1NZ6A

Crystal structure of auxilin j-domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
b'DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKPLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Auxilin
publication title Structure-function analysis of the auxilin J-domain reveals an extended Hsc70 interaction interface.
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein binding
total genus 29
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2003-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1nz6A00
2QWPB 2QSAA 1XBLA 2QWOB 2Y4TA 2EJ7A 3BVOA 1BQ0A 3UO3A 2CUGA 2DMXA 2CTWA 2LO1A 2QWRB 1FPOA 2YUAA 4RWUA 4IT5A 2PF4E 4J7ZA 2CTQA 2L6LA 1FAFA 1GH6A 2Y4UA 2GUZB 2OCHA 3APOA 1NZ6A 3APQA 2GUZA 1N4CA 2QWQB 2N04A 1WJZA 2LGWA 4J80A 2KQXA 2CTRA 1IURA 3AG7A 1HDJA 2CTPA 2N05A 3UO2A 1BQZA 2M6YA 2QWNB 3UCSC 2YS8A 2DN9A
chains in the Genus database with same CATH superfamily
1P49A 1HR0B 3SYOA 4MTGA 4ZOLA 1E79G 1DK1A 2ZKOA 4PD4F 1GN2A 4ZI7B 5IE9A 2PGGA 1U96A 1GTOA 5EYPB 5IJ9B 3S3WA 2QWQB 4X9QA 4N23A 2EZOA 1XNRO 1EZVH 4K8XA 2QE7G 2JK5C 1HNWO 2EILC 3OTOO 4TV8B 2UXBB 2WA4A 4FZ0A 4LFBO 2P67A 2ZM6B 3T2MA 2K9PA 4OXSA 4I0XB 3ZBHA 1AR5A 1Y74B 5IY5C 1R3JC 2WLMA 2PI5A 4F6RA 2UUBB 3CYOA 4X89A 3CJHB 3OGIB 3K0GA 2XHBA 2DQ0A 2Q9LA 3ZN0A 4JI7B 4TV9B 1NH2D 5JVDB 3X2QB 4LF8B 5H6QA 4X65B 3Q4HA 5LGUA 1MG1A 1MABG 4UUJC 5CBGA 1QR8A 1NT2B 3ZMZA 1FKAO 1SZTA 1FXHA 4DV7O 4GKJO 4B3MB 1Y66A 2VS0A 2IU3A 4TUYA 4YY3B 3G4SV 2E3CA 2H8PC 4JI0O 4JYAB 1CP9A 4LF5O 3E8FA 4YIPA 3B2EE 3SJBC 2CTPA 1AB3A 4R50A 1V54C 4JI1O 3LSUA 1QR9A 1RM1B 1SS3A 1W0KG 4EB6A 1YTFD 3RYCB 4YJ3A 3SDLA 3JYCA 2DW4A 3RYIA 1O9GA 2E74B 4LFCB 3K5MA 1H2KA 4FLZA 2JVDA 5GONA 3W7SA 1HNXO 2Y69C 3C3SA 2YICA 1QBZA 1SA0B 4I50B 4NTYA 2QSAA 2E75B 1K97A 2ZE5A 2W6JG 1NVPB 3ABKB 4HYOA 5LBQA 4PDVA 5B1BB 1YSCA 4GYCB 4DW1A 3AG4C 5HFLA 1OV9A 4A5UB 3DXRA 1BZKA 4HNAB 5KAFZ 1IBMO 1VQLV 4X66O 4JI2O 3KG2A 4I9QA 4WFAV 1BQ0A 1GN3A 2OTJV 4QIWF 1N0JA 1J5EB 2JGUA 4UV8A 2JEXA 1EBOA 2B5UA 5JJNB 1PNLA 3UT5B 2FYUH 1W2BU 1PM9A 1THZA 4QE9A 4JI6O 3L72H 3JAKA 4MW8A 5LXTB 4JV5O 5CB4B 4PA3A 2DMXA 2IJKA 3OR7C 2EIMC 4UCUA 1ENVA 4LCUC 4PDRA 4X20B 1M56B 2EIKB 1M9NA 4FLUA 4FM0A 2A9HA 4R6ZA 3OMIB 3SPJA 2B1IA 2AW9A 3T1YO 4PHZA 1B06A 1RSOB 3MDSA 4J11A 1XI1A 3A0HZ 2BTQB 5CA0B 3IJ4A 4I5SA 4NR1A 3WG7B 2FMLA 4LNUA 4P9PA 1NTKH 3U11A 4UFZA 2UU9B 2ZDIC 4I4TA 1GH6A 1W0JG 3WFVA 3K79A 5L3GA 1AVMA 3ETDA 5GTHZ 3JD3A 2HLDG 2YIBD 3K9SA 3E8HA 2DWDC 4JGSA 3CHXA 3PJSK 2HEPA 4J9ZB 2LFRA 5IT9N 4O4HA 2WLHA 2WLNA 2PF4E 1VMGA 3AG1B 3STZC 2JS5A 3CCUV 4B3TB 4IYIA 3K08A 1K33A 3ABLB 2Q6AA 4X62O 4B3RB 3GVMA 2Q73A 1IBKO 3JD0A 1XHZA 1JFFA 3FKSG 5EBLC 5HFMA 4ZOLB 4J42A 4RUFA 1SKVA 1URFA 1M93A 1SRYA 4UCSA 2D3OW 2OIEA 1X59A 4JYBA 3RWRD 3JCZA 1AI4A 1H8HG 2WLKA 4NXNO 1FS0G 3APOA 3CXHF 3X2QC 5IWAB 4JI8O 1I0HA 2JIZG 4NTXA 4OX9O 2DWEC 3WB2A 4QE7A 1SZXA 4P9OA 2YIBA 4CH6A 3UO2A 3G6BA 1VF5B 3NR7A 1PP9H 1RP3B 1XMOB 1FFXA 2GTSA 1XOUA 3M7MX 2DE0X 1AR1B 4O2AB 3LDDA 5K1XA 1GM9A 5DEDA 2WSSG 2N74A 4LF4O 1VF6C 4MVQA 1XNQO 4K0KB 4CS3A 2ZDIA 2QM8A 2WLIB 4UVBA 4E4EA 4JAAA 5IJ9A 1Q7YW 2XASA 5GW7A 5BXZA 4TQFA 3BPZA 4WBNA 1RM1C 1HW7A 1GN4A 2Y4TA 1QLNA 4RUEA 3MD0A 3CCMV 4FLWA 3VOUA 4LH7A 3ASNB 2B9ZA 4DR3O 1HR0O 3FD9A 2CGNA 4UVCA 1SERA 2WWWA 4KUMA 1S77D 4XDLA 2KSDA 2ZQMA 3J80N 1Q6IA 3B8NA 4I0XA 5H6RA 5BMVB 3OEEG 4MS2A 2N05A 1YDXA 2X6CA 3ABKC 5B1BC 2F66C 3FX7A 1K4DC 2PY5A 4DV4B 2UXBO 4DV2B 3CJHA 3RVZA 5E1AC 2P6JA 4TV9A 3MHSC 5JVDA 3H9VA 2OYQA 5A2QN 1R73A 1KP2A 5KHHA 2DYRB 1NVPD 4EB6B 5ITZB 1P84F 1ZWIC 4UV9A 3CCQV 4OGQB 3RYIB 2UUBO 1FAFA 4DV0B 4FM1A 4F6EA 2V7QG 2PYLA 1TAEA 3UM7A 4KL1A 1MMMA 4HZ3A 4I7ZB 4JI7O 1IBMB 1Y6XA 4LF8O 2A3QA 4X65O 4DW0A 4FJCC 1M56C 2EIKC 3RYCA 1XEQA 3JARB 3H1IH 3T1CA 4DR2O 1B04A 3KCYA 4B3MO 4ZIBA 4YY3O 3AG7A 3F7VC 3WG7C 3U0ZA 4FM2A 2F43G 5KHGA 2QKCA 5C93A 4JYAO 2H3OA 5B1AB 4DV5B 1QLEC 2IH3C 1SA0A 4I50A 3DGEA 2ZIMA 