A;  4GX1 A;  1KC8 W;  3H9V A;  2H3O A;  3K0G A;  4WFA V;  4GT1 A;  1YTF B;  4CH6 A;  3ETQ A;  2LO1 A;  4YJ2 A;  3OAA G;  5B3S B;  4JAS A;  1BGY H;  5BZB A;  4DR3 O;  1NH2 D;  1J5E O;  1QHT A;  1X59 A;  2HJD A;  2ZE8 A;  2IH1 C;  4IIJ A;  4YIP A;  2W0X A;  1EM1 A;  4LF7 O;  1SQX H;  4KUM A;  3ASN C;  4WBN A;  4YHH O;  3OMI B;  3X2Q B;  3T1H O;  4H44 B;  1ARO P;  2CH7 A;  3BRC A;  4GKK O;  1KUQ A;  5EYP A;  3O9O A;  1HP8 A;  1WB7 A;  2PGG A;  4P9P A;  1XMO O;  1J5E B;  3H1I H;  4H0L B;  3SJC C;  4FZ0 A;  1ZUQ A;  1Y4M A;  1K7D A;  3C3T A;  1EZJ A;  3VQY A;  4P30 A;  4DUY B;  3ZMV A;  1XNR B;  1WLE A;  3CSX A;  2Y69 B;  4I55 B;  1N34 O;  4DV6 O;  5F2V O;  2W6I G;  1UFI A;  1OCC C;  1ORQ C;  4ICG A;  3E86 A;  4P2Z A;  2V7Q G;  1VQ8 V;  1PV0 A;  3LSS A;  5B1N A;  4JAV A;  5H5N A;  5IYD O;  1XMQ O;  3CCE V;  4JZG A;  5IY5 B;  2P90 A;  5JVD B;  4KHP O;  2IJH A;  4J11 A;  3E2E A;  3HKD A;  4ZOL B;  3ABM C;  4LF4 B;  1AP6 A;  3CCR V;  4LC1 A;  4TSF G;  2VS0 A;  1J95 A;  1U97 A;  2DQ0 A;  2NLJ C;  4J10 A;  5H9C A;  5BMV A;  3AG2 C;  2EZO A;  2HVJ C;  3KZI Z;  3P3P A;  5LOV A;  3RGB A;  3JAS A;  5KUK A;  4X66 B;  5L3F A;  4MVR A;  1ZLZ A;  3OT7 A;  2JJ2 G;  4EB6 A;  2K9P A;  2ZDI A;  5IDJ A;  1DLB A;  2QM7 A;  1I5Y A;  5LA6 B;  5J2U A;  5CBG A;  3EXA A;  2WLJ A;  2WA3 A;  3ICX A;  5JQG B;  2ZR3 A;  5DM6 V;  4PHZ A;  2ZE6 A;  5B1B B;  5B1A C;  4TOI A;  4X1K B;  1Y67 A;  1BMF G;  4GKJ O;  2A3Q A;  4BIZ A;  2UXN A;  4WCE V;  3R65 A;  3JAW A;  4BWA A;  4Z2W A;  1VF7 A;  2UXC B;  3SJQ C;  3DSQ A;  4GZR B;  1SQV H;  2YIA A;  1SKV A;  1XDC A;  3RWR D;  3QVN A;  3K59 A;  1XHX A;  4RUF A;  1U96 A;  1S77 D;  4UCU A;  3JCU Z;  1NTK H;  2IBZ H;  5DEC A;  5KMG A;  1IXM A;  1PPJ H;  5E79 Z;  2VWK A;  3ABT A;  4DV4 B;  4AI8 A;  4B3T B;  4LF5 O;  4ZOL A;  5CA3 A;  1SQB H;  4LFB B;  4IGG A;  2XND G;  4HNA A;  3CB2 A;  4PA3 A;  3EVK A;  4WF9 V;  2EJ7 A;  3FB8 C;  1N36 O;  3D36 C;  1PL4 A;  5IYB