1NZ6A

Crystal structure of auxilin j-domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function analysis of the auxilin J-domain reveals an extended Hsc70 interaction interface.
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein binding
molecule keywords Auxilin
total genus 29
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2003-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1nz6A00
2CUGA 2YUAA 1BQ0A 2Y4TA 4J7ZA 4RWUA 2Y4UA 2QSAA 2QWOB 2QWRB 2YS8A 1HDJA 1FPOA 2DN9A 2M6YA 2CTQA 2GUZB 1GH6A 1FAFA 2CTPA 2PF4E 2N05A 1BQZA 2DMXA 1IURA 2EJ7A 2LGWA 2OCHA 1WJZA 3BVOA 3UO2A 1XBLA 2QWPB 1NZ6A 2QWQB 2KQXA 2L6LA 1N4CA 2QWNB 3APQA 2CTRA 2CTWA 4IT5A 2LO1A 3AG7A 3UO3A 3UCSC 3APOA 4J80A 2N04A 2GUZA
chains in the Genus database with same CATH superfamily
2H94A 4I9WA 2ITDC 3AG4B 3LNMB 3A8TA 5CBFA 2UXDB 4EEQA 2JEXA 4JI3O 2X0LA 2P06A 2UXNA 3WB2A 3P3PA 1YIJV 2LP7A 2A3QA 3LSSA 4J10A 4TQDA 1M4UA 4A5UB 5LL6Y 1XQ8A 2F4VB 5IYZB 1H2KA 1THZA 3HKCA 2HJDA 2OIEA 3ML0A 4LCUC 1VQOV 1XNRB 3ABLC 4IGGA 5IDJA 3DXRB 2GV9A 4E4EA 1MNGA 5FNVA 3T1HB 4LFBB 2QEXV 3EVKA 3ABKC 3T1HO 1NTMH 2QKSA 2QM4A 4Z1MG 3K04A 5IJ0B 4X66O 1W0JG 3Q4HB 1IBMO 5CA1A 1DGSA 4IIJB 3F7VC 3OTOB 1BQZA 4D7SA 5LOVB 2YEVB 2CAZC 1SQFA 3HPLC 5KUMA 1P7GA 3OFNG 4F4LA 2ZNJA 5KHJA 1WP8A 5H6RA 3UCSC 1MZFA 2DW4A 4PA3A 2Q67A 4YHHO 1Z5VA 1ZX3A 2OIGA 4FLYA 4QJFB 5CBHA 1Q90D 4K8XA 5EIBD 4DK1A 1GKFA 1QLEC 2V1DA 2HHHB 4H0LB 1RM1C 4ABMA 4LFCB 1YTFB 2Z5UA 2UXBO 5EK0A 3D36A 3CMEV 4FLUA 5KA6A 2ZIOA 1EM1A 1AR4A 3QTCA 1QR9A 1M9NA 4JYAB 2DJVA 1FXKC 5CBGA 2JGDB 1XNRO 2DWDC 1FFXB 3RGBA 4DV0O 3BRCA 5LA6A 4GX1A 5IYCO 4PV1B 4IHJA 4RO2A 3APOA 1FFXA 3N27A 3ABMB 3A0HZ 3FYEB 3THOA 1GTOA 2ZXWB 4G27B 5GTHZ 1YHQV 1HWYA 4GX0A 2FYUH 2Q69A 2RQ6A 2EIKB 1FXVA 4NTYA 1IBLO 4DR6B 4FLTA 4BIOA 4DR6O 4JTCB 2QKAA 4FZ0A 4JYBA 1GK9A 3FX7A 4F6RB 1FKAO 4X1KB 3EXAA 1M1KW 3IGAC 1FJGO 2AHZA 3H1KH 4EFEA 4X20A 2HR3A 1VQ5V 2NR5A 4NB5A 2XAHA 1JJ2U 4YIOA 3HKDB 5LP6C 1S5JA 2WWWA 3U10A 5KMGA 4FM2A 1HNXB 4UCVA 4LF6O 2X6CA 1YXBA 1MOFA 1ROPA 1AJPA 2R9IA 4B7EA 2JJ2G 2LW1A 4B7KA 1JCHA 4GLXA 4JYAO 4MW3A 1SQVH 4JI2O 2M6YA 1QCEA 2JGDA 2GSMB 3N2GB 2Q7EA 4YY3B 4TV8A 5IJ0A 5IT9N 3LSQA 4HNAB 1P49A 4O4JA 1BS3A 3ZRXA 1ZSPA 3P3NA 4LFCO 1QLNA 3VQWA 1ZTEA 2IH1C 2F1MA 4X64O 5JCOC 1WB8A 3K08A 1RM1B 4YIPA 3CCEV 1ENVA 3T1CA 4YHHB 3RN4A 4HZ3A 4JI2B 3NXSA 1MMMA 2CTPA 5ITZB 2EJ7A 3ZRVA 4KUMA 1K7DA 5LMUO 4DR1B 1K4DC 2UUCO 2KQXA 2L6LA 4X65O 5L3FA 1KBHA 3ZIAG 1RSOA 3BY6A 4FIPC 1NQTA 5KX5B 3DTUB 4IL6Z 4EKWA 1YVWA 5LMUB 4U3JB 2YEVA 1PPJH 2Q7HA 4GKJB 2JEUA 1KUQA 2ETNA 1XDCA 5J2UA 1EZVH 4ZHQB 2FB5A 2QJ1A 1SESA 3ZX6A 1QNMA 3KG2A 4J7JA 1NJIW 1US6A 5EBLC 1JQ0A 2FL4A 1XMQB 4QE9A 4WCEV 1AI4A 5FNVB 2P6JA 3JASB 5IWAO 1JMKC 3E2EA 2WA4A 1SA0A 3HKCB 4LF5B 3MD0A 1V55C 5ITZA 4FFBB 4OXSA 3ABLB 4JI3B 1ORQC 5KA5A 4LNUA 1K5SA 3H01A 2AW9A 1HR0O 4P2ZA 5GTIZ 1NH2D 3H1LH 2E5LB 3HR0A 1Z5WA 3HKEB 1F23A 1L8DA 2CGOA 4UB8Z 2ZCEA 3G67A 3CRAA 4D7TA 4X1IA 3HB3B 1ZAUA 2WLMA 3ZHUA 5LMNB 3AG3B 1EBOA 1WNSA 1XMOB 1Y6XA 3ASNB 3W7UA 2N05A 3ZN0A 2P4KA 5LP6A 3T2MA 2WLIA 2LJ2A 3F7YC 3CXCU 3HKDA 2CTRA 3LDDA 1N36O 3T4DA 5B3SC 4MTGA 3IC7A 3CD6V 1YITV 4JTAB 1F51A 4O2AA 3CEIA 2YICA 3OAAG 1N8RW 3JATB 2DQ0A 5BZBA 4TSFG 4ZOLA 1VQPV 1JJOA 3N2KA 1XNQO 2XTAA 2A06H 1WA8B 4H44B 1S5HC 3WU2Z 4X89A 5LYJB 1PL0A 4LR3A 2Q8VA 2HLDG 2ZQMA 2BE3A 1K73W 4PA7A 4E2LA 4AQYB 2Y48A 2UXXA 3QF7A 2CK3G 4U7NA 5FPOA 1XREA 4NTWA 1OCRB 1F4NA 4IHJB 1F4MA 2W0FC 4YY3O 2EINB 2XNDG 1WP7A 2EILC 1VQ6V 2JIZG 2ATKC 2ZXWC 2ZINA 4LF7B 3BAAA 3RVZA 1RP3B 3RFRA 1AP6A 4OPHA 1AI6A 3ABMC 1KYOF 4I4TA 5BY1A 4Q20A 1PNKA 1WA8A 1AI5A 2EIJC 4G28B 4JAVA 1GMGA 5DM6V 3W7TA 2EX3A 2WLJA 3N2KB 4H13B 3TCUA 4LF8O 2VQFB 5FPRA 2Y69B 1FJGB 2NLJC 3K06A 4X66B 4R8CA 2N04A 4XBFA 2HP8A 1WAZA 1L0NH 2QM8A 5BMVB 4DRXB 2F23A 1IVSA 3LDEA 4WBNB 3UT5B 4DR5B 3ZRWA 5KHKA 2WLIB 2UU9B 4MVMA 4TUYB 2B9ZA 1N4CA 2WLNA 1SQBH 