1SQVH 4PDMA 5IYDO 1VQ4V 1YTFB 2XTAA 2CE4A 1QQCA 1NKDA 3RBZA 4GLXA 4DR6B 2YI9A 3IC7A 2XAHA 3IFXA 3O65A 3CX5F 4LFCO 4FVMA 3ZX6A 5B1OA 2Q0OC 4HNAA 1KKDA 1PV0A 2DN9A 2IJHA 1F23A 1BL8A 1KECA 3UO3A 3AG1C 3G80A 4KP4A 2QDOA 1DGSA 2E5LB 3G6EV 3RW0A 3KCXA 4AILC 1AJPA 5CA3A 3ABLC 4L87A 5EC1C 3HKEB 3UT5A 1L0LH 1QNMA 1YVWA 4RO2A 3VQXA 1S0VA 4NB5A 5LXTA 1M90W 1SESA 1EN5A 1OZ0A 3FYEB 2YXHA 4XDJA 3W7UA 1J5EO 1YEWA 3ZCCA 3ABUA 3QO5A 2AHYA 4FFKA 4ZHQB 2C2AA 2X6BA 4PA6A 1FXKA 4XBFA 4DRXB 3B8MA 1RSOA 1GM7A 3ZHUA 5CA0A 4O4HB 1GRJA 1I5YA 4Z1MG 4WCEV 1JJOA 3I5DA 2DJVA 2UXXA 1ZL8B 1S5JA 1VQMV 2Q8VA 2P90A 1RPRA 4CC6A 4CZZA 5EBMC 3ETGA 5TISZ 2A79B 1TUEB 5L3FA 4DYLA 1JFFB 3ASNC 1AJNA 1EN4A 5AG2A 4J10A 4U3FH 3RN4A 1A32A 2ZINA 1K3EA 1Q86W 2L6LA 2UU9O 3QO7A 4DV3B 3RFRA 2OCCB 3K5NA 5JJJB 4JZGA 2Q7HA 3L71H 1FFXB 3CXCU 1F7YA 4DR3B 2YSUB 1G8MA 3W7WA 2XOKG 1WNSA 3JD4A 4EEQA 1IBLB 4H33A 1KU9A 5D5PA 2LJ2A 3CCEV 1G4YB 2Z3YA 3BA9A 1EFRG 3BAAA 3GB7C 2ZE8A 3J81N 2P4VA 2DYRC 4WBNB 4AHCA 2DQ3A 4B3TO 1I7FA 4B3RO 4GT1A 2QWOB 4AQYB 2Q69A 1I08A 1XHXA 4O2AA 5H2FZ 5CBFA 3BA8A 3BHPA 1KYOF 2F93B 3CC7V 2JGDB 2WLIA 2YC0A 3GWKC 3CRAA 5IWAO 1S3JA 2QM7A 4FLTA 2EBOA 4CH4A 1XQ8A 4BR6A 5B3SB 2DOSA 4DR5B 2LFSA 3B77A 4MTXA 4ZBMA 2NN4A 2F95B 1XMOO 2BOCC 2R9AA 3FB8C 4WFFA 4H44B 3L9DA 4JZ2A 4W4KA 4X1YB 4J9YB 2OTLV 4HBNA 4YHHB 1Z5WA 4K0KO 5B1AC 4K3AA 1KMIZ 5BMVA 5EIBC 2IM9A 2JDIG 4DV1B 1K73W 2HP8A 1Q5OA 3A0BZ 2WLJA 2LO1A 4J7ZA 4DR2B 2FL4A 1H2NA 3CRRA 1NZ6A 1KP3A 5LA6A 3HKDA 4CC5A 1WJZA 2GBOA 3OFNG 4NXMB 2RMKB 2LQTA 1M4UA 2YXLA 4NTWA 3ETEA 1JA8A 4PA7A 5EIBD 3ZHVA 5ITZA 5IYBO 2CH7B 4YJ2B 1NTZH 1YIJV 2WLLB 4DV4O 4DV2O 1DTOA 4EKWA 3D36A 5LP6B 2RQ6A 4DXWA 4DV6B 3K06A 1VIBA 2F4VO 3RYHB 4PI2A 5D5QA 1FXVA 5L3BA 4J7KA 2W6IG 5IJ0A 5KHKA 2YXYA 3CC4V 5L3DA 2RN9A 3FYIB 4DK0A 3AG3B 1H2GA 4O4JB 3BCCH 4DUYB 1DF4A 1WP7A 4LWSB 3ZJZA 3JARA 4DV0O 1K34A 2QKAA 1NS1A 4JASA 1BHAA 2A0LA 2OIGA 1BS3A 3LNMB 2P22C 2ZR2A 4UB6Z 5J2TB 5CN0A 1XDCA 4KFMA 4PA4A 4FLVA 3RT3C 2F1MA 1F4NA 4O2BB 2XAJA 3KKYA 5JWPA 3G71V 4IIJB 4MSWC 1R6TA 3RVYA 4DV5O 1YXBA 1IXMA 2HJFC 4MTOA 4Q20A 4UXNA 3FAVB 2OCCC 3P3NA 3UQ8A 1I5XA 3FB6C 2PYJA 4DR6O 2EULA 5LOVB 1H38A 2Q7EA 3HKEA 1FXKB 4UCTA 1NBMG 4JYYA 4QPKA 4GX2A 1HWYA 2QWRB 2Q67A 5KAIZ 4GKKB 4I55B 1YJWV 2EINB 5KMGA 3E86A 3TETA 1LR1A 4WF9V 2E5LO 1TA8A 4OPHA 4J7JA 4ZHQA 3HKBB 1ZUQA 1IX9A 4DRXA 4YXWG 2M7WA 3QNEA 3JATB 2QEXV 1BSMA 4CH3A 1N8RW 1BHBA 1HP8A 1Q6UA 3T4ZA 1BT8A 1R3KC 2Y4UA 1O9HA 4QNHB 1ZL8A 1KQSU 4LF9O 4UVAA 3JAMN 4TT3G 5B3SC 2XNDG 3K04A 1IXBA 3N2KA 1NR1A 4G2KA 1NQTA 5K1PA 2PI4A 4MW3A 3ZMTA 2XAQA 1S72V 3VBBA 4MVUA 4PJ0Z 3LSSA 1Q81W 4P30A 1JJ2U 4PV1B 5DM6V 3JD1A 1K7DA 1JMKC 1BMFG 1XBLA 2QA4V 2AZ2A 2GTAA 3A8TA 1JOYA 1E1QG 4BWAA 1XREA 2LW1A 3HKCB 1FD9A 3FB7C 4DV3O 1CPYA 4FMTA 2UUAB 1XUQA 3GWOA 5CA1B 2UXDB 1EZJA 2E76B 3M8AA 2OT5A 4QGPA 1TVKA 1YZBA 5LP6C 3QTCA 2UUCB 1GM8A 5FL7G 1G1XB 1P7BA 4NYKA 5LL6Y 1YCIA 2JGDA 2IBZH 1IBLO 4X1IB 2VQEB 1IURA 1Q43A 3K03A 3QO8A 3OD4A 3O9OA 3CMAV 3ZRSA 3LNNA 3AG3C 1VARA 5LGTA 1VQ5V 1S76D 1R6NA 5KX5B 3ICXA 2Y0PA 2Y48A 3IGAC 3BRCA 1EM1A 2VWKA 2ETNA 4AQYO 3TXQA 5LA6B 2BE3A 3HKDB 4X1YA 2F4VB 3AEIA 3K59A 1GAXA 1ORQC 4UB8Z 4JYCA 1HNZO 2KB1A 3BABA 2HKOA 5DN6G 1WB7A 2CDYA 3EXAA 1AROP 1H8EG 3E35A 2ADPA 2CTWA 2CGOA 2Q4PA 4DR5O 1YJNV 3CE2A 3LSQA 2CTQA 1XILA 4LR3A 3ZHTA 2A7WA 1WPXA 5LMUB 3SYAA 1N4CA 4RQFA 1AI6A 1GKFA 2W0XA 2RNBA 4KXRA 4YHHO 3CB2A 3STLC 1YI2V 4YIOA 5IJ0B 3SPCA 2HJDA 3JALB 5J9PC 3JD2A 3CMEV 2HR3A 4DV1O 1TUBB 2K1EA 5BR8B 2CH7A 4JI5B 4YJ2A 2ITCC 4RQEA 3OEHG 2ODMA 2WLLA 1VF7A 1FXKC 1AJQA 2P5OA 4U7OA 3ZMUA 3W7XA 3EFFK 5LP6A 1US6A 2GHYA 1ZX3A 5EBWC 5JCOC 3RYHA 4NXMO 2EIJB 4MVMA 1K5QA 4LF7O 3ZHQA 3B09A 3R65A 3JAWB 4ZKIA 2EINC 1M5IA 3E89A 4H37A 2FKXA 4O4JA 4U3JA 2XUMA 4LWSA 4QJFB 1JQ0A 1GO3F 5BZBA 4DK1A 4ICGA 3N2GA 4MVOA 1KD1W 2OWOA 1R3LC 2R9IA 4LH6A 4C7UA 1SQFA 4DV6O 2ZE7A 2YS8A 3VQYA 4BIOA 4LFAO 3CEIA 4H13B 3H1KH 