1NZ6A

Crystal structure of auxilin j-domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function analysis of the auxilin J-domain reveals an extended Hsc70 interaction interface.
pubmed doi rcsb
molecule keywords Auxilin
molecule tags Protein binding
source organism Bos taurus
total genus 29
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2003-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1nz6A00
2OCHA 2Y4TA 2QWOB 1WJZA 2DMXA 2EJ7A 1GH6A 1BQ0A 2QWQB 3APOA 4IT5A 1FAFA 2QWRB 1HDJA 2L6LA 3BVOA 2LGWA 2GUZB 2YUAA 3AG7A 4J80A 1BQZA 1FPOA 3UO2A 2M6YA 1XBLA 1NZ6A 2N04A 2QWPB 1IURA 3UCSC 4RWUA 2QSAA 2YS8A 2QWNB 2PF4E 2CTPA 3UO3A 2KQXA 2GUZA 2Y4UA 2DN9A 4J7ZA 3APQA 2CTRA 2CTWA 2LO1A 2CTQA 2CUGA 2N05A 1N4CA
chains in the Genus database with same CATH superfamily
4X62O 4MTXA 1FS0G 2LFRA 1FXKC 2A3QA 4JI0O 2WWWA 3JCZA 4JAVA 3VOUA 4O4JA 3RFRA 2DYRB 4EB6B 1D5NA 5LGUA 1NR1A 4TOIA 2AZ2A 4MTFA 2ZM6O 3IC7A 1NTZH 4JAUA 3L70H 5IYBO 3AG4B 3ASOC 1K73W 5CA1B 2GSMB 4O4HA 4UVCA 3GVMA 5KAIZ 3SYQA 5LGNA 2CTWA 4DV0B 3T2MA 1XNQB 1MSWD 5GTHZ 2WLJA 3G80A 2LP7A 4NKGB 3DXRA 2QEXV 1YTFD 4LH7A 1AI5A 2B5UA 4B3MO 2FL4A 4DV7O 3K5LA 1EZJA 3ML0A 4X65B 4U3JB 4DXWA 1FXKA 4YJ2A 3STZC 4UCVA 2WLMA 4DV3O 1OCOC 2ZE8A 3B4SA 3JAKB 4PJ0Z 2BE3A 1SQXH 1MA1A 1MZFA 2X0LA 1V9PA 1XBLA 5GW7A 2UXBB 3RYHA 1PP9H 2LFSA 2Y48A 3ABKB 1XDCA 2BTQB 1XQ8A 1Q86W 2ZQMA 4O4LA 4TQDA 3LSSA 4F6RA 2JDIG 3U11A 3BRCA 2GTAA 2V7QG 3FX7A 3R66A 1EBOA 3PJSK 1WA8B 4X8AA 3T1HB 4JI6B 3IGAC 2K1EA 3E83A 3BVOA 4JI4B 2F1MA 2H3OA 1YJNV 3JASA 2FB5A 3ABMC 4DR1O 5IYZB 2WLKA 1M90W 3RYFA 5KMGA 3H1KH 1UFIA 4UB8Z 5LA6A 3TETA 1NT2B 2UU9B 2IU3A 2CE4A 3SR2C 1ZWIC 2VQEO 1G6UA 2HR3A 1ZAUA 2IJIA 2GUZB 4I7ZB 4K0KB 1DLBA 1DF5A 1D5AA 5DN6G 1L8DA 1RSOB 3E35A 5IJ0A 3UT5B 1K34A 3CP1A 4HNAA 1PL4A 1Q6IA 1M4UA 5CA0A 2Y0PA 2ZDIC 4RAIA 5JH7A 1VIBA 1W0JG 2EULA 3Q4HB 3QVNA 4UCTA 4MTGA 4DV4B 3J81N 3LDEA 1XREA 3SYPA 2YIBA 4JGSA 4U7OA 1J5EO 4B3SO 4XDJA 3ZBHA 4PDVA 1JPXA 4J42A 2LW1A 5HFLA 5J2UA 4ICGA 1EM1A 3E8GA 3K59A 3JALB 1MG1A 4PV1B 3T1YO 2Q68A 1KYOF 2B1IA 2IM9A 4PA3A 2RDCA 2D2CB 4K3AA 3F5TA 1ZL8B 3BFRA 4LF5B 1FYJA 4O2AB 4RUEA 4BWAA 3CC2V 3CD6V 1H2GA 2OIGA 2EILC 2Q7HA 1S0VA 1R3IC 4J9YB 5KUKA 4CC6A 1YIJV 2FMLA 4O2BA 2ITCC 3HKBA 5C8YA 4DV5B 1IXBA 4JI1O 1T5EA 4LFBO 1VQ6V 1QVFU 1PNMA 1JVMA 3RYCB 2XNDG 4MVUA 3E22A 5JQGB 3C90A 1GMGA 3K08A 1SRYA 1W2BU 1GH6A 3B2EE 4O4JB 1OJHA 3CE2A 3BY6A 2JIZG 4Z1MG 3RN4A 4I0XA 1EFRG 1MSDA 4L8JA 1YF2A 2BTOA 3AG3B 2DJVA 3VQYA 5LBQA 1SA0A 3OFNG 3BEHA 1Y4MA 3CRRA 2QR4A 5J2TB 3G4SV 1GRJA 4PD4F 2P5OA 5IY5C 1MZEA 2F93B 1RPOA 2KG7A 3OE7G 3QTCA 1KB9F 3OTOB 4O4HB 3WB1A 2EIKC 3H1JH 3BPZA 4JTCB 1HNZB 3CHXA 2OCCB 3KKYA 4QJFB 1SQBH 1QLEB 1H8HG 4ZBMA 2VWKA 2ZE7A 4QNHB 2BCCH 2Y4TA 2A79B 3B40A 4YIOA 1Y76A 4DUYB 4EFBA 1BL8A 3P32A 1SQGA 1IBMO 3CYOA 5B1NA 3E86A 2XAJA 4CS3A 1F4NA 1TUBB 2LJ2A 1M9NA 1SERA 1WN7A 3RYHB 4ZI7B 5CB4A 5BY1A 3OUSA 3W7XA 5IJ9A 4CS2A 1SZXA 2HG5C 3CXHF 4O4LB 2GV9A 3STLC 3JARA 3MAQA 4KHPB 2WLLA 4I50A 4DV6O 4IGGA 4JTAB 2UUBB 1M93A 4IL6Z 4JI5B 3ASOB 1BT8A 2YI8A 3VQWA 4JI3B 2UXCO 4FLVA 1XHZA 4K8ZA 3RYFB 1AI7A 1YJWV 1XMQB 1NVPD 1NBMG 3CCUV 1H38A 4TSFG 4DR2O 1QVGU 1JA8A 2XAQA 1O9HA 1KUQA 2KB1A 1GK9A 2IBZH 3SGIA 1MABG 2WSSG 4HBNA 5EIBC 1FXHA 1Z5VA 1AJNA 3ZHTA 4LNUA 1K3EA 1AP6A 4ZOLA 4X66O 3E8BA 4DK1A 4JI8O 4FMTA 1I5YA 3AG7A 3CX5F 1K33A 5CA0B 1Y74A 5JH7B 2YIDA 1Q5OA 1N36O 1EZVH 5BMVA 4OX9O 2XASA 1P84F 1HWYA 4Z2WA 4GX0A 4I9WA 1QCEA 2QWOB 1LR1A 5KA5A 1WP8A 2ZNJA 4B7KA 2L6LA 3D3IA 1HNXB 1N32B 5J2UB 3ZHRA 2YSUB 1EN6A 2QSAA 4TV9A 1WB7A 5LYJB 3W7TA 1GAXA 3ABMB 1XEQA 3DGEA 4JYBA 4G2KA 5ITZB 4PA7A 1GKFA 1R6TA 1KD1W 1JX9A 1FJGO 5CBGA 5LMUB 2HVJC 3J7AU 1G4YB 2BSKB 2NLJC 3LUTB 3MD0A 2P6JA 3CCMV 1XHXA 4TT3G 2YEVB 3K3WA 5L3EA 2PI4A 4LF4B 4CZZA 4OGQB 4GLXA 4I9QA 5KLVH 3HKBB 2UXDO 4B3TB 1Q81W 4WBNB 3L9DA 1UJWB 1TVKB 1RP3B 2EIJC 1VQKV 4JTDB 5E1AC 3ZHVA 1G8MA 