4PDLA 1SETA 1YI2V 5LHHA 1GN6A 3JAWB 4I0XB 2RMKB 5IWAB 4IIJA 3SPJA 2VS0A 3LUTB 2Y69C 4PD4F 2OTLV 1WPXA 3K57A 4LF9O 3JARB 3OD4A 1DF4A 1FAFA 2UUBB 3G6BA 2HVJC 4JI0O 5CB4A 2IU0A 1S5LZ 3EFFK 3GWKC 4YXWG 4B3MO 3H1IH 3DXRA 4O4IA 3ZJZA 5JVDA 5LMNO 4GKJO 4NTXA 1EN6A 4RWUA 2PYLA 5DN6G 4FFBA 4YJ2A 1KP3A 1SF9A 3STLC 4U3FH 1Y76A 1XL4A 1Y74A 3CPWU 2LGQA 2HKOA 4MTXA 3JASA 5FL7G 4B3TB 1M57C 3D36C 4FVMA 4X8AA 1IBKB 3ASOC 5IJ9B 4J80A 3CCLV 2YUAA 4JI4O 1VQ9V 2DOSA 2XAGA 2BTQA 3CMAV 1ZWIC 4DUZO 3CJHB 3CCQV 2YIBD 3K5MA 1TGOA 4DR4O 1IZ3A 2Z3YA 4P9PA 5LXTA 1NVPD 2NNUA 1XMQO 3K0GA 3KZIZ 5IYDO 1WB7A 3ZHVA 4BIUA 2BSKB 3QO7A 1K9MW 1FYJA 4FK5C 4DK0A 3JD4A 3CC2V 5B1AC 4FLVA 3L71H 1B6QA 3E83A 3ABUA 2PI5A 4JGSA 4JI5O 3WFVA 4MVSA 2CGNA 3RVYA 3SYOA 5L3CA 4KP4A 1COWG 1R6KA 3E22A 4IYHA 2EIMC 1JPXA 3UO3A 3FB8C 3ZBHA 2D3OW 1DK1A 1Z2GA 4RUEA 3E86A 3CRRA 1PNLA 4Q6GA 3CP1A 3MHHC 4LP8A 2ARHA 2VQEO 3AG3C 3OGCC 1BGYH 3I56V 3E35A 4LWSB 4OGQB 3ZHRA 2RJZA 1NTZH 5B66Z 2AGAA 1VF7A 4OPAA 1XEQA 2RN9A 1H2MA 2QSAA 1GM7A 2P7TC 3CCUV 1JX9A 4K0KB 4TUYA 2AHYA 4UVBA 4I7ZB 4JI8O 1B04A 3FKSG 4BR6A 3L73H 2KB1A 4NKGB 2IBZH 5B5EZ 1PKXA 5CN0A 1HNWB 4QIWF 3RYHA 3VQVA 1YJ9V 4LF6B 4F6RA 1J5EB 2YDEA 2WLKA 1YF2A 3C3TA 3ASOB 1GO3F 5H9CA 5A2QN 5CA0B 2CE4A 2QDOA 2OCCB 2PZSA 1Q3EA 3GVMA 3UM7A 4JI7O 1NU1H 1XUQA 1MSWD 3RYCB 1YEWA 1BMFG 4DUYB 3K03A 1Q43A 2EILB 4GX2A 5CA3A 1OCCC 4TV9B 2X6BA 4J9YB 4FLZA 4OX9O 1OZ0A 1HNZO 3E8HA 4ASUG 2OWOA 4MVQA 1YDXA 5B1AB 2GTSA 1SS3A 4BWAA 5LYJA 4CH6A 1XI1A 3BFRA 2P22C 3ETQA 2A79B 1OCZB 4JV5B 3ETGA 3ZMZA 4DV0B 2EIJB 1Q6IA 3LNNA 3P32A 2Y0PA 2ZR3A 1GM8A 1HW7A 3SGIA 2YXLA 4R7CA 5IYBO 2QWNB 4DV3O 1GN2A 4KL1A 1AJNA 3SYCA 1N32O 3R66A 3CHXA 3TXQA 3L75H 3SPCA 3ETEA 4ZKIA 1DLBA 2RCVA 2ZT9B 3LDCA 4B3RB 4O2BA 2IW5A 1VARA 4DR7B 3B2EE 4MVOA 2ZM6O 4DV4O 1YZBA 4UVCA 3QO8A 1AR1B 4I55A 3CX5F 3J81N 4BAYA 3DGEA 4JI1B 4I5SA 4X62B 1K4CC 2JJ1G 2BTQB 4C7UA 2N74A 2PYJA 4JZ2A 4LF4O 5EC2C 5HFLA 3SJBC 2P4VA 2Q68A 3B4SA 1YJWV 2V7QG 1S3JA 1UFIA 4LFAO 3M99B 5C8YA 4JI7B 4XDLA 5KHIA 5L3EA 5GONB 1PM9A 2PUSA 3JCUZ 4WFAV 4I9QA 1D5AA 1EN5A 4MVZA 2QE7G 4NR1A 1O9GA 4DYLA 2E3CA 1V9PA 1TUBA 1YTFD 4MT8A 3RYFA 4LFBO 1U96A 2YC0A 4MTFA 3AK3A 5CMUA 1N33B 5JVDB 5C8YB 4DV7O 4FM0A 2R9AA 2Q9LA 1M93A 2IJJA 4AHCA 2UXCB 5CB4B 4GKKB 2Y0IA 3OUSA 4CH5A 4K0KO 5J2UB 2ZE7A 5IY5C 4MW8A 4UUJC 1JFFB 2LQTA 4I55B 2R9RB 3A2FA 5IE9A 3CCMV 4B3SO 4DW1A 4CH4A 2Q73A 1DTOA 4LC1A 5KX5A 2X6AA 2B1GA 4K8ZA 4JZGA 3U11A 2DN9A 2CTQA 1GH6A 1OCRC 2VQFO 5EBWC 2EJRA 1IURA 5LGTA 5KUKA 3VQXA 2V4DA 3QNEA 1VQKV 1PP9H 4LF4B 4GCZA 3TK1A 4DV6O 2QM7A 4PDVA 3ABTA 3CWBH 1KU9A 3D3QA 3ZEDA 2BOBC 3AG1C 4MVRA 1HNZB 5HFMA 4QE7A 2ODMA 4UV9A 1XOUA 2DYRB 1R3JC 3RYIA 1I94O 2ZM6B 3SYAA 4DV4B 5JQGB 3BVOA 2OT5A 4TV8B 4AQYO 3VBBA 3SJQC 2LFRA 3QVNA 4DR4B 2BTOA 5A9GA 3B40A 4GZRB 4FFKA 2Y4UA 4FM1A 1VQ7V 4UB6Z 4ZBMA 2E76B 4JI4B 4TQFA 1H38A 1EFRG 1PL4A 1GAXA 3MAQA 5CA0A 4DR3O 4JV5O 4ZOLB 1BHBA 3JYCA 2Z0AA 1KKDA 1VF6A 3M8AA 1I08A 1JR9A 1Q6HA 4O2AB 1TUEB 1ZL8A 5LGNA 1R3LC 2F93B 2OCCC 4LH7A 1W2BU 1KMIZ 4ZIBA 2DMXA 3QO5A 1R73A 1X59A 3CRCA 1B06A 1M56C 3ZHTA 3K5OA 4FLXA 4HBNA 2WAMA 1NT2B 2CH7B 5JJEB 1BQ0A 2Y4TA 2QWRB 1VQ8V 4UVAA 2ZKOA 4CZZA 1NVPB 3LSUA 2IJIA 3OT7A 2B5UA 4NXMB 3DSQA 3ASNC 1OCZC 4DR3B 3B8NA 1HP8A 3G80A 1N33O 5KAIZ 1VEWA 1K5QA 2DQ3A 1G8MA 3SPHA 4RQFA 2UUAB 4JAUA 4NXMO 3E22B 2ZDIA 4UCUA 3R65A 2UXBB 1H8EG 2QKCA 1S77D 3RT3C 2CDYA 3TGUH 4LF8B 3IJ4A 2F95B 2HVKC 1R3KC 4MVUA 1Y67A 4UCOA 1KQSU 1YJNV 3RWRD 4L8JA 3STZC 3OEHG 2LGWA 5LOVA 2EZOA 1XL6A 1KB9F 3CJHA 1BCCH 2JDIG 3GB7C 1O9HA 4WFGA 2EINC 3J7AU 2YI9A 3BABA 2AZ0A 1VIBA 3OTOO 3AK2A 1VQMV 2IJKA 3ZN1A 3K58A 1KKCA 3FYIB 2DE0X 4RUFA 1Y76B 2QWPB 1N34O 2QWQB 3AK1A 4JI6O 3CYOA 1AVMA 4UXNA 4DV2O 3W7SA 2QTSA 4X64B 1TUBB 3NR7A 2CUGA 4AI8A 3K5NA 4J7ZA 1NH2B 4WFFA 3KCYA 1UJWB 3K59A 1AR5A 4PELA 4QGPA 3FD9A 3BPZA 1GN3A 4G2KA 2E75B 1KECA 4FMTA 1OCOC 4HNAA 1QBZA 3I55V 