3THOA 4TOIA 4RWUA 2P7TC 4O4LA 4D6TH 1Y4MA 1D5NA 5J2TA 4DUYO 2P4KA 4CS4A 2N04A 4J80A 4AI8A 1PNMA 1NJIW 4O2BA 3MAQA 5GTIZ 4IIJA 2QWPB 4OPAA 2B1GA 3E22B 1DF5A 4F4LA 4LF9B 1N32B 5KMGB 1N34B 3FAVA 1WAZA 1SC5B 5LOVA 1BE3H 1VQ8V 2UXCO 1R3IC 2BSKA 1ROPA 5JCOA 3CCLV 4JI4O 1K92A 2QKSA 3CCSV 4KHPO 1V55B 4IT5A 1WLEA 1UJWB 1VQ6V 4K35A 4I55A 2R72A 3L75H 3SYCA 1CEZA 2KKWA 4D7TA 3T4DA 1B3QA 3HKBA 1F4MA 5EZYB 4Z2WA 4B3SB 2VQFB 1VQ7V 5KA5A 2KG7B 3N2KB 3OAAG 1NU1H 1OHHG 2H94A 2FTKA 3JATA 1F51A 3JASB 5H5NA 3A2FA 3D3QA 4X64B 4GKKO 2ZCEA 5FNVB 3OM3B 4JF3A 3ASOB 5IYZB 1COWG 1KB9F 4WFBV 1VQNV 5A9GA 4TSFG 5LYJB 3BFRA 1T5EA 1FPOA 3VQWA 3WB0A 1FJGB 2V4DA 2R9RB 4BW5A 3ZRXA 1NI8A 3OE7G 1K9MW 1LUWA 5FPOA 3APQA 5JH7B 5JJEB 3CC2V 1D5AA 2JRIA 4GCZA 4J41A 2YDEA 3TCUA 4I9WA 4DO2A 1QHTA 4QPJA 3QVNA 3CPWU 4WFEA 4GZRB 4CS2A 4E2LA 3EVKA 2AGAA 3A0RA 2W0FC 1Y76B 2GDSA 1TVKB 1Z5VA 5IYCO 3D36C 3OMNB 5F2VO 5LMNB 1PL4A 1JPXA 3P32A 3ZRWA 1HNZB 1WA8B 3OTFA 3HKCA 2D2CB 5EK0A 4D7SA 4H0LB 2HVKC 1P4RA 1E1RG 4TQDA 3CP1A 5KLVH 5CA1A 3SJAC 1PD3A 3H01A 2AZ0A 4O4IB 1QVGU 2EZPA 1K8AW 3CCJV 2GUZB 1N36B 1I94B 3AK1A 2ZT9B 2EIJC 2YEVA 4X1IA 2GV9A 5B66Z 1TGOA 3SPGA 2QR4A 1H2MA 4DR1O 3LUTB 3CRCA 3DC6A 3BY6A 1AI5A 3K0DA 2EJ7A 3D8CA 4DR7B 2UUAO 2UXDO 4IHJB 5KX5A 1M1KW 2JS3A 3HB3B 3DC5A 1G6UA 3HPLC 3QF7A 3PN1A 4JI3B 4B7EA 1VQ9V 2ZNIA 1J95A 2DYSB 2UUCO 3CS5A 2LGWA 3JSNA 4PI0A 2MK3A 1UPGA 4P2ZA 3J7AU 4UCOA 2VQEO 4LF7B 4WFHA 5LHHA 1XMQB 2AHZA 3OR6C 4LF6B 1WPBA 1AILA 5KHJA 3U10A 2ARHA 4CBCA 1QCEA 2LW7A 2CTRA 5J2UB 3ZHRA 1FFTB 1MZFA 5H9CA 4WFGA 1RPOA 1ZAUA 2PZSA 2QJ1A 4LFAB 5L3EA 3AK3A 4DUZB 2XAFA 2BOBC 3JALA 5EC2C 3QG5A 1M57B 3ETQA 1PPJH 2RCVA 1WN7A 1TUBA 4U3JB 1OCZB 4EFBA 5FPRA 4FPPA 1QVFU 3OW2U 3N2GB 3FB5C 3JCUZ 5LMUO 3ZRVA 3K5LA 1FYJA 4PDLA 4DR4B 4FK5C 3AG2B 5LHGA 2O57A 3N27A 1V55C 3ZHSA 3JAWA 1GMGA 2ZXWB 4O4LB 2EJRA 5BY1A 5BR8O 2NLJC 3K57A 1X4TA 2LP7A 4JI5O 3W7TA 2UXCB 3UKMA 3E2EA 2KQXA 5CMUA 1Q8IA 3RYFB 1H2SB 1LNQA 2FB5A 2YIDA 3E83A 4JI4B 4GX5A 4BIZA 2JJ2G 4KHPB 1OJHA 2CUGA 3RGBA 3ASOC 2Q7GA 4NVPA 2YIAA 1OCOB 1SQXH 4UCRA 1XL4A 5L3CA 2BSKB 4PA9A 2X0LA 3ABTA 3OUFA 1PL0A 2QM4A 3E8GA 2Z0AA 2JJ1G 1OCCB 1SQBH 4ABMA 4X8AA 4Z1VA 2YUAA 3E22A 1N33B 4IL6Z 2RJZA 4FFBB 3EHBB 4X1KB 1GN6A 1AR4A 4N21A 1IVSA 2GSMB 2JEUA 4MT8A 3ABMB 3FFQA 1U97A 2QTSA 5JQGB 4NKGB 3K58A 2CAZC 3SR2C 1QLEB 2IJJA 5DECA 3T1HB 3CCVV 3MHHC 1N32O 2BTOA 4MTFA 4JAVA 1N34O 1JVMA 3DTUB 1PKXA 2ATKC 3OMAB 5EZYA 2F23A 3L73H 3P30A 2KG7A 2PTMA 1ZSPA 3VQVA 1MZEA 3TGUH 3JASA 1KUQA 5KA6A 4FZ1A 1XNRB 1SQGA 4IYHA 2IJIA 1R1BA 1OCRB 5FNVA 1HNWB 3OTOB 1DLBA 5IYZA 1P7GA 4BW9A 1Q90D 3P3PA 3SJCC 3LDEA 2BCCH 4B3SO 2VQFO 4LFBB 1L1FA 2ZIOA 1AI7A 3B4SA 5LYJA 2NNUA 2DYSC 3K5OA 5B1NA 3R66A 3ZRWB 3H1JH 1QU7A 3G67A 5JH7A 2RDCA 4X64O 3IC9A 5C8YA 4DR1B 3OT7A 1JCHA 2ZNJA 4XDKA 3ZMVA 2A06H 2G38A 1Y76A 2ZE6A 1SQPH 1YHQV 1MOFA 4GX0A 3ZN1A 4ZI7A 4LBEC 2HHHO 3M99B 1FJGO 2WAMA 5EYPA 1LUVA 4G28B 1YF2A 5LHIA 2YEVB 3AK2A 1WA8A 1Z2GA 1BQZA 4FLYA 2QWNB 1M57C 4F6RB 4TV8A 1VQOV 4MVSA 4JTDB 1OCZC 4DV7B 4GKJB 3I55V 3L74H 5E79Z 3KZIZ 4O4IA 2ZR3A 2XAGA 4JI0B 4LF5B 2QGNA 1NR7A 2GUZA 4RAIA 5LMNO 4JAUA 1SQQH 1Y74A 3Q4HB 4JI1B 3AG2C 1SF9A 3WU2Z 2ITDC 2ZXWC 4PELA 1V9PA 3BVOA 2IH1C 5FLXN 3LDCA 1L0NH 2ZD9A 4IHJA 1CXZB 4TUYB 2OCHA 2ZM6O 1K4CC 4B08A 3DSQA 3SPIA 4B7KA 1WB8A 1HNXB 1ZTEA 5B5EZ 1N36O 1I94O 5KHIA 3BEHA 2VRZA 3B40A 2XT9A 3L70H 1H2LA 4CH5A 4YJ3B 3IAYA 2EILB 4L8JA 1OCOC 4DR7O 1AP5A 5GONB 3CD6V 1VF6A 4W4LA 2MW2B 3H1HH 4JI3O 1NH2B 3S3XA 1VP7A 3ML0A 4FIPC 5J2UA 4X66B 4JI2B 1W59A 1OCCC 5IY5B 2QTOA 3SJQC 3ZS8C 3SPHA 3JSLA 1IZ3A 1XMQO 4LF6O 3ABMC 3OGCC 4ASUG 1KC8W 2HG5C 1YJ9V 1BCCH 4TWKA 3ZIAG 4JI6B 3DXRB 4LP8A 2VWJA 4JV5B 3ZMSA 2M6YA 1Q82W 1GK9A 2HFEC 4JTCB 5KUMA 5KUKA 1B6QA 2P06A 4DUZO 4BAYA 1S5LZ 4IGGA 3F5TA 3T1YB 3SYQA 1VQPV 3CSXA 3SGIA 4LC1A 4FLXA 4BIUA 2Q5ZA 3RYFA 2IW5A 3JAKB 3TJTA 1VEWA 2UXNA 4X88A 4DR4O 4R7CA 3D3IA 1V54B 5IDJA 