O;  3ZMT A;  4MVM A;  4DXW A;  4J7K A;  3RYF A;  3LSU A;  4I7Z B;  1K73 W;  1K3E A;  3W7S A;  1SET A;  4LP8 A;  3L72 H;  3QNE A;  2QE7 G;  1R3K C;  2LFR A;  4DUZ B;  2HR3 A;  3B8M A;  1VQO V;  3K9A A;  3FYI B;  4LFB O;  1I7F A;  3VOU A;  4PA6 A;  2RNB A;  2IM9 A;  4NXN O;  2JJ1 G;  2CTR A;  2FKX A;  4JI7 O;  4UB8 Z;  3ABM B;  4NTW A;  4BR6 A;  2ZXW C;  3ABL B;  4X64 O;  1S72 V;  1M56 C;  1E1Q G;  2A79 B;  3ZHS A;  1Q90 D;  2HHH B;  4FVM A;  1BT8 A;  1JA8 A;  4K8Z A;  4IIJ B;  4LWS A;  3IC9 A;  4I0X A;  5GTI Z;  3NXS A;  3JYC A;  3NR7 A;  2ZE5 A;  3KCX A;  1YJN V;  3L73 H;  2Y48 A;  3QF7 A;  2JIZ G;  3K5M A;  1MOF A;  3K5L A;  3CWB H;  1Y66 A;  3G6B A;  1AJQ A;  3W7X A;  2HHH O;  3QTC A;  3OW2 U;  2E5L B;  3Q4H B;  1MSW D;  5D5P A;  1VF5 B;  3L75 H;  4PI2 A;  2QA4 V;  3CJH B;  4DV4 O;  3VQV A;  2HP8 A;  3S3X A;  1L8D A;  4LH6 A;  5K1X A;  4QNH B;  4DW0 A;  1SQQ H;  2Z3Y A;  1BL8 A;  1GH6 A;  2PY5 A;  4BW5 A;  3RYI A;  1X4T A;  1GO3 F;  1PL0 A;  4E4E A;  2QDO A;  1XL4 A;  1MNG A;  3J80 N;  4DV0 B;  3D3Q A;  4KP4 A;  3BA8 A;  2WLN A;  2FYU H;  2JEX A;  1IDS A;  3SPG A;  3CPW U;  2WLI B;  4CH3 A;  3ZN1 A;  1TAE A;  4FLU A;  2RMK B;  5E1A C;  3IJ4 A;  3HKD B;  4MTO A;  1FXV A;  1S5L Z;  2IH3 C;  1T5E A;  3JSN A;  1OCO B;  4L8J A;  2LW7 A;  2PZS A;  3FB7 C;  1EN4 A;  3ZHU A;  1TVK A;  2OTJ V;  1HDJ A;  4DV3 O;  5CBF A;  1HWY A;  2LJ2 A;  1W59 A;  4PV1 B;  3K03 A;  2BCC H;  3APQ A;  2BSK B;  1THZ A;  4LF9 B;  5IWA B;  5EBW C;  3K57 A;  1YJW V;  1EN5 A;  3AG1 B;  4X9Q A;  2Q8V A;  2EUL A;  2KG7 A;  1G1X B;  1ROP A;  4OX9 O;  4TV8 B;  3OMA B;  4TUY A;  1YTF D;  4C7U A;  2YI9 A;  5KA5 A;  4GCZ A;  4MVU A;  3JD3 A;  1MSD A;  2WLM A;  3JAL B;  3L70 H;  4FLX A;  2VQE O;  2Q69 A;  4FIP C;  3B4S A;  2P22 C;  5CA1 B;  4QE9 A;  2ADP A;  4TUY B;  4F4L A;  4U3F H;  3H1J H;  4JI0 O;  1N33 O;  4GX5 A;  3BPZ A;  3CC2 V;  1TUE B;  1NBM G;  5EZY B;  3D36 A;  2XT9 A;  3J81 N;  3AEI A;  3U11 A;  