5BR8O 4PA4A 2ZXWC 2UUAB 2JJ1G 2EJRA 1PL0A 3E22B 3H1HH 1P4RA 4FFBB 4DYLA 4XDKA 5IE9A 4LF9B 1P7GA 1KU9A 1H2NA 3KG2A 1WNSA 4UVBA 1RM1C 5FLXN 1N4CA 4Q6GA 3N2GA 5L3FA 1SQPH 2HHHO 1JFFA 4NVPA 5EYPB 1K7DA 4X1KA 2Q7EA 2ZT9B 3AG2B 1DF4A 5EZYA 1ZTEA 3CRCA 3JAMN 3LSUA 3SYOA 2ILMA 2EIMC 2EZOA 4PDLA 2UXXA 4X1IA 1ZUQA 4WFHA 1R3JC 1W0KG 2R72A 4GKJB 3J80N 2IH3C 2WLHA 4FVMA 2XT9A 2EILB 1S72V 2DQ3A 3BCCH 3U10A 5IWAB 3FAVB 2E76B 2AW9A 2GBOA 2XAHA 3FYIB 2N74A 2VS0A 1HNZO 5LP6A 3B8MA 5DECA 4CH3A 4DUZB 2P67A 3ZHSA 2RQ6A 5LXTB 1K8AW 4GUNA 5CBHA 3TGUH 2QJ1A 3N2KA 2F4VO 4HZ3A 4ZHQB 2NN4A 3K9AA 1GTOA 4LFCB 4JV5B 3WB0A 4GKKB 4FLWA 4D6TH 2RMKB 3D36A 2EJ7A 2CH7B 2IH1C 2WLLB 4I50B 5CN0A 4NTXA 4XDLA 1Q82W 5IY5B 1XNRB 3ZRXA 4LR3A 1RFYA 1VQOV 2JVDA 2Q8VA 2E3CA 2EIKB 4FLTA 1VF6C 1I0HA 3W7WA 1IVSA 4EFEA 1J95A 2AXTZ 3AG1C 1SKVA 2X6AA 1Q3EA 2W6IG 4RO2A 1R3LC 2H8PC 3FKSG 1SESA 4QE9A 4OPAA 4QIWF 4LF6B 3OEEG 4YY3O 1US6A 3IJ4A 3THOA 2JGDB 1QLNA 4U7NA 2JEXA 2V1DA 1JJ2U 3OAAG 3JD4A 4JYAB 1AB3A 2Z5UA 5BMVB 4JYCA 3QO8A 2F66C 2EINB 3ZCCA 4WFAV 2ZR3A 4Q20A 3RGBA 5EC2C 3HPLC 4IHJA 3T1CA 2Q0AA 3FFQA 1S5JA 4KFMA 2Y0IA 3HKEB 2ODMA 3E8FA 3H01A 2VQFB 5KX5A 2M7WA 4WFFA 1IX9A 1MNGA 1VF6A 4NXNO 1AJPA 1Y66A 1HNXO 1N34O 2DN9A 3B77A 3HKDA 3K79A 2RCVA 5EBLC 2WLIB 3LDDA 1L0NH 2A9HA 4DR4O 1BE3H 4FLZA 1YXBA 4BIZA 3L74H 4DR6B 5L3DA 3BA8A 4FM0A 5CMUA 2Q4PA 4X89A 1BHAA 2PYJA 2XUMA 4DR5B 3CJHA 4H13B 1VQPV 4JI7B 4KXRA 4HAMA 1DK1A 2ZE6A 3HKCB 2E74B 1K4DC 1NS1A 2XAFA 4WFBV 3A8TA 4GX1A 3WB2A 1KQSU 4A5UB 1KECA 3OGIB 2DOSA 4HYOA 1NH2B 1KKCA 4UVAA 4GCZA 4NXMB 4I5SA 3N2GB 4H0LB 4P30A 5BZBA 3ABTA 1GN3A 3CCRV 1X59A 1DTOA 3EVKA 2CGOA 5LMNO 2YXHA 4X1YA 4I4TB 3FB8C 4WCEV 5JCOC 4B3RO 4TV8B 4DR7O 1IURA 5B1AC 3ETDA 3UQ8A 2AHZA 3B09A 3RVYA 1Y67A 1H8EG 1ZLZA 2WPDG 1PPJH 1D2DA 2Q5ZA 2AGAA 1QNMA 4W4LA 2YIAA 4QE7A 3E2EA 4IIJA 2JS3A 4IYIA 3CXCU 5GONB 3SJBC 1AVMA 2QTSA 1BZKA 2EIJB 4DR3O 3SJQC 2ZXWB 3FD9A 3JAWA 2KQXA 4X20B 3I56V 3OGCC 2F23A 3ZMZA 2OT5A 2XAGA 5DM6V 1LUVA 3N2KB 2CGNA 4LC1A 1RM1B 1HR0O 1Z5WA 3ABUA 2GTSA 4CC5A 2PI5A 4UUJC 5IT9N 4FM2A 3CCEV 4TUYA 5BXZA 1AP5A 2E5LO 2K9PA 4DV1B 1PNKA 3JD2A 3F7YC 1BMFG 4CS4A 1PD3A 4LFCO 2ZD9A 4LF8O 4JV5O 3ZEDA 1VQLV 1M56C 1K4CC 3P3PA 1IBKO 3P3NA 1Q43A 5JCOA 1K97A 3KCXA 4CBCA 1NZ6A 1JR9A 3UCSC 3SPHA 2ZIMA 3RT3C 3E8HA 2ADQB 5B5EZ 2P06A 4DRXA 4JI2B 3WFVA 3ETGA 4P9OA 2IJJA 4PDMA 5EBMC 3ZMTA 3SYAA 1R73A 3MHHC 3CWBH 1S3JA 3JSNA 2FYUH 3ABLB 3CS5A 1TAEA 1TGOA 2NNUA 2QA4V 4UCUA 1I94B 1THZA 2PTMA 3L73H 2WA3A 4RWUA 4O4IA 3RBZA 1AI6A 2QM4A 3DXRB 3QNEA 4J10A 2F95B 3K5NA 2F43G 3GB7C 3T4ZA 1OCCC 3VBBA 4BAYA 4DV0O 1XNQO 3JSLA 4IHJB 3JD3A 2WAMA 1FXKB 3WG7C 2BOCC 4YJ2B 1N33B 1NKDA 4GX5A 1N8RW 1SQFA 3SPGA 2FKXA 4YHHB 3IC9A 2Z0AA 3X2QC 5KX5B 3CCSV 3OMAB 5FNVA 4X65O 4X64B 2P7TC 1QHTA 3WU2Z 1R3KC 1XILA 3OR7C 2YUAA 3HKDB 5K1PA 1BSMA 1XMOB 2QWPB 1LUWA 4F6RB 3K0GA 1DGSA 4H44B 1YJ9V 4X62B 1VF7A 4YJ3A 3AK3A 3K0DA 1YTFB 1NTMH 4CH6A 3A2FA 4I55A 4JI0B 1VQ9V 3P30A 2UXBO 3TJTA 5F2VO 3JASB 4F6EA 1L0LH 5EBWC 3TXSA 1JOYA 4R8CA 1GN2A 5KMGB 5LGTA 3L72H 3RW0A 3CPWU 1IBLB 2N04A 5LA6B 3T1HO 1P7BA 4JI6O 3ZIAG 1R6NA 2ZM6B 3TCUA 4FFKA 4JI4O 4PA6A 4GZRB 2B1GA 2MW2B 3T4DA 2Q69A 3K5OA 4R7CA 4JI7O 2DMXA 1NU1H 1SQVH 5IJ0B 3ABKC 5K1XA 3A0BZ 5LHGA 1OZ0A 1ROPA 4HNAB 4P9PA 2UU9O 1N0NA 1A32A 1OV9A 1OCOB 2ZIOA 2R9RB 4G27B 2CAZC 3RWRD 1QU7A 4K0KO 4GX2A 3SJAC 4RQFA 4RUFA 2JJ2G 5H9CA 1PM9A 4ASUG 5CA1A 4B3MB 4DV7B 3DSQA 4YIPA 3APOA 2G38A 3PN1A 1I5XA 1OHHG 1KKDA 2HP8A 4PELA 4DV4O 4IIJB 4DV3B 1Q8IA 2YI9A 1EN5A 1I7FA 5L3CA 1YITV 4U3JA 3K57A 1U97A 3JAWB 1ORQC 5A2QN 1VP7A 3JAKA 1XL6A 2XHBA 2QKAA 4H37A 3ZMSA 5CBFA 4LF5O 4O2BB 4LWSA 5C8YB 1YHQV 1I08A 2ITDC 5LHIA 3R65A 5LP6C 3ETEA 2BTQA 1E1RG 4DR1B 4LF7B 3K04A 2JRIA 4ABMA 1FPOA 1WA8A 2WLNA 4DV5O 5JWPA 3ZMVA 1EN4A 1PV0A 4MW3A 5IYZA 1K5QA 5B1AB 5EK0A 2ADPA 4I0XB 3SPIA 2RNBA 4OXSA 5B1BC 2QDOA 1SA0B 3AK2A 1JCHA 1V54C 3NXSA 