1R6KA 1VQKV 2EX3A 1OCRC 1RFYA 2L35A 2Q68A 1K5SA 1WP8A 1HDJA 3H1LH 3K3WA 3NXSA 2HVJC 1MNGA 2WPDG 4LNUB 4GX1A 3TK1A 1KKCA 3K9AA 2Y69B 2Y0IA 5CB4A 5CBHA 4I4TB 3C3TA 1S5HC 3CRMA 4X20A 1XL6A 4FFBA 4X1KA 5LGNA 3F5WC 4X62B 1L8DA 4K8ZA 1NTMH 2AXTZ 4MVRA 2WA3A 1IBKB 1Q6HA 4MVZA 4G27B 5JQGA 3C90A 1JX9A 1MSWD 2BTQA 1D2DA 3AG4B 1ZLZA 2R70A 3TXSA 2YI8A 4NXNB 1EN6A 2V1DA 4JTAB 2X7RB 1PNKA 4GUNA 4U7NA 4JPRA 1YITV 4JI8B 4OX9B 3CCRV 1UFIA 1N33O 3WB1A 2ADQB 2NR5A 3E8BA 3CWBH 1N0NA 2X6AA 1MSDA 2ILMA 3F7YC 3CRQA 1Y67A 4LF4B 3ZEDA 1XNQB 3OUSA 4Q6GA 3I56V 1BGYH 2HHHB 1AP6A 4EFEA 2IU0A 1Q3EA 3SYPA 2EIMB 2PUSA 2Z5UA 3T1HO 4HAMA 3HR0A 1SETA 2LGQA 4R8CA 2Q0AA 1KBHA 2CK3G 5C8YB 1IDSA 4UCVA 1JR9A 1MA1A 3UCSC
chains in the Genus database with same CATH topology
2QWPB 2QSAA 1XBLA 2QWOB 2Y4TA 2EJ7A 3BVOA 1BQ0A 3UO3A 2CUGA 2DMXA 2CTWA 2LO1A 2QWRB 1FPOA 2YUAA 4RWUA 4IT5A 2PF4E 4J7ZA 2CTQA 2L6LA 1FAFA 1GH6A 2Y4UA 2GUZB 2OCHA 3APOA 1NZ6A 3APQA 2GUZA 1N4CA 2QWQB 2N04A 1WJZA 2LGWA 4J80A 2KQXA 2CTRA 1IURA 3AG7A 1HDJA 2CTPA 2N05A 3UO2A 1BQZA 2M6YA 2QWNB 3UCSC 2YS8A 2DN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWP B;  2QSA A;  1XBL A;  2QWO B;  2Y4T A;  2EJ7 A;  3BVO A;  1BQ0 A;  3UO3 A;  2CUG A;  2DMX A;  2CTW A;  2LO1 A;  2QWR B;  1FPO A;  2YUA A;  4RWU A;  4IT5 A;  2PF4 E;  4J7Z A;  2CTQ A;  2L6L A;  1FAF A;  1GH6 A;  2Y4U A;  2GUZ B;  2OCH A;  3APO A;  1NZ6 A;  3APQ A;  2GUZ A;  1N4C A;  2QWQ B;  2N04 A;  1WJZ A;  2LGW A;  4J80 A;  2KQX A;  2CTR A;  1IUR A;  3AG7 A;  1HDJ A;  2CTP A;  2N05 A;  3UO2 A;  1BQZ A;  2M6Y A;  2QWN B;  3UCS C;  2YS8 A;  2DN9 A; 
#chains in the Genus database with same CATH topology
 1P49 A;  1HR0 B;  3SYO A;  4MTG A;  4ZOL A;  1E79 G;  1DK1 A;  2ZKO A;  4PD4 F;  1GN2 A;  4ZI7 B;  5IE9 A;  2PGG A;  1U96 A;  1GTO A;  5EYP B;  5IJ9 B;  3S3W A;  2QWQ B;  4X9Q A;  4N23 A;  2EZO A;  1XNR O;  1EZV H;  4K8X A;  2QE7 G;  2JK5 C;  1HNW O;  2EIL C;  3OTO O;  4TV8 B;  2UXB B;  2WA4 A;  4FZ0 A;  4LFB O;  2P67 A;  2ZM6 B;  3T2M A;  2K9P A;  4OXS A;  4I0X B;  3ZBH A;  1AR5 A;  1Y74 B;  5IY5 C;  1R3J C;  2WLM A;  2PI5 A;  4F6R A;  2UUB B;  3CYO A;  4X89 A;  3CJH B;  3OGI B;  3K0G A;  2XHB A;  2DQ0 A;  2Q9L A;  3ZN0 A;  4JI7 B;  4TV9 B;  1NH2 D;  5JVD B;  3X2Q B;  4LF8 B;  5H6Q A;  4X65 B;  3Q4H A;  5LGU A;  1MG1 A;  1MAB G;  4UUJ C;  5CBG A;  1QR8 A;  1NT2 B;  3ZMZ A;  1FKA O;  1SZT A;  1FXH A;  4DV7 O;  4GKJ O;  4B3M B;  1Y66 A;  2VS0 A;  2IU3 A;  4TUY A;  4YY3 B;  3G4S V;  2E3C A;  2H8P C;  4JI0 O;  4JYA B;  1CP9 A;  4LF5 O;  3E8F A;  4YIP A;  3B2E E;  3SJB C;  2CTP A;  1AB3 A;  4R50 A;  1V54 C;  4JI1 O;  3LSU A;  1QR9 A;  1RM1 B;  1SS3 A;  1W0K G;  4EB6 A;  1YTF D;  3RYC B;  4YJ3 A;  3SDL A;  3JYC A;  2DW4 A;  3RYI A;  1O9G A;  2E74 B;  4LFC B;  3K5M A;  1H2K A;  4FLZ A;  2JVD A;  5GON A;  3W7S A;  1HNX O;  2Y69 C;  3C3S A;  2YIC A;  1QBZ A;  1SA0 B;  4I50 B;  4NTY A;  2QSA A;  2E75 B;  1K97 A;  2ZE5 A;  2W6J G;  1NVP B;  3ABK B;  4HYO A;  5LBQ A;  4PDV A;  5B1B B;  1YSC A;  4GYC B;  4DW1 A;  3AG4 C;  5HFL A;  1OV9 A;  4A5U B;  3DXR A;  1BZK A;  4HNA B;  5KAF Z;  1IBM O;  1VQL V;  4X66 O;  4JI2 O;  3KG2 A;  4I9Q A;  4WFA V;  1BQ0 A;  1GN3 A;  2OTJ V;  4QIW F;  1N0J A;  1J5E B;  2JGU A;  4UV8 A;  2JEX A;  1EBO A;  2B5U A;  5JJN B;  1PNL A;  3UT5 B;  2FYU H;  1W2B U;  1PM9 A;  1THZ A;  4QE9 A;  4JI6 O;  3L72 H;  3JAK A;  4MW8 A;  5LXT B;  4JV5 O;  5CB4 B;  4PA3 A;  2DMX A;  2IJK A;  3OR7 C;  2EIM C;  4UCU A;  1ENV A;  4LCU C;  4PDR A;  4X20 B;  1M56 B;  2EIK B;  1M9N A;  4FLU A;  4FM0 A;  2A9H A;  4R6Z A;  3OMI B;  3SPJ A;  2B1I A;  2AW9 A;  3T1Y O;  4PHZ A;  1B06 A;  1RSO B;  3MDS A;  4J11 A;  1XI1 A;  3A0H Z;  2BTQ B;  5CA0 B;  3IJ4 A;  4I5S A;  4NR1 A;  3WG7 B;  2FML A;  4LNU A;  4P9P A;  1NTK H;  3U11 A;  4UFZ A;  2UU9 B;  2ZDI C;  4I4T A;  1GH6 A;  1W0J G;  3WFV A;  3K79 A;  5L3G