1NZ8A

Solution structure of the n-utilization substance g (nusg) n-terminal (ngn) domain from thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
119
Chain Sequence
SIEWYAVHTLVGQEEKAKANLEKRIKAFGLQDKIFQVLIPTEEVVELREGGKKEVVRKKLFPGYLFIQMDLGDEEEPNEAWEVVRGTPGITGFVGAGMRPVPLSPDEVRHILEVSGLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and sequence comparisons arising from the solution structure of the transcription elongation factor NusG from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription
molecule keywords TRANSCRIPTION ANTITERMINATION PROTEIN NUSG
total genus 18
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02357 NusG Transcription termination factor nusG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1nz8A00
2LQ8A 4ZN3A 1M1GA 1NPPA 1M1HA 1NZ8A 2OUGA 3H7HB 3QQCD 3P8BB 1NPRA 2K06A 3EWGA 2XHCA 2EXUA 4ZN1A 3LPEA
chains in the Genus database with same CATH superfamily
2KTQA 1KR4A 2G13A 3MMAB 5IC4B 1H7WA 1RU2A 2CDQA 3KDOA 2DH9A 3BS9A 4R0JA 2UVUA 3MAHA 3T9NA 4B02A 2DO4A 2PIIA 3I0RA 1VLOA 3R3TA 3CEDA 4ZVHA 2M3DA 3CMQA 1U6ZA 3M2VA 4HHUA 4OYZA 4ZP8A 4QW8A 4K4XA 1BC6A 1NDCA 2H51B 3HKZD 3PZPA 1NK4A 1S9GB 1OYEA 3HVTA 4F2SA 5DM7Q 1J5OB 1NAQA 1U1RA 2IHR1 2QA1A 3EDQB 4X66F 1ZAVA 3MMAA 2V69A 2UZAA 4ZVQB 5A6PA 1XC9A 3G9CA 4K4SA 4NZ6A 3HULA 3IG1B 3CJ5A 3OFFA 2Q6BA 4B3TJ 5AXMA 3SEOA 4CT9A 2UVWA 3X1LB 3NS7B 2ZH7A 5K20B 2Z8QA 4NCBA 1CJTB 1XR5A 2RMLA 1XK8A 1TVRB 4IDKB 3POTA 2Z30B 4FXWA 3OL9A 3TOQA 3NNHA 5B0GA 3EMTA 3NCQA 3SFGA 2ZHBA 3GV5B 5L1JA 4PEOA 4TU8A 2ATLA 3GTYX 2DNZA 3MD3A 3M6WA 4GVLA 5DDPC 4LFAF 3R2DJ 2EI5A 1VK3A 1GK8A 4GC6A 3M1VA 4M5LA 8ATCB 2C2DA 4S0MA 4ED4A 3FJ2A 1GTEA 4K2XA 4ZN3A 3UCZP 1JMTA 2GFFA 3PO4A 5KT5A 2VQEF 2VDIA 1RA6A 1SPBP 1BY9A 2AGQA 5C42B 4BDPA 1N32F 3D2WA 3Q0AA 1UAWA 2B9YA 2CNKB 4CZCA 1KS2A 2FC9A 1YBAA 2AEMA 4MK8A 4C0HA 2JFKA 4TU9A 3KLGB 1U6FA 1KOOA 3NKYA 4C8KA 4DWIA 1YJ7A 4QZVB 2DEJA 2MKSA 3R5BA 2MGZB 4ZA1A 1RTJA 3DOLA 4DSLA 2VFSA 1Z2LA 4K8RA 1F9HA 2BKOA 3ZTPA 4B3SJ 4OJ1A 3R9LA 4K50A 2ERRA 3ZZYA 1RB0A 2JRSA 4P52A 2KDOA 2D69A 4DPWA 2HS3A 3CDBA 2DGVA 3JSRA 1RACB 1QSYA 1XNRF 2FJBB 3BZQA 1HNWJ 3GJSB 2HWTA 3PYGA 3EZ5A 2HBZB 2E1PA 1FO1A 3DLGB 4EWTA 1HHTP 2HK2A 2WVBA 1VBZA 2RIJA 4OZ1A 1KQSR 1TUWA 1U1KA 4U7UK 4ED1A 1LW0B 2EC0A 3BB5A 3LUYA 1RBLA 2DNPA 4OJGA 2GVDA 4P75A 4C97A 3BJYA 4JV2A 2I1RA 2FB0A 2FUG9 3V4IB 1QLNA 3CW2C 4F0KA 4LSLB 4P7TA 4A48A 1ELOA 1SQGA 1WC0A 4USUA 1UVIA 1GMWA 4LQ9A 1Z2ZA 1GXTA 1RT2B 1T9VA 4DQSA 1Y5LB 5KFGA 1FT8A 5K8NA 1EETB 2BA9A 1P6TA 5HLFA 4YB1P 2BE2A 2OH2A 4C9DA 1DTTA 1QY7A 4XK8C 2F65A 1FHTA 3N28A 2Y9HA 4EUVA 3PFEA 2FJWA 4ES2A 1X4GA 3LF0A 2BR0A 2BEFA 3RZAA 3VAFA 3KG0A 4KKOA 1IBKJ 3CD6S 5HMYA 1SB6A 2DXEA 3GJTB 1X5SA 2PE8A 2V9KA 4K5SA 3MFHA 4NEYA 4Z2XA 2CRLA 4ZPVR 1C4CA 5IT9Y 1XERA 2MY7A 2YQ1A 2R8HA 4P7VA 2YKNB 3EDRB 3FQKA 2HMIB 3C16A 1RAEB 3W63A 3Q8VA 2Z57B 1ZM4A 1HR0F 3R6GB 3AY0A 3PHEA 4FF4A 4ILRA 4CRJA 2LMIA 3HZGA 1U0SA 2V50A 2L48A 3NCRA 2CWKA 2OI2A 1TUGB 5E3PA 5F8LA 1KC8T 1HQUA 2Y1IA 2FLLA 1N36F 2DR5A 4UY85 4A8YA 4NWBA 4YR0A 5KG3A 2XHCA 1SUQB 2QLXA 4EK2A 4RNMA 3V6KA 1J27A 1ZYQA 2B4OA 4EGLA 1Q0NA 3KJNB 4IQXA 4LF8F 3NNCA 1YJ9S 4LSLA 3P49B 1WKJA 5D4NA 3JTPA 5DLGA 4A8KA 3CVKA 5HK4A 1TL3B 2DR7A 4IYQA 5L39A 2PGCA 2GJIA 5IT9U 2ZDOA 1S72S 1IKXB 1CQNA 4NCGB 2W4CA 2ZDPA 2W7OA 3HVTB 2E7WA 2FYXA 4OZ2A 5JUMA 2ABYA 3W1YC 1EP4A 1WC6A 1F5AA 1R31A 2VFRA 5J2MA 4KPYA 1ZS6A 2GO8A 3HSJA 3LANA 4IRKA 4TNOA 3HFVA 1MU2B 2MY8A 3E8OA 2MJUA 4USJC 2IAJA 1FXRA 3TVYA 3H2UB 1TKTB 3H4DA 2E9ZA 4KHPF 3OTOJ 3M6XA 1RAIB 4ED3A 1U24A 4MKYA 3NOGA 1FTRA 2DRBA 4YP3A 3C19A 3I0SB 2OPPA 4B17A 4CM2A 4QIWD 4XPEA 4Q8EA 2AJ0A 2AWZA 3O2IA 3KMSA 4OL8A 3QAEA 2LQ5A 2GVZB 2F8EX 3OJUA 5D0EA 4J9OA 2PDAA 2ZUGA 2JOQA 4UW2A 2H4YB 4PPDA 3VAGA 3THPA 3K5MA 2EFPA 2AT1B 3BYRA 2BBEA 1O6XA 2ROPA 4K5RA 4KGXB 4ZPDA 2LDYA 5BR8F 4B9MA 1X4FA 2H9ZA 5HQMA 2MLXA 5F3ZA 5M2RA 4RW9B 3HK2A 1HYSB 1KHWA 3CDWA 2VKZG 4J9PA 4UOHA 1C1CA 1NDKA 2JLFA 4H4MB 4LIWA 2CPYA 2RF2A 4PWWA 3TUZC 2XCPA 2C2OB 2QLJB 4Q7AA 2VD3A 3I4PA 4IKAA 2WSFC 3TZYA 4Q43A 1RKJA 2RS8A 4TYBA 2VASA 4NLXA 3TEGA 5B0DA 4X64F 4V19X 5DLFA 4U7CA 3JSYA 1M5PC 1KONA 1MROB 3ZTOA 4LF8J 2Z56B 4Y28C 4P10A 4DSFA 3CJTA 4ZLPA 1U1NA 2H54B 2DIVA 3DNCA 5L1LA 3IAS9 2R7UA 5DDQC 3Q8UA 5EWFA 1GX5A 4EO6A 3KG1A 5K14B 2KG0A 1FVSA 2CPFA 3J7ZT 4ETZA 5GMDA 2CNOB 3CC4S 1JLAB 1GMWD 2LFVA 3BREA 2IA6A 3KLIA 5HMXA 4RBUA 4DV1F 3FRYA 5E3AA 3EVWA 4ZPBA 1VS3A 1B64A 5F41A 2LEPA 2O01C 2X1FA 1EQ0A 2ATCB 3R1HA 1H6KX 1NPKA 3VGTA 7AT1B 4C3KA 2W9CB 2KHDA 3EGNA 1HBNA 3PW4A 4CH0S 3RW7A 1P9YA 3W5ZA 4UUXA 3TJ8A 3V6HA 1TVRA 5I4MA 3DLEB 2F3JA 3LTOA 3UWTA 3IAM9 4A8OA 2B9XA 1QD1A 1REVB 3B4MA 3D0IE 1EETA 1IKYA 1H0HB 2IYIA 3M9MB 1UL3A 3WC2A 1A9NB 2ILZA 2WB4A 1RZMA 3KLIB 3D1HA 8RUCA 5KFZA 2CG8A 5L9NA 3TX8A 4CI0B 5HP1B 3MR6A 1TP7A 5THWA 3S01A 4P72A 1AROP 3BO2A 2HNYB 5K8MA 4GVBA 4LF7J 1QM9A 4JI1J 1HBNB 4O3OA 2KFNA 3HSDA 2UXBJ 4M5JA 1LW0A 4UUWA 4JI4J 2R2RA 4KGMA 1OS5A 2MQPA 1AUDA 5ETOA 4JI3J 1N88A 1SI9A 2DGTA 2JJ4D 2V8VA 4F25A 4OZLA 2CXEA 1LQ9A 2PA3A 1HNVB 3TVKA 4NYZA 3CO9A 5D3GB 3WX8A 1TK8A 1YTYA 2XZTB 3LAKA 1OWXA 3LW5C 2WAQD 1RCOB 4U95A 3PR5B 3W3SA 2DT9A 2CQPA 4P6QA 3IBFB 1I94J 2UUTA 2GQQA 3NWGA 1NPPA 1F6TA 4ECRA 2NCKL 3KG4A 1O8BA 2C3UA 3EICA 2CPJA 2CQIA 2HZCA 3AJ2A 1HNXF 3I96A 2E5LF 2YNGA 3CJ2A 4DFKA 2ZHOA 4UOFA 5J2QB 4O3SA 4PQAA 2HGMA 4I6WA 3M4XA 4Q44A 2RD5C 5D78A 2UUBF 4DPUA 2WOMA 2F40A 2UVRA 3A13A 2CJAA 2Y1RI 4K0KF 4WKRA 5F3TA 1L3SA 4PAAA 4ZHRA 1R0AA 3NAHA 4I4BA 3ENWA 1CC7A 1I3OB 3JQMA 3VALA 4JV1A 2MLZA 4DU7A 5K8OA 1Q1KA 2XO7A 2HHHJ 2UVVA 4UTGA 2HFVA 1SIWB 5KFFA 1PKUA 3MTJA 5KOWA 3KK2A 2XHWA 3MXHP 4KGKA 1N5SA 2VONA 4WWSA 5CCMA 3V4IA 2XMMA 1WSVA 5KFTA 2BKPA 3DDNA 4I6AA 4PYDA 2V4QA 5GVQA 3OL6A 2RRAA 2IAJB 3D5MA 3HJVA 1ZM3A 4CM0A 2HLUA 2XMWA 4ZVGA 3JAMY 1EHWA 5DG9A 4Q2LA 2VQFF 2MXYA 4XIUA 2CJ9A 5KFJA 1IR1A 4LFAJ 3F44A 1S4EA 1FJCA 3IM8A 4RBVA 3HJFA 1M5HA 2HG4A 3ISZA 4RNHA 4ZITA 5KG2A 2XY5A 4W90B 1T9UA 1RT3B 2CQBA 2ZH2A 1XR6A 4DQRA 2VZ9A 4C4WA 3G2XA 4JP8A 1FRIA 2BJ1A 3ILOA 4B9LA 3NGSA 3DU6A 4JI2F 2HVZA 3CULA 2K1RB 1K1SA 1RI7A 4FS1A 2HHHF 3L09A 1RT1A 4QIGA 1UA0A 2QL7B 4ZLNA 3CCUS 3TA0A 1HBMA 2KT3A 2ZOGA 3DM2B 5FDLA 4PG8A 3PNIA 3AB2B 3FRZA 3TJAA 4IOCQ 5BR8J 3THVA 1IM4A 3DCAA 3AXKA 5E2QA 2QYGA 2W9AA 1NM2A 2A10A 2HQFA 1N5QA 2AJ1A 3A3OB 5KFRA 3GPAA 2QA4S 1TKDA 2NQPA 1FKOA 4HEA9 1H2UX 1CJUA 3OLBA 2QJ3A 3GSDA 3MM5B 5BYQA 2FGCA 3IO1A 5CD4H 1FVQA 1J5OA 2DK2A 1IBKF 1XN9A 3PRBA 1HI1A 2N3LA 3OVSA 3M32B 1PYOB 2C3YA 4IFYA 4DR2J 4PRFA 5KFXA 2B5JA 1CULA 1HL6A 2XMJA 1CQMA 4PG5A 4DCJB 2QLFB 4X4PA 3O5TB 4O0IA 1UETA 2FY1A 1KHVA 1TL3A 2JH3A 1NPRA 1R3NA 5CYMB 1WWHA 2DR8A 2EG2A 3EZOA 3GR0A 2HFOA 1BHNA 2QC3A 4DN9A 1C0UA 4UY8T 3PX6A 1IKWB 4YR2A 3J81Y 2Q66A 1RAGB 3WQPA 2BJ3A 2JDJA 4CO5A 3TZXA 1UTAA 1P1TA 2GW8A 3M30A 1YWXA 3TUIC 5LM7E 2DHAA 3RU0A 3W9IA 5F8IA 1SL1A 4QU7A 4M5MA 3BKTA 3OL7A 1X9SA 2O67A 3BEGB 1GTHA 3KXDA 4KSEB 4LF4F 4O3NA 4LQ3A 3C15A 3CCSS 1RTHA 4O3PA 2RHQB 2XNRA 2EKYA 4OX8A 2MDAA 2DNMA 3MAAB 4HI1A 4DR7J 2BXJA 1N54B 4J37A 1DRZA 3HZEA 3UDVA 1B7FA 1RT5B 4ID5A 3HP6A 4HT5A 2DRAA 1CJTA 4N56A 2R8GA 4DR6F 5CABA 4RNFA 1C4AA 2ZWPA 5KFCA 3GIRA 1UPPA 3VHQA 4I67A 5H9EJ 4NA1A 1UWBB 2H3EB 3MDFA 5E3QA 4GVBB 1X31C 4LIRA 4LR9A 3H2LA 2ZUAA 2MYFA 2FVRA 2HFZA 3CD0A 3C66A 3MMBA 4W98A 4QJVA 5HBMA 4X64J 2D3ZA 4JI6F 3RAQA 3PJ9A 3RBZA 1Q7LB 4DL4A 2RQ4A 4H4KA 3HPOA 5LMNJ 3QSIA 1UZDA 1UVMA 3QGHA 4RO0A 3CJKA 3LA0A 1SH2A 2W2OP 1X5TA 5IQQA 3PKYA 2QZ8A 4DSIA 3SXLA 4GKKF 4QYZK 5DGAA 3QWUA 2EK1A 2EXUA 3GG1A 1RT4B 3I6PA 1FK9B 5EWGA 3OW2R 1IKXA 3KDNA 1UW9A 4Y65A 3SV4A 5H9EK 2G4BA 2RHSB 2YWKA 4JI7F 4I7FA 2DRDA 3MMCB 4CWBA 2J9CA 4C0BA 8AT1B 4ED0A 1VJQA 3U1MA 4QIFA 5IV4A 4UT4A 3CCMS 1N33J 1N0UA 3MPWA 1WHVA 4JI0F 4ECSA 1S77D 2M52A 3CJ8A 2R7QA 5MLCV 1X8DA 2HRUA 3MF5A 4L74A 2A6MA 5LSLA 4JI8F 3RJMB 1CLFA 5KT3A 3AHPA 1FDAA 1RT4A 2WVCA 3NBPB 4G1PA 4MJKA 1P8GA 2HW3A 3JYTB 4TU7A 1TL1A 1RYSA 1VIXA 2UUAJ 1S99A 2AX0A 3MM6B 4A46A 4ED7A 5FLXY 4CO2A 2CVEA 2WTFA 1EX8A 4NX9A 1BGXT 2HHTA 1DQ8A 4RWWA 4C48A 4CNZA 2FJEB 3DFEA 2P9EA 2R2UA 2DY9A 4MAKA 5DQGA 3R8YA 3C6UB 3H98A 4LR7A 3UN5A 3SYZA 2FJXA 5IC6B 2K7JA 3PO5A 4WU2A 3DN9A 1WNEA 1S1UA 4ICLB 3M2RA 3K5NA 1KFSA 2VG7A 2BUNA 1TKZA 1U09A 2DCUB 3NWRA 2B9WA 4WIQA 4PCQA 2XG8A 2RUSA 4YDXA 2J6TA 3AD7C 4DPTA 4RNNA 2YNHA 1SKSA 2E44A 3DKDA 2LKZA 1S59A 3FQLA 2BKNA 2ZH6A 2OEKA 1NSQA 3Q2SC 1T94A 4ZVOB 3G6VA 2DHXA 3NEKA 5GAHU 2W2PP 1T03A 4L3KA 3JQJA 2DNLA 1E6YA 2X1BA 1M5SA 4P73A 3O3LA 4R0EA 4ETXA 3KHRA 3CCLS 3QRRA 4JYAJ 3QNWB 1CPZA 3D0HE 3IS9B 3M2UA 1BLUA 1WHXA 2XSJB 2R3VA 3MUTP 4BHQA 3KYLA 3P5BP 1FDBA 2OP5A 3PCOB 1RHKB 1FNOA 4H4KC 2DTJA 4JI3F 2FZKB 5L38A 3MUVP 2E5GA 3B6BA 5J2QA 1JLFB 1I5OB 1OSDA 1R0BG 3HHLC 4LJMA 3U7JA 4ZLJA 4NA2A 1NLKL 3KUHA 2AJFE 4KO0B 3W8GA 1AFJA 1RQ0A 2CQ1A 1T0TV 2GQCA 4A8XA 3OR1A 2P9CA 3RAMA 1PCAA 2VUGA 5HROB 2QSWA 4RPFA 2AYGA 1VOMA 4WJBA 3OUYA 4GMKA 2WB1D 3ZZZA 1HPZB 3HDSA 2VC1A 3OHBA 2NREA 4IG3A 2Y3YA 1EKSA 4I2QB 1RAJA 4U8VA 4DPXA 1HNIA 2CJBA 4BWMA 4QBUA 1HQEB 3CT9A 1WJ9A 5KTQA 2UU9J 1AT1B 3FSYA 4O4RA 4DV7J 2JLEA 4NLRA 3BGLA 3ZC4A 4M95A 3B8HA 2BDPA 3N9UC 5KG1A 2V34A 3C15B 2OSRA 3DRXA 2FHKA 3IR7B 3P4UB 2FPHX 4I2PA 2KFZA 1QAXA 2SXLA 3CJ4A 2DH7A 4EBDA 2YWWA 3CMAS 5HROA 4H4OA 2B4VA 2AU0A 1DQ9A 1VRUB 2B8PA 2ZNYA 5K9FA 1UFKA 2K8GA 2V8GA 4MKVA 1RT3A 4L3NA 1HD1A 4J91A 4K4YA 2IJNA 1U7LA 3NP5A 4TVAB 3KHLA 2DR6A 4OI3A 2HNDB 4UZCA 1PJ5A 4IR1A 5AE1A 1T9TA 1X4EA 2V2ZA 3DGPB 1R27B 4OV6A 1OO0B 5AXLA 1YRUA 4OV1A 3OPKA 3W2WB 1RWVB 3SMZA 1O0PA 1ZM9A 2KO1A 2NUUG 2X7IA 2XNQA 2QFJA 3G8SA 1N48A 4B08A 1MSWD 1SH3A 3SI8A 1TFYA 2B6AB 2ZC4A 1DTQA 1ZZFA 1NJYA 4OHWA 1HWKA 5ETKA 3C14A 1RTDA 4IR9A 2VFVA 4WBFA 2YNIA 2LA4A 5I3PA 3IN5A 1T03B 3HHLA 4C11B 5CD4A 5FJ4A 2NXEA 2IPOB 3Q23A 2UV8G 3TO8A 1SJ1A 3ELHA 4Z7YA 3VAKA 3PX0A 1M1KT 1HNIB 2JHEA 2JEIA 