3D36C 3HB3B 2W0XA 4DRXB 2Y69C 1NJIW 2DQ0A 3ASNC 3DTUB 1QQCA 4J7JA 3ZHUA 4YXWG 3JYCA 2KG7B 1S76D 4J11A 4FZ0A 4FM1A 2DWEC 2D3OW 1RSOA 1H2KA 4JZ2A 3UT5A 1VF5B 3D8CA 1J5EB 1CXZB 4B3SB 4MVOA 1K92A 2Q9LA 2Q0OC 1L1FA 2ZCEA 2KKWA 2YC0A 4FJCC 4K35A 3ZN1A 4B7EA 1FFTB 5TISZ 3OTOO 1VQ5V 2B9ZA 1OCZC 3A0HZ 1AI4A 3ZS8C 2P4KA 3K9SA 5H6QA 2A0LA 4PA9A 1Y76B 5H5NA 4MW8A 4Z1VA 3D3QA 2QWRB 5IDJA 1YSCA 5JJEB 4NTYA 4DW0A 2Q67A 1M56B 2DYSC 3L75H 1BS3A 5LHHA 1AILA 1ZL8A 2GHYA 4K8XA 5CB4B 3EHBB 1AJQA 4DUYO 3CEIA 5IJ9B 2N05A 2OTLV 2Q7GA 1VEWA 1WJZA 2OCCC 1Q7YW 3JARB 4DK0A 1QLEC 1KP3A 2HEPA 4YJ3B 3VQXA 4BW5A 5EC1C 3K5MA 3OR6C 1B6QA 3I5DA 2CTQA 1VQ4V 4KHPO 2R70A 3ZRWA 3RYCA 2KSDA 5JQGA 1SF9A 2UUBO 2OIEA 1W59A 3BAAA 4JI5O 3H1IH 4J80A 4JI3O 1OCCB 1VQMV 2QTOA 3JATA 4LNUB 4X9QA 3LNNA 4J7KA 4ZOLB 1XMQO 1AROP 1JQ0A 1IBLO 1V55C 4W4KA 2Z3YA 2RN9A 1GM8A 4UCOA 2YDEA 3WG7B 5JJNB 1CP9A 2JS5A 3FB5C 4E4EA 1MOFA 4NTWA 5B3SC 3K58A 2HJFC 1F51A 1NTKH 3RYIA 4B08A 5J2TA 1Y74B 1BCCH 1YVWA 3X2QB 3F5WC 3F7VC 1HNWB 4JF3A 4BW9A 4H33A 4EEQA 5D5PA 1M5IA 3G67A 4BR6A 5KHKA 2JEUA 4LH6A 1NVPB 2OTJV 2HJDA 5LL6Y 4CH5A 2BOBC 3ZRSA 2ZKOA 4N23A 4FPPA 4N21A 4U3FH 4D7TA 1H2LA 3G6BA 4J41A 5KHIA 4TV9B 1E79G 1GM7A 4L87A 1IBMB 3SJCC 3CCQV 1Q90D 3RVZA 2AHYA 2R9AA 2ZINA 5E79Z 1N32O 2OYQA 5IYDO 3JD1A 1HP8A 3TXQA 5LOVA 1Y6XA 4DV6B 3OD4A 2JGUA 1TUBA 4UFZA 3OMIB 3OT7A 4LWSB 1YEWA 2ATKC 4LP8A 4JASA 1WPBA 1RPRA 4JYYA 4ZI7A 4NR1A 5LMUO 3K06A 2UXCB 5KHHA 1KP2A 1FXVA 3OUFA 2LGQA 3NR7A 3AEIA 2OCHA 1F4MA 3FYEB 4LF4O 4J9ZB 4C7UA 4DR2B 1JJOA 3N27A 4BIUA 4B3TO 3O9OA 1ZX3A 1IXMA 1S5LZ 4KL1A 3CC4V 4R6ZA 4LF7O 2YIBD 3OTFA 1WLEA 3IAYA 1H2MA 2UUAO 4X66B 1CPYA 5L3GA 2DE0X 1B06A 2CK3G 2DWDC 4JI8B 1GO3F 4LF9O 1JFFB 1S77D 1FAFA 2HKOA 4UV8A 4WFEA 4IYHA 3ZRVA 4X1KB 1QR9A 3CRAA 4MT8A 4IT5A 1SZTA 1HW7A 1FD9A 5EZYB 2LGWA 4OPHA 1UPGA 1N36B 1URFA 4OX9B 1JMKC 1PKXA 1H2SB 4X1IB 3OM3B 3CC7V 5L3BA 5KA6A 1SQQH 3SYCA 4GYCB 3CCLV 2X6CA 4MVMA 1B04A 5B1OA 3TK1A 1OCRC 2EBOA 3QO5A 4RQEA 3CSXA 4UCRA 5LP6B 3EFFK 4GKJO 1B3QA 3KCYA 4LBEC 1KMIZ 2P22C 3C3TA 4MVZA 2UXNA 5IWAO 2PGGA 5DEDA 1FJGB 4AQYB 5IYCO 3DC5A 4MVSA 4DV2B 5LYJA 3AG2C 4F4LA 4TQFA 3OW2U 2MK3A 1SS3A 1HDJA 4LCUC 4TWKA 5ITZA 2XTAA 2UXDB 5HFMA 2L35A 3EXAA 4DUZO 2M6YA 1XI1A 5B1BB 3IFXA 2AZ0A 1Q6UA 2QM7A 1V54B 1VARA 1ZSPA 2BSKA 1KC8W 2Y69B 3K03A 5BR8B 3UKMA 5KUMA 2YEVA 3A0RA 3ASNB 1Q6HA 1SC5B 4NYKA 2HFEC 2EIMB 4WBNA 4GKKO 2VWJA 3M7MX 1TVKA 2WA4A 4GT1A 3ZJZA 3ZRWB 3ZMUA 3G6EV 3W7UA 4JZGA 1LNQA 2ZE5A 2IW5A 2ZDIA 1XNRO 4P2ZA 4J7ZA 4FFBA 1E1QG 4UCSA 5KHGA 1VQNV 2HHHB 4UXNA 1M57C 4FK5C 4JAAA 1OCZB 3JATB 4E2LA 4CH4A 5J9PC 2C2AA 2LW7A 3OMNB 2X6BA 4MVRA 4DW1A 1N0JA 1VMGA 2P4VA 3SDLA 4UV9A 5EYPA 1AR1B 1GN6A 2QKSA 3RYIB 2DYSB 1PNLA 2UUCB 2YXYA 1NQTA 4WFGA 4DO2A 1FKAO 4ZKIA 2JK5C 1M1KW 4LF6O 2DYRC 3M8AA 3BABA 1AR4A 4JYAO 3LSQA 3H9VA 1MMMA 3JCUZ 3FAVA 2PYLA 1HNWO 3APQA 4JPRA 4AILC 3JD0A 2LO1A 5CA3A 3KZIZ 1VQ7V 2EZPA 2F4VB 2IJKA 3AG4C 2ZR2A 3BHPA 4FLYA 3LNMB 1BQZA 4LFAB 1FFXA 5LXTA 3AG1B 5LOVB 5H2FZ 3GWKC 2VQFO 2W0FC 4WF9V 1TA8A 3MDSA 4ZHQA 1GM9A 2CUGA 2EINC 1QBZA 3SPJA 4ZIBA 1V55B 5JVDA 2EX3A 1BQ0A 3U0ZA 4QPJA 2QWQB 4KUMA 2QGNA 2H94A 5B3SB 3CJHB 3LDCA 2CH7A 3CMEV 4MSWC 4DR6O 2O57A 5KAFZ 4KP4A 2QWNB 2P90A 1CEZA 5FL7G 3ZX6A 2W6JG 3W7SA 1QR8A 4UB6Z 5JJJB 4DR5O 4EB6A 1COWG 1KBHA 3H1LH 3CRMA 3GWOA 3UO2A 1WPXA 3UM7A 3M99B 4YY3B 4XBFA 4PDRA 2PF4E 4X1YB 3FB6C 2CTRA 3C3SA 4NXMO 4R50A 5FPOA 1YZBA 4FZ1A 2VRZA 1S5HC 3I55V 4MTOA 2JGDA 5H6RA 1NI8A 1YI2V 2V4DA 1G1XB 5EIBD 1SETA 2R9IA 2CTPA 1R1BA 2PY5A 4EKWA 2RJZA 3MHSC 4NXNB 1NR7A 1X4TA 5KHJA 1N34B 1VQ8V 4PHZA 2Q6AA 5AG2A 1XOUA 2HVKC 3HKEA 4DR4B 2A06H 2CDYA 4QPKA 2DW4A 1GN4A 4FIPC 1NH2D 2PZSA 3QO7A 1K5SA 4QGPA 4TUYB 4AQYO 1WB8A 4X88A 2WLIA 4DV2O 2OWOA 1IDSA 2FTKA 3ETQA 3HR0A 1BGYH 1BHBA 2Y4UA 5B66Z 3L71H 1F23A 2VQEB 1O9GA 1R6KA 1AR5A 2ETNA 4DV1O 2QKCA 3VQVA 2IU0A 5D5QA 4MS2A 3CMAV 3HKCA 1Z2GA 2X7RB 