1M5I A;  3AG3 C;  3S3W A;  1D2D A;  1SA0 B;  2Y0I A;  2QR4 A;  2ZNJ A;  2GV9 A;  2QKS A;  1AI4 A;  3BEH A;  2ZXW B;  3ABL C;  4H33 A;  3ZRW B;  3QG5 A;  2QKC A;  1DK1 A;  1PNM A;  2QM8 A;  1XNQ B;  4J80 A;  2UXD B;  4CC5 A;  1NZ6 A;  4LF8 B;  3E89 A;  2XTA A;  3VQW A;  5IY5 C;  1DTO A;  4O2A A;  3N27 A;  3J7A U;  4MTG A;  3TET A;  1XL6 A;  5LP6 B;  5IJ9 A;  2V1D A;  3PN1 A;  5JJJ B;  1XMO B;  4U3J A;  3UQ8 A;  2A9H A;  4O2B B;  4IYH A;  1KU9 A;  4DR2 O;  3UKM A;  4I50 A;  3RT3 C;  4DV6 B;  1Q7Y W;  2D2C B;  5GON A;  4LF5 B;  4I4T B;  4WFE A;  2N05 A;  1FS0 G;  5LXT B;  4FK5 C;  2AGA A;  1OCO C;  2ARH A;  1SZX A;  3JAS B;  3RYC A;  2XAJ A;  4CZZ A;  4JI7 B;  3LDC A;  2DW4 A;  1AR4 A;  1M4U A;  2QM4 A;  4TV8 A;  5LHG A;  1VEW A;  1H38 A;  1HNX B;  5EIB D;  1K5S A;  4X1Y A;  3SGI A;  1ZL8 B;  5LGT A;  4R6Z A;  5LXT A;  3T1H B;  2DQ3 A;  5FNV B;  4YY3 B;  2QTS A;  4FZ1 A;  4JGS A;  1FFX A;  3CXH F;  2KG7 B;  4B3M B;  4PEL A;  1HR0 O;  4LF6 B;  5HFM A;  4U3J B;  2EJR A;  2QSA A;  4IL6 Z;  5LP6 C;  2CAZ C;  1XNQ O;  2EIJ B;  2Q68 A;  4ASU G;  1YZB A;  4TQD A;  4WBN B;  4P9O A;  1WN7 A;  1Y76 A;  4DV2 B;  1V9P A;  1KEC A;  1OCZ B;  3E22 A;  1Z5W A;  3RN4 A;  2HLD G;  1JJ2 U;  4KFM A;  5IYZ A;  4JYA B;  1VMG A;  2H8P C;  2UUA O;  4B3S O;  1K4D C;  4LFC B;  1V54 B;  5C93 A;  2R72 A;  2GDS A;  4JAU A;  1R3L C;  1R1B A;  4JTD B;  2DWE C;  2CGO A;  2P4V A;  2WLK A;  4CS4 A;  2DYS C;  4XBF A;  4JAA A;  2E74 B;  4XDJ A;  2DYR B;  2QGN A;  1TUB B;  3SPC A;  1NR7 A;  3RYH B;  1XMQ B;  3CXC U;  1QVG U;  4X65 O;  2ZKO A;  4N23 A;  4FM0 A;  4BAY A;  4DV1 B;  2RN9 A;  1YEW A;  4CS3 A;  1Q81 W;  3HKC B;  1YDX A;  3ABK C;  4PDL A;  4JI3 B;  1N8R W;  1AIL A;  1VQ9 V;  3RYH A;  4RWU A;  2A7W A;  2CE4 A;  1OCR C;  3K06 A;  4NYK A;  4R8C A;  4FFB A;  2WLH A;  3WB1 A;  3MHS C;  5FL7 G;  3TXQ A;  1XHZ A;  1BCC H;  1QU7 A;  2UXX A;  2VWJ A;  5IWA O;  2UXB B;  1YF2 A;  2W0F C;  1H2G A;  2K1E A;  