3AQOA 2R2TA 3N79A 2CWXA 1Y5NB 2FC8A 4CH7A 2KRBA 3MTKA 1N0VC 2U2FA 3PG9A 1RWNB 3TZZA 3GYGA 4MTPA 2XC9A 1T05A 1R0CB 4KC5A 3VQTA 2DVIA 4LF5F 1DBDA 5D8HB 1K0TA 3PW2A 3CCWA 3UD3P 1RTDB 3KLEB 4FVMA 2HK3A 1IKYB 1VRUA 1FFWB 2CQ4A 3MCMA 4NXMJ 3A4TA 1Y5IB 1LWFB 3QWPA 1N8RT 4PWUA 2I38A 2FLNA 1KLNA 2JL9A 3ETOA 3ZNUA 4F0MA 2YQ3A 3FVYA 3DOKB 1IXKA 4JOUA 4OYIA 3UVJA 1Q82T 1FX4A 3D7SB 1RU1A 3Q2TC 3OTDA 4I7FB 5KT7A 3BGOP 1RT1B 2L9WA 3UI3A 2ASJA 5AT1B 2CQGA 3R2CJ 3PW0A 3KLVA 4KHMA 2C28A 3A8KA 1HWJA 4P2FA 3QGPA 3BGFA 3BH6B 2IM1A 4LFCJ 2VJUA 1FWPA 4DR4F 4JI2J 3M2RB 3PM9A 2NR0A 3C14B 2UXCF 1LV5A 2YNIB 1FRKA 2VOPA 1F3FA 5J1EA 4XAKA 5G0RB 2NSCA 3W9JA 3FSIA 3T3FA 3GLJA 4DF4A 1X5OA 2DPIA 2HYIB 3CDEA 1Y11A 1DARA 3JXOA 1OMSA 2WW4A 3N6LA 4WTYA 3ILIA 5F0WA 4CLFA 3MMBB 5GAGI 2DR9A 3UDCA 3NNAA 2HAFA 3DRYA 4P2MA 5J2MB 2Z4PA 1ULRA 1B99A 1SJRA 3FDSA 3F41A 4LRDA 3HI9A 1R8BA 2NXUA 1WC4A 2LQBA 1PILA 5C2CA 5CH7B 3H25A 5T7LA 1VQ4S 1UW4A 3CTRA 4USHA 1PO6A 1SJ3P 4HHHA 4F2RA 4FXDA 2LEAA 3I9ZA 4DQQA 2ADCA 1QE1B 1XNRJ 5J2NA 1RCXB 2Z2YB 3TWZA 2GC8A 3KJQB 3DLBA 2M8DB 3IR6B 2B56A 3TR5A 1Y3JA 4DQPA 4NCAA 4HYKA 1I6JA 3QSYB 5KG6A 4ZVTB 4RW4B 3QGIA 4FKXA 2QSFA 4ZPTR 4X4RA 3QFHA 2A18A 2XWYA 4EYIB 1U1MA 1VBYA 2HRYA 2I8EA 3A8JA 3L7UA 1TK0A 3AJ1A 3NGUA 3OUYB 1W2IA 2W8LA 2HS0A 1KSPA 4F36A 5J2NB 1FWKA 1S1VA 4JI7J 2QO3A 2KYZA 3MEGA 1RWPB 1S1XA 4KY3A 5KT6A 2F5GA 1VQ5S 3F56A 3ZFVA 2O1PA 3J7YI 4NXNJ 3TUPA 5F0UA 2AJ2A 2IA0A 1QDUB 1T9XA 4DUYF 4AQYF 1TZ0A 2AMCB 3OL8A 4QCLA 4AUKA 2YPYA 3HFKA 1NK8A 5IZHA 1S1UB 3H42A 3KOAA 2EBEA 1WUUA 1K9MT 1FDNA 2HBQB 5LXYA 1GMVA 2V0NA 2DGQA 3OR1B 4TQSA 1X9MA 3FEXB 3KHHA 4MK9A 5HVFA 4KHRA 4YOEA 1KQGB 3MEGB 2WVDA 2KFYA 2AYMA 2RS2A 3HSGA 3EE3A 4OYWA 3DHWC 1VQPS 3NOCA 2ZBIA 2V8PA 2OPQA 4PG7A 1UJ5A 4HLBA 2NYIA 2IVFB 1KQKA 1YJTA 2W9CA 3HX9A 7FDRA 3CJRA 1BQMA 4LUBA 4RLEA 4J9VA 2IVMA 3MGJA 4KKOB 2OO4A 4P74A 5T41A 1SCJB 2J7UA 1NKEA 2EFQA 2X1AA 2KN4A 5GAEI 3J80U 1RWWB 3PR4A 3GFZA 3Q86A 1S57A 3BN7A 3H8YA 4I68A 4NI2B 4DL0C 4DMZA 4IH6A 1P1LA 2HMIA 1MMLA 3EGVA 1REGX 1OSCA 2OAUA 4CO4A 4DLEA 2I5JB 3ZNJ1 1VHIA 3HCXA 3M30B 5HO4A 3W64A 4FYVB 1N56A 1NK0A 2KJWA 3MPYA 4DU8A 4AL5A 2VV5A 2Q3PA 3GB0A 5LMUF 1FNXH 3K7RA 1RP5A 3MEEB 3OTCA 3LPEA 4WFBQ 2DGOA 2AZ1A 2VG6B 4O4GA 2E5JA 1JJ2R 4OX9J 1T05B 2CQ2A 1UZHA 3OBIA 3CO0P 3L4BC 4NLQA 2BOPA 4USMA 2IMWP 2FDNA 2RU9A 2AIRB 1YZ6A 1H73A 3RBXA 4LF9J 3RRKA 1E6VB 2JX2A 4KAIA 1GNKA 2Y0SD 5AXNA 1U26A 3FBEA 3MCSA 5EN1A 1WD6A 2W2MP 3KWMA 4AL6A 3HHLB 1U1OA 3RBDA 3BV8A 1F5CA 3ISNC 1RGVA 2B8QA 4C11A 1RAFB 4F26A 4DX5A 5KFKA 2ASLA 4WZQA 3TYTA 3NRBA 3R27A 3QRQA 2GVDB 3A1YG 2LP4A 2QN6B 4PG6A 5ADZA 4R5PB 1FEEA 4RWXA 3VVTA 1KP6A 2FGOA 2UUCF 1YX2A 3C8YA 4F8RA 1WDDA 5CHCB 4WCEQ 3G8QA 1WSRA 3IRXB 1U0HB 4YY3F 4ECXA 1RT7A 3R7NB 2CPZA 1TV6B 3G6XA 3OVBA 1W2BR 4OI6A 1WKLA 2XYHB 2HLTA 3K89A 3TW0A 5G4DA 1I94F 2CUYA 2RVJA 4Q0BB 3QT7A 2DNHA 4O44A 2GS8A 2ZE2B 2YH1A 2DHGA 4J9LA 1VQ8S 1URRA 4DUTA 2BJ7A 1YBTA 4KTQA 2IJRA 1PBUA 2LU2A 1QVGR 4O3RA 1EARA 5IT4A 2LXIA 3X3UA 2YPZA 2YY3A 1WACA 3QT5A 4WK1A 1FJGF 3HLUA 1RWKB 2EWHA 4K0KJ 1IQZA 3I5AA 1RA7A 4WE1B 3SCJE 4K4ZA 2DHSA 1FEHA 4N8NA 4CLKA 3KJFB 5DQHA 3I0RB 3H40A 3IWXA 3J7YU 2LXUA 3A12A 3BPSP 3RB4A 1XQIA 2K7KA 1RK8A 4FF3A 3V6DA 2A6OA 2AP6A 3H5UA 1ZAWA 4EI2A 2HHVA 1LK5A 1VRTB 2J7WA 3G6ES 3LGNA 3EXCX 3RB6A 3KLHB 1U4BA 4DFPA 2ROEA 5I3QA 3P45B 4R5PA 1CC8A 3KJVB 4TLRA 4PABA 2RNEA 1XJWB 2IMOA 2W2QP 1NXIA 1X4CA 3I32A 2M70A 3K2YA 4MYTA 5CZXA 4J9QA 2BOAA 2RKIB 1D8ZA 3ZZRA 1PG5B 3M05A 4NLTA 1HWUA 4QWAA 3OHAA 4U9RA 5F9LA 3T5LA 2YX7A 4K59A 1S6QA 4QIVA 1NRKA 2KXFA 1RWMB 2KU7A 2P5VA 2YNHB 4J9KA 3TANA 1L5UA 3H5XA 2ZH3A 3GJRB 1HNZJ 3LP1B 2KJVA 2YKMA 3SQOP 1NSKL 2B4UA 3CCES 3UDLA 3M32A 1SBRA 4WTOB 1WG1A 2ALZA 2MTLA 2AYEA 3MM8B 3Q83A 4OJ3A 4DL6A 5IOLA 4LF6J 1DTQB 2G0CA 4OYOA 5ETSA 1R0AB 4USVA 4PUOB 2VH7A 5D0GA 1IN0A 2XWXA 3NL0A 2IVYA 2EEYA 5DG8A 5C24A 2J9DA 5B0AA 4M94A 1S10A 2OPRB 5CA5A 1R6YA 4YQWA 4DR6J 3L9ZA 3I82A 2XM3A 5HMZA 4JYAF 1Q8KA 4IO1A 3ENQA 1VQ9S 5KG0A 1M1GA 4GKJJ 3DI6A 1VQYA 2FD2A 2W7PA 2Z58B 5KG7A 1FD2A 2HQGA 2D3UA 4GO5X 4OYBA 4YMEA 2WVFA 3ENVA 3UQSA 3H59A 1T3OA 2AGOA 3N4WA 1VQ6S 4OYPA 3S8SA 3QT8A 4PKDB 4B3TF 4ECWA 3RTVA 3M2VB 1HARA 5F8GA 2OELA 4ERDA 2RT3A 2WZ1A 2KH9A 1FRXA 2A3JA 4Q2MA 4DX8H 1JX4A 3DRSA 4UOCA 3UNYA 3U27A 5CCLA 3CC7S 4BCAA 3NGKA 3KUGA 2H65B 2OPQB 3Q24A 3L7PA 3GE9A 4NXMF 2Y8YA 2LYVA 3H5YA 3ZZPA 4ELVA 1TMMA 4MIBA 1MLAA 3IGVA 4FF2A 3EYZA 1W25A 5L1KA 4AXJA 1W7WA 3N0VA 3PTWA 4DL3A 1FERA 3ZTRA 2EFNA 2VPXB 1IWAA 2MQNA 4ZHRB 3W8PA 4UZBA 4G65A 4ZOSA 5D4PA 1KEKA 1Q95G 3HKWA 1H38A 2GGPA 2KZZA 2YWEA 4QYRA 1Q5VA 1D1UA 5AE3A 2E5LJ 4NRUA 4OQJA 5KFOA 2E9TA 3BKFA 1UJ4A 1WEXA 2CPDA 2C3PA 2V2QA 4M5DB 1IJFB 4NEZA 4C8MA 4A4JA 2R4FA 4DHVA 3AFGA 5KFIA 5DM6Q 3GV7B 1HD0A 2M88A 2JSXA 1U47A 2HHUA 2BM1A 2MLYA 5A0YA 2L9DA 3QJLA 4WF9Q 3FSXA 2R42A 5A2QY 4CLLA 5J2PA 1JLCB 5DS7A 4ZIWA 2MQQA 4DV0F 1YRTA 4AFFA 3Q8SB 1SL2A 2PFDA 1QAJA 3DC2A 4CO3A 2IM0A 2GIFA 4YY3J 3V2UC 3OXFA 4M5NA 4NZ0A 2XI2A 3T1HJ 4Y2AA 4KJIA 3ADAC 1URNA 1DURA 3PW7A 1T02A 1DFDA 9RUBA 2N7CA 4CLYA 1WI6A 4DUZJ 1F60B 5LXRA 1HHSA 4HR2A 2BJDA 4ZMMA 3MECB 2ZH1A 4HACA 3C6UA 3W62A 2MZSA 1N32J 2XEXA 4RW7B 4A8MP 1LWEA 1NZ8A 1AA1B 3CCRS 4LF5J 4DR3J 2XO6A 4BLGA 1PGZA 5A2QU 2I5JA 3PY8A 1Q7YT 4ZJLA 4RZRA 1IBLF 2XS2A 2IFXA 3MM5A 3C6TA 4ECTA 2HHSA 3JSMA 4LR8A 1RTIA 2ZC3A 2RSQA 1ZA1B 2QLBB 4AT1B 3M9OB 4NOHA 3KJVA 4NLWA 1CULB 4KRWA 4KH0B 2HGLA 4UOGA 4RW7A 3ET6A 2IY5B 2R7TA 3FMBA 3FCHA 3UO0A 3I56S 4M63A 1S6PA 1D09B 2LEBA 3QBCA 2I2YA 3KTQA 4CQ1A 5H1SV 3W2VB 2GJFA 1LWFA 1U48A 3RR7A 1Y10A 3WIVA 1YJRA 2Z0GA 1TAQA 5D6GA 1M90T 2YQ0A 3IRWP 9ATCB 1CVJA 4OIXA 3FK4A 1S4FA 5EX0A 4HTIA 4C2MA 1SJFA 2HHQA 3QQCD 3QIPB 3PIOQ 3HD1A 2GAHC 3IRXA 3QO9A 1OPZA 4KT0C 3AB4B 5BXIA 1PC4A 3IFEA 2VHGA 3PEHA 3QMQA 4QQBA 3VGSA 1HYSA 1LWEB 1Y7PA 2MSSA 3E01B 3G86A 5B0EA 3ITHA 2R7VA 1SC3B 1YI2S 4TN2A 1EIYB 4HKQA 3MM6A 4DPYA 2HSEB 3AQPA 2PMWA 1RJJA 1SXLA 1UWBA 1NSAA 4YHHJ 2VA2A 2HFUA 2YH0A 4RW8B 3NS6A 4RW4A 1YZ7A 4QYZJ 1MROA 2AEFA 1RE1B 2J76E 3IG1A 1UEUA 2B7CB 4M5GA 2AYBA 2MKCA 5HN0A 4KIAA 2PI5A 2BJ9A 2CZVC 4PXCA 2E9RX 2HVIA 1RWXB 1O51A 4PR6A 3VGUA 3NMRA 1GQEA 3HHDA 3TI0A 2JVOA 2N7YA 1QUPA 2EC2A 2XULA 3D3CJ 5KG5A 2YWHA 2BYCA 1XMOJ 1HLWA 4Y6IA 1HIYA 2XMKA 3VAIA 1U1LA 2CDRB 5B0CA 1FESA 3NGRA 1HMVB 2HZVA 1F1BB 4OZ0A 1J2VA 2HFSA 4PPZA 2J9EA 3TX0A 3H20A 5T14A 1N4LA 3KNAA 2Z2MA 4URSA 3LQVA 4N47A 3PW5A 2NZCA 4F3OA 2RKIA 3T1AA 3VAHA 2BQRA 2ZVIA 2DXDA 2FY8A 3AT1B 3M2UB 4CLZA 1RTZA 1QAYA 3I31A 2QV6A 2XQCA 2G9OA 1ZPWX 4NLUA 5JJBA 2MSTA 3I0SA 5BYRA 2FJAB 1O5JA 3VAJA 2CQ0A 1S1VB 1KQFB 3TUJC 2AGPA 4DEZA 1VC0A 2GIRA 2OUGA 1NK5A 1CG2A 3CNQP 2K06A 5IV3A 2CNLB 4N41A 2KM8C 3W7BA 3M7VA 5DDOC 1NB2A 3BQ2A 4I0WA 2BACA 1BUXA 2F9JA 2O66A 4I69A 2UV8A 4YB6A 3MAAA 4CLPA 1JXLA 3JTOA 3IWNC 3NGDA 4ZVFA 5K8PA 3R5AA 2HQCA 4XO0A 1UPMB 3P5TL 5M2PA 2ZOFA 1CEZA 3OFHA 4RW6A 1MG7A 2VG5B 4H4MA 5KFPA 4B9SA 1JJCB 2AW0A 1Z4UA 2D1CA 5SUHA 2QT7A 2WVEA 2QMUB 3JAMU 1TQLA 3T9ZA 1VRQC 2MHNA 2MKJA 4BC9A 4WFYA 4M5DA 5KFQA 1NHVA 4QWDA 4J9RA 4C3LA 3H90A 4HH0A 4NZ7A 2KYXA 5KFMA 2ZZTA 2B51A 2YX1A 5EX3A 3IMQJ 3B82A 4OI4A 3TAMB 4OZ3A 3G71S 1H3DA 1PYSB 3BPDA 4IH5A 3WBZA 2H4WB 3FFIA 1WC5A 1S9EA 4KE5A 1U1QA 2HQ3A 5F8NA 5LOQA 5RUBA 5G0RA 4OFZA 3I55S 3VGVA 5IWAF 4O3QA 3F73A 4KQZA 3G6YA 3MWBA 3D54A 4IH7A 2BQ3A 1H74A 2D3O1 3H2VE 3ONQA 3KK2B 4PWDA 3CDUA 2QLWA 2VPYB 5CZVA 5KT4A 4YB5A 3V5RA 1IBLJ 2VBWA 4LF9F 3U1NA 3B54A 4ZPCA 2ZJQQ 4ZVEA 4FF1A 1FE4A 3KFWX 4F4AA 1CBKA 3CJ0A 5MAOA 2DCLA 3TAMA 1K1QA 5LSRA 4LF7F 4L72B 4LFCF 3NGTA 3IC1A 4DR4J 1J5EF 3V6JA 3IBWA 4OZNA 2DY1A 4N5SA 1HFEL 1VBXA 4FZVA 1MWQA 3C16B 3G8TA 1EJ7L 4MIWA 3KLFB 3RG6A 4PQUA 2VBXA 1G4CA 2OFGX 1P27B 2HWIA 3GG0A 4DV1J 3AD8C 1P9QC 1C1CB 1FDDA 4FBUA 1U8SA 1S5ZA 3B78A 2MHEA 1FX2A 4WKYA 4IOAQ 3PYFA 2JWNA 3TA2A 1LW2B 5KG4A 1RXOB 1B0TA 3M9NB 1TL5A 3SSQA 1N6QB 3LH2S 2KG1A 4ECVA 3E3XA 1NO8A 3T5JA 1NK9A 3FBFA 3P3DA 1JLBB 1LFPA 4A8WA 2V94A 1JNZB 3D0GE 4MKBA 4NPOA 3O44A 4LF1A 3Q8RB 2R7SA 1HA1A 2HKEA 3R5DA 4X4UA 1PYTA 4WXWA 3HVWA 3DOKA 2C3MA 1JLAA 2CA9A 4ANEA 2AJQA 3G4SS 2RQMA 6FDRA 2LLZA 5CYQA 3PACA 2UXBF 2FQQB 2DBBA 2Q1LA 4O44B 3T5KA 4IG0A 5ETQA 1M5KC 1KOHA 1Q8BA 3P96A 3QZ7A 1JLGA 4JUZA 4C98A 2A0FB 4OHXA 4QWCA 1F2HA 4B9VA 1AFIA 1HBUB 2KI2A 1VQSA 2QE5A 3M8ZA 5A8KA 7FD1A 1FNMA 3LP0B 1JKHA 2BW7A 3E01A 3FGVA 1LWXA 3QLHA 3V4MA 5IWAJ 1NJIT 5KFDA 2YKAA 3O8WA 2KKHA 3OR2A 4IG0B 2X1GA 2HVEA 2IDLA 1N34F 1IR2A 1YJUA 2HFNA 1QSLA 1YJWS 3BR8A 4L75A 2KHCA 3KK3A 1QTNB 2MKHA 3ET6B 2UUBJ 3V81B 1FXLA 1JQGA 4QR0A 2DNOA 1YLXA 2J0SD 4ED5A 2E1AA 4NA3A 2G1DA 2EFVA 1NKBA 1T8EA 2KL8A 4ZP6A 5KFEA 2RDJA 2V2KA 1HPZA 5C25A 1Q78A 3ZZTA 1CJVA 3QAUA 2DNRA 3DHXA 4F0HA 1V5IB 2CQHA 3D1OA 4F3MA 2HIQA 4A47A 4OLOA 1UEVA 2WBMA 2ZBCA 4RKUC 1KNZA 4L73A 1JK9B 1TL4A 1B7YB 2C2ZB 3D6FB 3K8VA 2YKMB 3MEEA 4M5KA 2OMLA 1EKRA 2QRRA 1QAIA 4DJBA 2OIHA 2CG4A 1SVDA 3CJQA 3KMQA 4NASA 3FZBA 2BX6A 3MECA 4ZS6A 2IC3B 1RHQB 5C5JA 3L3CA 1Y0HA 3BGRB 2C2EA 4K4UA 3LALA 1MNEA 3W5XA 2J7KA 4DR2F 1XMQJ 2XS5A 4K2JA 3R6LB 3QPIA 2D9OA 3TRGA 4Q5VA 2RJZA 1B0PA 1FKOB 2VDHA 3D6HB 3UD5A 5HVHA 1M1HA 2BE2B 2F8HA 2GO9A 1MMDA 2M0GB 3DGVA 1NNDA 2R7WA 5LMUJ 2V4RA 1DQAA 3AH6A 5KFSA 4ZCIA 5KFBA 4F50A 4B3RJ 1HWIA 2AV5A 3K57A 2DNKA 1JLEA 4YN3B 2XCAA 3US5A 3GIJA 4WP3A 1HHQA 3RR8A 1NCLA 1T9YA 2AF6A 2B6AA 3LAMA 4WXOA 1RAOA 2VL1A 1VCTA 5CYJA 2ZD1A 1WF0A 5M2UA 2W9BB 1PJ6A 4MYUA 5T7LB 4LF4J 1REVA 2K2PA 1R89A 4C8NA 1LWCB 3T41A 4AL7A 4DS4A 2XY6A 1IKWA 1U02A 3PYEA 2PO4A 1LEOA 4LFBF 2ZKUA 4EU0A 2L41A 1XEZA 1NSPA 1B0VA 4U96A 4DL7A 3T6JA 3ZZ0A 1UKUA 2GV1A 4RU2A 3IGNA 2CFXA 2JLGA 3DLLQ 5DZ6A 4K4WA 5IQ6A 2DKOB 1WF2A 2XZWA 4J9UE 1R8PA 3T6BA 1FE0A 3NCPA 4NYOA 4MT1A 1A0OB 5ETVA 1Q5YA 2PC6A 1X4BA 2Z2ZA 4L76A 2HIYA 2DHHA 3J7A1 1ZH5A 3RB0A 1YG0A 1WEYA 4LT6A 5IM0A 1RYRA 5LL6d 4NI2A 5ITHA 2FHOB 2W2NP 1SQEA 4FYWB 1SL0A 