2YICA 3AK1A 4AHCA 5LMNB 4NB5A 1WP7A 4FLXA 1TUEB 3CCVV 1OCRB 2GUZA 4MVQA 2QM8A 5C93A 2NR5A 1IZ3A 3DC6A 1YDXA 5FPRA 3S3XA 4B3RB 4DR7B 2QE7G 4O4IB 4JI2O 3ZN0A 3ZHQA 2YXLA 3CRQA 2Q73A 3B8NA 1XL4A 4I4TA 1WAZA 3Q4HA 3QG5A 3S3WA 2YS8A 5GTIZ 4BIOA 3T1YB 3UO3A 1F7YA 3G71V 1I94O 4TV8A 2PUSA 3E89A 1U96A 2XOKG 2GDSA 3AG3C 4DR3B 3O65A 2ARHA 3JALA 2UUCO 1K9MW 1ENVA 4FLUA 1P49A 1XUQA 2LQTA 1YCIA 5GONA 5FNVB 3BA9A 2IJHA 1HR0B 4PI0A 3ABLC 4O2AA 4JI1B 2A7WA 1N33O 2ZNIA 4LFBB 4X20A 3ICXA 4YHHO 3SPCA 1FFXB 2E5LB 3CCJV 3OEHG 1M57B 4D7SA 2HLDG 4X64O 3FB7C 4I55B 4AI8A 4LF8B 5JVDB 3QF7A 4PI2A 2E75B 4G28B 1XMOO 1IBKB 3CB2A 5A9GA 4LFAO
chains in the Genus database with same CATH topology
2OCHA 2Y4TA 2QWOB 1WJZA 2DMXA 2EJ7A 1GH6A 1BQ0A 2QWQB 3APOA 4IT5A 1FAFA 2QWRB 1HDJA 2L6LA 3BVOA 2LGWA 2GUZB 2YUAA 3AG7A 4J80A 1BQZA 1FPOA 3UO2A 2M6YA 1XBLA 1NZ6A 2N04A 2QWPB 1IURA 3UCSC 4RWUA 2QSAA 2YS8A 2QWNB 2PF4E 2CTPA 3UO3A 2KQXA 2GUZA 2Y4UA 2DN9A 4J7ZA 3APQA 2CTRA 2CTWA 2LO1A 2CTQA 2CUGA 2N05A 1N4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCH A;  2Y4T A;  2QWO B;  1WJZ A;  2DMX A;  2EJ7 A;  1GH6 A;  1BQ0 A;  2QWQ B;  3APO A;  4IT5 A;  1FAF A;  2QWR B;  1HDJ A;  2L6L A;  3BVO A;  2LGW A;  2GUZ B;  2YUA A;  3AG7 A;  4J80 A;  1BQZ A;  1FPO A;  3UO2 A;  2M6Y A;  1XBL A;  1NZ6 A;  2N04 A;  2QWP B;  1IUR A;  3UCS C;  4RWU A;  2QSA A;  2YS8 A;  2QWN B;  2PF4 E;  2CTP A;  3UO3 A;  2KQX A;  2GUZ A;  2Y4U A;  2DN9 A;  4J7Z A;  3APQ A;  2CTR A;  2CTW A;  2LO1 A;  2CTQ A;  2CUG A;  2N05 A;  1N4C A; 
#chains in the Genus database with same CATH topology
 4X62 O;  4MTX A;  1FS0 G;  2LFR A;  1FXK C;  2A3Q A;  4JI0 O;  2WWW A;  3JCZ A;  4JAV A;  3VOU A;  4O4J A;  3RFR A;  2DYR B;  4EB6 B;  1D5N A;  5LGU A;  1NR1 A;  4TOI A;  2AZ2 A;  4MTF A;  2ZM6 O;  3IC7 A;  1NTZ H;  4JAU A;  3L70 H;  5IYB O;  3AG4 B;  3ASO C;  1K73 W;  5CA1 B;  2GSM B;  4O4H A;  4UVC A;  3GVM A;  5KAI Z;  3SYQ A;  5LGN A;  2CTW A;  4DV0 B;  3T2M A;  1XNQ B;  1MSW D;  5GTH Z;  2WLJ A;  3G80 A;  2LP7 A;  4NKG B;  3DXR A;  2QEX V;  1YTF D;  4LH7 A;  1AI5 A;  2B5U A;  4B3M O;  2FL4 A;  4DV7 O;  3K5L A;  1EZJ A;  3ML0 A;  4X65 B;  4U3J B;  4DXW A;  1FXK A;  4YJ2 A;  3STZ C;  4UCV A;  2WLM A;  4DV3 O;  1OCO C;  2ZE8 A;  3B4S A;  3JAK B;  4PJ0 Z;  2BE3 A;  1SQX H;  1MA1 A;  1MZF A;  2X0L A;  1V9P A;  1XBL A;  5GW7 A;  2UXB B;  3RYH A;  1PP9 H;  2LFS A;  2Y48 A;  3ABK B;  1XDC A;  2BTQ B;  1XQ8 A;  1Q86 W;  2ZQM A;  4O4L A;  4TQD A;  3LSS A;  4F6R A;  2JDI G;  3U11 A;  3BRC A;  2GTA A;  2V7Q G;  3FX7 A;  3R66 A;  1EBO A;  3PJS K;  1WA8 B;  4X8A A;  3T1H B;  4JI6 B;  3IGA C;  2K1E A;  3E83 A;  3BVO A;  4JI4 B;  2F1M A;  2H3O A;  1YJN V;  3JAS A;  2FB5 A;  3ABM C;  4DR1 O;  5IYZ B;  2WLK A;  1M90 W;  3RYF A;  5KMG A;  3H1K H;  1UFI A;  4UB8 Z;  5LA6 A;  3TET A;  1NT2 B;  2UU9 B;  2IU3 A;  2CE4 A;  3SR2 C;  1ZWI C;  2VQE O;  1G6U A;  2HR3 A;  1ZAU A;  2IJI A;  2GUZ B;  4I7Z B;  4K0K B;  1DLB A;  1DF5 A;  1D5A A;  5DN6 G;  1L8D A;  1RSO B;  3E35 A;  5IJ0 A;  3UT5 B;  1K34 A;  3CP1 A;  4HNA A;  1PL4 A;  1Q6I A;  1M4U A;  5CA0 A;  2Y0P A;  2ZDI C;  4RAI A;  5JH7 A;  1VIB A;  1W0J G;  2EUL A;  3Q4H B;  3QVN A;  4UCT A;  4MTG A;  4DV4 B;  3J81 N;  3LDE A;  1XRE A;  3SYP A;  2YIB A;  4JGS A;  4U7O A;  1J5E O;  4B3S O;  4XDJ A;  3ZBH A;  4PDV A;  1JPX A;  4J42 A;  2LW1 A;  5HFL A;  5J2U A;  4ICG A;  1EM1 A;  3E8G A;  3K59 A;  3JAL B;  1MG1 A;  4PV1 B;  3T1Y O;  2Q68 A;  1KYO F;  2B1I A;  2IM9 A;  4PA3 A;  2RDC A;  2D2C B;  4K3A A;  3F5T A;  1ZL8 B;  3BFR A;  4LF5 B;  1FYJ A;  4O2A B;  4RUE A;  4BWA A;  3CC2 V;  3CD6 V;  1H2G A;  2OIG A;  2EIL C;  2Q7H A;  1S0V A;  1R3I C;  4J9Y B;  5KUK A;  4CC6 A;  1YIJ V;  2FML A;  4O2B A;  2ITC C;  3HKB A;  5C8Y A;  4DV5 B;  1IXB A;  4JI1 O;  1T5E A;  4LFB O;  1VQ6 V;  1QVF U;  1PNM A;  1JVM A;  3RYC B;  2XND G;  