2GUZA 3TJTA 1BT8A 4DV6B 2VWJA 2HFEC 5C93A 5JJNB 4FJCC 3E8BA 2JRIA 1Q8IA 5IY5B 4CC5A 1QHTA 3BA9A 3OR7C 4DUYO 2PTMA 4TT3G 1S76D 3ZRWB 3UQ8A 1P84F 4NYKA 2A7WA 4LFAB 4N21A 3L9DA 2R72A 2JVDA 4DRXA 5BMVA 1NR1A 3CRMA 3X2QC 2UUAO 4X20B 1I0HA 3TETA 1HR0B 2QGNA 5JCOA 2IH3C 3H9VA 5AG2A 1ZL8B 3SYPA 3JAKA 2KG7B 1FXHA 5B3SB 1AJQA 2BOCC 4J7KA 1MZEA 1LUWA 4TWKA 3OMAB 1IX9A 3C3SA 2DYRC 4LF5O 4I50B 2XUMA 3AG2C 2H3OA 4GKKO 5B1BC 1SZTA 2KSDA 4DW0A 1R6TA 2XAQA 3IC9A 4HYOA 1D2DA 3KCXA 4ZI7B 3KKYA 1N0NA 2P5OA 3JD3A 2ZE5A 2ZDIC 3B77A 2VWKA 1XNQB 4J42A 3JCZA 5KLVH 5K1PA 4DV2B 1Q81W 4JI6B 4JAAA 5LBQA 2CH7A 2WA3A 1D5NA 2VQEB 1G6UA 2M7WA 1S72V 3VQYA 3JALA 3RYIB 2EZPA 3RYCA 1E1RG 3JAMN 4O4HB 3D8CA 2HHHO 1QQCA 4I50A 5D5PA 1WJZA 4QNHB 4DR2O 1BHAA 1JVMA 2CTWA 2ZE6A 4R50A 2L35A 5LHIA 3ZMUA 3O9OA 4ICGA 3CC4V 4Z2WA 4KFMA 3D3IA 4BW5A 1CEZA 2LFSA 1URFA 4F6EA 2EBOA 1NR7A 1NI8A 1Q82W 3F5TA 2W0XA 4JASA 3MDSA 5H6QA 5DECA 2YXHA 3ZS8C 2FMLA 4PDRA 1Y4MA 3OM3B 4WF9V 1IXMA 4Z1VA 1I94B 1SC5B 2G38A 1BSMA 3H1JH 1F7YA 3K3WA 1VF6C 3RBZA 3CE2A 5EYPB 3W7XA 4X1IB 3FB6C 2GUZB 5L3DA 4O4LA 5J2TA 2OTJV 5B1BB 1PV0A 5D5QA 1HNXO 3HKEA 4FZ1A 2E74B 4IT5A 4QPKA 2XHBA 2JS3A 5LGUA 1XHXA 2XAFA 4MSWC 2K9PA 4XDJA 4DV7B 5IYZA 1NBMG 1T5EA 2MK3A 2XASA 1RFYA 1LNQA 4PHZA 2OCHA 2UXDO 2EIKC 4JTDB 3DC5A 2HJFC 1QLEB 1QU7A 2PY5A 1SA0B 2ZD9A 2IM9A 3A0RA 1FS0G 3G4SV 2W6IG 2GHYA 4GUNA 4P9OA 1G1XB 2GBOA 2UUBO 2O57A 4PI0A 5TISZ 1HDJA 4W4LA 3WG7C 4FPPA 4X9QA 1KC8W 4YJ3B 2H8PC 1SQQH 1OHHG 3SR2C 3K79A 2C2AA 5H2FZ 1Q7YW 1WLEA 1OCCB 1ZUQA 1OCOB 2UU9O 3SPGA 3AEIA 1K92A 1K8AW 4DR5O 1HNWO 1FFTB 3ZHSA 4X88A 1TAEA 2DYSC 1I5YA 5IJ9A 1MG1A 1V54B 4PA9A 2Q0OC 4O2BB 1BL8A 1Y74B 4DV5B 3CC7V 1RPRA 4WFHA 4UV8A 1W0KG 4DR7O 3RYFB 1KP2A 4BW9A 3E89A 4EB6A 2YXYA 4U7OA 1Q6UA 1BE3H 1SQGA 2WLHA 1EZJA 2ZNIA 5GONA 3VOUA 1K3EA 4O4IB 1CXZB 4X62O 2LW7A 3HKBB 3F5WC 4K35A 4QPJA 2QTOA 1QVGU 1H2NA 4O4JB 4X1YB 4N23A 2Q7GA 4J11A 5EYPA 3BEHA 3JAWA 5GW7A 1EN4A 5L3GA 2JK5C 3I5DA 1NTKH 2EIMB 2WPDG 4RQEA 3FB7C 5KHHA 4WFEA 4OX9B 1RPOA 1N32B 2YIAA 4IYIA 3UT5A 5EIBC 3S3WA 1TVKA 4B3MB 3APQA 1JOYA 4B3SB 1Q5OA 1FD9A 1SERA 2PGGA 4JI0B 1LUVA 4X1KA 3X2QB 3K9SA 1VQLV 3QG5A 3RYHB 3CXHF 4DV1O 2DYSB 4CS4A 5BXZA 2ILMA 1V55B 1J5EO 1IXBA 1R6NA 3PN1A 4I4TB 1A32A 1H2GA 2JGUA 2B1IA 4CBCA 3S3XA 1P4RA 4D6TH 5K1XA 2GDSA 3K5LA 1SRYA 3RW0A 4TV9A 1YSCA 4GX5A 5LA6B 2Q5ZA 4ZI7A 3H1HH 4GT1A 3GWOA 3IFXA 4CS3A 3ABKB 2MW2B 4L87A 5JQGA 5L3BA 1YCIA 3O65A 2D2CB 2FTKA 4PA6A 4R6ZA 3U0ZA 2IU3A 3JSNA 4H33A 4JI1O 2YIDA 2EULA 4EFBA 3OGIB 3EHBB 4LF9B 3FAVA 1NS1A 3J80N 1QVFU 2GTAA 3JAKB 4GYCB 3CB2A 5JWPA 2NN4A 1WN7A 3M7MX 3CCRV 5DEDA 2UXCO 3SDLA 2YSUB 3JD2A 4JPRA 3ZRSA 1IBMB 1TVKB 4JF3A 3K9AA 4LH6A 3E8GA 4WFBV 4MTOA 3ZMTA 3ZMSA 4B08A 3ETDA 4HAMA 1OV9A 5LXTB 1N34B 3L72H 1KD1W 4W4KA 3JD0A 3OEEG 3Q4HA 1GRJA 1VMGA 3CCJV 2RDCA 4AILC 2XAJA 4X1YA 1R1BA 4J41A 3HKBA 4RAIA 3SPIA 2F43G 2YI8A 2XT9A 2ADPA 4TOIA 5J9PC 3WB0A 2A0LA 1J95A 3AG2B 2WLLA 2F66C 4JI5B 3BHPA 3ZHQA 4JYYA 3FB5C 4DXWA 4LF7O 1V54C 4B3TO 3A0BZ 4UFZA 1AB3A 3P30A 1M57B 3CCSV 2HEPA 4JYCA 1AILA 2WLLB 1SQPH 1L1FA 4B3RO 1DF5A 1K97A 4FLWA 2Q4PA 3WG7B 2A9HA 3B8MA 4PI2A 1NKDA 3BCCH 1ZLZA 3ICXA 4NXNB 4DUZB 4DV3B 3JARA 2R70A 1G4YB 5BR8O 4KHPB 2Q6AA 5EZYB 2ITCC 2RNBA 4CS2A 4YJ3A 3SJAC 3SYQA 5H5NA 5B1NA 3W7WA 4U3JA 3ZMVA 2LO1A 3AG7A 2F4VO 2QR4A 4P30A 4JI8B 3L70H 3G6EV 2OYQA 4WBNA 4CH3A 1RSOB 1PNMA 1BZKA 5JJJB 2P67A 3WB1A 1S0VA 4MS2A 2QA4V 3L74H 4YJ2B 5KHGA 1TA8A 3DC6A 3BA8A 4KXRA 3FAVB 1IBLB 2BCCH 1L0LH 5B1OA 1AI7A 2PI4A 3ZCCA 2AZ2A 2ADQB 3JSLA 4DO2A 3B09A 1VQNV 2E5LO 3AG1B 4O4LB 5J2TB 1XBLA 1VQ4V 1B3QA 1P7BA 3E8FA 4K3AA 2ZR2A 2HG5C 1H2SB 3N2GA 1H8HG 1UPGA 4H37A 4DR1O 4I0XA 1M90W 3C90A 3G71V 1FXKB 1E1QG 1MA1A 3SJCC 1U97A 2AXTZ 5KAFZ 1W59A 1X4TA 1OJHA 5EC1C 1Q86W 1CP9A 3OUFA 1FPOA 5E1AC 1E79G 2IJHA 4UCTA 5KMGB 4J9ZB 4DV1B 4NXNO 3OTFA 3UO2A 3FFQA 1I5XA 2KKWA 3T1YB 3CSXA 3T1YO 2FKXA 4CC6A 