4OPA A;  2L35 A;  5LBQ A;  1ZX3 A;  1H2K A;  1SQG A;  4DV1 O;  3HKB B;  3G4S V;  1F4M A;  2QJ1 A;  4FM1 A;  1NR1 A;  4UVB A;  1FFX B;  4X88 A;  3KG2 A;  3ZHV A;  2MK3 A;  1HNW O;  2FML A;  2VQE B;  1IUR A;  1VF6 A;  4YXW G;  2ZIO A;  5LGU A;  1Q82 W;  1JQ0 A;  2G38 A;  3OE7 G;  2BTQ A;  4DR1 B;  3ABK B;  3ETE A;  1K33 A;  2JDI G;  3ZS8 C;  2UUB O;  4EEQ A;  2QKA A;  2BTO A;  4TT3 G;  4Q6G A;  4X1Y B;  1YJ9 V;  1K92 A;  4U7O A;  5IYC O;  4BIU A;  2GSM B;  1IVS A;  3A0H Z;  3E8H A;  1KBH A;  1FJG B;  3JD4 A;  3GVM A;  1UJW B;  1G4Y B;  3CC7 V;  2CTP A;  1NT2 B;  1SF9 A;  2PI5 A;  4UVA A;  1BSM A;  1QNM A;  1M56 B;  4PA9 A;  4X1I B;  1GN2 A;  1QR8 A;  3FYE B;  1QVF U;  4LH7 A;  2BE3 A;  4B3R O;  1AP5 A;  1CPY A;  1O9H A;  5LYJ B;  1N4C A;  1RPO A;  4O2A B;  3WG7 B;  3SPI A;  5B66 Z;  3SYA A;  1LR1 A;  5ITZ B;  4FLY A;  4LWS B;  1MZE A;  2EIL C;  1LUW A;  3FKS G;  5JQG A;  3OD4 A;  1H2L A;  2VRZ A;  4IHJ B;  2AHY A;  1L0N H;  4DR4 O;  1OV9 A;  3N2G A;  4DV2 O;  2RCV A;  2OT5 A;  1BE3 H;  3LUT B;  1KKD A;  2AW9 A;  1AJN A;  1COW G;  5JCO C;  1O9G A;  3GB7 C;  2ZCE A;  1AI6 A;  5A2Q N;  5KLV H;  1FXH A;  1R3J C;  1ZSP A;  3P32 A;  4JV5 O;  1Z2G A;  4K3A A;  2F95 B;  2ZQM A;  2B9Z A;  3WFV A;  1NTM H;  1JR9 A;  4D7S A;  2AZ0 A;  1N36 B;  1MAB G;  4GYC B;  2VQF O;  3RBZ A;  3JD2 A;  3ZRX A;  5LOV B;  2NN4 A;  4LFA B;  2QEX V;  1FXK B;  4G28 B;  1K34 A;  4HYO A;  1SZT A;  1GN4 A;  3WB0 A;  4JYB A;  4JTC B;  3MD0 A;  3SYP A;  4ZHQ B;  1KQS U;  1VQ7 V;  3E22 B;  4DR3 B;  4B7E A;  4NXM O;  2BTQ B;  2YI8 A;  3G6E V;  1VQM V;  3JAL A;  4LR3 A;  5LHI A;  1K8A W;  2JS3 A;  1DF4 A;  4JI4 B;  1N0J A;  1BQZ A;  3WU2 Z;  3BHP A;  3DC5 A;  3CC4 V;  5EC2 C;  5FPR A;  1HNZ B;  2EIL B;  4QE7 A;  5EK0 A;  3SPH A;  4PA7 A;  3SYO A;  4JPR A;  5GTH Z;  1AR1 B;  1NH2 B;  3F5W C;  4UVC A;  1EZV H;  1RSO A;  4OXS A;  2ZIN A;  3JAR B;  4JI6 B;  1N0N A;  4ZIB A;  3APO A;  2CH7 B;  1US6 A;  5H6R A;  1FD9 