A;  1AVM A;  3ETD A;  5GTH Z;  3JD3 A;  2HLD G;  2YIB D;  3K9S A;  3E8H A;  2DWD C;  4JGS A;  3CHX A;  3PJS K;  2HEP A;  4J9Z B;  2LFR A;  5IT9 N;  4O4H A;  2WLH A;  2WLN A;  2PF4 E;  1VMG A;  3AG1 B;  3STZ C;  2JS5 A;  3CCU V;  4B3T B;  4IYI A;  3K08 A;  1K33 A;  3ABL B;  2Q6A A;  4X62 O;  4B3R B;  3GVM A;  2Q73 A;  1IBK O;  3JD0 A;  1XHZ A;  1JFF A;  3FKS G;  5EBL C;  5HFM A;  4ZOL B;  4J42 A;  4RUF A;  1SKV A;  1URF A;  1M93 A;  1SRY A;  4UCS A;  2D3O W;  2OIE A;  1X59 A;  4JYB A;  3RWR D;  3JCZ A;  1AI4 A;  1H8H G;  2WLK A;  4NXN O;  1FS0 G;  3APO A;  3CXH F;  3X2Q C;  5IWA B;  4JI8 O;  1I0H A;  2JIZ G;  4NTX A;  4OX9 O;  2DWE C;  3WB2 A;  4QE7 A;  1SZX A;  4P9O A;  2YIB A;  4CH6 A;  3UO2 A;  3G6B A;  1VF5 B;  3NR7 A;  1PP9 H;  1RP3 B;  1XMO B;  1FFX A;  2GTS A;  1XOU A;  3M7M X;  2DE0 X;  1AR1 B;  4O2A B;  3LDD A;  5K1X A;  1GM9 A;  5DED A;  2WSS G;  2N74 A;  4LF4 O;  1VF6 C;  4MVQ A;  1XNQ O;  4K0K B;  4CS3 A;  2ZDI A;  2QM8 A;  2WLI B;  4UVB A;  4E4E A;  4JAA A;  5IJ9 A;  1Q7Y W;  2XAS A;  5GW7 A;  5BXZ A;  4TQF A;  3BPZ A;  4WBN A;  1RM1 C;  1HW7 A;  1GN4 A;  2Y4T A;  1QLN A;  4RUE A;  3MD0 A;  3CCM V;  4FLW A;  3VOU A;  4LH7 A;  3ASN B;  2B9Z A;  4DR3 O;  1HR0 O;  3FD9 A;  2CGN A;  4UVC A;  1SER A;  2WWW A;  4KUM A;  1S77 D;  4XDL A;  2KSD A;  2ZQM A;  3J80 N;  1Q6I A;  3B8N A;  4I0X A;  5H6R A;  5BMV B;  3OEE G;  4MS2 A;  2N05 A;  1YDX A;  2X6C A;  3ABK C;  5B1B C;  2F66 C;  3FX7 A;  1K4D C;  2PY5 A;  4DV4 B;  2UXB O;  4DV2 B;  3CJH A;  3RVZ A;  5E1A C;  2P6J A;  4TV9 A;  3MHS C;  5JVD A;  3H9V A;  2OYQ A;  5A2Q N;  1R73 A;  1KP2 A;  5KHH A;  2DYR B;  1NVP D;  4EB6 B;  5ITZ B;  1P84 F;  1ZWI C;  4UV9 A;  3CCQ V;  4OGQ B;  3RYI B;  2UUB O;  1FAF A;  4DV0 B;  4FM1 A;  4F6E A;  2V7Q G;  2PYL A;  1TAE A;  3UM7 A;  4KL1 A;  1MMM A;  4HZ3 A;  4I7Z B;  4JI7 O;  1IBM B;  1Y6X A;  4LF8 O;  2A3Q A;  4X65 O;  4DW0 A;  4FJC C;  1M56 C;  2EIK C;  3RYC A;  1XEQ A;  3JAR B;  3H1I H;  3T1C A;  4DR2 O;  1B04 A;  3KCY A;  4B3M O;  4ZIB A;  4YY3 O;  3AG7 A;  3F7V C;  3WG7 C;  3U0Z A;  4FM2 A;  2F43 G;  5KHG A;  2QKC A;  5C93 A;  4JYA O;  2H3O A;  5B1A B;  4DV5 B;  1QLE C;  2IH3 C;  1SA0 A;  4I50 A;  3DGE A;  2ZIM A;  1SQV H;  4PDM A;  5IYD O;  1VQ4 V;  1YTF B;  2XTA A;  2CE4 A;  1QQC A;  1NKD A;  3RBZ A;  4GLX A;  4DR6 B;  2YI9 A;  3IC7 A;  2XAH A;  3IFX A;  3O65 A;  3CX5 F;  4LFC O;  4FVM A;  3ZX6 A;  5B1O A;  2Q0O C;  4HNA A;  1KKD A;  1PV0 A;  2DN9 A;  2IJH A;  1F23 A;  1BL8 A;  1KEC A;  3UO3 A;  3AG1 C;  3G80 A;  4KP4 A;  2QDO A;  1DGS A;  2E5L B;  3G6E V;  3RW0 A;  3KCX A;  4AIL C;  1AJP A;  5CA3 A;  3ABL C;  4L87 A;  5EC1 C;  3HKE B;  3UT5 A;  1L0L H;  1QNM A;  1YVW A;  4RO2 A;  3VQX A;  1S0V A;  4NB5 A;  5LXT A;  1M90 W;  1SES A;  1EN5 A;  1OZ0 A;  3FYE B;  2YXH A;  4XDJ A;  3W7U A;  1J5E O;  1YEW A;  3ZCC A;  3ABU A;  3QO5 A;  2AHY A;  4FFK A;  4ZHQ B;  2C2A A;  2X6B A;  4PA6 A;  1FXK A;  4XBF A;  4DRX B;  3B8M A;  1RSO A;  1GM7 A;  3ZHU A;  5CA0 A;  4O4H B;  1GRJ A;  1I5Y A;  4Z1M G;  4WCE V;  1JJO A;  3I5D A;  2DJV A;  2UXX A;  1ZL8 B;  1S5J A;  1VQM V;  2Q8V A;  2P90 A;  1RPR A;  4CC6 A;  4CZZ A;  5EBM C;  3ETG A;  5TIS Z;  2A79 B;  1TUE B;  5L3F A;  4DYL A;  1JFF B;  3ASN C;  1AJN A;  1EN4 A;  5AG2 A;  4J10 A;  4U3F H;  3RN4 A;  1A32 A;  2ZIN A;  1K3E A;  1Q86 W;  2L6L A;  2UU9 O;  3QO7 A;  4DV3 B;  3RFR A;  2OCC B;  3K5N A;  5JJJ B;  4JZG A;  2Q7H A;  3L71 H;  1FFX B;  3CXC U;  1F7Y A;  4DR3 B;  2YSU B;  1G8M A;  3W7W A;  2XOK G;  1WNS A;  3JD4 A;  4EEQ A;  1IBL B;  4H33 A;  1KU9 A;  5D5P A;  2LJ2 A;  3CCE V;  1G4Y B;  2Z3Y A;  3BA9 A;  1EFR G;  3BAA A;  3GB7 C;  2ZE8 A;  3J81 N;  2P4V A;  2DYR C;  4WBN B;  4AHC A;  2DQ3 A;  4B3T O;  1I7F A;  4B3R O;  4GT1 A;  2QWO B;  4AQY B;  2Q69 A;  1I08 A;  1XHX A;  4O2A A;  5H2F Z;  5CBF A;  3BA8 A;  3BHP A;  1KYO F;  2F93 B;  3CC7 