1R3IC 4PDMA 5JH7B 3JATA 4LBEC 3OE7G 1MABG 5E79Z 5JH7A 3PJSK 2PF4E 1N0JA 3OMIB 2P90A 3K0DA 4NVPA 2XOKG 4O4HA 5LHGA 3AG4C 3OMNB 2W6JG 1QR8A 3JALB 1I7FA 1GM9A 4DR2B 3CCVV 1XHZA 1SKVA 1M5IA 1K33A 1H2LA 5LP6B 3IAYA 1VF5B 4UCRA 4BIZA 4X65B 2YIBA 2QWOB 1Y66A 2WSSG 1WPBA 4XDKA 3MHSC 2UUCB 1AP5A 1FXKA 3OW2U 1SZXA 2K1EA 2Q0AA 1VP7A 4LWSA 2DWEC 4PJ0Z 2ZE8A 2VRZA 1SQXH 3JD1A 1M56B 4UCSA 1GN4A 2YS8A 1JA8A 5F2VO 5EBMC 4PA4A 4LNUB 3CRQA 4EB6B 2KG7A 4DV5O 1NZ6A 1N36B 1IDSA 1LR1A 1PD3A 2JS5A 1IBKO 2X7RB 1XILA 3T4ZA 5BR8B 1K34A 2ZIMA 4KHPO 1AROP 2BSKA 1XMOO 3TXSA 3CS5A 5FLXN 1JFFA 4ZHQA 5EZYA 1CPYA 1MSDA 5CA1B 3OR6C 3UKMA
chains in the Genus database with same CATH topology
2CUGA 2YUAA 1BQ0A 2Y4TA 4J7ZA 4RWUA 2Y4UA 2QSAA 2QWOB 2QWRB 2YS8A 1HDJA 1FPOA 2DN9A 2M6YA 2CTQA 2GUZB 1GH6A 1FAFA 2CTPA 2PF4E 2N05A 1BQZA 2DMXA 1IURA 2EJ7A 2LGWA 2OCHA 1WJZA 3BVOA 3UO2A 1XBLA 2QWPB 1NZ6A 2QWQB 2KQXA 2L6LA 1N4CA 2QWNB 3APQA 2CTRA 2CTWA 4IT5A 2LO1A 3AG7A 3UO3A 3UCSC 3APOA 4J80A 2N04A 2GUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CUG A;  2YUA A;  1BQ0 A;  2Y4T A;  4J7Z A;  4RWU A;  2Y4U A;  2QSA A;  2QWO B;  2QWR B;  2YS8 A;  1HDJ A;  1FPO A;  2DN9 A;  2M6Y A;  2CTQ A;  2GUZ B;  1GH6 A;  1FAF A;  2CTP A;  2PF4 E;  2N05 A;  1BQZ A;  2DMX A;  1IUR A;  2EJ7 A;  2LGW A;  2OCH A;  1WJZ A;  3BVO A;  3UO2 A;  1XBL A;  2QWP B;  1NZ6 A;  2QWQ B;  2KQX A;  2L6L A;  1N4C A;  2QWN B;  3APQ A;  2CTR A;  2CTW A;  4IT5 A;  2LO1 A;  3AG7 A;  3UO3 A;  3UCS C;  3APO A;  4J80 A;  2N04 A;  2GUZ A; 
#chains in the Genus database with same CATH topology
 2H94 A;  4I9W A;  2ITD C;  3AG4 B;  3LNM B;  3A8T A;  5CBF A;  2UXD B;  4EEQ A;  2JEX A;  4JI3 O;  2X0L A;  2P06 A;  2UXN A;  3WB2 A;  3P3P A;  1YIJ V;  2LP7 A;  2A3Q A;  3LSS A;  4J10 A;  4TQD A;  1M4U A;  4A5U B;  5LL6 Y;  1XQ8 A;  2F4V B;  5IYZ B;  1H2K A;  1THZ A;  3HKC A;  2HJD A;  2OIE A;  3ML0 A;  4LCU C;  1VQO V;  1XNR B;  3ABL C;  4IGG A;  5IDJ A;  3DXR B;  2GV9 A;  4E4E A;  1MNG A;  5FNV A;  3T1H B;  4LFB B;  2QEX V;  3EVK A;  3ABK C;  3T1H O;  1NTM H;  2QKS A;  2QM4 A;  4Z1M G;  3K04 A;  5IJ0 B;  4X66 O;  1W0J G;  3Q4H B;  1IBM O;  5CA1 A;  1DGS A;  4IIJ B;  3F7V C;  3OTO B;  1BQZ A;  4D7S A;  5LOV B;  2YEV B;  2CAZ C;  1SQF A;  3HPL C;  5KUM A;  1P7G A;  3OFN G;  4F4L A;  2ZNJ A;  5KHJ A;  1WP8 A;  5H6R A;  3UCS C;  1MZF A;  2DW4 A;  4PA3 A;  2Q67 A;  4YHH O;  1Z5V A;  1ZX3 A;  2OIG A;  4FLY A;  4QJF B;  5CBH A;  1Q90 D;  4K8X A;  5EIB D;  4DK1 A;  1GKF A;  1QLE C;  2V1D A;  2HHH B;  4H0L B;  1RM1 C;  4ABM A;  4LFC B;  1YTF B;  2Z5U A;  2UXB O;  5EK0 A;  3D36 A;  3CME V;  4FLU A;  5KA6 A;  2ZIO A;  1EM1 A;  1AR4 A;  3QTC A;  1QR9 A;  1M9N A;  4JYA B;  2DJV A;  1FXK C;  5CBG A;  2JGD B;  1XNR O;  2DWD C;  1FFX B;  3RGB A;  4DV0 O;  3BRC A;  5LA6 A;  4GX1 A;  5IYC O;  4PV1 B;  4IHJ A;  4RO2 A;  3APO A;  1FFX A;  3N27 A;  3ABM B;  3A0H Z;  3FYE B;  3THO A;  1GTO A;  2ZXW B;  4G27 B;  5GTH Z;  1YHQ V;  1HWY A;  4GX0 A;  2FYU H;  2Q69 A;  2RQ6 A;  2EIK B;  1FXV A;  4NTY A;  1IBL O;  4DR6 B;  4FLT A;  4BIO A;  4DR6 O;  4JTC B;  2QKA A;  4FZ0 A;  4JYB A;  1GK9 A;  3FX7 A;  4F6R B;  1FKA O;  4X1K B;  3EXA A;  1M1K W;  3IGA C;  1FJG O;  2AHZ A;  3H1K H;  4EFE A;  4X20 A;  2HR3 A;  1VQ5 V;  2NR5 A;  4NB5 A;  2XAH A;  1JJ2 U;  4YIO A;  3HKD B;  5LP6 C;  1S5J A;  2WWW A;  3U10 A;  5KMG A;  4FM2 A;  1HNX B;  4UCV A;  4LF6 O;  2X6C A;  1YXB A;  1MOF A;  1ROP A;  1AJP A;  2R9I A;  4B7E A;  2JJ2 G;  2LW1 A;  4B7K A;  1JCH A;  4GLX A;  4JYA O;  4MW3 A;  1SQV H;  4JI2 O;  2M6Y A;  1QCE A;  2JGD A;  2GSM B;  3N2G B;  2Q7E A;  4YY3 B;  4TV8 A;  5IJ0 A;  5IT9 N;  3LSQ A;  4HNA B;  1P49 A;  4O4J A;  1BS3 A;  3ZRX A;  1ZSP A;  3P3N A;  4LFC O;  1QLN A;  3VQW A;  1ZTE A;  2IH1 C;  2F1M A;  4X64 O;  5JCO C;  1WB8 A;  3K08 A;  1RM1 B;  4YIP A;  3CCE V;  1ENV A;  3T1C