4MVU A;  3E22 A;  5JQG B;  3C90 A;  1GMG A;  3K08 A;  1SRY A;  1W2B U;  1GH6 A;  3B2E E;  4O4J B;  1OJH A;  3CE2 A;  3BY6 A;  2JIZ G;  4Z1M G;  3RN4 A;  4I0X A;  1EFR G;  1MSD A;  4L8J A;  1YF2 A;  2BTO A;  3AG3 B;  2DJV A;  3VQY A;  5LBQ A;  1SA0 A;  3OFN G;  3BEH A;  1Y4M A;  3CRR A;  2QR4 A;  5J2T B;  3G4S V;  1GRJ A;  4PD4 F;  2P5O A;  5IY5 C;  1MZE A;  2F93 B;  1RPO A;  2KG7 A;  3OE7 G;  3QTC A;  1KB9 F;  3OTO B;  4O4H B;  3WB1 A;  2EIK C;  3H1J H;  3BPZ A;  4JTC B;  1HNZ B;  3CHX A;  2OCC B;  3KKY A;  4QJF B;  1SQB H;  1QLE B;  1H8H G;  4ZBM A;  2VWK A;  2ZE7 A;  4QNH B;  2BCC H;  2Y4T A;  2A79 B;  3B40 A;  4YIO A;  1Y76 A;  4DUY B;  4EFB A;  1BL8 A;  3P32 A;  1SQG A;  1IBM O;  3CYO A;  5B1N A;  3E86 A;  2XAJ A;  4CS3 A;  1F4N A;  1TUB B;  2LJ2 A;  1M9N A;  1SER A;  1WN7 A;  3RYH B;  4ZI7 B;  5CB4 A;  5BY1 A;  3OUS A;  3W7X A;  5IJ9 A;  4CS2 A;  1SZX A;  2HG5 C;  3CXH F;  4O4L B;  2GV9 A;  3STL C;  3JAR A;  3MAQ A;  4KHP B;  2WLL A;  4I50 A;  4DV6 O;  4IGG A;  4JTA B;  2UUB B;  1M93 A;  4IL6 Z;  4JI5 B;  3ASO B;  1BT8 A;  2YI8 A;  3VQW A;  4JI3 B;  2UXC O;  4FLV A;  1XHZ A;  4K8Z A;  3RYF B;  1AI7 A;  1YJW V;  1XMQ B;  1NVP D;  1NBM G;  3CCU V;  1H38 A;  4TSF G;  4DR2 O;  1QVG U;  1JA8 A;  2XAQ A;  1O9H A;  1KUQ A;  2KB1 A;  1GK9 A;  2IBZ H;  3SGI A;  1MAB G;  2WSS G;  4HBN A;  5EIB C;  1FXH A;  1Z5V A;  1AJN A;  3ZHT A;  4LNU A;  1K3E A;  1AP6 A;  4ZOL A;  4X66 O;  3E8B A;  4DK1 A;  4JI8 O;  4FMT A;  1I5Y A;  3AG7 A;  3CX5 F;  1K33 A;  5CA0 B;  1Y74 A;  5JH7 B;  2YID A;  1Q5O A;  1N36 O;  1EZV H;  5BMV A;  4OX9 O;  2XAS A;  1P84 F;  1HWY A;  4Z2W A;  4GX0 A;  4I9W A;  1QCE A;  2QWO B;  1LR1 A;  5KA5 A;  1WP8 A;  2ZNJ A;  4B7K A;  2L6L A;  3D3I A;  1HNX B;  1N32 B;  5J2U B;  3ZHR A;  2YSU B;  1EN6 A;  2QSA A;  4TV9 A;  1WB7 A;  5LYJ B;  3W7T A;  1GAX A;  3ABM B;  1XEQ A;  3DGE A;  4JYB A;  4G2K A;  5ITZ B;  4PA7 A;  1GKF A;  1R6T A;  1KD1 W;  1JX9 A;  1FJG O;  5CBG A;  5LMU B;  2HVJ C;  3J7A U;  1G4Y B;  2BSK B;  2NLJ C;  3LUT B;  3MD0 A;  2P6J A;  3CCM V;  1XHX A;  4TT3 G;  2YEV B;  3K3W A;  5L3E A;  2PI4 A;  4LF4 B;  4CZZ A;  4OGQ B;  4GLX A;  4I9Q A;  5KLV H;  3HKB B;  2UXD O;  4B3T B;  1Q81 W;  4WBN B;  3L9D A;  1UJW B;  1TVK B;  1RP3 B;  2EIJ C;  1VQK V;  4JTD B;  5E1A C;  3ZHV A;  1G8M A;  5BR8 O;  4PA4 A;  2ZXW C;  2UUA B;  2JJ1 G;  2EJR A;  1PL0 A;  3E22 B;  3H1H H;  1P4R A;  4FFB B;  4DYL A;  4XDK A;  5IE9 A;  4LF9 B;  1P7G A;  1KU9 A;  1H2N A;  3KG2 A;  1WNS A;  4UVB A;  1RM1 C;  5FLX N;  1N4C A;  4Q6G A;  3N2G A;  5L3F A;  1SQP H;  2HHH O;  1JFF A;  4NVP A;  5EYP B;  1K7D A;  4X1K A;  2Q7E A;  2ZT9 B;  3AG2 B;  1DF4 A;  5EZY A;  1ZTE A;  3CRC A;  3JAM N;  3LSU A;  3SYO A;  2ILM A;  2EIM C;  2EZO A;  4PDL A;  2UXX A;  4X1I A;  1ZUQ A;  4WFH A;  1R3J C;  1W0K G;  2R72 A;  4GKJ B;  3J80 N;  2IH3 C;  2WLH A;  4FVM A;  2XT9 A;  2EIL B;  1S72 V;  2DQ3 A;  3BCC H;  3U10 A;  5IWA B;  3FAV B;  2E76 B;  2AW9 A;  2GBO A;  2XAH A;  3FYI B;  2N74 A;  2VS0 A;  1HNZ O;  5LP6 A;  3B8M A;  5DEC A;  4CH3 A;  4DUZ B;  2P67 A;  3ZHS A;  2RQ6 A;  5LXT B;  1K8A W;  4GUN A;  5CBH A;  3TGU H;  2QJ1 A;  3N2K A;  2F4V O;  4HZ3 A;  4ZHQ B;  2NN4 A;  3K9A A;  1GTO A;  4LFC B;  4JV5 B;  3WB0 A;  4GKK B;  4FLW A;  4D6T H;  2RMK B;  3D36 A;  2EJ7 A;  2CH7 B;  2IH1 C;  2WLL B;  4I50 B;  5CN0 A;  4NTX A;  4XDL A;  1Q82 W;  5IY5 B;  1XNR B;  3ZRX A;  4LR3 A;  1RFY A;  1VQO V;  2JVD A;  2Q8V A;  2E3C A;  2EIK B;  4FLT A;  1VF6 C;  1I0H A;  3W7W A;  1IVS A;  4EFE A;  1J95 A;  2AXT Z;  3AG1 C;  1SKV A;  2X6A A;  1Q3E A;  2W6I G;  4RO2 A;  1R3L C;  2H8P C;  3FKS G;  1SES A;  4QE9 A;  4OPA A;  4QIW F;  4LF6 B;  3OEE G;  4YY3 O;  1US6 A;  3IJ4 A;  3THO A;  2JGD B;  1QLN A;  4U7N A;  2JEX A;  2V1D A;  1JJ2 U;  3OAA G;  3JD4 A;  4JYA B;  1AB3 A;  2Z5U A;  5BMV B;  4JYC A;  3QO8 A;  2F66 