V;  2JGD B;  2WLI A;  2YC0 A;  3GWK C;  3CRA A;  5IWA O;  1S3J A;  2QM7 A;  4FLT A;  2EBO A;  4CH4 A;  1XQ8 A;  4BR6 A;  5B3S B;  2DOS A;  4DR5 B;  2LFS A;  3B77 A;  4MTX A;  4ZBM A;  2NN4 A;  2F95 B;  1XMO O;  2BOC C;  2R9A A;  3FB8 C;  4WFF A;  4H44 B;  3L9D A;  4JZ2 A;  4W4K A;  4X1Y B;  4J9Y B;  2OTL V;  4HBN A;  4YHH B;  1Z5W A;  4K0K O;  5B1A C;  4K3A A;  1KMI Z;  5BMV A;  5EIB C;  2IM9 A;  2JDI G;  4DV1 B;  1K73 W;  2HP8 A;  1Q5O A;  3A0B Z;  2WLJ A;  2LO1 A;  4J7Z A;  4DR2 B;  2FL4 A;  1H2N A;  3CRR A;  1NZ6 A;  1KP3 A;  5LA6 A;  3HKD A;  4CC5 A;  1WJZ A;  2GBO A;  3OFN G;  4NXM B;  2RMK B;  2LQT A;  1M4U A;  2YXL A;  4NTW A;  3ETE A;  1JA8 A;  4PA7 A;  5EIB D;  3ZHV A;  5ITZ A;  5IYB O;  2CH7 B;  4YJ2 B;  1NTZ H;  1YIJ V;  2WLL B;  4DV4 O;  4DV2 O;  1DTO A;  4EKW A;  3D36 A;  5LP6 B;  2RQ6 A;  4DXW A;  4DV6 B;  3K06 A;  1VIB A;  2F4V O;  3RYH B;  4PI2 A;  5D5Q A;  1FXV A;  5L3B A;  4J7K A;  2W6I G;  5IJ0 A;  5KHK A;  2YXY A;  3CC4 V;  5L3D A;  2RN9 A;  3FYI B;  4DK0 A;  3AG3 B;  1H2G A;  4O4J B;  3BCC H;  4DUY B;  1DF4 A;  1WP7 A;  4LWS B;  3ZJZ A;  3JAR A;  4DV0 O;  1K34 A;  2QKA A;  1NS1 A;  4JAS A;  1BHA A;  2A0L A;  2OIG A;  1BS3 A;  3LNM B;  2P22 C;  2ZR2 A;  4UB6 Z;  5J2T B;  5CN0 A;  1XDC A;  4KFM A;  4PA4 A;  4FLV A;  3RT3 C;  2F1M A;  1F4N A;  4O2B B;  2XAJ A;  3KKY A;  5JWP A;  3G71 V;  4IIJ B;  4MSW C;  1R6T A;  3RVY A;  4DV5 O;  1YXB A;  1IXM A;  2HJF C;  4MTO A;  4Q20 A;  4UXN A;  3FAV B;  2OCC C;  3P3N A;  3UQ8 A;  1I5X A;  3FB6 C;  2PYJ A;  4DR6 O;  2EUL A;  5LOV B;  1H38 A;  2Q7E A;  3HKE A;  1FXK B;  4UCT A;  1NBM G;  4JYY A;  4QPK A;  4GX2 A;  1HWY A;  2QWR B;  2Q67 A;  5KAI Z;  4GKK B;  4I55 B;  1YJW V;  2EIN B;  5KMG A;  3E86 A;  3TET A;  1LR1 A;  4WF9 V;  2E5L O;  1TA8 A;  4OPH A;  4J7J A;  4ZHQ A;  3HKB B;  1ZUQ A;  1IX9 A;  4DRX A;  4YXW G;  2M7W A;  3QNE A;  3JAT B;  2QEX V;  1BSM A;  4CH3 A;  1N8R W;  1BHB A;  1HP8 A;  1Q6U A;  3T4Z A;  1BT8 A;  1R3K C;  2Y4U A;  1O9H A;  4QNH B;  1ZL8 A;  1KQS U;  4LF9 O;  4UVA A;  3JAM N;  4TT3 G;  5B3S C;  2XND G;  3K04 A;  1IXB A;  3N2K A;  1NR1 A;  4G2K A;  1NQT A;  5K1P A;  2PI4 A;  4MW3 A;  3ZMT A;  2XAQ A;  1S72 V;  3VBB A;  4MVU A;  4PJ0 Z;  3LSS A;  1Q81 W;  4P30 A;  1JJ2 U;  4PV1 B;  5DM6 V;  3JD1 A;  1K7D A;  1JMK C;  1BMF G;  1XBL A;  2QA4 V;  2AZ2 A;  2GTA A;  3A8T A;  1JOY A;  1E1Q G;  4BWA A;  1XRE A;  2LW1 A;  3HKC B;  1FD9 A;  3FB7 C;  4DV3 O;  1CPY A;  4FMT A;  2UUA B;  1XUQ A;  3GWO A;  5CA1 B;  2UXD B;  1EZJ A;  2E76 B;  3M8A A;  2OT5 A;  4QGP A;  1TVK A;  1YZB A;  5LP6 C;  3QTC A;  2UUC B;  1GM8 A;  5FL7 G;  1G1X B;  1P7B A;  4NYK A;  5LL6 Y;  1YCI A;  2JGD A;  2IBZ H;  1IBL O;  4X1I B;  2VQE B;  1IUR A;  1Q43 A;  3K03 A;  3QO8 A;  3OD4 A;  3O9O A;  3CMA V;  3ZRS A;  3LNN A;  3AG3 C;  1VAR A;  5LGT A;  1VQ5 V;  1S76 D;  1R6N A;  5KX5 B;  3ICX A;  2Y0P A;  2Y48 A;  3IGA C;  3BRC A;  1EM1 A;  2VWK A;  2ETN A;  4AQY O;  3TXQ A;  5LA6 B;  2BE3 A;  3HKD B;  4X1Y A;  2F4V B;  3AEI A;  3K59 A;  1GAX A;  1ORQ C;  4UB8 Z;  4JYC A;  1HNZ O;  2KB1 A;  3BAB A;  2HKO A;  5DN6 G;  1WB7 A;  2CDY A;  3EXA A;  1ARO P;  1H8E G;  3E35 A;  2ADP A;  2CTW A;  2CGO A;  2Q4P A;  4DR5 O;  1YJN V;  3CE2 A;  3LSQ A;  2CTQ A;  1XIL A;  4LR3 A;  3ZHT A;  2A7W A;  1WPX A;  5LMU B;  3SYA A;  1N4C A;  4RQF A;  1AI6 A;  1GKF A;  2W0X A;  2RNB A;  4KXR A;  4YHH O;  3CB2 A;  3STL C;  1YI2 V;  4YIO A;  5IJ0 B;  3SPC A;  2HJD A;  3JAL B;  5J9P C;  3JD2 A;  3CME V;  2HR3 A;  4DV1 O;  1TUB B;  2K1E A;  5BR8 B;  2CH7 A;  4JI5 B;  4YJ2 A;  2ITC C;  4RQE A;  3OEH G;  2ODM A;  2WLL A;  1VF7 A;  1FXK C;  1AJQ A;  2P5O A;  4U7O A;  3ZMU A;  3W7X A;  3EFF K;  5LP6 A;  1US6 A;  2GHY A;  1ZX3 A;  5EBW C;  5JCO C;  3RYH A;  4NXM O;  2EIJ B;  4MVM A;  1K5Q A;  4LF7 O;  3ZHQ A;  3B09 A;  3R65 A;  3JAW B;  4ZKI A;  2EIN C;  1M5I A;  3E89 