A;  4YHH B;  3RN4 A;  4HZ3 A;  4JI2 B;  3NXS A;  1MMM A;  2CTP A;  5ITZ B;  2EJ7 A;  3ZRV A;  4KUM A;  1K7D A;  5LMU O;  4DR1 B;  1K4D C;  2UUC O;  2KQX A;  2L6L A;  4X65 O;  5L3F A;  1KBH A;  3ZIA G;  1RSO A;  3BY6 A;  4FIP C;  1NQT A;  5KX5 B;  3DTU B;  4IL6 Z;  4EKW A;  1YVW A;  5LMU B;  4U3J B;  2YEV A;  1PPJ H;  2Q7H A;  4GKJ B;  2JEU A;  1KUQ A;  2ETN A;  1XDC A;  5J2U A;  1EZV H;  4ZHQ B;  2FB5 A;  2QJ1 A;  1SES A;  3ZX6 A;  1QNM A;  3KG2 A;  4J7J A;  1NJI W;  1US6 A;  5EBL C;  1JQ0 A;  2FL4 A;  1XMQ B;  4QE9 A;  4WCE V;  1AI4 A;  5FNV B;  2P6J A;  3JAS B;  5IWA O;  1JMK C;  3E2E A;  2WA4 A;  1SA0 A;  3HKC B;  4LF5 B;  3MD0 A;  1V55 C;  5ITZ A;  4FFB B;  4OXS A;  3ABL B;  4JI3 B;  1ORQ C;  5KA5 A;  4LNU A;  1K5S A;  3H01 A;  2AW9 A;  1HR0 O;  4P2Z A;  5GTI Z;  1NH2 D;  3H1L H;  2E5L B;  3HR0 A;  1Z5W A;  3HKE B;  1F23 A;  1L8D A;  2CGO A;  4UB8 Z;  2ZCE A;  3G67 A;  3CRA A;  4D7T A;  4X1I A;  3HB3 B;  1ZAU A;  2WLM A;  3ZHU A;  5LMN B;  3AG3 B;  1EBO A;  1WNS A;  1XMO B;  1Y6X A;  3ASN B;  3W7U A;  2N05 A;  3ZN0 A;  2P4K A;  5LP6 A;  3T2M A;  2WLI A;  2LJ2 A;  3F7Y C;  3CXC U;  3HKD A;  2CTR A;  3LDD A;  1N36 O;  3T4D A;  5B3S C;  4MTG A;  3IC7 A;  3CD6 V;  1YIT V;  4JTA B;  1F51 A;  4O2A A;  3CEI A;  2YIC A;  3OAA G;  1N8R W;  3JAT B;  2DQ0 A;  5BZB A;  4TSF G;  4ZOL A;  1VQP V;  1JJO A;  3N2K A;  1XNQ O;  2XTA A;  2A06 H;  1WA8 B;  4H44 B;  1S5H C;  3WU2 Z;  4X89 A;  5LYJ B;  1PL0 A;  4LR3 A;  2Q8V A;  2HLD G;  2ZQM A;  2BE3 A;  1K73 W;  4PA7 A;  4E2L A;  4AQY B;  2Y48 A;  2UXX A;  3QF7 A;  2CK3 G;  4U7N A;  5FPO A;  1XRE A;  4NTW A;  1OCR B;  1F4N A;  4IHJ B;  1F4M A;  2W0F C;  4YY3 O;  2EIN B;  2XND G;  1WP7 A;  2EIL C;  1VQ6 V;  2JIZ G;  2ATK C;  2ZXW C;  2ZIN A;  4LF7 B;  3BAA A;  3RVZ A;  1RP3 B;  3RFR A;  1AP6 A;  4OPH A;  1AI6 A;  3ABM C;  1KYO F;  4I4T A;  5BY1 A;  4Q20 A;  1PNK A;  1WA8 A;  1AI5 A;  2EIJ C;  4G28 B;  4JAV A;  1GMG A;  5DM6 V;  3W7T A;  2EX3 A;  2WLJ A;  3N2K B;  4H13 B;  3TCU A;  4LF8 O;  2VQF B;  5FPR A;  2Y69 B;  1FJG B;  2NLJ C;  3K06 A;  4X66 B;  4R8C A;  2N04 A;  4XBF A;  2HP8 A;  1WAZ A;  1L0N H;  2QM8 A;  5BMV B;  4DRX B;  2F23 A;  1IVS A;  3LDE A;  4WBN B;  3UT5 B;  4DR5 B;  3ZRW A;  5KHK A;  2WLI B;  2UU9 B;  4MVM A;  4TUY B;  2B9Z A;  1N4C A;  2WLN A;  1SQB H;  4PDL A;  1SET A;  1YI2 V;  5LHH A;  1GN6 A;  3JAW B;  4I0X B;  2RMK B;  5IWA B;  4IIJ A;  3SPJ A;  2VS0 A;  3LUT B;  2Y69 C;  4PD4 F;  2OTL V;  1WPX A;  3K57 A;  4LF9 O;  3JAR B;  3OD4 A;  1DF4 A;  1FAF A;  2UUB B;  3G6B A;  2HVJ C;  4JI0 O;  5CB4 A;  2IU0 A;  1S5L Z;  3EFF K;  3GWK C;  4YXW G;  4B3M O;  3H1I H;  3DXR A;  4O4I A;  3ZJZ A;  5JVD A;  5LMN O;  4GKJ O;  4NTX A;  1EN6 A;  4RWU A;  2PYL A;  5DN6 G;  4FFB A;  4YJ2 A;  1KP3 A;  1SF9 A;  3STL C;  4U3F H;  1Y76 A;  1XL4 A;  1Y74 A;  3CPW U;  2LGQ A;  2HKO A;  4MTX A;  3JAS A;  5FL7 G;  4B3T B;  1M57 C;  3D36 C;  4FVM A;  4X8A A;  1IBK B;  3ASO C;  5IJ9 B;  4J80 A;  3CCL V;  2YUA A;  4JI4 O;  1VQ9 V;  2DOS A;  2XAG A;  2BTQ A;  3CMA V;  1ZWI C;  4DUZ O;  3CJH B;  3CCQ V;  2YIB D;  3K5M A;  1TGO A;  4DR4 O;  1IZ3 A;  2Z3Y A;  4P9P A;  5LXT A;  1NVP D;  2NNU A;  1XMQ O;  3K0G A;  3KZI Z;  5IYD O;  1WB7 A;  3ZHV A;  4BIU A;  2BSK B;  3QO7 A;  1K9M W;  1FYJ A;  4FK5 C;  4DK0 A;  3JD4 A;  3CC2 V;  5B1A C;  4FLV A;  3L71 H;  1B6Q A;  3E83 A;  3ABU A;  2PI5 A;  4JGS A;  4JI5 O;  3WFV A;  4MVS A;  2CGN A;  3RVY A;  3SYO A;  5L3C A;  4KP4 A;  1COW G;  1R6K A;  3E22 A;  4IYH A;  2EIM C;  1JPX A;  3UO3 A;  3FB8 C;  3ZBH A;  2D3O W;  1DK1 A;  1Z2G A;  4RUE A;  3E86 A;  3CRR A;  1PNL A;  4Q6G A;  3CP1 A;  3MHH C;  4LP8 A;  2ARH A;  2VQE O;  3AG3 C;  3OGC C;  1BGY H;  3I56 V;  3E35 A;  4LWS B;  4OGQ B;  3ZHR A;  2RJZ A;  1NTZ H;  5B66 Z;  2AGA A;  1VF7 A;  4OPA A;  1XEQ A;  2RN9 A;  1H2M A;  2QSA A;  1GM7 A;  2P7T C;  