C;  2EIN B;  3ZCC A;  4WFA V;  2ZR3 A;  4Q20 A;  3RGB A;  5EC2 C;  3HPL C;  4IHJ A;  3T1C A;  2Q0A A;  3FFQ A;  1S5J A;  4KFM A;  2Y0I A;  3HKE B;  2ODM A;  3E8F A;  3H01 A;  2VQF B;  5KX5 A;  2M7W A;  4WFF A;  1IX9 A;  1MNG A;  1VF6 A;  4NXN O;  1AJP A;  1Y66 A;  1HNX O;  1N34 O;  2DN9 A;  3B77 A;  3HKD A;  3K79 A;  2RCV A;  5EBL C;  2WLI B;  3LDD A;  1L0N H;  2A9H A;  4DR4 O;  1BE3 H;  4FLZ A;  1YXB A;  4BIZ A;  3L74 H;  4DR6 B;  5L3D A;  3BA8 A;  4FM0 A;  5CMU A;  2Q4P A;  4X89 A;  1BHA A;  2PYJ A;  2XUM A;  4DR5 B;  3CJH A;  4H13 B;  1VQP V;  4JI7 B;  4KXR A;  4HAM A;  1DK1 A;  2ZE6 A;  3HKC B;  2E74 B;  1K4D C;  1NS1 A;  2XAF A;  4WFB V;  3A8T A;  4GX1 A;  3WB2 A;  1KQS U;  4A5U B;  1KEC A;  3OGI B;  2DOS A;  4HYO A;  1NH2 B;  1KKC A;  4UVA A;  4GCZ A;  4NXM B;  4I5S A;  3N2G B;  4H0L B;  4P30 A;  5BZB A;  3ABT A;  1GN3 A;  3CCR V;  1X59 A;  1DTO A;  3EVK A;  2CGO A;  5LMN O;  2YXH A;  4X1Y A;  4I4T B;  3FB8 C;  4WCE V;  5JCO C;  4B3R O;  4TV8 B;  4DR7 O;  1IUR A;  5B1A C;  3ETD A;  3UQ8 A;  2AHZ A;  3B09 A;  3RVY A;  1Y67 A;  1H8E G;  1ZLZ A;  2WPD G;  1PPJ H;  1D2D A;  2Q5Z A;  2AGA A;  1QNM A;  4W4L A;  2YIA A;  4QE7 A;  3E2E A;  4IIJ A;  2JS3 A;  4IYI A;  3CXC U;  5GON B;  3SJB C;  1AVM A;  2QTS A;  1BZK A;  2EIJ B;  4DR3 O;  3SJQ C;  2ZXW B;  3FD9 A;  3JAW A;  2KQX A;  4X20 B;  3I56 V;  3OGC C;  2F23 A;  3ZMZ A;  2OT5 A;  2XAG A;  5DM6 V;  1LUV A;  3N2K B;  2CGN A;  4LC1 A;  1RM1 B;  1HR0 O;  1Z5W A;  3ABU A;  2GTS A;  4CC5 A;  2PI5 A;  4UUJ C;  5IT9 N;  4FM2 A;  3CCE V;  4TUY A;  5BXZ A;  1AP5 A;  2E5L O;  2K9P A;  4DV1 B;  1PNK A;  3JD2 A;  3F7Y C;  1BMF G;  4CS4 A;  1PD3 A;  4LFC O;  2ZD9 A;  4LF8 O;  4JV5 O;  3ZED A;  1VQL V;  1M56 C;  1K4C C;  3P3P A;  1IBK O;  3P3N A;  1Q43 A;  5JCO A;  1K97 A;  3KCX A;  4CBC A;  1NZ6 A;  1JR9 A;  3UCS C;  3SPH A;  2ZIM A;  3RT3 C;  3E8H A;  2ADQ B;  5B5E Z;  2P06 A;  4DRX A;  4JI2 B;  3WFV A;  3ETG A;  4P9O A;  2IJJ A;  4PDM A;  5EBM C;  3ZMT A;  3SYA A;  1R73 A;  3MHH C;  3CWB H;  1S3J A;  3JSN A;  2FYU H;  3ABL B;  3CS5 A;  1TAE A;  1TGO A;  2NNU A;  2QA4 V;  4UCU A;  1I94 B;  1THZ A;  2PTM A;  3L73 H;  2WA3 A;  4RWU A;  4O4I A;  3RBZ A;  1AI6 A;  2QM4 A;  3DXR B;  3QNE A;  4J10 A;  2F95 B;  3K5N A;  2F43 G;  3GB7 C;  3T4Z A;  1OCC C;  3VBB A;  4BAY A;  4DV0 O;  1XNQ O;  3JSL A;  4IHJ B;  3JD3 A;  2WAM A;  1FXK B;  3WG7 C;  2BOC C;  4YJ2 B;  1N33 B;  1NKD A;  4GX5 A;  1N8R W;  1SQF A;  3SPG A;  2FKX A;  4YHH B;  3IC9 A;  2Z0A A;  3X2Q C;  5KX5 B;  3CCS V;  3OMA B;  5FNV A;  4X65 O;  4X64 B;  2P7T C;  1QHT A;  3WU2 Z;  1R3K C;  1XIL A;  3OR7 C;  2YUA A;  3HKD B;  5K1P A;  1BSM A;  1XMO B;  2QWP B;  1LUW A;  4F6R B;  3K0G A;  1DGS A;  4H44 B;  1YJ9 V;  4X62 B;  1VF7 A;  4YJ3 A;  3AK3 A;  3K0D A;  1YTF B;  1NTM H;  4CH6 A;  3A2F A;  4I55 A;  4JI0 B;  1VQ9 V;  3P30 A;  2UXB O;  3TJT A;  5F2V O;  3JAS B;  4F6E A;  1L0L H;  5EBW C;  3TXS A;  1JOY A;  4R8C A;  1GN2 A;  5KMG B;  5LGT A;  3L72 H;  3RW0 A;  3CPW U;  1IBL B;  2N04 A;  5LA6 B;  3T1H O;  1P7B A;  4JI6 O;  3ZIA G;  1R6N A;  2ZM6 B;  3TCU A;  4FFK A;  4JI4 O;  4PA6 A;  4GZR B;  2B1G A;  2MW2 B;  3T4D A;  2Q69 A;  3K5O A;  4R7C A;  4JI7 O;  2DMX A;  1NU1 H;  1SQV H;  5IJ0 B;  3ABK C;  5K1X A;  3A0B Z;  5LHG A;  1OZ0 A;  1ROP A;  4HNA B;  4P9P A;  2UU9 O;  1N0N A;  1A32 A;  1OV9 A;  1OCO B;  2ZIO A;  2R9R B;  4G27 B;  2CAZ C;  3RWR D;  1QU7 A;  4K0K O;  4GX2 A;  3SJA C;  4RQF A;  4RUF A;  2JJ2 G;  5H9C A;  1PM9 A;  4ASU G;  5CA1 A;  4B3M B;  4DV7 B;  3DSQ A;  4YIP A;  3APO A;  2G38 A;  3PN1 A;  1I5X A;  1OHH G;  1KKD A;  2HP8 A;  4PEL A;  4DV4 O;  4IIJ B;  4DV3 B;  1Q8I A;  2YI9 A;  1EN5 A;  1I7F A;  5L3C A;  1YIT V;  4U3J A;  3K57 A;  1U97 A;  3JAW B;  1ORQ C;  5A2Q N;  1VP7 A;  3JAK A;  1XL6 A;  2XHB A;  2QKA A;  4H37 A;  3ZMS A;  5CBF A;  4LF5 O;  4O2B B;  