1WDTA 2WK4A 5LMNF 5EGYA 1F2GA 3FEYB 2MJNA 2RILA 5KFUA 2DH8A 2ZH5A 4EZ9A 4FDFA 2P6TA 4MMOA 1AXQA 3LPYA 2OTLS 3CJSA 3BSNA 4ECQA 2KVIA 1U6BA 2BABA 3UW1A 1N36J 3RBEA 3I9V9 2VB6A 2VIHA 1UFLA 4UQGA 4WIIA 3W9HA 2R7RA 2XMVA 4NLDA 3SCIE 3GCXP 2YNGB 1APSA 2H5JB 2MKKA 1M5OC 4ILLA 5IM0B 4ZLLA 2DGXA 3VVUA 1OY9A 1H72C 3RYLA 3LO3A 4Q0BA 2R8JA 1QTMA 4WZMA 3R5JB 1JLBA 4ZVRB 1EAYC 2ZH9A 5AE2A 5I3UA 5LJ5Y 2ZJRQ 2VG5A 4JI0J 3R5GA 4O23A 1HKAA 2VODA 3EZUA 4Y2CA 3ILJA 1OY6A 2KM8B 3GONA 2J0QD 5SZTA 2HVDA 2QL5B 3C6TB 2IRXA 4JV5F 3EPGA 1S0OA 1TL7A 3CCZA 3RAXA 1S9FA 4PG4A 2MZRA 3GCWP 5HJXA 2F9DA 4PXEA 3VCDA 2GA7A 2ZH4A 2VQEJ 2OHDA 5D77A 2J0XA 2QA4G 3R97A 1ZZNA 1PBAA 2IRUA 4DI6A 2I0XA 2Q6CA 2Z2LA 1T95A 3MHYA 4KFBB 2JEJA 1TV6A 4WFXA 1K73T 4WFNQ 4N77A 3TQEA 1VR6A 2BV3A 5A8RB 3TAPA 3EUNA 1LNQA 3JYTA 1OYDA 6FD1A 4EMDA 1IM6A 1B70B 2Q79A 1HQUB 5H9FJ 2E1CA 5HAOA 4PYAA 1KRPA 1KVKA 4P71A 3Q8PB 3CXCR 3PEJA 1Y3KA 4DZDA 4ZP9A 2FTRA 5F8MA 3KK3B 4QR2A 5ETLA 2WSEC 4XDDA 4NRTA 4JI8J 3AD9C 3BBFA 3G82A 4ZDNA 4DLGA 2Y8WA 2JFDA 3GYNA 1E6VA 1GAOA 4RUBA 5ETMA 5A8WA 4WP8A 4DR1J 2FLOA 3BBBA 1N5VA 5A8KB 5HSPA 1VQOS 2VPZB 1XMOF 3DOMA 2P8IA 3GILA 1HBOB 4XPCA 1H2TZ 1K0VA 1F9FA 1MN9A 1DTTB 1GXUA 2E1RA 4X62J 3FBBA 2L9NA 1XWLA 2M2BA 2XMUA 5I42B 5C7PA 4O0NA 1U8WA 1TK5A 1KD1T 5KFHA 1G3OA 1VC6A 2J5AA 3W5YA 2ZZNA 3DLKA 1FFSB 2KRRA 2LU1A 1E6YB 2WONA 1NK6A 2E1MC 3V81A 3QO9B 1D9DA 1VBKA 4J5OA 2BZ2A 2YKQA 2ACMA 2MZQA 1VI7A 4KFBA 4YHHF 4DUYJ 4AQYJ 4JI4F 3MEDB 1FJGJ 1GFWB 3ICLA 3SDEA 2FZCB 1BWEA 3DDIA 2H1YA 2M4MA 4CT8A 4DXLA 3LP1A 4ZP7A 2YWFA 1RWUA 3M8QB 3EWGA 3MCOA 4F4ZA 2W7AA 3TARA 2GX8A 1DJ0A 4ZVUB 2W8KA 4Q8FA 4Y2KA 1VFJA 4USKA 3T1HF 3MM8A 1WORA 2VF3A 1YSJA 1VQ7S 3TP2A 3GIMA 1PC5A 4DZ6A 1F0XA 2HURA 3RRHA 1FJ7A 2PA8D 4E2FB 2KT5A 2XY7A 1UVLA 3G82B 2BMBA 4DUZF 1FKAF 4MK7A 2G0IA 4GRSA 3KLFA 2B0GA 4RNOA 4BBYA 2O3DA 2EBGA 5B08A 3GIKA 2F4VF 2C2NA 4M8LA 4ES1A 4QPXA 4DV4J 2YNFA 4E98A 1UP1A 1C0TA 3FKBA 5IT0A 4U6PA 1UWAA 4ZK7M 3MMJA 3D6TB 2RU3A 2OEMA 1NB7A 4RUCA 3SBMA 3UNGC 2E29A 3BQ1A 1X4AA 3QFWA 4F02A 1HI8A 4QIEA 4R8UB 5HANA 5JVGQ 2CPIA 5DJBA 1RTIB 3A8EA 4U67Q 2VA3A 4DQIA 4ENOA 2AQ4A 1RABB 4J7CA 4EZ6A 1XNQF 1IBCB 2JNJA 3BGRA 4GKKJ 5GADI 1N5YB 3HT0A 2CPXA 5AJ3F 1ITPA 4EEYA 3CE8A 3PFOA 3PVXA 1HNZF 1RLCL 1S76D 1WOOA 3LP0A 1VMBA 2ZBRA 2HNZB 4WPAA 4V19J 5DO2A 3G96A 2PMHA 3DDKA 5F9NA 3CDAA 2QEXS 3TVZA 1CS4B 1UEKA 2NXNA 3EVOA 3T1YF 4JV5J 2H48B 1HQEA 3K59A 2R8KA 4FP9A 3JQKA 1YHQS 2ADBA 3MPVA 2ZD1B 1UJ6A 5E33A 4ZVPB 3VZIA 1ZTWA 3U1LA 4ZPAA 2UXDF 4USTA 1HBMB 2RQKA 2AKWB 2R8IA 2XMTA 3BGUA 3BDPA 4ICLA 4OHZA 2RUGA 5EWEA 2NUHA 1CJKB 4CLWA 1ZOTA 2KT2A 4NLGA 1G1XA 4KR0B 4G1QB 1S1XB 2NXCA 2XB2D 2WBRA 2B43A 3ISND 3N5BA 1IKVA 1VK8A 3MUMP 1VRTA 4KB7A 1K8AT 2HHXA 1R8AA 1TL7B 1EP4B 1D8YA 3MCNA 2JVRA 1DHMA 2E5HA 4Y3CA 2CQ3A 3GQCA 4GC7A 1YIJS 1I51B 3OTBA 4DR5J 2VC0A 1NK7A 2DIUA 2PFFB 3GR1A 1RHJB 4TLQA 3HO1A 3GYXB 2PEBA 3MEKA 5BJRA 4CIOA 3P6YC 5J1EB 4PQUB 3SFUA 4CLUA 3GIIA 3MPDA 4KPCA 2HNZA 1S1WA 2VBYA 1SKUB 1WOPA 2ZVSA 1DLOA 4DR7F 4ED6A 4B3SF 4DSJA 4LBHA 3EX7B 1S0MA 1ROFA 3L95X 2W01A 3MOJB 1X5PA 3CGIA 1Q8IA 5KOXA 2MZTA 1SC4B 3EVMA 3W65A 3OXGA 2UUWA 2ZH8A 3H0PA 3E2EA 4A8FA 1BQMB 3UCUP 1RT6B 2FVPA 2NLWA 4HHJA 2CKWA 3GFXA 4PXBA 1N6QA 3VF0B 2XGPA 4WYWA 3VWSA 3CCVS 1SV5A 1PAEX 4LSNA 5J2PB 2RE1A 2CQDA 2GMLA 1D3WA 4DDFA 4DG1B 3SZ2A 2HHPA 1NH7A 1QE1A 1RBAA 1FWLA 1WC3A 3DRPA 4X4QA 3HVAA 1CJKA 3K5PA 1IQTA 1BE4A 3T19A 3OR2B 4Y00A 1S12A 4J9MA 4RUHA 4F4WA 4XDCA 1OJ4A 1Z1ZA 2JZ5A 2E5IA 2VU5A 3GFYA 4ES3A 2RQCA 2ACYA 2NSBA 2RRBA 3A3NB 2WW8A 3EXYA 3QIPA 2W4DA 5E3CA 4MFBB 3CUNA 2MZ1A 3PRDA 3LWMA 1WEZA 3AJDA 1HQ2A 2HEKA 3ZZUA 5E5NA 1XMQF 2CYYA 4DPOA 1PIEA 2P9GA 4QU6A 2ZZMA 1Q53A 2WOMB 2CIMA 2ZEJA 5D0HA 3DRPB 3D9BA 3OXLA 3MEDA 2A1BA 4OX6A 4LRFA 2IJFA 2ROGA 4I64A 4URQU 4AYBD 5FLXU 2HNDA 2F7VA 1KDNA 1R6VA 4DOZA 5JXSA 5B7WA 3THTA 2F4VJ 4ANCA 1UCNA 2OD6A 3D28A 3BSCA 3KNGA 3M1VB 3MMCA 4NLVA 4ZVSB 5GMKa 3N6NA 3M8SA 3MOZA 1ICEB 3DLHA 1NH8A 1NDPA 1IJEB 3CCTA 4ZCLA 5DZ7A 5J1PA 1RADB 4K4TA 3PX4A 2KZMA 2U1AA 2YX4A 3IR5B 4BC7A 1U0HA 5GAEU 1VYAA 4PXDA 1S6PB 3S6EA 3TNVA 5B0BA 3DOMB 1VGYA 2VJVA 1JB0C 3VTIA 3GU0A 2DNYA 1T7PA 3NBPA 2QIFA 1IBMF 1B3TA 2X3DA 4LBPA 3LP2A 1RHUB 4HL9A 4B3MF 1WHWA 3UCGA 4C0OC 4DCOB 3KK1B 1PAUB 4ZN1A 2V6AA 3L7OA 1SJ4P 1K44A 2HNYA 2MGZA 2VQFJ 1JLEB 1KLMB 1MWZA 1RTJB 1ZAXA 1KFDA 3DOLB 3UD4P 3BO3A 3MD1A 4RL1A 1SUQA 1X7VA 4P2SA 2XLJA 5DGBA 1YRXA 1WOSA 4PZVA 5KFVA 1X9WA 1N5TA 4DV2J 1T3NA 2GAGC 2DGUA 1RT5A 3MZIA 4WE1A 3SSSA 2P6SA 4HTJA 3VR1A 2ILYA 5KFYA 2PT0A 2VG7B 3PYDA 5LSOA 5B09A 3CD7A 3MR3A 3GV8B 1S0VA 4EO8A 2GMHA 4IFVB 1EQMA 3PV8A 1HW8A 3PRVA 4KH1B 1RHRB 1KKHA 1Y9OA 2J0WA 2LECA 1G6BA 2HGNA 2DISA 5HJYA 4LMZA 4LRBA 2DITA 2L08A 4RW8A 4L6V3 4F67A 3N6MA 2ZM6J 3FBCA 2HBYB 1RISA 1NJXA 2N4CA 4HACB 3C2PA 2MPUA 3BYPA 1RAHB 5E0OA 5HQLA 2PD1A 2ZNZA 3M8RA 2DEIA 1K47A 1NEEA 2ZKTA 2APOA 3K58A 1H98A 5K5MA 2RDDA 1S1TA 5CYMA 4NE9C 4DS5A 1C2PA 4USWA 1HNWF 1LWCA 1IWGA 5ETRA 1N52B 2XSJA 2POKA 4V1Ak 3BN4A 3HM9A 4F4YA 2OEJA 1HI0P 1PJ7A 4Y34A 1VQMS 4AXIA 4CNYA 5CYQB 2OTJS 4ED8A 2DGSA 5CQGA 4D3HA 2HBRB 3JS9A 4OX9F 4RUAA 1X0FA 4B9TA 1U2CA 2CNNB 2MQ8A 2KVQE 4X4VA 4OYXA 3GSIA 3SQGA 1C0TB 3AA9A 4LF2A 4EFAC 2VICA 1KN6A 2WONB 1WTBA 1RKIA 2BJEA 1ZA2B 4JI6J 2KXHA 4CYUB 1ACMB 1S9EB 1AB8A 1S7HA 2YTCA 4LRAA 1DZ5A 2J8SA 3CB4A 1Q4RA 1YKWA 2A2DA 1DAXA 2E7VA 2OGUA 4Z37A 2WSCC 5EDWA 4OHYA 2FJDB 3W2VA 4NXNF 3SDEB 3Q8YA 4C8LA 1NKCA 1GH8A 1DLOB 3BH7B 1KBRA 4RX6A 4PWDB 4WP9A 2E66A 5IXUA 4JBCA 1BQNB 1LXNA 1RDRA 2CPHA 2H5EA 1UFWA 3R7SB 2ZE2A 2FIUA 5GAGU 4DV6F 2CJKA 2K1RA 4TY8B 2I9SA 3MURP 1MW7A 2HQIA 2W1BA 3DI6B 3MM7B 4F7VA 3M8WA 2R9LA 2MB0B 3HMJG 5F8JA 4I2PB 1U25A 4NMLA 5D0RA 1JXVA 5GADU 2K3IA 3NG8A 2VFUA 2LDIA 3U02A 3PIPQ 2G0JA 3K8WA 3W60A 5C25B 4IDKA 3KHGA 5DG7A 2WCXA 2FHJA 4ID8A 1WC1A 3TEHB 4X4NA 3HF5A 1GT8A 3GJQB 3K5LA 2DO0A 2VFTA 4X66J 1RLDA 5ETNA 1N34J 1S49A 1NBEB 2UU9F 1IUJA 3MPUB 3N01A 4DV7F 4HDGA 3HT3A 2X51A 6AT1B 5DQIA 3BM7A 2BE7D 1HW9A 2V68A 4Q45A 1FKPB 2GQ2A 3PJWA 4M1KA 3FUYA 2LQ9A 1GEHA 3OLAA 3MR2A 2I6WA 1ZPVA 4LRCA 4WK3A 2ZHAA 4DV6J 1TKTA 1D0EA 4K4VA 3D4JA 2DXFA 4DV5J 2XSFA 3MFIA 3DLEA 2RDIA 1Q79A 1Y00A 3TAQA 2OKQA 1S6QB 2HS4A 1C0UB 1HBOA 1Q16B 1T9WA 2ZBPA 1SH0A 2CZ9A 1V6HA 5A76A 1LFWA 2D7SA 1HMVA 1QUVA 1W26A 2GVZA 3GZ7A 1U45A 2J6UA 1RUSA 2K3KA 1JLGB 3D68A 3FCWA 4ECUA 4JV0A 4TY8A 1NUEA 4A8SA 4KO0A 2V4JB 3DYAA 3JSBA 2MQOA 1KWMA 2ZWOA 3C46A 4DBQA 1N5YA 3OT9A 2V8DA 2YXLA 3MR7A 2B3TB 3OVAA 4IRDA 4I56A 4GKJF 2IBKA 3HFZB 3NAIA 1HNVA 3UR3C 4K7QA 5L1IA 5D3GA 2IM2A 3OD2A 4KV8A 3MR5A 1U2RA 4LBIA 4I2QA 1ZM2A 4B3RF 3DLGA 4I1TA 4TKTA 4WYLA 3PJXA 4OZJA 2ASDA 4Y0FA 3RW6A 3NXZA 1KLMA 2LCWA 3UVJB 2LA6A 1J5EJ 2AEJA 2JC1A 1KTVA 2VG6A 4O4GB 3J81U 1LKZA 2R7OA 3O6QA 4U8YA 2BRLA 3BO4A 1RHMB 3DLKB 2BRKA 2MEWA 2QYCA 1R43A 3UN3A 2H5IB 3Q22A 3OJSA 3WHIA 2RH3A 5DETA 1WF1A 2PN6A 4CH1A 2XTJP 4FYYB 4RW6B 3EJMA 3IA0A 2JEGA 1UVKA 4W92B 3NLCA 1FXDA 5GMEA 4P9SA 1JLQB 3BKUA 4RU9A 3J80Y 4ED2A 2UXDJ 2N3OA 1UVNA 2FZGB 1IKVB 3AOAA 3M8QA 1JWWA 4ATNA 2N4DA 4QOTA 3F0NA 1AUSL 2J8AA 3AOBA 4FVCA 4BS2A 4I6YA 3TZWA 1FRLA 1JXEA 1NMEB 3RGIA 2LQ8A 2PMZD 5HLFB 5IS2A 1VHFA 2FVQA 1MWYA 3QJJA 2MKYA 2ZM6F 2CQCA 3LOUA 4URGA 1RSCA 4CP5A 1TELA 1RT7B 2QL9B 2AX1A 4F4XA 3A3PB 1X4HA 1JJ4A 4ALZA 1LXJA 1FRMA 1V3ZA 2GJ2A 1OIAA 1KTQA 1VIOA 4KV8B 2V2VA 4NYPA 1FCAA 1WG4A 5E41A 1WTFA 1S6OA 4J90A 3UN2A 5KAKA 3A8IA 1BXNA 4QWEA 1VQKS 3UE2A 4KGVB 3DXBA 3D3BJ 2Y0BB 3ZTSA 4JI5J 3DLJA 4G1IA 2DNQA 2EK6A 3AXMA 4X65F 2FLPA 2DB1A 4CYUA 3EM1A 4C8OA 2C2KB 2QG9B 3AODA 3CIMA 2M5YA 5LJ3Y 3ULHA 4C7QA 4B9NA 2RB7A 2YBVA 2EVZA 1EB0A 3GFHA 1NHUA 3O1LA 4H4OB 1GMUA 5L9XA 4DG1A 3FNNA 1TKZB 3K0JA 5K14A 1CJVB 4OHVA 1SC1B 3FEZA 2VPWB 3IWLA 2C22A 1NDLA 1CJUB 4NLPA 4DX6A 2WRMA 3KLGA 1WKKA 3H4BA 4DR3F 1VQLS 4NCGA 3FC9A 3DRSB 2EFGA 3GWCA 1JJHA 4FXVA 4R8UA 2F8MA 3DU5A 4CO0A 3K17A 4DN0A 3EPIA 4DX7A 4GO7X 1XTZA 2OMOA 1YITS 3JB9k 5D15A 1S79A 2MZJA 2ZBQA 2WHOA 3SQGB 4Z7CA 4DV0J 1L3TA 2ASYA 2IDEA 2RAQA 5U47A 4IRCA 3QJPA 4B3MJ 1L3VA 5A8WB 4YFUA 4DV3J 2EW9A 5J1NA 5HQ8A 1YDLA 2BANB 4DFJA 3T1YJ 2XZDB 4TYAA 3WC0A 5CXTA 2XS7A 3M8YA 3PDNA 3IM9A 4E8UA 4B3OA 3JSMB 3W61A 3MI7X 1U2FA 2CJYB 2QA2A 3PXGa 2YKOA 2G2ZA 3CCJS 4J9SA 2LVWA 4D3GA 3WDOA 1H7XA 2HRTA 3JTNA 1OPIA 3I87A 1A7GE 4OI1A 3BQ0A 4FS2A 2XI3A 2EG1A 3ILLA 5AXKA 1SJQA 5A0YB 3NS5A 1RT2A 1Q8LA 2BANA 2M9KA 2CADA 3G87A 3I4HX 1SC6A 2COLA 4RW9A 4USIA 4ZIVA 3M8PB 1JKHB 3QLHB 4DV5F 4HH1A 3CF5Q 4EYHB 2OPRA 2OFHX 3FZ2A 4U7UD 1TR0A 2M7SA 1MMNA 1YJNS 1TAUA 3EGZA 2KXNB 1WG5A 3FCVA 4JI5F 3BR9A 2KB2A 3GMGA 5JVHQ 3DMJA 1LK7A 3KLEA 3H5SA 4UF4A 1SKWA 1M0SA 2V5HG 1YQHA 1QJHA 1IBMJ 2XGQA 4QW9A 5B0FA 3DM2A 5FDLB 1S97A 4LFBJ 4N76A 2BJ8A 3P8BB 4DV4F 1ZBTA 1V3SA 2A2CA 3M8PA 2YKNA 1OY8A 1SQFA 3HHLD 1X0PA 3ITHB 4KBIA 4Y2MA 4TY9A 4YS2A 2PSZA 1M5VC 1AYEA 3MM9B 1JNRB 4OI2A 3LWLA 2B7BB 3H7HB 4CTAB 4HDHA 2IIHA 2DYAA 3D66A 3QRPA 4F4KA 2GHPA 1FK9A 2C1EB 2YVSA 4E0DA 3OV7A 4RJVA 3DGPA 1AW0A 4N7TA 1U49A 1L3UA 4MFBA 2BW2A 4FNIA 1WI8A 4OJHA 3CIZA 4MIAA 2FVCA 1R8CA 4F04B 4CO1A 3DRRB 1H2VZ 2IC3A 1N33F 4ITSA 4ECYA 3HHKA 1VDHA 1TMJA 3BSOA 1R7IA 5A6WA 4X2BA 4A8QA 1XIQA 1MN7A 5LT5A 5I3UB 2W25A 3MM9A 5C42A 5EHHA 1XNQJ 1KVIA 1PSDA 1XBWA 1S7IA 1V5VA 3R5CA 4IQMA 4JB8B 5AJ3J 3T5HA 4ZCKA 2R2SA 1TL1B 1RWOB 3CCQS 1D9FA 1F5BA 2EKNA 4G3IA 4ZPWR 2UP1A 5BYSA 2C3OA 3CSKA 3DMJB 3DRRA 4LVOP 2AZ3A 4FKYA 5HI7A 2CJXB 5DDRC 2NXJA 1KVJA 3VZHA 2FVSA 1C1BA 2HWHA 1NJWA 4X4SA 4B9UA 1JLCA 1F9EB 2QX0A 1ZETA 1XR7A 3TA1A 3QT6A 4WFZA 4ZJOA 3IBCB 3WX4A 2DNNA 2F63A 1VISA 4AD6A 3CJ3A 3VAMA 3LP2B 3HHEA 3AAWB 1FRJA 5ETTA 1HR0J 3MAQA 2F1FA 2X3GA 4OMFG 2CPEA 1FJEB 2VKRA 1BQNA 4MKAA 2NPFA 2AHOB 2B9EA 5GAHI 2E7XA 4ECZA 4FN5A 1XMBA 2FHMA 1UVJA 2VOOA 4AE5A 3QATA 3M6UA 1LW2A 1YVFA 2L3MA 4P2XA 2R7XA 3ETMA 2J6SA 3WIUA 2IRYA 2IYGA 3QYYA 2XMAA 5L46A 4IOBA 3SSRA 3M6VA 