3CCU V;  1JX9 A;  4K0K B;  4TUY A;  2AHY A;  4UVB A;  4I7Z B;  4JI8 O;  1B04 A;  3FKS G;  4BR6 A;  3L73 H;  2KB1 A;  4NKG B;  2IBZ H;  5B5E Z;  1PKX A;  5CN0 A;  1HNW B;  4QIW F;  3RYH A;  3VQV A;  1YJ9 V;  4LF6 B;  4F6R A;  1J5E B;  2YDE A;  2WLK A;  1YF2 A;  3C3T A;  3ASO B;  1GO3 F;  5H9C A;  5A2Q N;  5CA0 B;  2CE4 A;  2QDO A;  2OCC B;  2PZS A;  1Q3E A;  3GVM A;  3UM7 A;  4JI7 O;  1NU1 H;  1XUQ A;  1MSW D;  3RYC B;  1YEW A;  1BMF G;  4DUY B;  3K03 A;  1Q43 A;  2EIL B;  4GX2 A;  5CA3 A;  1OCC C;  4TV9 B;  2X6B A;  4J9Y B;  4FLZ A;  4OX9 O;  1OZ0 A;  1HNZ O;  3E8H A;  4ASU G;  2OWO A;  4MVQ A;  1YDX A;  5B1A B;  2GTS A;  1SS3 A;  4BWA A;  5LYJ A;  4CH6 A;  1XI1 A;  3BFR A;  2P22 C;  3ETQ A;  2A79 B;  1OCZ B;  4JV5 B;  3ETG A;  3ZMZ A;  4DV0 B;  2EIJ B;  1Q6I A;  3LNN A;  3P32 A;  2Y0P A;  2ZR3 A;  1GM8 A;  1HW7 A;  3SGI A;  2YXL A;  4R7C A;  5IYB O;  2QWN B;  4DV3 O;  1GN2 A;  4KL1 A;  1AJN A;  3SYC A;  1N32 O;  3R66 A;  3CHX A;  3TXQ A;  3L75 H;  3SPC A;  3ETE A;  4ZKI A;  1DLB A;  2RCV A;  2ZT9 B;  3LDC A;  4B3R B;  4O2B A;  2IW5 A;  1VAR A;  4DR7 B;  3B2E E;  4MVO A;  2ZM6 O;  4DV4 O;  1YZB A;  4UVC A;  3QO8 A;  1AR1 B;  4I55 A;  3CX5 F;  3J81 N;  4BAY A;  3DGE A;  4JI1 B;  4I5S A;  4X62 B;  1K4C C;  2JJ1 G;  2BTQ B;  4C7U A;  2N74 A;  2PYJ A;  4JZ2 A;  4LF4 O;  5EC2 C;  5HFL A;  3SJB C;  2P4V A;  2Q68 A;  3B4S A;  1YJW V;  2V7Q G;  1S3J A;  1UFI A;  4LFA O;  3M99 B;  5C8Y A;  4JI7 B;  4XDL A;  5KHI A;  5L3E A;  5GON B;  1PM9 A;  2PUS A;  3JCU Z;  4WFA V;  4I9Q A;  1D5A A;  1EN5 A;  4MVZ A;  2QE7 G;  4NR1 A;  1O9G A;  4DYL A;  2E3C A;  1V9P A;  1TUB A;  1YTF D;  4MT8 A;  3RYF A;  4LFB O;  1U96 A;  2YC0 A;  4MTF A;  3AK3 A;  5CMU A;  1N33 B;  5JVD B;  5C8Y B;  4DV7 O;  4FM0 A;  2R9A A;  2Q9L A;  1M93 A;  2IJJ A;  4AHC A;  2UXC B;  5CB4 B;  4GKK B;  2Y0I A;  3OUS A;  4CH5 A;  4K0K O;  5J2U B;  2ZE7 A;  5IY5 C;  4MW8 A;  4UUJ C;  1JFF B;  2LQT A;  4I55 B;  2R9R B;  3A2F A;  5IE9 A;  3CCM V;  4B3S O;  4DW1 A;  4CH4 A;  2Q73 A;  1DTO A;  4LC1 A;  5KX5 A;  2X6A A;  2B1G A;  4K8Z A;  4JZG A;  3U11 A;  2DN9 A;  2CTQ A;  1GH6 A;  1OCR C;  2VQF O;  5EBW C;  2EJR A;  1IUR A;  5LGT A;  5KUK A;  3VQX A;  2V4D A;  3QNE A;  1VQK V;  1PP9 H;  4LF4 B;  4GCZ A;  3TK1 A;  4DV6 O;  2QM7 A;  4PDV A;  3ABT A;  3CWB H;  1KU9 A;  3D3Q A;  3ZED A;  2BOB C;  3AG1 C;  4MVR A;  1HNZ B;  5HFM A;  4QE7 A;  2ODM A;  4UV9 A;  1XOU A;  2DYR B;  1R3J C;  3RYI A;  1I94 O;  2ZM6 B;  3SYA A;  4DV4 B;  5JQG B;  3BVO A;  2OT5 A;  4TV8 B;  4AQY O;  3VBB A;  3SJQ C;  2LFR A;  3QVN A;  4DR4 B;  2BTO A;  5A9G A;  3B40 A;  4GZR B;  4FFK A;  2Y4U A;  4FM1 A;  1VQ7 V;  4UB6 Z;  4ZBM A;  2E76 B;  4JI4 B;  4TQF A;  1H38 A;  1EFR G;  1PL4 A;  1GAX A;  3MAQ A;  5CA0 A;  4DR3 O;  4JV5 O;  4ZOL B;  1BHB A;  3JYC A;  2Z0A A;  1KKD A;  1VF6 A;  3M8A A;  1I08 A;  1JR9 A;  1Q6H A;  4O2A B;  1TUE B;  1ZL8 A;  5LGN A;  1R3L C;  2F93 B;  2OCC C;  4LH7 A;  1W2B U;  1KMI Z;  4ZIB A;  2DMX A;  3QO5 A;  1R73 A;  1X59 A;  3CRC A;  1B06 A;  1M56 C;  3ZHT A;  3K5O A;  4FLX A;  4HBN A;  2WAM A;  1NT2 B;  2CH7 B;  5JJE B;  1BQ0 A;  2Y4T A;  2QWR B;  1VQ8 V;  4UVA A;  2ZKO A;  4CZZ A;  1NVP B;  3LSU A;  2IJI A;  3OT7 A;  2B5U A;  4NXM B;  3DSQ A;  3ASN C;  1OCZ C;  4DR3 B;  3B8N A;  1HP8 A;  3G80 A;  1N33 O;  5KAI Z;  1VEW A;  1K5Q A;  2DQ3 A;  1G8M A;  3SPH A;  4RQF A;  2UUA B;  4JAU A;  4NXM O;  3E22 B;  2ZDI A;  4UCU A;  3R65 A;  2UXB B;  1H8E G;  2QKC A;  1S77 D;  3RT3 C;  2CDY A;  3TGU H;  4LF8 B;  3IJ4 A;  2F95 B;  2HVK C;  1R3K C;  4MVU A;  1Y67 A;  4UCO A;  1KQS U;  1YJN V;  3RWR D;  4L8J A;  3STZ C;  3OEH G;  2LGW A;  5LOV A;  2EZO A;  1XL6 A;  1KB9 F;  3CJH A;  1BCC H;  2JDI G;  3GB7 C;  1O9H A;  4WFG A;  2EIN C;  3J7A U;  2YI9 A;  3BAB A;  2AZ0 A;  1VIB A;  3OTO O;  3AK2 A;  1VQM V;  2IJK A;  3ZN1 A;  3K58 A;  