4LWS A;  5C8Y B;  1YHQ V;  1I08 A;  2ITD C;  5LHI A;  3R65 A;  5LP6 C;  3ETE A;  2BTQ A;  1E1R G;  4DR1 B;  4LF7 B;  3K04 A;  2JRI A;  4ABM A;  1FPO A;  1WA8 A;  2WLN A;  4DV5 O;  5JWP A;  3ZMV A;  1EN4 A;  1PV0 A;  4MW3 A;  5IYZ A;  1K5Q A;  5B1A B;  5EK0 A;  2ADP A;  4I0X B;  3SPI A;  2RNB A;  4OXS A;  5B1B C;  2QDO A;  1SA0 B;  3AK2 A;  1JCH A;  1V54 C;  3NXS A;  3D36 C;  3HB3 B;  2W0X A;  4DRX B;  2Y69 C;  1NJI W;  2DQ0 A;  3ASN C;  3DTU B;  1QQC A;  4J7J A;  3ZHU A;  4YXW G;  3JYC A;  2KG7 B;  1S76 D;  4J11 A;  4FZ0 A;  4FM1 A;  2DWE C;  2D3O W;  1RSO A;  1H2K A;  4JZ2 A;  3UT5 A;  1VF5 B;  3D8C A;  1J5E B;  1CXZ B;  4B3S B;  4MVO A;  1K92 A;  2Q9L A;  2Q0O C;  1L1F A;  2ZCE A;  2KKW A;  2YC0 A;  4FJC C;  4K35 A;  3ZN1 A;  4B7E A;  1FFT B;  5TIS Z;  3OTO O;  1VQ5 V;  2B9Z A;  1OCZ C;  3A0H Z;  1AI4 A;  3ZS8 C;  2P4K A;  3K9S A;  5H6Q A;  2A0L A;  4PA9 A;  1Y76 B;  5H5N A;  4MW8 A;  4Z1V A;  3D3Q A;  2QWR B;  5IDJ A;  1YSC A;  5JJE B;  4NTY A;  4DW0 A;  2Q67 A;  1M56 B;  2DYS C;  3L75 H;  1BS3 A;  5LHH A;  1AIL A;  1ZL8 A;  2GHY A;  4K8X A;  5CB4 B;  3EHB B;  1AJQ A;  4DUY O;  3CEI A;  5IJ9 B;  2N05 A;  2OTL V;  2Q7G A;  1VEW A;  1WJZ A;  2OCC C;  1Q7Y W;  3JAR B;  4DK0 A;  1QLE C;  1KP3 A;  2HEP A;  4YJ3 B;  3VQX A;  4BW5 A;  5EC1 C;  3K5M A;  3OR6 C;  1B6Q A;  3I5D A;  2CTQ A;  1VQ4 V;  4KHP O;  2R70 A;  3ZRW A;  3RYC A;  2KSD A;  5JQG A;  1SF9 A;  2UUB O;  2OIE A;  1W59 A;  3BAA A;  4JI5 O;  3H1I H;  4J80 A;  4JI3 O;  1OCC B;  1VQM V;  2QTO A;  3JAT A;  4LNU B;  4X9Q A;  3LNN A;  4J7K A;  4ZOL B;  1XMQ O;  1ARO P;  1JQ0 A;  1IBL O;  1V55 C;  4W4K A;  2Z3Y A;  2RN9 A;  1GM8 A;  4UCO A;  2YDE A;  3WG7 B;  5JJN B;  1CP9 A;  2JS5 A;  3FB5 C;  4E4E A;  1MOF A;  4NTW A;  5B3S C;  3K58 A;  2HJF C;  1F51 A;  1NTK H;  3RYI A;  4B08 A;  5J2T A;  1Y74 B;  1BCC H;  1YVW A;  3X2Q B;  3F5W C;  3F7V C;  1HNW B;  4JF3 A;  4BW9 A;  4H33 A;  4EEQ A;  5D5P A;  1M5I A;  3G67 A;  4BR6 A;  5KHK A;  2JEU A;  4LH6 A;  1NVP B;  2OTJ V;  2HJD A;  5LL6 Y;  4CH5 A;  2BOB C;  3ZRS A;  2ZKO A;  4N23 A;  4FPP A;  4N21 A;  4U3F H;  4D7T A;  1H2L A;  3G6B A;  4J41 A;  5KHI A;  4TV9 B;  1E79 G;  1GM7 A;  4L87 A;  1IBM B;  3SJC C;  3CCQ V;  1Q90 D;  3RVZ A;  2AHY A;  2R9A A;  2ZIN A;  5E79 Z;  1N32 O;  2OYQ A;  5IYD O;  3JD1 A;  1HP8 A;  3TXQ A;  5LOV A;  1Y6X A;  4DV6 B;  3OD4 A;  2JGU A;  1TUB A;  4UFZ A;  3OMI B;  3OT7 A;  4LWS B;  1YEW A;  2ATK C;  4LP8 A;  4JAS A;  1WPB A;  1RPR A;  4JYY A;  4ZI7 A;  4NR1 A;  5LMU O;  3K06 A;  2UXC B;  5KHH A;  1KP2 A;  1FXV A;  3OUF A;  2LGQ A;  3NR7 A;  3AEI A;  2OCH A;  1F4M A;  3FYE B;  4LF4 O;  4J9Z B;  4C7U A;  4DR2 B;  1JJO A;  3N27 A;  4BIU A;  4B3T O;  3O9O A;  1ZX3 A;  1IXM A;  1S5L Z;  4KL1 A;  3CC4 V;  4R6Z A;  4LF7 O;  2YIB D;  3OTF A;  1WLE A;  3IAY A;  1H2M A;  2UUA O;  4X66 B;  1CPY A;  5L3G A;  2DE0 X;  1B06 A;  2CK3 G;  2DWD C;  4JI8 B;  1GO3 F;  4LF9 O;  1JFF B;  1S77 D;  1FAF A;  2HKO A;  4UV8 A;  4WFE A;  4IYH A;  3ZRV A;  4X1K B;  1QR9 A;  3CRA A;  4MT8 A;  4IT5 A;  1SZT A;  1HW7 A;  1FD9 A;  5EZY B;  2LGW A;  4OPH A;  1UPG A;  1N36 B;  1URF A;  4OX9 B;  1JMK C;  1PKX A;  1H2S B;  4X1I B;  3OM3 B;  3CC7 V;  5L3B A;  5KA6 A;  1SQQ H;  3SYC A;  4GYC B;  3CCL V;  2X6C A;  4MVM A;  1B04 A;  5B1O A;  3TK1 A;  1OCR C;  2EBO A;  3QO5 A;  4RQE A;  3CSX A;  4UCR A;  5LP6 B;  3EFF K;  4GKJ O;  1B3Q A;  3KCY A;  4LBE C;  1KMI Z;  2P22 C;  3C3T A;  4MVZ A;  2UXN A;  5IWA O;  2PGG A;  5DED A;  1FJG B;  4AQY B;  5IYC O;  3DC5 A;  4MVS A;  4DV2 B;  5LYJ A;  3AG2 C;  4F4L A;  4TQF A;  3OW2 U;  2MK3 A;  1SS3 A;  1HDJ A;  4LCU C;  4TWK A;  5ITZ A;  2XTA A;  2UXD B;  5HFM A;  2L35 A;  3EXA A;  4DUZ O;  2M6Y A;  1XI1 A;  5B1B B;  3IFX A;  2AZ0 A;  1Q6U A;  2QM7 A;  1V54 B;  1VAR A;  1ZSP A;  2BSK A;  1KC8 W;  2Y69 B;  3K03 A;  5BR8 B;  3UKM A;  5KUM