A;  4X66 O;  2IJI A;  4FLZ A;  1H2S B;  3RYI B;  1LUV A;  3OUF A;  4WFG A;  2DMX A;  2X6C A;  2F4V B;  2W6J G;  1P7B A;  4NB5 A;  2QWO B;  2HVK C;  2Q4P A;  3ZBH A;  3F7Y C;  3OMN B;  3G67 A;  5LMU B;  4UCV A;  4JI8 O;  2CGN A;  2PF4 E;  4FM2 A;  3E83 A;  3T4D A;  3WB2 A;  4I9Q A;  1QR9 A;  1G6U A;  2ITC C;  1UPG A;  5CBH A;  5EBM C;  2OYQ A;  2OIE A;  2ZD9 A;  4EFB A;  1GK9 A;  1V54 C;  1ZAU A;  2B1I A;  3P3N A;  4LFC O;  3FAV A;  1AI5 A;  2Q73 A;  4JYA O;  1TUB A;  1NVP B;  2AXT Z;  3HPL C;  2EZP A;  2DOS A;  4ZI7 B;  3W7W A;  2ETN A;  4I50 B;  1RPR A;  3R66 A;  2EIK C;  3OEH G;  4JYY A;  1WB8 A;  1D5A A;  3SJB C;  1XBL A;  4JYC A;  1TA8 A;  1WA8 A;  2QWR B;  3N2K B;  2B5U A;  2YUA A;  5JCO A;  4NXN B;  3CP1 A;  1R6K A;  1GTO A;  3M99 B;  1I08 A;  3CCQ V;  2KB1 A;  4J7J A;  3THO A;  1DF5 A;  5JJN B;  4MS2 A;  1YIJ V;  2RDC A;  3M8A A;  1W2B U;  5TIS Z;  1RP3 B;  4WFB V;  1K97 A;  4GX0 A;  2Q0O C;  3L74 H;  2WLL B;  2LQT A;  1AB3 A;  1R3I C;  2MW2 B;  1ENV A;  4CS2 A;  5CB4 B;  5KHK A;  3JD0 A;  1F7Y A;  1OCR B;  1AI7 A;  3T1C A;  1JMK C;  4O4I B;  4H37 A;  1S5J A;  2JGU A;  1EFR G;  2WSS G;  1XIL A;  3ML0 A;  1IBL B;  1FKA O;  2PYJ A;  4AQY B;  3ASO B;  3CME V;  4LF9 O;  3RYF B;  2LGQ A;  4UCO A;  1Q6I A;  3B40 A;  3H1L H;  1KP3 A;  2PTM A;  3DXR B;  3M7M X;  1WJZ A;  3ZHR A;  4J42 A;  2XAH A;  1RFY A;  1VQL V;  3IGA C;  3K5N A;  2UU9 B;  4I5S A;  1B04 A;  2P4K A;  3RVZ A;  1NI8 A;  3ABU A;  4DK1 A;  2F93 B;  4PDV A;  4DRX B;  4QPJ A;  2NR5 A;  1W0J G;  2R9A A;  3CRM A;  4BW9 A;  1VF6 C;  3N2K A;  2XHB A;  1R6N A;  3TJT A;  5H6Q A;  4LF7 B;  5KUM A;  3UCS C;  4K8X A;  1GN6 A;  3E8F A;  4DR6 B;  1FJG O;  4U7N A;  3CEI A;  1B06 A;  5EZY A;  3JAM N;  3CJH A;  1Y74 B;  3U10 A;  2KQX A;  3ZRW A;  2YDE A;  4DR5 B;  3MDS A;  1F51 A;  4DRX A;  2BOB C;  1FPO A;  3E8G A;  1VQK V;  4EKW A;  2H94 A;  3HKC A;  3TGU H;  3ZRV A;  3K58 A;  4YJ2 B;  5K1P A;  4O4I A;  1QLE B;  2PUS