1KKC A;  3FYI B;  2DE0 X;  4RUF A;  1Y76 B;  2QWP B;  1N34 O;  2QWQ B;  3AK1 A;  4JI6 O;  3CYO A;  1AVM A;  4UXN A;  4DV2 O;  3W7S A;  2QTS A;  4X64 B;  1TUB B;  3NR7 A;  2CUG A;  4AI8 A;  3K5N A;  4J7Z A;  1NH2 B;  4WFF A;  3KCY A;  1UJW B;  3K59 A;  1AR5 A;  4PEL A;  4QGP A;  3FD9 A;  3BPZ A;  1GN3 A;  4G2K A;  2E75 B;  1KEC A;  4FMT A;  1OCO C;  4HNA A;  1QBZ A;  3I55 V;  2GUZ A;  3TJT A;  1BT8 A;  4DV6 B;  2VWJ A;  2HFE C;  5C93 A;  5JJN B;  4FJC C;  3E8B A;  2JRI A;  1Q8I A;  5IY5 B;  4CC5 A;  1QHT A;  3BA9 A;  3OR7 C;  4DUY O;  2PTM A;  4TT3 G;  1S76 D;  3ZRW B;  3UQ8 A;  1P84 F;  4NYK A;  2A7W A;  4LFA B;  4N21 A;  3L9D A;  2R72 A;  2JVD A;  4DRX A;  5BMV A;  1NR1 A;  3CRM A;  3X2Q C;  2UUA O;  4X20 B;  1I0H A;  3TET A;  1HR0 B;  2QGN A;  5JCO A;  2IH3 C;  3H9V A;  5AG2 A;  1ZL8 B;  3SYP A;  3JAK A;  2KG7 B;  1FXH A;  5B3S B;  1AJQ A;  2BOC C;  4J7K A;  1MZE A;  1LUW A;  4TWK A;  3OMA B;  1IX9 A;  3C3S A;  2DYR C;  4LF5 O;  4I50 B;  2XUM A;  3AG2 C;  2H3O A;  4GKK O;  5B1B C;  1SZT A;  2KSD A;  4DW0 A;  1R6T A;  2XAQ A;  3IC9 A;  4HYO A;  1D2D A;  3KCX A;  4ZI7 B;  3KKY A;  1N0N A;  2P5O A;  3JD3 A;  2ZE5 A;  2ZDI C;  3B77 A;  2VWK A;  1XNQ B;  4J42 A;  3JCZ A;  5KLV H;  5K1P A;  4DV2 B;  1Q81 W;  4JI6 B;  4JAA A;  5LBQ A;  2CH7 A;  2WA3 A;  1D5N A;  2VQE B;  1G6U A;  2M7W A;  1S72 V;  3VQY A;  3JAL A;  3RYI B;  2EZP A;  3RYC A;  1E1R G;  3JAM N;  4O4H B;  3D8C A;  2HHH O;  1QQC A;  4I50 A;  5D5P A;  1WJZ A;  4QNH B;  4DR2 O;  1BHA A;  1JVM A;  2CTW A;  2ZE6 A;  4R50 A;  2L35 A;  5LHI A;  3ZMU A;  3O9O A;  4ICG A;  3CC4 V;  4Z2W A;  4KFM A;  3D3I A;  4BW5 A;  1CEZ A;  2LFS A;  1URF A;  4F6E A;  2EBO A;  1NR7 A;  1NI8 A;  1Q82 W;  3F5T A;  2W0X A;  4JAS A;  3MDS A;  5H6Q A;  5DEC A;  2YXH A;  3ZS8 C;  2FML A;  4PDR A;  1Y4M A;  3OM3 B;  4WF9 V;  1IXM A;  4Z1V A;  1I94 B;  1SC5 B;  2G38 A;  1BSM A;  3H1J H;  1F7Y A;  3K3W A;  1VF6 C;  3RBZ A;  3CE2 A;  5EYP B;  3W7X A;  4X1I B;  3FB6 C;  2GUZ B;  5L3D A;  4O4L A;  5J2T A;  2OTJ V;  5B1B B;  1PV0 A;  5D5Q A;  1HNX O;  3HKE A;  4FZ1 A;  2E74 B;  4IT5 A;  4QPK A;  2XHB A;  2JS3 A;  5LGU A;  1XHX A;  2XAF A;  4MSW C;  2K9P A;  4XDJ A;  4DV7 B;  5IYZ A;  1NBM G;  1T5E A;  2MK3 A;  2XAS A;  1RFY A;  1LNQ A;  4PHZ A;  2OCH A;  2UXD O;  2EIK C;  4JTD B;  3DC5 A;  2HJF C;  1QLE B;  1QU7 A;  2PY5 A;  1SA0 B;  2ZD9 A;  2IM9 A;  3A0R A;  1FS0 G;  3G4S V;  2W6I G;  2GHY A;  4GUN A;  4P9O A;  1G1X B;  2GBO A;  2UUB O;  2O57 A;  4PI0 A;  5TIS Z;  1HDJ A;  4W4L A;  3WG7 C;  4FPP A;  4X9Q A;  1KC8 W;  4YJ3 B;  2H8P C;  1SQQ H;  1OHH G;  3SR2 C;  3K79 A;  2C2A A;  5H2F Z;  1Q7Y W;  1WLE A;  1OCC B;  1ZUQ A;  1OCO B;  2UU9 O;  3SPG A;  3AEI A;  1K92 A;  1K8A W;  4DR5 O;  1HNW O;  1FFT B;  3ZHS A;  4X88 A;  1TAE A;  2DYS C;  1I5Y A;  5IJ9 A;  1MG1 A;  1V54 B;  4PA9 A;  2Q0O C;  4O2B B;  1BL8 A;  1Y74 B;  4DV5 B;  3CC7 V;  1RPR A;  4WFH A;  4UV8 A;  1W0K G;  4DR7 O;  3RYF B;  1KP2 A;  4BW9 A;  3E89 A;  4EB6 A;  2YXY A;  4U7O A;  1Q6U A;  1BE3 H;  1SQG A;  2WLH A;  1EZJ A;  2ZNI A;  5GON A;  3VOU A;  1K3E A;  4O4I B;  1CXZ B;  4X62 O;  2LW7 A;  3HKB B;  3F5W C;  4K35 A;  4QPJ A;  2QTO A;  1QVG U;  1H2N A;  4O4J B;  4X1Y B;  4N23 A;  2Q7G A;  4J11 A;  5EYP A;  3BEH A;  3JAW A;  5GW7 A;  1EN4 A;  5L3G A;  2JK5 C;  3I5D A;  1NTK H;  2EIM B;  2WPD G;  4RQE A;  3FB7 C;  5KHH A;  4WFE A;  4OX9 B;  1RPO A;  1N32 B;  2YIA A;  4IYI A;  3UT5 A;  5EIB C;  3S3W A;  1TVK A;  4B3M B;  3APQ A;  1JOY A;  4B3S B;  1Q5O A;  1FD9 A;  1SER A;  2PGG A;  4JI0 B;  1LUV A;  4X1K A;  3X2Q B;  3K9S A;  1VQL V;  3QG5 A;  3RYH B;  3CXH F;  4DV1 O;  2DYS B;  4CS4 A;  5BXZ A;  2ILM A;  1V55 B;  1J5E O;  1IXB A;  1R6N A;  3PN1 A;  4I4T B;  1A32 A;  1H2G A;  2JGU A;  2B1I A;  4CBC A;  3S3X A;  1P4R A;  4D6T H;  5K1X A;  2GDS A;  3K5L A;  1SRY A;  3RW0 A;  4TV9 