A;  4H37 A;  2FKX A;  4O4J A;  4U3J A;  2XUM A;  4LWS A;  4QJF B;  1JQ0 A;  1GO3 F;  5BZB A;  4DK1 A;  4ICG A;  3N2G A;  4MVO A;  1KD1 W;  2OWO A;  1R3L C;  2R9I A;  4LH6 A;  4C7U A;  1SQF A;  4DV6 O;  2ZE7 A;  2YS8 A;  3VQY A;  4BIO A;  4LFA O;  3CEI A;  4H13 B;  3H1K H;  3THO A;  4TOI A;  4RWU A;  2P7T C;  4O4L A;  4D6T H;  1Y4M A;  1D5N A;  5J2T A;  4DUY O;  2P4K A;  4CS4 A;  2N04 A;  4J80 A;  4AI8 A;  1PNM A;  1NJI W;  4O2B A;  3MAQ A;  5GTI Z;  4IIJ A;  2QWP B;  4OPA A;  2B1G A;  3E22 B;  1DF5 A;  4F4L A;  4LF9 B;  1N32 B;  5KMG B;  1N34 B;  3FAV A;  1WAZ A;  1SC5 B;  5LOV A;  1BE3 H;  1VQ8 V;  2UXC O;  1R3I C;  2BSK A;  1ROP A;  5JCO A;  3CCL V;  4JI4 O;  1K92 A;  2QKS A;  3CCS V;  4KHP O;  1V55 B;  4IT5 A;  1WLE A;  1UJW B;  1VQ6 V;  4K35 A;  4I55 A;  2R72 A;  3L75 H;  3SYC A;  1CEZ A;  2KKW A;  4D7T A;  3T4D A;  1B3Q A;  3HKB A;  1F4M A;  5EZY B;  4Z2W A;  4B3S B;  2VQF B;  1VQ7 V;  5KA5 A;  2KG7 B;  3N2K B;  3OAA G;  1NU1 H;  1OHH G;  2H94 A;  2FTK A;  3JAT A;  1F51 A;  3JAS B;  5H5N A;  3A2F A;  3D3Q A;  4X64 B;  4GKK O;  2ZCE A;  5FNV B;  3OM3 B;  4JF3 A;  3ASO B;  5IYZ B;  1COW G;  1KB9 F;  4WFB V;  1VQN V;  5A9G A;  4TSF G;  5LYJ B;  3BFR A;  1T5E A;  1FPO A;  3VQW A;  3WB0 A;  1FJG B;  2V4D A;  2R9R B;  4BW5 A;  3ZRX A;  1NI8 A;  3OE7 G;  1K9M W;  1LUW A;  5FPO A;  3APQ A;  5JH7 B;  5JJE B;  3CC2 V;  1D5A A;  2JRI A;  4GCZ A;  4J41 A;  2YDE A;  3TCU A;  4I9W A;  4DO2 A;  1QHT A;  4QPJ A;  3QVN A;  3CPW U;  4WFE A;  4GZR B;  4CS2 A;  4E2L A;  3EVK A;  2AGA A;  3A0R A;  2W0F C;  1Y76 B;  2GDS A;  1TVK B;  1Z5V A;  5IYC O;  3D36 C;  3OMN B;  5F2V O;  5LMN B;  1PL4 A;  1JPX A;  3P32 A;  3ZRW A;  1HNZ B;  1WA8 B;  3OTF A;  3HKC A;  2D2C B;  5EK0 A;  4D7S A;  4H0L B;  2HVK C;  1P4R A;  1E1R G;  4TQD A;  3CP1 A;  5KLV H;  5CA1 A;  3SJA C;  1PD3 A;  3H01 A;  2AZ0 A;  4O4I B;  1QVG U;  2EZP A;  1K8A W;  3CCJ V;  2GUZ B;  1N36 B;  1I94 B;  3AK1 A;  2ZT9 B;  2EIJ C;  2YEV A;  4X1I A;  2GV9 A;  5B66 Z;  1TGO A;  3SPG A;  2QR4 A;  1H2M A;  4DR1 O;  3LUT B;  3CRC A;  3DC6 A;  3BY6 A;  1AI5 A;  3K0D A;  2EJ7 A;  3D8C A;  4DR7 B;  2UUA O;  2UXD O;  4IHJ B;  5KX5 A;  1M1K W;  2JS3 A;  3HB3 B;  3DC5 A;  1G6U A;  3HPL C;  3QF7 A;  3PN1 A;  4JI3 B;  4B7E A;  1VQ9 V;  2ZNI A;  1J95 A;  2DYS B;  2UUC O;  3CS5 A;  2LGW A;  3JSN A;  4PI0 A;  2MK3 A;  1UPG A;  4P2Z A;  3J7A U;  4UCO A;  2VQE O;  4LF7 B;  4WFH A;  5LHH A;  1XMQ B;  2AHZ A;  3OR6 C;  4LF6 B;  1WPB A;  1AIL A;  5KHJ A;  3U10 A;  2ARH A;  4CBC A;  1QCE A;  2LW7 A;  2CTR A;  5J2U B;  3ZHR A;  1FFT B;  1MZF A;  5H9C A;  4WFG A;  1RPO A;  1ZAU A;  2PZS A;  2QJ1 A;  4LFA B;  5L3E A;  3AK3 A;  4DUZ B;  2XAF A;  2BOB C;  3JAL A;  5EC2 C;  3QG5 A;  1M57 B;  3ETQ A;  1PPJ H;  2RCV A;  1WN7 A;  1TUB A;  4U3J B;  1OCZ B;  4EFB A;  5FPR A;  4FPP A;  1QVF U;  3OW2 U;  3N2G B;  3FB5 C;  3JCU Z;  5LMU O;  3ZRV A;  3K5L A;  1FYJ A;  4PDL A;  4DR4 B;  4FK5 C;  3AG2 B;  5LHG A;  2O57 A;  3N27 A;  1V55 C;  3ZHS A;  3JAW A;  1GMG A;  2ZXW B;  4O4L B;  2EJR A;  5BY1 A;  5BR8 O;  2NLJ C;  3K57 A;  1X4T A;  2LP7 A;  4JI5 O;  3W7T A;  2UXC B;  3UKM A;  3E2E A;  2KQX A;  5CMU A;  1Q8I A;  3RYF B;  1H2S B;  1LNQ A;  2FB5 A;  2YID A;  3E83 A;  4JI4 B;  4GX5 A;  4BIZ A;  2JJ2 G;  4KHP B;  1OJH A;  2CUG A;  3RGB A;  3ASO C;  2Q7G A;  4NVP A;  2YIA A;  1OCO B;  1SQX H;  4UCR A;  1XL4 A;  5L3C A;  2BSK B;  4PA9 A;  2X0L A;  3ABT A;  3OUF A;  1PL0 A;  2QM4 A;  3E8G A;  2Z0A A;  2JJ1 G;  1OCC B;  1SQB H;  4ABM A;  4X8A A;  4Z1V A;  2YUA A;  3E22 A;  1N33 B;  4IL6 Z;  2RJZ A;  4FFB B;  3EHB B;  4X1K B;  1GN6 A;  1AR4 A;  4N21 A;  1IVS A;  2GSM B;  2JEU A;  4MT8 A;  3ABM B;  3FFQ A;  1U97 A;  2QTS A;  5JQG B;  4NKG B;  3K58 A;  2CAZ C;  3SR2 C;  1QLE B;  2IJJ A;  5DEC A;  3T1H B;  3CCV V;  3MHH C;  1N32 O;  2BTO A;  4MTF A;  4JAV A;  1N34 O;  1JVM A;  3DTU