4QPTA 3QGGA 1FTCA 4LVNP 5EUHA 2HPUA 2RF2B 4LF6F 4NLYA 5JMNA 2FHJD 4M5HA 2JEFA 1Y4ZB 4YUDA 5E3RA 3KK1A 1VC5A 2Q43A 2YNFB 1YGYA 5D4LA 5I42A 2G2YA 3J7AN 4ELTA 4DSEA 4F3QA 1JLFA 2QMXA 2F4FA 2LQJA 3IP0A 1AZSA 3D67A 4FYDA 2GCFA 2CJQA 4TXSA 4NLOA 4HI2A 4OX7A 1RTHB 4CLSA 5C2GA 4TQRA 3HXMA 2D3OR 1ZTTA 1VQNS 1WELA 3POTB 3S7RA 2DD8S 3QIDA 4N8OA 3AA8A 3UPFA 1OQ3A 4OYAA 3HSZA 2XLIA 4EBCA 1SKRA 4DV3F 4G6VB 1WHYA 1U1PA 1BWVA 2OLWA 4IFVA 1QSSA 4PUOA 1TKXB 2XBPA 4C6AA 1S9GA 4WFAQ 2D41A 1HWLA 2HVHA 4BWJA 2QFIA 1FA0A 1AZSB 3R7BB 2AD9A 1RT6A 2BE9B 2W24A 3UDEA 4X4OA 2MQMA 2FJVA 3K5OA 2OD4A 2XYGB 3ZXWA 2EFOA 1NZAA 1YK9A 4FYXB 2YWGA 5A8RA 5HVGA 1S1TB 2NS1B 3RB3A 1NU4A 2NZ4A 2HHWA 2P2CB 4NLSA 4OI0A 3ENAA 1CS4A 3J81j 1FF2A 2GZOA 5HP1A 3BSAA 1S0NA 2BVZA 3V6DB 4DL5A 1VJWA 1TKXA 5CAAA 5L8RC 4DL2A 3AOCA 3I5BA 4OYMA 3CWJA 5KT2A 2MKIA 3D6MB 2XLKA 2Y1LB 4OLPA 2GIQA 1X4DA 2CVIA 1IR0A 4NMXA 4LSZB 5KFNA 1S48A 4MH8A 4KYZA 4X4TA 3KLHA 3PKMA 3W2WA 3S1TA 2M8HA 3D1QA 3SCKE 2Y1JA 2XYPB 3I5CA 2MQLA 2ZFHA 1TU0B 2V63A 4UQTA 4X84A 3EGWB 2ZITA 2G1HA 3TJ9A 1RAAB 1QVFR 4ANDA 4JI1F 3Q8QB 4Y2IA 3E51A 3ZZOA 3OQ2A 4G1QA 4YDDB 3KUEA 4CTAA 4QWBA 2C42A 3LGMA 1X60A 4EBEA 3R1LA 1UA1A 2OPPB 2BM0A 1Q86T 1T11A 2C2MB 2V8HA 4ZJQA 2OJ3A 2HZAA 3OFEA 3RRGA 3SCLE 4RBTA 2GMJA 4X65J 1TUVA 4DR1F 3CC2S 2UUCJ 1FKPA 4CDIA 1BD6A 5HMWA 3SV3A 4FNHA 4DF8A 5FD1A 3TQ1A 3NMAA 4WU3A 1B4SA 3MM7A 1OQ6A 2MMYA 3ZO7A 3QZ8A 4KGZB 2EPIA 3FMWA 5ETPA 4X62F 1UMJA 1S6UA 4DCPB 2G2OA 3VQSA 3OSNA 2W9BA 2BQUA 5HL7Q 1D9AA 4ID5B 4IO9Q 2YKPA 4ER8A 1L3KA 4HVZA 1HNXJ 4KHPJ 3OSPA 3N5FA 3OFGA 2B4PA 3ZTQA 3OTOF 5C24B 2GHVC 4DV2F 3C3LA 2J9DE 1FI4A 4YB7A 1F3VA 2NPIA 5HATA 4YR3A 1RBOB 2HQDA 4LREA 4C8ZA 3CPWR 2QTWA 1G2EA 1DY3A 1FRHA 2O5DA 2QMWA 3J7Z5 4DFMA 2V67A 3W66A 4ILMA 3HVRA 3IXQA 2GHWA 3VV2B 1G7CB 1NHKL 4ZCMA 5HBMB 5H9FK 4HT7A 2UXCJ 2V9WA 5KFAA 1C1BB 5KFLA 4XTTA 1SV5B 1V3RA 3BBCA 4LSNB 1YJVA 3PHTA 3Q89A 4DR5F 1FFGB 4QR1A 3OTEA 4ELUA 3CJKB 1TFWA 2IBOA 5FIIA 5KFWA 1A6LA 2OPSB 3UR0A 5D4OA 1NJZA 3KKFA 2DNGA 1LOUA 1YBUA 3GP9A 1GX6A 1GXLA 2D9PA 2IM3A 2GNKA 3IS9A 3NY0A 4J9NA 1FD8A 4YEAA 4C8YA 5E7OB 3BF4A 2CZ4A 2DPJA 2ALYB 2DJWA 4OZ5A 2UUAF 1Q81T 2ZOMA 1TTHB 1SIZA 4W4MA 2ZJPQ 3HHNB 4IUFA 2CAJA 2PEHA 3BDEA 3DXSX 4FPIA 2V4JA 3DYAB 3LGHA 5F8HA 3RUBL 1BMQB 4RR5A 1EZZB 2C2RA 2N82B 1IVZA 1BQXA 2JC0A 2OPSA 3FFIB 4C3MA 1I1GA 2LXFA 1R8HA 4R25A 1HBUA 2NYHA 2VBZA 4H54A 1JLQA 4CLTA 2GGPB 2RRNA 4ZKAA 4DSKA 1CSJA 1S1WB 3CD5A 1V9OA 2PI4A 3UFCX 2HAIA 2OSQA 4FBTA 4B3OB 2W4PA 3SIPB 2AJ4A 4FPRA 5DRKA 4IG3B 4CCHA 2D74B 1JIHA 2DGWA 3WZ0A 4IFYB 4NL5A 1VLYA 3B4DA 3CMES 2B5JB 2QGFB 5IFMA 1MU2A 3HD2A 4M5IA
chains in the Genus database with same CATH topology
2LQ8A 4ZN3A 1M1GA 1NPPA 1M1HA 1NZ8A 2OUGA 3H7HB 3QQCD 3P8BB 1NPRA 2K06A 3EWGA 2XHCA 2EXUA 4ZN1A 3LPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQ8 A;  4ZN3 A;  1M1G A;  1NPP A;  1M1H A;  1NZ8 A;  2OUG A;  3H7H B;  3QQC D;  3P8B B;  1NPR A;  2K06 A;  3EWG A;  2XHC A;  2EXU A;  4ZN1 A;  3LPE A; 
#chains in the Genus database with same CATH topology
 2KTQ A;  1KR4 A;  2G13 A;  3MMA B;  5IC4 B;  1H7W A;  1RU2 A;  2CDQ A;  3KDO A;  2DH9 A;  3BS9 A;  4R0J A;  2UVU A;  3MAH A;  3T9N A;  4B02 A;  2DO4 A;  2PII A;  3I0R A;  1VLO A;  3R3T A;  3CED A;  4ZVH A;  2M3D A;  3CMQ A;  1U6Z A;  3M2V A;  4HHU A;  4OYZ A;  4ZP8 A;  4QW8 A;  4K4X A;  1BC6 A;  1NDC A;  2H51 B;  3HKZ D;  3PZP A;  1NK4 A;  1S9G B;  1OYE A;  3HVT A;  4F2S A;  5DM7 Q;  1J5O B;  1NAQ A;  1U1R A;  2IHR 1;  2QA1 A;  3EDQ B;  4X66 F;  1ZAV A;  3MMA A;  2V69 A;  2UZA A;  4ZVQ B;  5A6P A;  1XC9 A;  3G9C A;  4K4S A;  4NZ6 A;  3HUL A;  3IG1 B;  3CJ5 A;  3OFF A;  2Q6B A;  4B3T J;  5AXM A;  3SEO A;  4CT9 A;  2UVW A;  3X1L B;  3NS7 B;  2ZH7 A;  5K20 B;  2Z8Q A;  4NCB A;  1CJT B;  1XR5 A;  2RML A;  1XK8 A;  1TVR B;  4IDK B;  3POT A;  2Z30 B;  4FXW A;  3OL9 A;  3TOQ A;  3NNH A;  5B0G A;  3EMT A;  3NCQ A;  3SFG A;  2ZHB A;  3GV5 B;  5L1J A;  4PEO A;  4TU8 A;  2ATL A;  3GTY X;  2DNZ A;  3MD3 A;  3M6W A;  4GVL A;  5DDP C;  4LFA F;  3R2D J;  2EI5 A;  1VK3 A;  1GK8 A;  4GC6 A;  3M1V A;  4M5L A;  8ATC B;  2C2D A;  4S0M A;  4ED4 A;  3FJ2 A;  1GTE A;  4K2X A;  4ZN3 A;  3UCZ P;  1JMT A;  2GFF A;  3PO4 A;  5KT5 A;  2VQE F;  2VDI A;  1RA6 A;  1SPB P;  1BY9 A;  2AGQ A;  5C42 B;  4BDP A;  1N32 F;  3D2W A;  3Q0A A;  1UAW A;  2B9Y A;  2CNK B;  4CZC A;  1KS2 A;  2FC9 A;  1YBA A;  2AEM A;  4MK8 A;  4C0H A;  2JFK A;  4TU9 A;  3KLG B;  1U6F A;  1KOO A;  3NKY A;  4C8K A;  4DWI A;  1YJ7 A;  4QZV B;  2DEJ A;  2MKS A;  3R5B A;  2MGZ B;  4ZA1 A;  1RTJ A;  3DOL A;  4DSL A;  2VFS A;  1Z2L A;  4K8R A;  1F9H A;  2BKO A;  3ZTP A;  4B3S J;  4OJ1 A;  3R9L A;  4K50 A;  2ERR A;  3ZZY A;  1RB0 A;  2JRS A;  4P52 A;  2KDO A;  2D69 A;  4DPW A;  2HS3 A;  3CDB A;  2DGV A;  3JSR A;  1RAC B;  1QSY A;  1XNR F;  2FJB B;  3BZQ A;  1HNW J;  3GJS B;  2HWT A;  3PYG A;  3EZ5 A;  2HBZ B;  2E1P A;  1FO1 A;  3DLG B;  4EWT A;  1HHT P;  2HK2 A;  2WVB A;  1VBZ A;  2RIJ A;  4OZ1 A;  1KQS R;  1TUW A;  1U1K A;  4U7U K;  4ED1 A;  1LW0 B;  2EC0 A;  3BB5 A;  3LUY A;  1RBL A;  2DNP A;  4OJG A;  2GVD A;  4P75 A;  4C97 A;  3BJY A;  4JV2 A;  2I1R A;  2FB0 A;  2FUG 9;  3V4I B;  1QLN A;  3CW2 C;  4F0K A;  4LSL B;  4P7T A;  4A48 A;  1ELO A;  1SQG A;  1WC0 A;  4USU A;  1UVI A;  1GMW A;  4LQ9 A;  1Z2Z A;  1GXT A;  1RT2 B;  1T9V A;  4DQS A;  1Y5L B;  5KFG A;  1FT8 A;  5K8N A;  1EET B;  2BA9 A;  1P6T A;  5HLF A;  4YB1 P;  2BE2 A;  2OH2 A;  4C9D A;  1DTT A;  1QY7 A;  4XK8 C;  2F65 A;  1FHT A;  3N28 A;  2Y9H A;  4EUV A;  3PFE A;  2FJW A;  4ES2 A;  1X4G A;  3LF0 A;  2BR0 A;  2BEF A;  3RZA A;  3VAF A;  3KG0 A;  4KKO A;  1IBK J;  3CD6 S;  5HMY A;  1SB6 A;  2DXE A;  3GJT B;  1X5S A;  2PE8 A;  2V9K A;  4K5S A;  3MFH A;  4NEY A;  4Z2X A;  2CRL A;  4ZPV R;  1C4C A;  5IT9 Y;  1XER A;  2MY7 A;  2YQ1 A;  2R8H A;  4P7V A;  2YKN B;  3EDR B;  3FQK A;  2HMI B;  3C16 A;  1RAE B;  3W63 A;  3Q8V A;  2Z57 B;  1ZM4 A;  1HR0 F;  3R6G B;  3AY0 A;  3PHE A;  4FF4 A;  4ILR A;  4CRJ A;  2LMI A;  3HZG A;  1U0S A;  2V50 A;  2L48 A;  3NCR A;  2CWK A;  2OI2 A;  1TUG B;  5E3P A;  5F8L A;  1KC8 T;  1HQU A;  2Y1I A;  2FLL A;  1N36 F;  2DR5 A;  4UY8 5;  4A8Y A;  4NWB A;  4YR0 A;  5KG3 A;  2XHC A;  1SUQ B;  2QLX A;  4EK2 A;  4RNM A;  3V6K A;  1J27 A;  1ZYQ A;  2B4O A;  4EGL A;  1Q0N A;  3KJN B;  4IQX A;  4LF8 F;  3NNC A;  1YJ9 S;  4LSL A;  3P49 B;  1WKJ A;  5D4N A;  3JTP A;  5DLG A;  4A8K A;  3CVK A;  5HK4 A;  1TL3 B;  2DR7 A;  4IYQ A;  5L39 A;  2PGC A;  2GJI A;  5IT9 U;  2ZDO A;  1S72 S;  1IKX B;  1CQN A;  4NCG B;  2W4C A;  2ZDP A;  2W7O A;  3HVT B;  2E7W A;  2FYX A;  4OZ2 A;  5JUM A;  2ABY A;  3W1Y C;  1EP4 A;  1WC6 A;  1F5A A;  1R31 A;  2VFR A;  5J2M A;  4KPY A;  1ZS6 A;  2GO8 A;  3HSJ A;  3LAN A;  4IRK A;  4TNO A;  3HFV A;  1MU2 B;  2MY8 A;  3E8O A;  2MJU A;  4USJ C;  2IAJ A;  1FXR A;  3TVY A;  3H2U B;  1TKT B;  3H4D A;  2E9Z A;  4KHP F;  3OTO J;  3M6X A;  1RAI B;  4ED3 A;  1U24 A;  4MKY A;  3NOG A;  1FTR A;  2DRB A;  4YP3 A;  3C19 A;  3I0S B;  2OPP A;  4B17 A;  4CM2 A;  4QIW D;  4XPE A;  4Q8E A;  2AJ0 A;  2AWZ A;  3O2I A;  3KMS A;  4OL8 A;  3QAE A;  2LQ5 A;  2GVZ B;  2F8E X;  3OJU A;  5D0E A;  4J9O A;  2PDA A;  2ZUG A;  2JOQ A;  4UW2 A;  2H4Y B;  4PPD A;  3VAG A;  3THP A;  3K5M A;  2EFP A;  2AT1 B;  3BYR A;  2BBE A;  1O6X A;  2ROP A;  4K5R A;  4KGX B;  4ZPD A;  2LDY A;  5BR8 F;  4B9M A;  1X4F A;  2H9Z A;  5HQM A;  2MLX A;  5F3Z A;  5M2R A;  4RW9 B;  3HK2 A;  1HYS B;  1KHW A;  3CDW A;  2VKZ G;  4J9P A;  4UOH A;  1C1C A;  1NDK A;  2JLF A;  4H4M B;  4LIW A;  2CPY A;  2RF2 A;  4PWW A;  3TUZ C;  2XCP A;  2C2O B;  2QLJ B;  4Q7A A;  2VD3 A;  3I4P A;  4IKA A;  2WSF C;  3TZY A;  4Q43 A;  1RKJ A;  2RS8 A;  4TYB A;  2VAS A;  4NLX A;  3TEG A;  5B0D A;  4X64 F;  4V19 X;  5DLF A;  4U7C A;  3JSY A;  1M5P C;  1KON A;  1MRO B;  3ZTO A;  4LF8 J;  2Z56 B;  4Y28 C;  4P10 A;  4DSF A;  3CJT A;  4ZLP A;  1U1N A;  2H54 B;  2DIV A;  3DNC A;  5L1L A;  3IAS 9;  2R7U A;  5DDQ C;  3Q8U A;  5EWF A;  1GX5 A;  4EO6 A;  3KG1 A;  5K14 B;  2KG0 A;  1FVS A;  2CPF A;  3J7Z T;  4ETZ A;  5GMD A;  2CNO B;  3CC4 S;  1JLA B;  1GMW D;  2LFV A;  3BRE A;  2IA6 A;  3KLI A;  5HMX A;  4RBU A;  4DV1 F;  3FRY A;  5E3A A;  3EVW A;  4ZPB A;  1VS3 A;  1B64 A;  5F41 A;  2LEP A;  2O01 C;  2X1F A;  1EQ0 A;  2ATC B;  3R1H A;  1H6K X;  1NPK A;  3VGT A;  7AT1 B;  4C3K A;  2W9C B;  2KHD A;  3EGN A;  1HBN A;  3PW4 A;  4CH0 S;  3RW7 A;  1P9Y A;  3W5Z A;  4UUX A;  3TJ8 A;  3V6H A;  1TVR A;  5I4M A;  3DLE B;  2F3J A;  3LTO A;  3UWT A;  3IAM 9;  4A8O A;  2B9X A;  1QD1 A;  1REV B;  3B4M A;  3D0I E;  1EET A;  1IKY A;  1H0H B;  2IYI A;  3M9M B;  1UL3 A;  3WC2 A;  1A9N B;  2ILZ A;  2WB4 A;  1RZM A;  3KLI B;  3D1H A;  8RUC A;  5KFZ A;  2CG8 A;  5L9N A;  3TX8 A;  4CI0 B;  5HP1 B;  3MR6 A;  1TP7 A;  5THW A;  3S01 A;  4P72 A;  1ARO P;  3BO2 A;  2HNY B;  5K8M A;  4GVB A;  4LF7 J;  1QM9 A;  4JI1 J;  1HBN B;  4O3O A;  2KFN A;  3HSD A;  2UXB J;  4M5J A;  1LW0 A;  4UUW A;  4JI4 J;  2R2R A;  4KGM A;  1OS5 A;  2MQP A;  1AUD A;  5ETO A;  4JI3 J;  1N88 A;  1SI9 A;  2DGT A;  2JJ4 D;  2V8V A;  4F25 A;  4OZL A;  2CXE A;  1LQ9 A;  2PA3 A;  1HNV B;  3TVK A;  4NYZ A;  3CO9 A;  5D3G B;  3WX8 A;  1TK8 A;  1YTY A;  2XZT B;  3LAK A;  1OWX A;  3LW5 C;  2WAQ D;  1RCO B;  4U95 A;  3PR5 B;  3W3S A;  2DT9 A;  2CQP A;  4P6Q A;  3IBF B;  1I94 J;  2UUT A;  2GQQ A;  3NWG A;  1NPP A;  1F6T A;  4ECR A;  2NCK L;  3KG4 A;  1O8B A;  2C3U A;  3EIC A;  2CPJ A;  2CQI A;  2HZC A;  3AJ2 A;  1HNX F;  3I96 A;  2E5L F;  2YNG A;  3CJ2 A;  4DFK A;  2ZHO A;  4UOF A;  5J2Q B;  4O3S A;  4PQA A;  2HGM A;  4I6W A;  3M4X A;  4Q44 A;  2RD5 C;  5D78 A;  2UUB F;  4DPU A;  2WOM A;  2F40 A;  2UVR A;  3A13 A;  2CJA A;  2Y1R I;  4K0K