A;  1YSC A;  4GX5 A;  5LA6 B;  2Q5Z A;  4ZI7 A;  3H1H H;  4GT1 A;  3GWO A;  3IFX A;  4CS3 A;  3ABK B;  2MW2 B;  4L87 A;  5JQG A;  5L3B A;  1YCI A;  3O65 A;  2D2C B;  2FTK A;  4PA6 A;  4R6Z A;  3U0Z A;  2IU3 A;  3JSN A;  4H33 A;  4JI1 O;  2YID A;  2EUL A;  4EFB A;  3OGI B;  3EHB B;  4LF9 B;  3FAV A;  1NS1 A;  3J80 N;  1QVF U;  2GTA A;  3JAK B;  4GYC B;  3CB2 A;  5JWP A;  2NN4 A;  1WN7 A;  3M7M X;  3CCR V;  5DED A;  2UXC O;  3SDL A;  2YSU B;  3JD2 A;  4JPR A;  3ZRS A;  1IBM B;  1TVK B;  4JF3 A;  3K9A A;  4LH6 A;  3E8G A;  4WFB V;  4MTO A;  3ZMT A;  3ZMS A;  4B08 A;  3ETD A;  4HAM A;  1OV9 A;  5LXT B;  1N34 B;  3L72 H;  1KD1 W;  4W4K A;  3JD0 A;  3OEE G;  3Q4H A;  1GRJ A;  1VMG A;  3CCJ V;  2RDC A;  4AIL C;  2XAJ A;  4X1Y A;  1R1B A;  4J41 A;  3HKB A;  4RAI A;  3SPI A;  2F43 G;  2YI8 A;  2XT9 A;  2ADP A;  4TOI A;  5J9P C;  3WB0 A;  2A0L A;  1J95 A;  3AG2 B;  2WLL A;  2F66 C;  4JI5 B;  3BHP A;  3ZHQ A;  4JYY A;  3FB5 C;  4DXW A;  4LF7 O;  1V54 C;  4B3T O;  3A0B Z;  4UFZ A;  1AB3 A;  3P30 A;  1M57 B;  3CCS V;  2HEP A;  4JYC A;  1AIL A;  2WLL B;  1SQP H;  1L1F A;  4B3R O;  1DF5 A;  1K97 A;  4FLW A;  2Q4P A;  3WG7 B;  2A9H A;  3B8M A;  4PI2 A;  1NKD A;  3BCC H;  1ZLZ A;  3ICX A;  4NXN B;  4DUZ B;  4DV3 B;  3JAR A;  2R70 A;  1G4Y B;  5BR8 O;  4KHP B;  2Q6A A;  5EZY B;  2ITC C;  2RNB A;  4CS2 A;  4YJ3 A;  3SJA C;  3SYQ A;  5H5N A;  5B1N A;  3W7W A;  4U3J A;  3ZMV A;  2LO1 A;  3AG7 A;  2F4V O;  2QR4 A;  4P30 A;  4JI8 B;  3L70 H;  3G6E V;  2OYQ A;  4WBN A;  4CH3 A;  1RSO B;  1PNM A;  1BZK A;  5JJJ B;  2P67 A;  3WB1 A;  1S0V A;  4MS2 A;  2QA4 V;  3L74 H;  4YJ2 B;  5KHG A;  1TA8 A;  3DC6 A;  3BA8 A;  4KXR A;  3FAV B;  1IBL B;  2BCC H;  1L0L H;  5B1O A;  1AI7 A;  2PI4 A;  3ZCC A;  2AZ2 A;  2ADQ B;  3JSL A;  4DO2 A;  3B09 A;  1VQN V;  2E5L O;  3AG1 B;  4O4L B;  5J2T B;  1XBL A;  1VQ4 V;  1B3Q A;  1P7B A;  3E8F A;  4K3A A;  2ZR2 A;  2HG5 C;  1H2S B;  3N2G A;  1H8H G;  1UPG A;  4H37 A;  4DR1 O;  4I0X A;  1M90 W;  3C90 A;  3G71 V;  1FXK B;  1E1Q G;  1MA1 A;  3SJC C;  1U97 A;  2AXT Z;  5KAF Z;  1W59 A;  1X4T A;  1OJH A;  5EC1 C;  1Q86 W;  1CP9 A;  3OUF A;  1FPO A;  5E1A C;  1E79 G;  2IJH A;  4UCT A;  5KMG B;  4J9Z B;  4DV1 B;  4NXN O;  3OTF A;  3UO2 A;  3FFQ A;  1I5X A;  2KKW A;  3T1Y B;  3CSX A;  3T1Y O;  2FKX A;  4CC6 A;  1R3I C;  4PDM A;  5JH7 B;  3JAT A;  4LBE C;  3OE7 G;  1MAB G;  5E79 Z;  5JH7 A;  3PJS K;  2PF4 E;  1N0J A;  3OMI B;  2P90 A;  3K0D A;  4NVP A;  2XOK G;  4O4H A;  5LHG A;  3AG4 C;  3OMN B;  2W6J G;  1QR8 A;  3JAL B;  1I7F A;  1GM9 A;  4DR2 B;  3CCV V;  1XHZ A;  1SKV A;  1M5I A;  1K33 A;  1H2L A;  5LP6 B;  3IAY A;  1VF5 B;  4UCR A;  4BIZ A;  4X65 B;  2YIB A;  2QWO B;  1Y66 A;  2WSS G;  1WPB A;  4XDK A;  3MHS C;  2UUC B;  1AP5 A;  1FXK A;  3OW2 U;  1SZX A;  2K1E A;  2Q0A A;  1VP7 A;  4LWS A;  2DWE C;  4PJ0 Z;  2ZE8 A;  2VRZ A;  1SQX H;  3JD1 A;  1M56 B;  4UCS A;  1GN4 A;  2YS8 A;  1JA8 A;  5F2V O;  5EBM C;  4PA4 A;  4LNU B;  3CRQ A;  4EB6 B;  2KG7 A;  4DV5 O;  1NZ6 A;  1N36 B;  1IDS A;  1LR1 A;  1PD3 A;  2JS5 A;  1IBK O;  2X7R B;  1XIL A;  3T4Z A;  5BR8 B;  1K34 A;  2ZIM A;  4KHP O;  1ARO P;  2BSK A;  1XMO O;  3TXS A;  3CS5 A;  5FLX N;  1JFF A;  4ZHQ A;  5EZY A;  1CPY A;  1MSD A;  5CA1 B;  3OR6 C;  3UKM A; 
#chains in the Genus database with same CATH homology
 2CUG A;  2YUA A;  1BQ0 A;  2Y4T A;  4J7Z A;  4RWU A;  2Y4U A;  2QSA A;  2QWO B;  2QWR B;  2YS8 A;  1HDJ A;  1FPO A;  2DN9 A;  2M6Y A;  2CTQ A;  2GUZ B;  1GH6 A;  1FAF A;  2CTP A;  2PF4 E;  2N05 A;  1BQZ A;  2DMX A;  1IUR A;  2EJ7 A;  2LGW A;  2OCH A;  1WJZ A;  3BVO A;  3UO2 A;  1XBL A;  2QWP B;  1NZ6 A;  2QWQ B;  2KQX A;  2L6L A;  1N4C A;  2QWN B;  3APQ A;  2CTR A;  2CTW A;  4IT5 A;  2LO1 A;  3AG7 A;  3UO3 A;  3UCS C;  3APO A;  4J80 A;  2N04 A;  2GUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...