A;  2LW1 A;  3FD9 A;  1QLE C;  2LGW A;  3CMA V;  1I94 B;  3K3W A;  3CCS V;  3AK1 A;  3OUS A;  3X2Q C;  3LDE A;  3H1H H;  1GM9 A;  4X64 B;  3T4Z A;  1GM8 A;  1XUQ A;  1F4N A;  3EHB B;  2EBO A;  4RUE A;  5JVD A;  2OCH A;  4JI3 O;  2QWQ B;  3A2F A;  4FLV A;  2VQF B;  2UXC O;  3E35 A;  3RW0 A;  4EFE A;  4JI5 B;  4YIO A;  2OWO A;  1WPB A;  1JFF B;  1TVK B;  1YCI A;  1Y76 B;  2ZIM A;  1MMM A;  2X6A A;  5L3D A;  4PA4 A;  1BHA A;  4G2K A;  4GLX A;  5EYP B;  5BR8 B;  2YXL A;  1KYO F;  5IT9 N;  4JI5 O;  4R50 A;  2GHY A;  4KXR A;  3A0B Z;  4ZI7 A;  4DR4 B;  1MZF A;  3GWO A;  4ZBM A;  3K04 A;  5C8Y A;  1FAF A;  4X8A A;  5LL6 Y;  3LSQ A;  5KX5 B;  2QTO A;  4LNU B;  1HW7 A;  4YJ3 B;  1WPX A;  4D6T H;  1JJO A;  1Q43 A;  3B77 A;  1SRY A;  5B1O A;  2X6B A;  5AG2 A;  3OTO B;  1Q86 W;  2PYL A;  3STL C;  2F1M A;  1WP7 A;  3IFX A;  2FTK A;  4XDK A;  2Y69 C;  3KCY A;  4GKK B;  2JVD A;  1OCZ C;  2OIG A;  1VQ4 V;  1BHB A;  4NXM B;  5GON B;  1NTZ H;  1GAX A;  2O57 A;  4O4J A;  1V55 C;  5LGN A;  3CS5 A;  4JTA B;  1AJP A;  2YSU B;  3D3I A;  5GW7 A;  4PDR A;  1HNX O;  4A5U B;  5A9G A;  4TV9 B;  1XNR O;  3AG7 A;  1MG1 A;  1R73 A;  3CRC A;  2Y4U A;  4X1K A;  2Q7H A;  3FB5 C;  4UCT A;  4DR6 O;  1KB9 F;  3ZMU A;  2HFE C;  3H01 A;  5J2U B;  5JJE B;  1XEQ A;  2FL4 A;  3JD1 A;  2YIC A;  4JV5 B;  1JFF A;  1PM9 A;  5LYJ A;  2IW5 A;  2ZM6 O;  1P84 F; 
#chains in the Genus database with same CATH homology
 2QWP B;  2M6Y A;  4J7Z A;  2DN9 A;  1BQ0 A;  4J80 A;  2YUA A;  4IT5 A;  1IUR A;  1NZ6 A;  2PF4 E;  2Y4T A;  2OCH A;  1N4C A;  2QWQ B;  3BVO A;  3APO A;  2CUG A;  2EJ7 A;  1HDJ A;  2KQX A;  2N04 A;  2LGW A;  2CTR A;  2QSA A;  2CTQ A;  1WJZ A;  2CTP A;  2N05 A;  1BQZ A;  3APQ A;  2GUZ A;  3UO2 A;  3UCS C;  2QWR B;  2QWN B;  3UO3 A;  2CTW A;  2GUZ B;  2DMX A;  2YS8 A;  1FPO A;  2LO1 A;  1FAF A;  3AG7 A;  1GH6 A;  1XBL A;  4RWU A;  2L6L A;  2Y4U A;  2QWO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...