F;  4WKR A;  5F3T A;  1L3S A;  4PAA A;  4ZHR A;  1R0A A;  3NAH A;  4I4B A;  3ENW A;  1CC7 A;  1I3O B;  3JQM A;  3VAL A;  4JV1 A;  2MLZ A;  4DU7 A;  5K8O A;  1Q1K A;  2XO7 A;  2HHH J;  2UVV A;  4UTG A;  2HFV A;  1SIW B;  5KFF A;  1PKU A;  3MTJ A;  5KOW A;  3KK2 A;  2XHW A;  3MXH P;  4KGK A;  1N5S A;  2VON A;  4WWS A;  5CCM A;  3V4I A;  2XMM A;  1WSV A;  5KFT A;  2BKP A;  3DDN A;  4I6A A;  4PYD A;  2V4Q A;  5GVQ A;  3OL6 A;  2RRA A;  2IAJ B;  3D5M A;  3HJV A;  1ZM3 A;  4CM0 A;  2HLU A;  2XMW A;  4ZVG A;  3JAM Y;  1EHW A;  5DG9 A;  4Q2L A;  2VQF F;  2MXY A;  4XIU A;  2CJ9 A;  5KFJ A;  1IR1 A;  4LFA J;  3F44 A;  1S4E A;  1FJC A;  3IM8 A;  4RBV A;  3HJF A;  1M5H A;  2HG4 A;  3ISZ A;  4RNH A;  4ZIT A;  5KG2 A;  2XY5 A;  4W90 B;  1T9U A;  1RT3 B;  2CQB A;  2ZH2 A;  1XR6 A;  4DQR A;  2VZ9 A;  4C4W A;  3G2X A;  4JP8 A;  1FRI A;  2BJ1 A;  3ILO A;  4B9L A;  3NGS A;  3DU6 A;  4JI2 F;  2HVZ A;  3CUL A;  2K1R B;  1K1S A;  1RI7 A;  4FS1 A;  2HHH F;  3L09 A;  1RT1 A;  4QIG A;  1UA0 A;  2QL7 B;  4ZLN A;  3CCU S;  3TA0 A;  1HBM A;  2KT3 A;  2ZOG A;  3DM2 B;  5FDL A;  4PG8 A;  3PNI A;  3AB2 B;  3FRZ A;  3TJA A;  4IOC Q;  5BR8 J;  3THV A;  1IM4 A;  3DCA A;  3AXK A;  5E2Q A;  2QYG A;  2W9A A;  1NM2 A;  2A10 A;  2HQF A;  1N5Q A;  2AJ1 A;  3A3O B;  5KFR A;  3GPA A;  2QA4 S;  1TKD A;  2NQP A;  1FKO A;  4HEA 9;  1H2U X;  1CJU A;  3OLB A;  2QJ3 A;  3GSD A;  3MM5 B;  5BYQ A;  2FGC A;  3IO1 A;  5CD4 H;  1FVQ A;  1J5O A;  2DK2 A;  1IBK F;  1XN9 A;  3PRB A;  1HI1 A;  2N3L A;  3OVS A;  3M32 B;  1PYO B;  2C3Y A;  4IFY A;  4DR2 J;  4PRF A;  5KFX A;  2B5J A;  1CUL A;  1HL6 A;  2XMJ A;  1CQM A;  4PG5 A;  4DCJ B;  2QLF B;  4X4P A;  3O5T B;  4O0I A;  1UET A;  2FY1 A;  1KHV A;  1TL3 A;  2JH3 A;  1NPR A;  1R3N A;  5CYM B;  1WWH A;  2DR8 A;  2EG2 A;  3EZO A;  3GR0 A;  2HFO A;  1BHN A;  2QC3 A;  4DN9 A;  1C0U A;  4UY8 T;  3PX6 A;  1IKW B;  4YR2 A;  3J81 Y;  2Q66 A;  1RAG B;  3WQP A;  2BJ3 A;  2JDJ A;  4CO5 A;  3TZX A;  1UTA A;  1P1T A;  2GW8 A;  3M30 A;  1YWX A;  3TUI C;  5LM7 E;  2DHA A;  3RU0 A;  3W9I A;  5F8I A;  1SL1 A;  4QU7 A;  4M5M A;  3BKT A;  3OL7 A;  1X9S A;  2O67 A;  3BEG B;  1GTH A;  3KXD A;  4KSE B;  4LF4 F;  4O3N A;  4LQ3 A;  3C15 A;  3CCS S;  1RTH A;  4O3P A;  2RHQ B;  2XNR A;  2EKY A;  4OX8 A;  2MDA A;  2DNM A;  3MAA B;  4HI1 A;  4DR7 J;  2BXJ A;  1N54 B;  4J37 A;  1DRZ A;  3HZE A;  3UDV A;  1B7F A;  1RT5 B;  4ID5 A;  3HP6 A;  4HT5 A;  2DRA A;  1CJT A;  4N56 A;  2R8G A;  4DR6 F;  5CAB A;  4RNF A;  1C4A A;  2ZWP A;  5KFC A;  3GIR A;  1UPP A;  3VHQ A;  4I67 A;  5H9E J;  4NA1 A;  1UWB B;  2H3E B;  3MDF A;  5E3Q A;  4GVB B;  1X31 C;  4LIR A;  4LR9 A;  3H2L A;  2ZUA A;  2MYF A;  2FVR A;  2HFZ A;  3CD0 A;  3C66 A;  3MMB A;  4W98 A;  4QJV A;  5HBM A;  4X64 J;  2D3Z A;  4JI6 F;  3RAQ A;  3PJ9 A;  3RBZ A;  1Q7L B;  4DL4 A;  2RQ4 A;  4H4K A;  3HPO A;  5LMN J;  3QSI A;  1UZD A;  1UVM A;  3QGH A;  4RO0 A;  3CJK A;  3LA0 A;  1SH2 A;  2W2O P;  1X5T A;  5IQQ A;  3PKY A;  2QZ8 A;  4DSI A;  3SXL A;  4GKK F;  4QYZ K;  5DGA A;  3QWU A;  2EK1 A;  2EXU A;  3GG1 A;  1RT4 B;  3I6P A;  1FK9 B;  5EWG A;  3OW2 R;  1IKX A;  3KDN A;  1UW9 A;  4Y65 A;  3SV4 A;  5H9E K;  2G4B A;  2RHS B;  2YWK A;  4JI7 F;  4I7F A;  2DRD A;  3MMC B;  4CWB A;  2J9C A;  4C0B A;  8AT1 B;  4ED0 A;  1VJQ A;  3U1M A;  4QIF A;  5IV4 A;  4UT4 A;  3CCM S;  1N33 J;  1N0U A;  3MPW A;  1WHV A;  4JI0 F;  4ECS A;  1S77 D;  2M52 A;  3CJ8 A;  2R7Q A;  5MLC V;  1X8D A;  2HRU A;  3MF5 A;  4L74 A;  2A6M A;  5LSL A;  4JI8 F;  3RJM B;  1CLF A;  5KT3 A;  3AHP A;  1FDA A;  1RT4 A;  2WVC A;  3NBP B;  4G1P A;  4MJK A;  1P8G A;  2HW3 A;  3JYT B;  4TU7 A;  1TL1 A;  1RYS A;  1VIX A;  2UUA J;  1S99 A;  2AX0 A;  3MM6 B;  4A46 A;  4ED7 A;  5FLX Y;  4CO2 A;  2CVE A;  2WTF A;  1EX8 A;  4NX9 A;  1BGX T;  2HHT A;  1DQ8 A;  4RWW A;  4C48 A;  4CNZ A;  2FJE B;  3DFE A;  2P9E A;  2R2U A;  2DY9 A;  4MAK A;  5DQG A;  3R8Y A;  3C6U B;  3H98 A;  4LR7 A;  3UN5 A;  3SYZ A;  2FJX A;  5IC6 B;  2K7J A;  3PO5 A;  4WU2 A;  3DN9 A;  1WNE A;  1S1U A;  4ICL B;  3M2R A;  3K5N A;  1KFS A;  2VG7 A;  2BUN A;  1TKZ A;  1U09 A;  2DCU B;  3NWR A;  2B9W A;  4WIQ A;  4PCQ A;  2XG8 A;  2RUS A;  4YDX A;  2J6T A;  3AD7 C;  4DPT A;  4RNN A;  2YNH A;  1SKS A;  2E44 A;  3DKD A;  2LKZ A;  1S59 A;  3FQL A;  2BKN A;  2ZH6 A;  2OEK A;  1NSQ A;  3Q2S C;  1T94 A;  4ZVO B;  3G6V A;  2DHX A;  3NEK A;  5GAH U;  2W2P P;  1T03 A;  4L3K A;  3JQJ A;  2DNL A;  1E6Y A;  2X1B A;  1M5S A;  4P73 A;  3O3L A;  4R0E A;  4ETX A;  3KHR A;  3CCL S;  3QRR A;  4JYA J;  3QNW B;  1CPZ A;  3D0H E;  3IS9 B;  3M2U A;  1BLU A;  1WHX A;  2XSJ B;  2R3V A;  3MUT P;  4BHQ A;  3KYL A;  3P5B P;  1FDB A;  2OP5 A;  3PCO B;  1RHK B;  1FNO A;  4H4K C;  2DTJ A;  4JI3 F;  2FZK B;  5L38 A;  3MUV P;  2E5G A;  3B6B A;  5J2Q A;  1JLF B;  1I5O B;  1OSD A;  1R0B G;  3HHL C;  4LJM A;  3U7J A;  4ZLJ A;  4NA2 A;  1NLK L;  3KUH A;  2AJF E;  4KO0 B;  3W8G A;  1AFJ A;  1RQ0 A;  2CQ1 A;  1T0T V;  2GQC A;  4A8X A;  3OR1 A;  2P9C A;  3RAM A;  1PCA A;  2VUG A;  5HRO B;  2QSW A;  4RPF A;  2AYG A;  1VOM A;  4WJB A;  3OUY A;  4GMK A;  2WB1 D;  3ZZZ A;  1HPZ B;  3HDS A;  2VC1 A;  3OHB A;  2NRE A;  4IG3 A;  2Y3Y A;  1EKS A;  4I2Q B;  1RAJ A;  4U8V A;  4DPX A;  1HNI A;  2CJB A;  4BWM A;  4QBU A;  1HQE B;  3CT9 A;  1WJ9 A;  5KTQ A;  2UU9 J;  1AT1 B;  3FSY A;  4O4R A;  4DV7 J;  2JLE A;  4NLR A;  3BGL A;  3ZC4 A;  4M95 A;  3B8H A;  2BDP A;  3N9U C;  5KG1 A;  2V34 A;  3C15 B;  2OSR A;  3DRX A;  2FHK A;  3IR7 B;  3P4U B;  2FPH X;  4I2P A;  2KFZ A;  1QAX A;  2SXL A;  3CJ4 A;  2DH7 A;  4EBD A;  2YWW A;  3CMA S;  5HRO A;  4H4O A;  2B4V A;  2AU0 A;  1DQ9 A;  1VRU B;  2B8P A;  2ZNY A;  5K9F A;  1UFK A;  2K8G A;  2V8G A;  4MKV A;  1RT3 A;  4L3N A;  1HD1 A;  4J91 A;  4K4Y A;  2IJN A;  1U7L A;  3NP5 A;  4TVA B;  3KHL A;  2DR6 A;  4OI3 A;  2HND B;  4UZC A;  1PJ5 A;  4IR1 A;  5AE1 A;  1T9T A;  1X4E A;  2V2Z A;  3DGP B;  1R27 B;  4OV6 A;  1OO0 B;  5AXL A;  1YRU A;  4OV1 A;  3OPK A;  3W2W B;  1RWV B;  3SMZ A;  1O0P A;  1ZM9 A;  2KO1 A;  2NUU G;  2X7I A;  2XNQ A;  2QFJ A;  3G8S A;  1N48 A;  4B08 A;  1MSW D;  1SH3 A;  3SI8 A;  1TFY A;  2B6A B;  2ZC4 A;  1DTQ A;  1ZZF A;  1NJY A;  4OHW A;  1HWK A;  5ETK A;  3C14 A;  1RTD A;  4IR9 A;  2VFV A;  4WBF A;  2YNI A;  2LA4 A;  5I3P A;  3IN5 A;  1T03 B;  3HHL A;  4C11 B;  5CD4 A;  5FJ4 A;  2NXE A;  2IPO B;  3Q23 A;  2UV8 G;  3TO8 A;  1SJ1 A;  3ELH A;  4Z7Y A;  3VAK A;  3PX0 A;  1M1K T;  1HNI B;  2JHE A;  2JEI A;  3AQO A;  2R2T A;  3N79 A;  2CWX A;  1Y5N B;  2FC8 A;  4CH7 A;  2KRB A;  3MTK A;  1N0V C;  2U2F A;  3PG9 A;  1RWN B;  3TZZ A;  3GYG A;  4MTP A;  2XC9 A;  1T05 A;  1R0C B;  4KC5 A;  3VQT A;  2DVI A;  4LF5 F;  1DBD A;  5D8H B;  1K0T A;  3PW2 A;  3CCW A;  3UD3 P;  1RTD B;  3KLE B;  4FVM A;  2HK3 A;  1IKY B;  1VRU A;  1FFW B;  2CQ4 A;  3MCM A;  4NXM J;  3A4T A;  1Y5I B;  1LWF B;  3QWP A;  1N8R T;  4PWU A;  2I38 A;  2FLN A;  1KLN A;  2JL9 A;  3ETO A;  3ZNU A;  4F0M A;  2YQ3 A;  3FVY A;  3DOK B;  1IXK A;  4JOU A;  4OYI A;  3UVJ A;  1Q82 T;  1FX4 A;  3D7S B;  1RU1 A;  3Q2T C;  3OTD A;  4I7F B;  5KT7 A;  3BGO P;  1RT1 B;  2L9W A;  3UI3 A;  2ASJ A;  5AT1 B;  2CQG A;  3R2C J;  3PW0 A;  3KLV A;  4KHM A;  2C28 A;  3A8K A;  1HWJ A;  4P2F A;  3QGP A;  3BGF A;  3BH6 B;  2IM1 A;  4LFC J;  2VJU A;  1FWP A;  4DR4 F;  4JI2 J;  3M2R B;  3PM9 A;  2NR0 A;  3C14 B;  2UXC F;  1LV5 A;  2YNI B;  1FRK A;  2VOP A;  1F3F A;  5J1E A;  4XAK A;  5G0R B;  2NSC A;  3W9J A;  3FSI A;  3T3F A;  3GLJ A;  4DF4 A;  1X5O A;  2DPI A;  2HYI B;  3CDE A;  1Y11 A;  1DAR A;  3JXO A;  1OMS A;  2WW4 A;  3N6L A;  4WTY A;  3ILI A;  5F0W A;  4CLF A;  3MMB B;  5GAG I;  2DR9 A;  3UDC A;  3NNA A;  2HAF A;  3DRY A;  4P2M A;  5J2M B;  2Z4P A;  1ULR A;  1B99 A;  1SJR A;  3FDS A;  3F41 A;  4LRD A;  3HI9 A;  1R8B A;  2NXU A;  1WC4 A;  2LQB A;  1PIL A;  5C2C A;  5CH7 B;  3H25 A;  5T7L A;  1VQ4 S;  1UW4 A;  3CTR A;  4USH A;  1PO6 A;  1SJ3 P;  4HHH A;  4F2R A;  4FXD A;  2LEA A;  3I9Z A;  4DQQ A;  2ADC A;  1QE1 B;  1XNR J;  5J2N A;  1RCX B;  2Z2Y B;  3TWZ A;  2GC8 A;  3KJQ B;  3DLB A;  2M8D B;  3IR6 B;  2B56 A;  3TR5 A;  1Y3J A;  4DQP A;  4NCA A;  4HYK A;  1I6J A;  3QSY B;  5KG6 A;  4ZVT B;  4RW4 B;  3QGI A;  4FKX A;  2QSF A;  4ZPT R;  4X4R A;  3QFH A;  2A18 A;  2XWY A;  4EYI B;  1U1M A;  1VBY A;  2HRY A;  2I8E A;  3A8J A;  3L7U A;  1TK0 A;  3AJ1 A;  3NGU A;  3OUY B;  1W2I A;  2W8L A;  2HS0 A;  1KSP A;  4F36 A;  5J2N B;  1FWK A;  1S1V A;  4JI7 J;  2QO3 A;  2KYZ A;  3MEG A;  1RWP B;  1S1X A;  4KY3 A;  5KT6 A;  2F5G A;  1VQ5 S;  3F56 A;  3ZFV A;  2O1P A;  3J7Y I;  4NXN J;  3TUP A;  5F0U A;  2AJ2 A;  2IA0 A;  1QDU B;  1T9X A;  4DUY F;  4AQY F;  1TZ0 A;  2AMC B;  3OL8 A;  4QCL A;  4AUK A;  2YPY A;  3HFK A;  1NK8 A;  5IZH A;  1S1U B;  3H42 A;  3KOA A;  2EBE A;  1WUU A;  1K9M T;  1FDN A;  2HBQ B;  5LXY A;  1GMV A;  2V0N A;  2DGQ A;  3OR1 B;  4TQS A;  1X9M A;  3FEX B;  3KHH A;  4MK9 A;  5HVF A;  4KHR A;  4YOE A;  1KQG B;  3MEG B;  2WVD A;  2KFY A;  2AYM A;  2RS2 A;  3HSG A;  3EE3 A;  4OYW A;  3DHW C;  1VQP S;  3NOC A;  2ZBI A;  2V8P A;  2OPQ A;  4PG7 A;  1UJ5 A;  4HLB A;  2NYI A;  2IVF B;  1KQK A;  1YJT A;  2W9C A;  3HX9 A;  7FDR A;  3CJR A;  1BQM A;  4LUB A;  4RLE A;  4J9V A;  2IVM A;  3MGJ A;  4KKO B;  2OO4 A;  4P74 A;  5T41 A;  1SCJ B;  2J7U A;  1NKE A;  2EFQ A;  2X1A A;  2KN4 A;  5GAE I;  3J80 U;  1RWW B;  3PR4 A;  3GFZ A;  3Q86 A;  1S57 A;  3BN7 A;  3H8Y A;  4I68 A;  4NI2 B;  4DL0 C;  4DMZ A;  4IH6 A;  1P1L A;  2HMI A;  1MML A;  3EGV A;  1REG X;  1OSC A;  2OAU A;  4CO4 A;  4DLE A;  2I5J B;  3ZNJ 1;  1VHI A;  3HCX A;  3M30 B;  5HO4 A;  3W64 A;  4FYV B;  1N56 A;  1NK0 A;  2KJW A;  3MPY A;  4DU8 A;  4AL5 A;  2VV5 A;  2Q3P