A;  2YEV A;  3A0R A;  3ASN B;  1Q6H A;  1SC5 B;  4NYK A;  2HFE C;  2EIM B;  4WBN A;  4GKK O;  2VWJ A;  3M7M X;  1TVK A;  2WA4 A;  4GT1 A;  3ZJZ A;  3ZRW B;  3ZMU A;  3G6E V;  3W7U A;  4JZG A;  1LNQ A;  2ZE5 A;  2IW5 A;  2ZDI A;  1XNR O;  4P2Z A;  4J7Z A;  4FFB A;  1E1Q G;  4UCS A;  5KHG A;  1VQN V;  2HHH B;  4UXN A;  1M57 C;  4FK5 C;  4JAA A;  1OCZ B;  3JAT B;  4E2L A;  4CH4 A;  5J9P C;  2C2A A;  2LW7 A;  3OMN B;  2X6B A;  4MVR A;  4DW1 A;  1N0J A;  1VMG A;  2P4V A;  3SDL A;  4UV9 A;  5EYP A;  1AR1 B;  1GN6 A;  2QKS A;  3RYI B;  2DYS B;  1PNL A;  2UUC B;  2YXY A;  1NQT A;  4WFG A;  4DO2 A;  1FKA O;  4ZKI A;  2JK5 C;  1M1K W;  4LF6 O;  2DYR C;  3M8A A;  3BAB A;  1AR4 A;  4JYA O;  3LSQ A;  3H9V A;  1MMM A;  3JCU Z;  3FAV A;  2PYL A;  1HNW O;  3APQ A;  4JPR A;  4AIL C;  3JD0 A;  2LO1 A;  5CA3 A;  3KZI Z;  1VQ7 V;  2EZP A;  2F4V B;  2IJK A;  3AG4 C;  2ZR2 A;  3BHP A;  4FLY A;  3LNM B;  1BQZ A;  4LFA B;  1FFX A;  5LXT A;  3AG1 B;  5LOV B;  5H2F Z;  3GWK C;  2VQF O;  2W0F C;  4WF9 V;  1TA8 A;  3MDS A;  4ZHQ A;  1GM9 A;  2CUG A;  2EIN C;  1QBZ A;  3SPJ A;  4ZIB A;  1V55 B;  5JVD A;  2EX3 A;  1BQ0 A;  3U0Z A;  4QPJ A;  2QWQ B;  4KUM A;  2QGN A;  2H94 A;  5B3S B;  3CJH B;  3LDC A;  2CH7 A;  3CME V;  4MSW C;  4DR6 O;  2O57 A;  5KAF Z;  4KP4 A;  2QWN B;  2P90 A;  1CEZ A;  5FL7 G;  3ZX6 A;  2W6J G;  3W7S A;  1QR8 A;  4UB6 Z;  5JJJ B;  4DR5 O;  4EB6 A;  1COW G;  1KBH A;  3H1L H;  3CRM A;  3GWO A;  3UO2 A;  1WPX A;  3UM7 A;  3M99 B;  4YY3 B;  4XBF A;  4PDR A;  2PF4 E;  4X1Y B;  3FB6 C;  2CTR A;  3C3S A;  4NXM O;  4R50 A;  5FPO A;  1YZB A;  4FZ1 A;  2VRZ A;  1S5H C;  3I55 V;  4MTO A;  2JGD A;  5H6R A;  1NI8 A;  1YI2 V;  2V4D A;  1G1X B;  5EIB D;  1SET A;  2R9I A;  2CTP A;  1R1B A;  2PY5 A;  4EKW A;  2RJZ A;  3MHS C;  4NXN B;  1NR7 A;  1X4T A;  5KHJ A;  1N34 B;  1VQ8 V;  4PHZ A;  2Q6A A;  5AG2 A;  1XOU A;  2HVK C;  3HKE A;  4DR4 B;  2A06 H;  2CDY A;  4QPK A;  2DW4 A;  1GN4 A;  4FIP C;  1NH2 D;  2PZS A;  3QO7 A;  1K5S A;  4QGP A;  4TUY B;  4AQY O;  1WB8 A;  4X88 A;  2WLI A;  4DV2 O;  2OWO A;  1IDS A;  2FTK A;  3ETQ A;  3HR0 A;  1BGY H;  1BHB A;  2Y4U A;  5B66 Z;  3L71 H;  1F23 A;  2VQE B;  1O9G A;  1R6K A;  1AR5 A;  2ETN A;  4DV1 O;  2QKC A;  3VQV A;  2IU0 A;  5D5Q A;  4MS2 A;  3CMA V;  3HKC A;  1Z2G A;  2X7R B;  2YIC A;  3AK1 A;  4AHC A;  5LMN B;  4NB5 A;  1WP7 A;  4FLX A;  1TUE B;  3CCV V;  1OCR B;  2GUZ A;  4MVQ A;  2QM8 A;  5C93 A;  2NR5 A;  1IZ3 A;  3DC6 A;  1YDX A;  5FPR A;  3S3X A;  4B3R B;  4DR7 B;  2QE7 G;  4O4I B;  4JI2 O;  3ZN0 A;  3ZHQ A;  2YXL A;  3CRQ A;  2Q73 A;  3B8N A;  1XL4 A;  4I4T A;  1WAZ A;  3Q4H A;  3QG5 A;  3S3W A;  2YS8 A;  5GTI Z;  4BIO A;  3T1Y B;  3UO3 A;  1F7Y A;  3G71 V;  1I94 O;  4TV8 A;  2PUS A;  3E89 A;  1U96 A;  2XOK G;  2GDS A;  3AG3 C;  4DR3 B;  3O65 A;  2ARH A;  3JAL A;  2UUC O;  1K9M W;  1ENV A;  4FLU A;  1P49 A;  1XUQ A;  2LQT A;  1YCI A;  5GON A;  5FNV B;  3BA9 A;  2IJH A;  1HR0 B;  4PI0 A;  3ABL C;  4O2A A;  4JI1 B;  2A7W A;  1N33 O;  2ZNI A;  4LFB B;  4X20 A;  3ICX A;  4YHH O;  3SPC A;  1FFX B;  2E5L B;  3CCJ V;  3OEH G;  1M57 B;  4D7S A;  2HLD G;  4X64 O;  3FB7 C;  4I55 B;  4AI8 A;  4LF8 B;  5JVD B;  3QF7 A;  4PI2 A;  2E75 B;  4G28 B;  1XMO O;  1IBK B;  3CB2 A;  5A9G A;  4LFA O; 
#chains in the Genus database with same CATH homology
 2OCH A;  2Y4T A;  2QWO B;  1WJZ A;  2DMX A;  2EJ7 A;  1GH6 A;  1BQ0 A;  2QWQ B;  3APO A;  4IT5 A;  1FAF A;  2QWR B;  1HDJ A;  2L6L A;  3BVO A;  2LGW A;  2GUZ B;  2YUA A;  3AG7 A;  4J80 A;  1BQZ A;  1FPO A;  3UO2 A;  2M6Y A;  1XBL A;  1NZ6 A;  2N04 A;  2QWP B;  1IUR A;  3UCS C;  4RWU A;  2QSA A;  2YS8 A;  2QWN B;  2PF4 E;  2CTP A;  3UO3 A;  2KQX A;  2GUZ A;  2Y4U A;  2DN9 A;  4J7Z A;  3APQ A;  2CTR A;  2CTW A;  2LO1 A;  2CTQ A;  2CUG A;  2N05 A;  1N4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...