B;  1PKX A;  2ATK C;  3OMA B;  5EZY A;  2F23 A;  3L73 H;  3P30 A;  2KG7 A;  2PTM A;  1ZSP A;  3VQV A;  1MZE A;  3TGU H;  3JAS A;  1KUQ A;  5KA6 A;  4FZ1 A;  1XNR B;  1SQG A;  4IYH A;  2IJI A;  1R1B A;  1OCR B;  5FNV A;  1HNW B;  3OTO B;  1DLB A;  5IYZ A;  1P7G A;  4BW9 A;  1Q90 D;  3P3P A;  3SJC C;  3LDE A;  2BCC H;  4B3S O;  2VQF O;  4LFB B;  1L1F A;  2ZIO A;  1AI7 A;  3B4S A;  5LYJ A;  2NNU A;  2DYS C;  3K5O A;  5B1N A;  3R66 A;  3ZRW B;  3H1J H;  1QU7 A;  3G67 A;  5JH7 A;  2RDC A;  4X64 O;  3IC9 A;  5C8Y A;  4DR1 B;  3OT7 A;  1JCH A;  2ZNJ A;  4XDK A;  3ZMV A;  2A06 H;  2G38 A;  1Y76 A;  2ZE6 A;  1SQP H;  1YHQ V;  1MOF A;  4GX0 A;  3ZN1 A;  4ZI7 A;  4LBE C;  2HHH O;  3M99 B;  1FJG O;  2WAM A;  5EYP A;  1LUV A;  4G28 B;  1YF2 A;  5LHI A;  2YEV B;  3AK2 A;  1WA8 A;  1Z2G A;  1BQZ A;  4FLY A;  2QWN B;  1M57 C;  4F6R B;  4TV8 A;  1VQO V;  4MVS A;  4JTD B;  1OCZ C;  4DV7 B;  4GKJ B;  3I55 V;  3L74 H;  5E79 Z;  3KZI Z;  4O4I A;  2ZR3 A;  2XAG A;  4JI0 B;  4LF5 B;  2QGN A;  1NR7 A;  2GUZ A;  4RAI A;  5LMN O;  4JAU A;  1SQQ H;  1Y74 A;  3Q4H B;  4JI1 B;  3AG2 C;  1SF9 A;  3WU2 Z;  2ITD C;  2ZXW C;  4PEL A;  1V9P A;  3BVO A;  2IH1 C;  5FLX N;  3LDC A;  1L0N H;  2ZD9 A;  4IHJ A;  1CXZ B;  4TUY B;  2OCH A;  2ZM6 O;  1K4C C;  4B08 A;  3DSQ A;  3SPI A;  4B7K A;  1WB8 A;  1HNX B;  1ZTE A;  5B5E Z;  1N36 O;  1I94 O;  5KHI A;  3BEH A;  2VRZ A;  3B40 A;  2XT9 A;  3L70 H;  1H2L A;  4CH5 A;  4YJ3 B;  3IAY A;  2EIL B;  4L8J A;  1OCO C;  4DR7 O;  1AP5 A;  5GON B;  3CD6 V;  1VF6 A;  4W4L A;  2MW2 B;  3H1H H;  4JI3 O;  1NH2 B;  3S3X A;  1VP7 A;  3ML0 A;  4FIP C;  5J2U A;  4X66 B;  4JI2 B;  1W59 A;  1OCC C;  5IY5 B;  2QTO A;  3SJQ C;  3ZS8 C;  3SPH A;  3JSL A;  1IZ3 A;  1XMQ O;  4LF6 O;  3ABM C;  3OGC C;  4ASU G;  1KC8 W;  2HG5 C;  1YJ9 V;  1BCC H;  4TWK A;  3ZIA G;  4JI6 B;  3DXR B;  4LP8 A;  2VWJ A;  4JV5 B;  3ZMS A;  2M6Y A;  1Q82 W;  1GK9 A;  2HFE C;  4JTC B;  5KUM A;  5KUK A;  1B6Q A;  2P06 A;  4DUZ O;  4BAY A;  1S5L Z;  4IGG A;  3F5T A;  3T1Y B;  3SYQ A;  1VQP V;  3CSX A;  3SGI A;  4LC1 A;  4FLX A;  4BIU A;  2Q5Z A;  3RYF A;  2IW5 A;  3JAK B;  3TJT A;  1VEW A;  2UXN A;  4X88 A;  4DR4 O;  4R7C A;  3D3I A;  1V54 B;  5IDJ A;  1R6K A;  1VQK V;  2EX3 A;  1OCR C;  1RFY A;  2L35 A;  2Q68 A;  1K5S A;  1WP8 A;  1HDJ A;  3H1L H;  3K3W A;  3NXS A;  2HVJ C;  1MNG A;  2WPD G;  4LNU B;  4GX1 A;  3TK1 A;  1KKC A;  3K9A A;  2Y69 B;  2Y0I A;  5CB4 A;  5CBH A;  4I4T B;  3C3T A;  1S5H C;  3CRM A;  4X20 A;  1XL6 A;  4FFB A;  4X1K A;  5LGN A;  3F5W C;  4X62 B;  1L8D A;  4K8Z A;  1NTM H;  2AXT Z;  4MVR A;  2WA3 A;  1IBK B;  1Q6H A;  4MVZ A;  4G27 B;  5JQG A;  3C90 A;  1JX9 A;  1MSW D;  2BTQ A;  1D2D A;  3AG4 B;  1ZLZ A;  2R70 A;  3TXS A;  2YI8 A;  4NXN B;  1EN6 A;  2V1D A;  4JTA B;  2X7R B;  1PNK A;  4GUN A;  4U7N A;  4JPR A;  1YIT V;  4JI8 B;  4OX9 B;  3CCR V;  1UFI A;  1N33 O;  3WB1 A;  2ADQ B;  2NR5 A;  3E8B A;  3CWB H;  1N0N A;  2X6A A;  1MSD A;  2ILM A;  3F7Y C;  3CRQ A;  1Y67 A;  4LF4 B;  3ZED A;  1XNQ B;  3OUS A;  4Q6G A;  3I56 V;  1BGY H;  2HHH B;  1AP6 A;  4EFE A;  2IU0 A;  1Q3E A;  3SYP A;  2EIM B;  2PUS A;  2Z5U A;  3T1H O;  4HAM A;  3HR0 A;  1SET A;  2LGQ A;  4R8C A;  2Q0A A;  1KBH A;  2CK3 G;  5C8Y B;  1IDS A;  4UCV A;  1JR9 A;  1MA1 A;  3UCS C; 
#chains in the Genus database with same CATH homology
 2QWP B;  2QSA A;  1XBL A;  2QWO B;  2Y4T A;  2EJ7 A;  3BVO A;  1BQ0 A;  3UO3 A;  2CUG A;  2DMX A;  2CTW A;  2LO1 A;  2QWR B;  1FPO A;  2YUA A;  4RWU A;  4IT5 A;  2PF4 E;  4J7Z A;  2CTQ A;  2L6L A;  1FAF A;  1GH6 A;  2Y4U A;  2GUZ B;  2OCH A;  3APO A;  1NZ6 A;  3APQ A;  2GUZ A;  1N4C A;  2QWQ B;  2N04 A;  1WJZ A;  2LGW A;  4J80 A;  2KQX A;  2CTR A;  1IUR A;  3AG7 A;  1HDJ A;  2CTP A;  2N05 A;  3UO2 A;  1BQZ A;  2M6Y A;  2QWN B;  3UCS C;  2YS8 A;  2DN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...