A;  3GB0 A;  5LMU F;  1FNX H;  3K7R A;  1RP5 A;  3MEE B;  3OTC A;  3LPE A;  4WFB Q;  2DGO A;  2AZ1 A;  2VG6 B;  4O4G A;  2E5J A;  1JJ2 R;  4OX9 J;  1T05 B;  2CQ2 A;  1UZH A;  3OBI A;  3CO0 P;  3L4B C;  4NLQ A;  2BOP A;  4USM A;  2IMW P;  2FDN A;  2RU9 A;  2AIR B;  1YZ6 A;  1H73 A;  3RBX A;  4LF9 J;  3RRK A;  1E6V B;  2JX2 A;  4KAI A;  1GNK A;  2Y0S D;  5AXN A;  1U26 A;  3FBE A;  3MCS A;  5EN1 A;  1WD6 A;  2W2M P;  3KWM A;  4AL6 A;  3HHL B;  1U1O A;  3RBD A;  3BV8 A;  1F5C A;  3ISN C;  1RGV A;  2B8Q A;  4C11 A;  1RAF B;  4F26 A;  4DX5 A;  5KFK A;  2ASL A;  4WZQ A;  3TYT A;  3NRB A;  3R27 A;  3QRQ A;  2GVD B;  3A1Y G;  2LP4 A;  2QN6 B;  4PG6 A;  5ADZ A;  4R5P B;  1FEE A;  4RWX A;  3VVT A;  1KP6 A;  2FGO A;  2UUC F;  1YX2 A;  3C8Y A;  4F8R A;  1WDD A;  5CHC B;  4WCE Q;  3G8Q A;  1WSR A;  3IRX B;  1U0H B;  4YY3 F;  4ECX A;  1RT7 A;  3R7N B;  2CPZ A;  1TV6 B;  3G6X A;  3OVB A;  1W2B R;  4OI6 A;  1WKL A;  2XYH B;  2HLT A;  3K89 A;  3TW0 A;  5G4D A;  1I94 F;  2CUY A;  2RVJ A;  4Q0B B;  3QT7 A;  2DNH A;  4O44 A;  2GS8 A;  2ZE2 B;  2YH1 A;  2DHG A;  4J9L A;  1VQ8 S;  1URR A;  4DUT A;  2BJ7 A;  1YBT A;  4KTQ A;  2IJR A;  1PBU A;  2LU2 A;  1QVG R;  4O3R A;  1EAR A;  5IT4 A;  2LXI A;  3X3U A;  2YPZ A;  2YY3 A;  1WAC A;  3QT5 A;  4WK1 A;  1FJG F;  3HLU A;  1RWK B;  2EWH A;  4K0K J;  1IQZ A;  3I5A A;  1RA7 A;  4WE1 B;  3SCJ E;  4K4Z A;  2DHS A;  1FEH A;  4N8N A;  4CLK A;  3KJF B;  5DQH A;  3I0R B;  3H40 A;  3IWX A;  3J7Y U;  2LXU A;  3A12 A;  3BPS P;  3RB4 A;  1XQI A;  2K7K A;  1RK8 A;  4FF3 A;  3V6D A;  2A6O A;  2AP6 A;  3H5U A;  1ZAW A;  4EI2 A;  2HHV A;  1LK5 A;  1VRT B;  2J7W A;  3G6E S;  3LGN A;  3EXC X;  3RB6 A;  3KLH B;  1U4B A;  4DFP A;  2ROE A;  5I3Q A;  3P45 B;  4R5P A;  1CC8 A;  3KJV B;  4TLR A;  4PAB A;  2RNE A;  1XJW B;  2IMO A;  2W2Q P;  1NXI A;  1X4C A;  3I32 A;  2M70 A;  3K2Y A;  4MYT A;  5CZX A;  4J9Q A;  2BOA A;  2RKI B;  1D8Z A;  3ZZR A;  1PG5 B;  3M05 A;  4NLT A;  1HWU A;  4QWA A;  3OHA A;  4U9R A;  5F9L A;  3T5L A;  2YX7 A;  4K59 A;  1S6Q A;  4QIV A;  1NRK A;  2KXF A;  1RWM B;  2KU7 A;  2P5V A;  2YNH B;  4J9K A;  3TAN A;  1L5U A;  3H5X A;  2ZH3 A;  3GJR B;  1HNZ J;  3LP1 B;  2KJV A;  2YKM A;  3SQO P;  1NSK L;  2B4U A;  3CCE S;  3UDL A;  3M32 A;  1SBR A;  4WTO B;  1WG1 A;  2ALZ A;  2MTL A;  2AYE A;  3MM8 B;  3Q83 A;  4OJ3 A;  4DL6 A;  5IOL A;  4LF6 J;  1DTQ B;  2G0C A;  4OYO A;  5ETS A;  1R0A B;  4USV A;  4PUO B;  2VH7 A;  5D0G A;  1IN0 A;  2XWX A;  3NL0 A;  2IVY A;  2EEY A;  5DG8 A;  5C24 A;  2J9D A;  5B0A A;  4M94 A;  1S10 A;  2OPR B;  5CA5 A;  1R6Y A;  4YQW A;  4DR6 J;  3L9Z A;  3I82 A;  2XM3 A;  5HMZ A;  4JYA F;  1Q8K A;  4IO1 A;  3ENQ A;  1VQ9 S;  5KG0 A;  1M1G A;  4GKJ J;  3DI6 A;  1VQY A;  2FD2 A;  2W7P A;  2Z58 B;  5KG7 A;  1FD2 A;  2HQG A;  2D3U A;  4GO5 X;  4OYB A;  4YME A;  2WVF A;  3ENV A;  3UQS A;  3H59 A;  1T3O A;  2AGO A;  3N4W A;  1VQ6 S;  4OYP A;  3S8S A;  3QT8 A;  4PKD B;  4B3T F;  4ECW A;  3RTV A;  3M2V B;  1HAR A;  5F8G A;  2OEL A;  4ERD A;  2RT3 A;  2WZ1 A;  2KH9 A;  1FRX A;  2A3J A;  4Q2M A;  4DX8 H;  1JX4 A;  3DRS A;  4UOC A;  3UNY A;  3U27 A;  5CCL A;  3CC7 S;  4BCA A;  3NGK A;  3KUG A;  2H65 B;  2OPQ B;  3Q24 A;  3L7P A;  3GE9 A;  4NXM F;  2Y8Y A;  2LYV A;  3H5Y A;  3ZZP A;  4ELV A;  1TMM A;  4MIB A;  1MLA A;  3IGV A;  4FF2 A;  3EYZ A;  1W25 A;  5L1K A;  4AXJ A;  1W7W A;  3N0V A;  3PTW A;  4DL3 A;  1FER A;  3ZTR A;  2EFN A;  2VPX B;  1IWA A;  2MQN A;  4ZHR B;  3W8P A;  4UZB A;  4G65 A;  4ZOS A;  5D4P A;  1KEK A;  1Q95 G;  3HKW A;  1H38 A;  2GGP A;  2KZZ A;  2YWE A;  4QYR A;  1Q5V A;  1D1U A;  5AE3 A;  2E5L J;  4NRU A;  4OQJ A;  5KFO A;  2E9T A;  3BKF A;  1UJ4 A;  1WEX A;  2CPD A;  2C3P A;  2V2Q A;  4M5D B;  1IJF B;  4NEZ A;  4C8M A;  4A4J A;  2R4F A;  4DHV A;  3AFG A;  5KFI A;  5DM6 Q;  3GV7 B;  1HD0 A;  2M88 A;  2JSX A;  1U47 A;  2HHU A;  2BM1 A;  2MLY A;  5A0Y A;  2L9D A;  3QJL A;  4WF9 Q;  3FSX A;  2R42 A;  5A2Q Y;  4CLL A;  5J2P A;  1JLC B;  5DS7 A;  4ZIW A;  2MQQ A;  4DV0 F;  1YRT A;  4AFF A;  3Q8S B;  1SL2 A;  2PFD A;  1QAJ A;  3DC2 A;  4CO3 A;  2IM0 A;  2GIF A;  4YY3 J;  3V2U C;  3OXF A;  4M5N A;  4NZ0 A;  2XI2 A;  3T1H J;  4Y2A A;  4KJI A;  3ADA C;  1URN A;  1DUR A;  3PW7 A;  1T02 A;  1DFD A;  9RUB A;  2N7C A;  4CLY A;  1WI6 A;  4DUZ J;  1F60 B;  5LXR A;  1HHS A;  4HR2 A;  2BJD A;  4ZMM A;  3MEC B;  2ZH1 A;  4HAC A;  3C6U A;  3W62 A;  2MZS A;  1N32 J;  2XEX A;  4RW7 B;  4A8M P;  1LWE A;  1NZ8 A;  1AA1 B;  3CCR S;  4LF5 J;  4DR3 J;  2XO6 A;  4BLG A;  1PGZ A;  5A2Q U;  2I5J A;  3PY8 A;  1Q7Y T;  4ZJL A;  4RZR A;  1IBL F;  2XS2 A;  2IFX A;  3MM5 A;  3C6T A;  4ECT A;  2HHS A;  3JSM A;  4LR8 A;  1RTI A;  2ZC3 A;  2RSQ A;  1ZA1 B;  2QLB B;  4AT1 B;  3M9O B;  4NOH A;  3KJV A;  4NLW A;  1CUL B;  4KRW A;  4KH0 B;  2HGL A;  4UOG A;  4RW7 A;  3ET6 A;  2IY5 B;  2R7T A;  3FMB A;  3FCH A;  3UO0 A;  3I56 S;  4M63 A;  1S6P A;  1D09 B;  2LEB A;  3QBC A;  2I2Y A;  3KTQ A;  4CQ1 A;  5H1S V;  3W2V B;  2GJF A;  1LWF A;  1U48 A;  3RR7 A;  1Y10 A;  3WIV A;  1YJR A;  2Z0G A;  1TAQ A;  5D6G A;  1M90 T;  2YQ0 A;  3IRW P;  9ATC B;  1CVJ A;  4OIX A;  3FK4 A;  1S4F A;  5EX0 A;  4HTI A;  4C2M A;  1SJF A;  2HHQ A;  3QQC D;  3QIP B;  3PIO Q;  3HD1 A;  2GAH C;  3IRX A;  3QO9 A;  1OPZ A;  4KT0 C;  3AB4 B;  5BXI A;  1PC4 A;  3IFE A;  2VHG A;  3PEH A;  3QMQ A;  4QQB A;  3VGS A;  1HYS A;  1LWE B;  1Y7P A;  2MSS A;  3E01 B;  3G86 A;  5B0E A;  3ITH A;  2R7V A;  1SC3 B;  1YI2 S;  4TN2 A;  1EIY B;  4HKQ A;  3MM6 A;  4DPY A;  2HSE B;  3AQP A;  2PMW A;  1RJJ A;  1SXL A;  1UWB A;  1NSA A;  4YHH J;  2VA2 A;  2HFU A;  2YH0 A;  4RW8 B;  3NS6 A;  4RW4 A;  1YZ7 A;  4QYZ J;  1MRO A;  2AEF A;  1RE1 B;  2J76 E;  3IG1 A;  1UEU A;  2B7C B;  4M5G A;  2AYB A;  2MKC A;  5HN0 A;  4KIA A;  2PI5 A;  2BJ9 A;  2CZV C;  4PXC A;  2E9R X;  2HVI A;  1RWX B;  1O51 A;  4PR6 A;  3VGU A;  3NMR A;  1GQE A;  3HHD A;  3TI0 A;  2JVO A;  2N7Y A;  1QUP A;  2EC2 A;  2XUL A;  3D3C J;  5KG5 A;  2YWH A;  2BYC A;  1XMO J;  1HLW A;  4Y6I A;  1HIY A;  2XMK A;  3VAI A;  1U1L A;  2CDR B;  5B0C A;  1FES A;  3NGR A;  1HMV B;  2HZV A;  1F1B B;  4OZ0 A;  1J2V A;  2HFS A;  4PPZ A;  2J9E A;  3TX0 A;  3H20 A;  5T14 A;  1N4L A;  3KNA A;  2Z2M A;  4URS A;  3LQV A;  4N47 A;  3PW5 A;  2NZC A;  4F3O A;  2RKI A;  3T1A A;  3VAH A;  2BQR A;  2ZVI A;  2DXD A;  2FY8 A;  3AT1 B;  3M2U B;  4CLZ A;  1RTZ A;  1QAY A;  3I31 A;  2QV6 A;  2XQC A;  2G9O A;  1ZPW X;  4NLU A;  5JJB A;  2MST A;  3I0S A;  5BYR A;  2FJA B;  1O5J A;  3VAJ A;  2CQ0 A;  1S1V B;  1KQF B;  3TUJ C;  2AGP A;  4DEZ A;  1VC0 A;  2GIR A;  2OUG A;  1NK5 A;  1CG2 A;  3CNQ P;  2K06 A;  5IV3 A;  2CNL B;  4N41 A;  2KM8 C;  3W7B A;  3M7V A;  5DDO C;  1NB2 A;  3BQ2 A;  4I0W A;  2BAC A;  1BUX A;  2F9J A;  2O66 A;  4I69 A;  2UV8 A;  4YB6 A;  3MAA A;  4CLP A;  1JXL A;  3JTO A;  3IWN C;  3NGD A;  4ZVF A;  5K8P A;  3R5A A;  2HQC A;  4XO0 A;  1UPM B;  3P5T L;  5M2P A;  2ZOF A;  1CEZ A;  3OFH A;  4RW6 A;  1MG7 A;  2VG5 B;  4H4M A;  5KFP A;  4B9S A;  1JJC B;  2AW0 A;  1Z4U A;  2D1C A;  5SUH A;  2QT7 A;  2WVE A;  2QMU B;  3JAM U;  1TQL A;  3T9Z A;  1VRQ C;  2MHN A;  2MKJ A;  4BC9 A;  4WFY A;  4M5D A;  5KFQ A;  1NHV A;  4QWD A;  4J9R A;  4C3L A;  3H90 A;  4HH0 A;  4NZ7 A;  2KYX A;  5KFM A;  2ZZT A;  2B51 A;  2YX1 A;  5EX3 A;  3IMQ J;  3B82 A;  4OI4 A;  3TAM B;  4OZ3 A;  3G71 S;  1H3D A;  1PYS B;  3BPD A;  4IH5 A;  3WBZ A;  2H4W B;  3FFI A;  1WC5 A;  1S9E A;  4KE5 A;  1U1Q A;  2HQ3 A;  5F8N A;  5LOQ A;  5RUB A;  5G0R A;  4OFZ A;  3I55 S;  3VGV A;  5IWA F;  4O3Q A;  3F73 A;  4KQZ A;  3G6Y A;  3MWB A;  3D54 A;  4IH7 A;  2BQ3 A;  1H74 A;  2D3O 1;  3H2V E;  3ONQ A;  3KK2 B;  4PWD A;  3CDU A;  2QLW A;  2VPY B;  5CZV A;  5KT4 A;  4YB5 A;  3V5R A;  1IBL J;  2VBW A;  4LF9 F;  3U1N A;  3B54 A;  4ZPC A;  2ZJQ Q;  4ZVE A;  4FF1 A;  1FE4 A;  3KFW X;  4F4A A;  1CBK A;  3CJ0 A;  5MAO A;  2DCL A;  3TAM A;  1K1Q A;  5LSR A;  4LF7 F;  4L72 B;  4LFC F;  3NGT A;  3IC1 A;  4DR4 J;  1J5E F;  3V6J A;  3IBW A;  4OZN A;  2DY1 A;  4N5S A;  1HFE L;  1VBX A;  4FZV A;  1MWQ A;  3C16 B;  3G8T A;  1EJ7 L;  4MIW A;  3KLF B;  3RG6 A;  4PQU A;  2VBX A;  1G4C A;  2OFG X;  1P27 B;  2HWI A;  3GG0 A;  4DV1 J;  3AD8 C;  1P9Q C;  1C1C B;  1FDD A;  4FBU A;  1U8S A;  1S5Z A;  3B78 A;  2MHE A;  1FX2 A;  4WKY A;  4IOA Q;  3PYF A;  2JWN A;  3TA2 A;  1LW2 B;  5KG4 A;  1RXO B;  1B0T A;  3M9N B;  1TL5 A;  3SSQ A;  1N6Q B;  3LH2 S;  2KG1 A;  4ECV A;  3E3X A;  1NO8 A;  3T5J A;  1NK9 A;  3FBF A;  3P3D A;  1JLB B;  1LFP A;  4A8W A;  2V94 A;  1JNZ B;  3D0G E;  4MKB A;  4NPO A;  3O44 A;  4LF1 A;  3Q8R B;  2R7S A;  1HA1 A;  2HKE A;  3R5D A;  4X4U A;  1PYT A;  4WXW A;  3HVW A;  3DOK A;  2C3M A;  1JLA A;  2CA9 A;  4ANE A;  2AJQ A;  3G4S S;  2RQM A;  6FDR A;  2LLZ A;  5CYQ A;  3PAC A;  2UXB F;  2FQQ B;  2DBB A;  2Q1L A;  4O44 B;  3T5K A;  4IG0 A;  5ETQ A;  1M5K C;  1KOH A;  1Q8B A;  3P96 A;  3QZ7 A;  1JLG A;  4JUZ A;  4C98 A;  2A0F B;  4OHX A;  4QWC A;  1F2H A;  4B9V A;  1AFI A;  1HBU B;  2KI2 A;  1VQS A;  2QE5 A;  3M8Z A;  5A8K A;  7FD1 A;  1FNM A;  3LP0 B;  1JKH A;  2BW7 A;  3E01 A;  3FGV A;  1LWX A;  3QLH A;  3V4M A;  5IWA J;  1NJI T;  5KFD A;  2YKA A;  3O8W A;  2KKH A;  3OR2 A;  4IG0 B;  2X1G A;  2HVE A;  2IDL A;  1N34 F;  1IR2 A;  1YJU A;  2HFN A;  1QSL A;  1YJW S;  3BR8 A;  4L75 A;  2KHC A;  3KK3 A;  1QTN B;  2MKH A;  3ET6 B;  2UUB J;  3V81 B;  1FXL A;  1JQG A;  4QR0 A;  2DNO A;  1YLX A;  2J0S D;  4ED5 A;  2E1A A;  4NA3 A;  2G1D A;  2EFV A;  1NKB A;  1T8E A;  2KL8 A;  4ZP6 A;  5KFE A;  2RDJ A;  2V2K A;  1HPZ A;  5C25 A;  1Q78 A;  3ZZT A;  1CJV A;  3QAU A;  2DNR A;  3DHX A;  4F0H A;  1V5I B;  2CQH A;  3D1O A;  4F3M A;  2HIQ A;  4A47 A;  4OLO A;  1UEV A;  2WBM A;  2ZBC A;  4RKU C;  1KNZ A;  4L73 A;  1JK9 B;  1TL4 A;  1B7Y B;  2C2Z B;  3D6F B;  3K8V A;  2YKM B;  3MEE A;  4M5K A;  2OML A;  1EKR A;  2QRR A;  1QAI A;  4DJB A;  2OIH A;  2CG4 A;  1SVD A;  3CJQ A;  3KMQ A;  4NAS A;  3FZB A;  2BX6 A;  3MEC A;  4ZS6 A;  2IC3 B;  1RHQ B;  5C5J A;  3L3C A;  1Y0H A;  3BGR B;  2C2E A;  4K4U A;  3LAL A;  1MNE A;  3W5X A;  2J7K A;  4DR2 F;  1XMQ J;  2XS5 A;  4K2J A;  3R6L B;  3QPI A;  2D9O A;  3TRG A;  4Q5V A;  2RJZ A;  1B0P A;  1FKO B;  2VDH A;  3D6H B;  3UD5 A;  5HVH A;  1M1H A;  2BE2 B;  2F8H A;  2GO9 A;  1MMD A;  2M0G B;  3DGV A;  1NND A;  2R7W A;  5LMU J;  2V4R A;  1DQA A;  3AH6 A;  5KFS A;  4ZCI A;  5KFB A;  4F50 A;  4B3R J;  1HWI A;  2AV5 A;  3K57 A;  2DNK A;  1JLE A;  4YN3 B;  2XCA A;  3US5 A;  3GIJ A;  4WP3 A;  1HHQ A;  3RR8 A;  1NCL A;  1T9Y A;  2AF6 A;  2B6A A;  3LAM A;  4WXO A;  1RAO A;  2VL1 A;  1VCT A;  5CYJ A;  2ZD1 A;  1WF0 A;  5M2U A;  2W9B B;  1PJ6 A;  4MYU A;  5T7L B;  4LF4 J;  1REV A;  2K2P A;  1R89 A;  4C8N A;  1LWC B;  3T41 A;  4AL7 A;  4DS4 A;  2XY6 A;  1IKW A;  1U02 A;  3PYE A;  2PO4 A;  1LEO A;  4LFB F;  2ZKU A;  4EU0 A;  2L41 A;  1XEZ A;  1NSP A;  1B0V A;  4U96 A;  4DL7 A;  3T6J A;  3ZZ0 A;  1UKU A;  2GV1 A;  4RU2 A;  3IGN A;  2CFX A;  2JLG A;  3DLL Q;  5DZ6 A;  4K4W A;  5IQ6 A;  2DKO B;  1WF2 A;  2XZW A;  4J9U E;  1R8P A;  3T6B A;  1FE0 A;  3NCP A;  4NYO A;  4MT1 A;  1A0O B;  5ETV A;  1Q5Y A;  2PC6 A;  1X4B A;  2Z2Z A;  4L76 A;  2HIY A;  2DHH A;  3J7A 1;  1ZH5 A;  3RB0 A;  1YG0 A;  1WEY A;  4LT6 A;  5IM0 A;  1RYR A;  5LL6 d;  4NI2 A;  5ITH A;  2FHO B;  2W2N P;  1SQE A;  4FYW B;  1SL0 A;  1WDT A;  2WK4 A;  5LMN F;  5EGY A;  1F2G A;  3FEY B;  2MJN A;  2RIL A;  5KFU A;  2DH8 A;  2ZH5 A;  4EZ9 A;  4FDF A;  2P6T A;  4MMO A;  1AXQ A;  3LPY A;  2OTL S;  3CJS A;  3BSN A;  4ECQ A;  2KVI A;  1U6B A;  2BAB A;  3UW1 A;  1N36 J;  3RBE A;  3I9V 9;  2VB6 A;  2VIH A;  1UFL A;  4UQG A;  4WII A;  3W9H A;  2R7R A;  2XMV A;  4NLD A;  3SCI E;  3GCX P;  2YNG B;  1APS A;  2H5J B;  2MKK A;  1M5O C;  4ILL A;  5IM0 B;  4ZLL A;  2DGX A;  3VVU A;  1OY9 A;  1H72 C;  3RYL A;  3LO3 A;  4Q0B A;  2R8J A;  1QTM A;  4WZM A;  3R5J B;  1JLB A;  4ZVR B;  1EAY C;  2ZH9 A;  5AE2 A;  5I3U A;  5LJ5 Y;  2ZJR Q;  2VG5 A;  4JI0 J;  3R5G A;  4O23 A;  1HKA A;  2VOD A;  3EZU A;  4Y2C A;  3ILJ A;  1OY6 A;  2KM8 B;  3GON A;  2J0Q D;  5SZT A;  2HVD A;  2QL5 B;  3C6T B;  2IRX A;  4JV5 F;  3EPG A;  1S0O A;  1TL7 A;  3CCZ A;  3RAX A;  1S9F A;  4PG4 A;  2MZR A;  3GCW P;  5HJX A;  2F9D A;  4PXE A;  3VCD A;  2GA7 A;  2ZH4 A;  2VQE J;  2OHD A;  5D77 A;  2J0X A;  2QA4 G;  3R97 A;  1ZZN A;  1PBA A;  2IRU A;  4DI6 A;  2I0X A;  2Q6C A;  2Z2L A;  1T95 A;  3MHY A;  4KFB B;  2JEJ A;  1TV6 A;  4WFX A;  1K73 T;  4WFN Q;  4N77 A;  3TQE A;  1VR6 A;  2BV3 A;  5A8R B;  3TAP A;  3EUN A;  1LNQ A;  3JYT A;  1OYD A;  6FD1 A;  4EMD A;  1IM6 A;  1B70 B;  2Q79 A;  1HQU B;  5H9F J;  2E1C A;  5HAO A;  4PYA A;  1KRP A;  1KVK A;  4P71 A;  3Q8P B;  3CXC R;  3PEJ A;  1Y3K A;  4DZD A;  4ZP9 A;  2FTR A;  5F8M A;  3KK3 B;  4QR2 A;  5ETL A;  2WSE C;  4XDD A;  4NRT A;  4JI8 J;  3AD9 C;  3BBF A;  3G82 A;  4ZDN A;  4DLG A;  2Y8W A;  2JFD A;  3GYN A;  1E6V A;  1GAO A;  4RUB A;  5ETM A;  5A8W A;  4WP8 A;  4DR1 J;  2FLO A;  3BBB A;  1N5V A;  5A8K B;  5HSP A;  1VQO S;  2VPZ B;  1XMO F;  3DOM A;  2P8I A;  3GIL A;  1HBO B;  4XPC A;  1H2T Z;  1K0V A;  1F9F A;  1MN9 A;  1DTT B;  1GXU A;  2E1R A;  4X62 J;  3FBB A;  2L9N A;  1XWL A;  2M2B A;  2XMU A;  5I42 B;  5C7P A;  4O0N A;  1U8W A;  1TK5 A;  1KD1 T;  5KFH A;  1G3O A;  1VC6 A;  2J5A A;  3W5Y A;  2ZZN A;  3DLK A;  1FFS B;  2KRR A;  2LU1 A;  1E6Y B;  2WON A;  1NK6 A;  2E1M C;  3V81 A;  3QO9 B;  1D9D A;  1VBK A;  4J5O A;  2BZ2 A;  2YKQ A;  2ACM A;  2MZQ A;  1VI7 A;  4KFB A;  4YHH F;  4DUY J;  4AQY J;  4JI4 F;  3MED B;  1FJG J;  1GFW B;  3ICL A;  3SDE A;  2FZC B;  1BWE A;  3DDI A;  2H1Y A;  2M4M A;  4CT8 A;  4DXL A;  3LP1 A;  4ZP7 A;  2YWF A;  1RWU A;  3M8Q B;  3EWG A;  3MCO A;  4F4Z A;  2W7A A;  3TAR A;  2GX8 A;  1DJ0 A;  4ZVU B;  2W8K A;  4Q8F A;  4Y2K A;  1VFJ A;  4USK A;  3T1H F;  3MM8 A;  1WOR A;  2VF3 A;  1YSJ A;  1VQ7 S;  3TP2 A;  3GIM A;  1PC5 A;  4DZ6 A;  1F0X A;  2HUR A;  3RRH A;  1FJ7 A;  2PA8 D;  4E2F B;  2KT5 A;  2XY7 A;  1UVL A;  3G82 B;  2BMB A;  4DUZ F;  1FKA F;  4MK7 A;  2G0I A;  4GRS A;  3KLF A;  2B0G A;  4RNO A;  4BBY A;  2O3D A;  2EBG A;  5B08 A;  3GIK A;  2F4V F;  2C2N A;  4M8L A;  4ES1 A;  4QPX A;  4DV4 J;  2YNF A;  4E98 A;  1UP1 A;  1C0T A;  3FKB A;  5IT0 A;  4U6P A;  1UWA A;  4ZK7 M;  3MMJ A;  3D6T B;  2RU3 A;  2OEM A;  1NB7 A;  4RUC A;  3SBM A;  3UNG C;  2E29 A;  3BQ1 A;  1X4A A;  3QFW A;  4F02 A;  1HI8 A;  4QIE A;  4R8U B;  5HAN A;  5JVG Q;  2CPI A;  5DJB A;  1RTI B;  3A8E A;  4U67 Q;  2VA3 A;  4DQI A;  4ENO A;  2AQ4 A;  1RAB B;  4J7C A;  4EZ6 A;  1XNQ F;  1IBC B;  2JNJ A;  3BGR A;  4GKK J;  5GAD I;  1N5Y B;  3HT0 A;  2CPX A;  5AJ3 F;  1ITP A;  4EEY A;  3CE8 A;  3PFO A;  3PVX A;  1HNZ F;  1RLC L;  1S76 D;  1WOO A;  3LP0 A;  1VMB A;  2ZBR A;  2HNZ B;  4WPA A;  4V19 J;  5DO2 A;  3G96 A;  2PMH A;  3DDK A;  5F9N A;  3CDA A;  2QEX S;  3TVZ A;  1CS4 B;  1UEK A;  2NXN A;  3EVO A;  3T1Y F;  4JV5 J;  2H48 B;  1HQE A;  3K59 A;  2R8K A;  4FP9 A;  3JQK A;  1YHQ S;  2ADB A;  3MPV A;  2ZD1 B;  1UJ6 A;  5E33 A;  4ZVP B;  3VZI A;  1ZTW A;  3U1L A;  4ZPA A;  2UXD F;  4UST A;  1HBM B;  2RQK A;  2AKW B;  2R8I A;  2XMT A;  3BGU A;  3BDP A;  4ICL A;  4OHZ A;  2RUG A;  5EWE A;  2NUH A;  1CJK B;  4CLW A;  1ZOT A;  2KT2 A;  4NLG A;  1G1X A;  4KR0 B;  4G1Q B;  1S1X B;  2NXC A;  2XB2 D;  2WBR A;  2B43 A;  3ISN D;  3N5B A;  1IKV A;  1VK8 A;  3MUM P;  1VRT A;  4KB7 A;  1K8A T;  2HHX A;  1R8A A;  1TL7 B;  1EP4 B;  1D8Y A;  3MCN A;  2JVR A;  1DHM A;  2E5H A;  4Y3C A;  2CQ3 A;  3GQC A;  4GC7 A;  1YIJ S;  1I51 B;  3OTB A;  4DR5 J;  2VC0 A;  1NK7 A;  2DIU A;  2PFF B;  3GR1 A;  1RHJ B;  4TLQ A;  3HO1 A;  3GYX B;  2PEB A;  3MEK A;  5BJR A;  4CIO A;  3P6Y C;  5J1E B;  4PQU B;  3SFU A;  4CLU A;  3GII A;  3MPD A;  4KPC A;  2HNZ A;  1S1W A;  2VBY A;  1SKU B;  1WOP A;  2ZVS A;  1DLO A;  4DR7 F;  4ED6 A;  4B3S F;  4DSJ A;  4LBH A;  3EX7 B;  1S0M A;  1ROF A;  3L95 X;  2W01 A;  3MOJ B;  1X5P A;  3CGI A;  1Q8I A;  5KOX A;  2MZT A;  1SC4 B;  3EVM A;  3W65 A;  3OXG A;  2UUW A;  2ZH8 A;  3H0P A;  3E2E A;  4A8F A;  1BQM B;  3UCU P;  1RT6 B;  2FVP A;  2NLW A;  4HHJ A;  2CKW A;  3GFX A;  4PXB A;  1N6Q A;  3VF0 B;  2XGP A;  4WYW A;  3VWS A;  3CCV S;  1SV5 A;  1PAE X;  4LSN A;  5J2P B;  2RE1 A;  2CQD A;  2GML A;  1D3W A;  4DDF A;  4DG1 B;  3SZ2 A;  2HHP A;  1NH7 A;  1QE1 A;  1RBA A;  1FWL A;  1WC3 A;  3DRP A;  4X4Q A;  3HVA A;  1CJK A;  3K5P A;  1IQT A;  1BE4 A;  3T19 A;  3OR2 B;  4Y00 A;  1S12 A;  4J9M A;  4RUH A;  4F4W A;  4XDC A;  1OJ4 A;  1Z1Z A;  2JZ5 A;  2E5I A;  2VU5 A;  3GFY A;  4ES3 A;  2RQC A;  2ACY A;  2NSB A;  2RRB A;  3A3N B;  2WW8 A;  3EXY A;  3QIP A;  2W4D A;  5E3C A;  4MFB B;  3CUN A;  2MZ1 A;  3PRD A;  3LWM A;  1WEZ A;  3AJD A;  1HQ2 A;  2HEK A;  3ZZU A;  5E5N A;  1XMQ F;  2CYY A;  4DPO A;  1PIE A;  2P9G A;  4QU6 A;  2ZZM A;  1Q53 A;  2WOM B;  2CIM A;  2ZEJ A;  5D0H A;  3DRP B;  3D9B A;  3OXL A;  3MED A;  2A1B A;  4OX6 A;  4LRF A;  2IJF A;  2ROG A;  4I64 A;  4URQ U;  4AYB D;  5FLX U;  2HND A;  2F7V A;  1KDN A;  1R6V A;  4DOZ A;  5JXS A;  5B7W A;  3THT A;  2F4V J;  4ANC A;  1UCN A;  2OD6 A;  3D28 A;  3BSC A;  3KNG A;  3M1V B;  3MMC A;  4NLV A;  4ZVS B;  5GMK a;  3N6N A;  3M8S A;  3MOZ A;  1ICE B;  3DLH A;  1NH8 A;  1NDP A;  1IJE B;  3CCT A;  4ZCL A;  5DZ7 A;  5J1P A;  1RAD B;  4K4T A;  3PX4 A;  2KZM A;  2U1A A;  2YX4 A;  3IR5 B;  4BC7 A;  1U0H A;  5GAE U;  1VYA A;  4PXD A;  1S6P B;  3S6E A;  3TNV A;  5B0B A;  3DOM B;  1VGY A;  2VJV A;  1JB0 C;  3VTI A;  3GU0 A;  2DNY A;  1T7P A;  3NBP A;  2QIF A;  1IBM F;  1B3T A;  2X3D A;  4LBP A;  3LP2 A;  1RHU B;  4HL9 A;  4B3M F;  1WHW A;  3UCG A;  4C0O C;  4DCO B;  3KK1 B;  1PAU B;  4ZN1 A;  2V6A A;  3L7O A;  1SJ4 P;  1K44 A;  2HNY A;  2MGZ A;  2VQF J;  1JLE B;  1KLM B;  1MWZ A;  1RTJ B;  1ZAX A;  1KFD A;  3DOL B;  3UD4 P;  3BO3 A;  3MD1 A;  4RL1 A;  1SUQ A;  1X7V A;  4P2S A;  2XLJ A;  5DGB A;  1YRX A;  1WOS A;  4PZV A;  5KFV A;  1X9W A;  1N5T A;  4DV2 J;  1T3N A;  2GAG C;  2DGU A;  1RT5 A;  3MZI A;  4WE1 A;  3SSS A;  2P6S A;  4HTJ A;  3VR1 A;  2ILY A;  5KFY A;  2PT0 A;  2VG7 B;  3PYD A;  5LSO A;  5B09 A;  3CD7 A;  3MR3 A;  3GV8 B;  1S0V A;  4EO8 A;  2GMH A;  4IFV B;  1EQM A;  3PV8 A;  1HW8 A;  3PRV A;  4KH1 B;  1RHR B;  1KKH A;  1Y9O A;  2J0W A;  2LEC A;  1G6B A;  2HGN A;  2DIS A;  5HJY A;  4LMZ A;  4LRB A;  2DIT A;  2L08 A;  4RW8 A;  4L6V 3;  4F67 A;  3N6M A;  2ZM6 J;  3FBC A;  2HBY B;  1RIS A;  1NJX A;  2N4C A;  4HAC B;  3C2P A;  2MPU A;  3BYP A;  1RAH B;  5E0O A;  5HQL A;  2PD1 A;  2ZNZ A;  3M8R A;  2DEI A;  1K47 A;  1NEE A;  2ZKT A;  2APO A;  3K58 A;  1H98 A;  5K5M A;  2RDD A;  1S1T A;  5CYM A;  4NE9 C;  4DS5 A;  1C2P A;  4USW A;  1HNW F;  1LWC A;  1IWG A;  5ETR A;  1N52 B;  2XSJ A;  2POK A;  4V1A k;  3BN4 A;  3HM9 A;  4F4Y A;  2OEJ A;  1HI0 P;  1PJ7 A;  4Y34 A;  1VQM S;  4AXI A;  4CNY A;  5CYQ B;  2OTJ S;  4ED8 A;  2DGS A;  5CQG A;  4D3H A;  2HBR B;  3JS9 A;  4OX9 F;  4RUA A;  1X0F A;  4B9T A;  1U2C A;  2CNN B;  2MQ8 A;  2KVQ E;  4X4V A;  4OYX A;  3GSI A;  3SQG A;  1C0T B;  3AA9 A;  4LF2 A;  4EFA C;  2VIC A;  1KN6 A;  2WON B;  1WTB A;  1RKI A;  2BJE A;  1ZA2 B;  4JI6 J;  2KXH A;  4CYU B;  1ACM B;  1S9E B;  1AB8 A;  1S7H A;  2YTC A;  4LRA A;  1DZ5 A;  2J8S A;  3CB4 A;  1Q4R A;  1YKW A;  2A2D A;  1DAX A;  2E7V A;  2OGU A;  4Z37 A;  2WSC C;  5EDW A;  4OHY A;  2FJD B;  3W2V A;  4NXN F;  3SDE B;  3Q8Y A;  4C8L A;  1NKC A;  1GH8 A;  1DLO B;  3BH7 B;  1KBR A;  4RX6 A;  4PWD B;  4WP9 A;  2E66 A;  5IXU A;  4JBC A;  1BQN B;  1LXN A;  1RDR A;  2CPH A;  2H5E A;  1UFW A;  3R7S B;  2ZE2 A;  2FIU A;  5GAG U;  4DV6 F;  2CJK A;  2K1R A;  4TY8 B;  2I9S A;  3MUR P;  1MW7 A;  2HQI A;  2W1B A;  3DI6 B;  3MM7 B;  4F7V A;  3M8W A;  2R9L A;  2MB0 B;  3HMJ G;  5F8J A;  4I2P B;  1U25 A;  4NML A;  5D0R A;  1JXV A;  5GAD U;  2K3I A;  3NG8 A;  2VFU A;  2LDI A;  3U02 A;  3PIP Q;  2G0J A;  3K8W A;  3W60 A;  5C25 B;  4IDK A;  3KHG A;  5DG7 A;  2WCX A;  2FHJ A;  4ID8 A;  1WC1 A;  3TEH B;  4X4N A;  3HF5 A;  1GT8 A;  3GJQ B;  3K5L A;  2DO0 A;  2VFT A;  4X66 J;  1RLD A;  5ETN A;  1N34 J;  1S49 A;  1NBE B;  2UU9 F;  1IUJ A;  3MPU B;  3N01 A;  4DV7 F;  4HDG A;  3HT3 A;  2X51 A;  6AT1 B;  5DQI A;  3BM7 A;  2BE7 D;  1HW9 A;  2V68 A;  4Q45 A;  1FKP B;  2GQ2 A;  3PJW A;  4M1K A;  3FUY A;  2LQ9 A;  1GEH A;  3OLA A;  3MR2 A;  2I6W A;  1ZPV A;  4LRC A;  4WK3 A;  2ZHA A;  4DV6 J;  1TKT A;  1D0E A;  4K4V A;  3D4J A;  2DXF A;  4DV5 J;  2XSF A;  3MFI A;  3DLE A;  2RDI A;  1Q79 A;  1Y00 A;  3TAQ A;  2OKQ A;  1S6Q B;  2HS4 A;  1C0U B;  1HBO A;  1Q16 B;  1T9W A;  2ZBP A;  1SH0 A;  2CZ9 A;  1V6H A;  5A76 A;  1LFW A;  2D7S A;  1HMV A;  1QUV A;  1W26 A;  2GVZ A;  3GZ7 A;  1U45 A;  2J6U A;  1RUS A;  2K3K A;  1JLG B;  3D68 A;  3FCW A;  4ECU A;  4JV0 A;  4TY8 A;  1NUE A;  4A8S A;  4KO0 A;  2V4J B;  3DYA A;  3JSB A;  2MQO A;  1KWM A;  2ZWO A;  3C46 A;  4DBQ A;  1N5Y A;  3OT9 A;  2V8D A;  2YXL A;  3MR7 A;  2B3T B;  3OVA A;  4IRD A;  4I56 A;  4GKJ F;  2IBK A;  3HFZ B;  3NAI A;  1HNV A;  3UR3 C;  4K7Q A;  5L1I A;  5D3G A;  2IM2 A;  3OD2 A;  4KV8 A;  3MR5 A;  1U2R A;  4LBI A;  4I2Q A;  1ZM2 A;  4B3R F;  3DLG A;  4I1T A;  4TKT A;  4WYL A;  3PJX A;  4OZJ A;  2ASD A;  4Y0F A;  3RW6 A;  3NXZ A;  1KLM A;  2LCW A;  3UVJ B;  2LA6 A;  1J5E J;  2AEJ A;  2JC1 A;  1KTV A;  2VG6 A;  4O4G B;  3J81 U;  1LKZ A;  2R7O A;  3O6Q A;  4U8Y A;  2BRL A;  3BO4 A;  1RHM B;  3DLK B;  2BRK A;  2MEW A;  2QYC A;  1R43 A;  3UN3 A;  2H5I B;  3Q22 A;  3OJS A;  3WHI A;  2RH3 A;  5DET A;  1WF1 A;  2PN6 A;  4CH1 A;  2XTJ P;  4FYY B;  4RW6 B;  3EJM A;  3IA0 A;  2JEG A;  1UVK A;  4W92 B;  3NLC A;  1FXD A;  5GME A;  4P9S A;  1JLQ B;  3BKU A;  4RU9 A;  3J80 Y;  4ED2 A;  2UXD J;  2N3O A;  1UVN A;  2FZG B;  1IKV B;  3AOA A;  3M8Q A;  1JWW A;  4ATN A;  2N4D A;  4QOT A;  3F0N A;  1AUS L;  2J8A A;  3AOB A;  4FVC A;  4BS2 A;  4I6Y A;  3TZW A;  1FRL A;  1JXE A;  1NME B;  3RGI A;  2LQ8 A;  2PMZ D;  5HLF B;  5IS2 A;  1VHF A;  2FVQ A;  1MWY A;  3QJJ A;  2MKY A;  2ZM6 F;  2CQC A;  3LOU A;  4URG A;  1RSC A;  4CP5 A;  1TEL A;  1RT7 B;  2QL9 B;  2AX1 A;  4F4X A;  3A3P B;  1X4H A;  1JJ4 A;  4ALZ A;  1LXJ A;  1FRM A;  1V3Z A;  2GJ2 A;  1OIA A;  1KTQ A;  1VIO A;  4KV8 B;  2V2V A;  4NYP A;  1FCA A;  1WG4 A;  5E41 A;  1WTF A;  1S6O A;  4J90 A;  3UN2 A;  5KAK A;  3A8I A;  1BXN A;  4QWE A;  1VQK S;  3UE2 A;  4KGV B;  3DXB A;  3D3B J;  2Y0B B;  3ZTS A;  4JI5 J;  3DLJ A;  4G1I A;  2DNQ A;  2EK6 A;  3AXM A;  4X65 F;  2FLP A;  2DB1 A;  4CYU A;  3EM1 A;  4C8O A;  2C2K B;  2QG9 B;  3AOD A;  3CIM A;  2M5Y A;  5LJ3 Y;  3ULH A;  4C7Q A;  4B9N A;  2RB7 A;  2YBV A;  2EVZ A;  1EB0 A;  3GFH A;  1NHU A;  3O1L A;  4H4O B;  1GMU A;  5L9X A;  4DG1 A;  3FNN A;  1TKZ B;  3K0J A;  5K14 A;  1CJV B;  4OHV A;  1SC1 B;  3FEZ A;  2VPW B;  3IWL A;  2C22 A;  1NDL A;  1CJU B;  4NLP A;  4DX6 A;  2WRM A;  3KLG A;  1WKK A;  3H4B A;  4DR3 F;  1VQL S;  4NCG A;  3FC9 A;  3DRS B;  2EFG A;  3GWC A;  1JJH A;  4FXV A;  4R8U A;  2F8M A;  3DU5 A;  4CO0 A;  3K17 A;  4DN0 A;  3EPI A;  4DX7 A;  4GO7 X;  1XTZ A;  2OMO A;  1YIT S;  3JB9 k;  5D15 A;  1S79 A;  2MZJ A;  2ZBQ A;  2WHO A;  3SQG B;  4Z7C A;  4DV0 J;  1L3T A;  2ASY A;  2IDE A;  2RAQ A;  5U47 A;  4IRC A;  3QJP A;  4B3M J;  1L3V A;  5A8W B;  4YFU A;  4DV3 J;  2EW9 A;  5J1N A;  5HQ8 A;  1YDL A;  2BAN B;  4DFJ A;  3T1Y J;  2XZD B;  4TYA A;  3WC0 A;  5CXT A;  2XS7 A;  3M8Y A;  3PDN A;  3IM9 A;  4E8U A;  4B3O A;  3JSM B;  3W61 A;  3MI7 X;  1U2F A;  2CJY B;  2QA2 A;  3PXG a;  2YKO A;  2G2Z A;  3CCJ S;  4J9S A;  2LVW A;  4D3G A;  3WDO A;  1H7X A;  2HRT A;  3JTN A;  1OPI A;  3I87 A;  1A7G E;  4OI1 A;  3BQ0 A;  4FS2 A;  2XI3 A;  2EG1 A;  3ILL A;  5AXK A;  1SJQ A;  5A0Y B;  3NS5 A;  1RT2 A;  1Q8L A;  2BAN A;  2M9K A;  2CAD A;  3G87 A;  3I4H X;  1SC6 A;  2COL A;  4RW9 A;  4USI A;  4ZIV A;  3M8P B;  1JKH B;  3QLH B;  4DV5 F;  4HH1 A;  3CF5 Q;  4EYH B;  2OPR A;  2OFH X;  3FZ2 A;  4U7U D;  1TR0 A;  2M7S A;  1MMN A;  1YJN S;  1TAU A;  3EGZ A;  2KXN B;  1WG5 A;  3FCV A;  4JI5 F;  3BR9 A;  2KB2 A;  3GMG A;  5JVH Q;  3DMJ A;  1LK7 A;  3KLE A;  3H5S A;  4UF4 A;  1SKW A;  1M0S A;  2V5H G;  1YQH A;  1QJH A;  1IBM J;  2XGQ A;  4QW9 A;  5B0F A;  3DM2 A;  5FDL B;  1S97 A;  4LFB J;  4N76 A;  2BJ8 A;  3P8B B;  4DV4 F;  1ZBT A;  1V3S A;  2A2C A;  3M8P A;  2YKN A;  1OY8 A;  1SQF A;  3HHL D;  1X0P A;  3ITH B;  4KBI A;  4Y2M A;  4TY9 A;  4YS2 A;  2PSZ A;  1M5V C;  1AYE A;  3MM9 B;  1JNR B;  4OI2 A;  3LWL A;  2B7B B;  3H7H B;  4CTA B;  4HDH A;  2IIH A;  2DYA A;  3D66 A;  3QRP A;  4F4K A;  2GHP A;  1FK9 A;  2C1E B;  2YVS A;  4E0D A;  3OV7 A;  4RJV A;  3DGP A;  1AW0 A;  4N7T A;  1U49 A;  1L3U A;  4MFB A;  2BW2 A;  4FNI A;  1WI8 A;  4OJH A;  3CIZ A;  4MIA A;  2FVC A;  1R8C A;  4F04 B;  4CO1 A;  3DRR B;  1H2V Z;  2IC3 A;  1N33 F;  4ITS A;  4ECY A;  3HHK A;  1VDH A;  1TMJ A;  3BSO A;  1R7I A;  5A6W A;  4X2B A;  4A8Q A;  1XIQ A;  1MN7 A;  5LT5 A;  5I3U B;  2W25 A;  3MM9 A;  5C42 A;  5EHH A;  1XNQ J;  1KVI A;  1PSD A;  1XBW A;  1S7I A;  1V5V A;  3R5C A;  4IQM A;  4JB8 B;  5AJ3 J;  3T5H A;  4ZCK A;  2R2S A;  1TL1 B;  1RWO B;  3CCQ S;  1D9F A;  1F5B A;  2EKN A;  4G3I A;  4ZPW R;  2UP1 A;  5BYS A;  2C3O A;  3CSK A;  3DMJ B;  3DRR A;  4LVO P;  2AZ3 A;  4FKY A;  5HI7 A;  2CJX B;  5DDR C;  2NXJ A;  1KVJ A;  3VZH A;  2FVS A;  1C1B A;  2HWH A;  1NJW A;  4X4S A;  4B9U A;  1JLC A;  1F9E B;  2QX0 A;  1ZET A;  1XR7 A;  3TA1 A;  3QT6 A;  4WFZ A;  4ZJO A;  3IBC B;  3WX4 A;  2DNN A;  2F63 A;  1VIS A;  4AD6 A;  3CJ3 A;  3VAM A;  3LP2 B;  3HHE A;  3AAW B;  1FRJ A;  5ETT A;  1HR0 J;  3MAQ A;  2F1F A;  2X3G A;  4OMF G;  2CPE A;  1FJE B;  2VKR A;  1BQN A;  4MKA A;  2NPF A;  2AHO B;  2B9E A;  5GAH I;  2E7X A;  4ECZ A;  4FN5 A;  1XMB A;  2FHM A;  1UVJ A;  2VOO A;  4AE5 A;  3QAT A;  3M6U A;  1LW2 A;  1YVF A;  2L3M A;  4P2X A;  2R7X A;  3ETM A;  2J6S A;  3WIU A;  2IRY A;  2IYG A;  3QYY A;  2XMA A;  5L46 A;  4IOB A;  3SSR A;  3M6V A;  4QPT A;  3QGG A;  1FTC A;  4LVN P;  5EUH A;  2HPU A;  2RF2 B;  4LF6 F;  4NLY A;  5JMN A;  2FHJ D;  4M5H A;  2JEF A;  1Y4Z B;  4YUD A;  5E3R A;  3KK1 A;  1VC5 A;  2Q43 A;  2YNF B;  1YGY A;  5D4L A;  5I42 A;  2G2Y A;  3J7A N;  4ELT A;  4DSE A;  4F3Q A;  1JLF A;  2QMX A;  2F4F A;  2LQJ A;  3IP0 A;  1AZS A;  3D67 A;  4FYD A;  2GCF A;  2CJQ A;  4TXS A;  4NLO A;  4HI2 A;  4OX7 A;  1RTH B;  4CLS A;  5C2G A;  4TQR A;  3HXM A;  2D3O R;  1ZTT A;  1VQN S;  1WEL A;  3POT B;  3S7R A;  2DD8 S;  3QID A;  4N8O A;  3AA8 A;  3UPF A;  1OQ3 A;  4OYA A;  3HSZ A;  2XLI A;  4EBC A;  1SKR A;  4DV3 F;  4G6V B;  1WHY A;  1U1P A;  1BWV A;  2OLW A;  4IFV A;  1QSS A;  4PUO A;  1TKX B;  2XBP A;  4C6A A;  1S9G A;  4WFA Q;  2D41 A;  1HWL A;  2HVH A;  4BWJ A;  2QFI A;  1FA0 A;  1AZS B;  3R7B B;  2AD9 A;  1RT6 A;  2BE9 B;  2W24 A;  3UDE A;  4X4O A;  2MQM A;  2FJV A;  3K5O A;  2OD4 A;  2XYG B;  3ZXW A;  2EFO A;  1NZA A;  1YK9 A;  4FYX B;  2YWG A;  5A8R A;  5HVG A;  1S1T B;  2NS1 B;  3RB3 A;  1NU4 A;  2NZ4 A;  2HHW A;  2P2C B;  4NLS A;  4OI0 A;  3ENA A;  1CS4 A;  3J81 j;  1FF2 A;  2GZO A;  5HP1 A;  3BSA A;  1S0N A;  2BVZ A;  3V6D B;  4DL5 A;  1VJW A;  1TKX A;  5CAA A;  5L8R C;  4DL2 A;  3AOC A;  3I5B A;  4OYM A;  3CWJ A;  5KT2 A;  2MKI A;  3D6M B;  2XLK A;  2Y1L B;  4OLP A;  2GIQ A;  1X4D A;  2CVI A;  1IR0 A;  4NMX A;  4LSZ B;  5KFN A;  1S48 A;  4MH8 A;  4KYZ A;  4X4T A;  3KLH A;  3PKM A;  3W2W A;  3S1T A;  2M8H A;  3D1Q A;  3SCK E;  2Y1J A;  2XYP B;  3I5C A;  2MQL A;  2ZFH A;  1TU0 B;  2V63 A;  4UQT A;  4X84 A;  3EGW B;  2ZIT A;  2G1H A;  3TJ9 A;  1RAA B;  1QVF R;  4AND A;  4JI1 F;  3Q8Q B;  4Y2I A;  3E51 A;  3ZZO A;  3OQ2 A;  4G1Q A;  4YDD B;  3KUE A;  4CTA A;  4QWB A;  2C42 A;  3LGM A;  1X60 A;  4EBE A;  3R1L A;  1UA1 A;  2OPP B;  2BM0 A;  1Q86 T;  1T11 A;  2C2M B;  2V8H A;  4ZJQ A;  2OJ3 A;  2HZA A;  3OFE A;  3RRG A;  3SCL E;  4RBT A;  2GMJ A;  4X65 J;  1TUV A;  4DR1 F;  3CC2 S;  2UUC J;  1FKP A;  4CDI A;  1BD6 A;  5HMW A;  3SV3 A;  4FNH A;  4DF8 A;  5FD1 A;  3TQ1 A;  3NMA A;  4WU3 A;  1B4S A;  3MM7 A;  1OQ6 A;  2MMY A;  3ZO7 A;  3QZ8 A;  4KGZ B;  2EPI A;  3FMW A;  5ETP A;  4X62 F;  1UMJ A;  1S6U A;  4DCP B;  2G2O A;  3VQS A;  3OSN A;  2W9B A;  2BQU A;  5HL7 Q;  1D9A A;  4ID5 B;  4IO9 Q;  2YKP A;  4ER8 A;  1L3K A;  4HVZ A;  1HNX J;  4KHP J;  3OSP A;  3N5F A;  3OFG A;  2B4P A;  3ZTQ A;  3OTO F;  5C24 B;  2GHV C;  4DV2 F;  3C3L A;  2J9D E;  1FI4 A;  4YB7 A;  1F3V A;  2NPI A;  5HAT A;  4YR3 A;  1RBO B;  2HQD A;  4LRE A;  4C8Z A;  3CPW R;  2QTW A;  1G2E A;  1DY3 A;  1FRH A;  2O5D A;  2QMW A;  3J7Z 5;  4DFM A;  2V67 A;  3W66 A;  4ILM A;  3HVR A;  3IXQ A;  2GHW A;  3VV2 B;  1G7C B;  1NHK L;  4ZCM A;  5HBM B;  5H9F K;  4HT7 A;  2UXC J;  2V9W A;  5KFA A;  1C1B B;  5KFL A;  4XTT A;  1SV5 B;  1V3R A;  3BBC A;  4LSN B;  1YJV A;  3PHT A;  3Q89 A;  4DR5 F;  1FFG B;  4QR1 A;  3OTE A;  4ELU A;  3CJK B;  1TFW A;  2IBO A;  5FII A;  5KFW A;  1A6L A;  2OPS B;  3UR0 A;  5D4O A;  1NJZ A;  3KKF A;  2DNG A;  1LOU A;  1YBU A;  3GP9 A;  1GX6 A;  1GXL A;  2D9P A;  2IM3 A;  2GNK A;  3IS9 A;  3NY0 A;  4J9N A;  1FD8 A;  4YEA A;  4C8Y A;  5E7O B;  3BF4 A;  2CZ4 A;  2DPJ A;  2ALY B;  2DJW A;  4OZ5 A;  2UUA F;  1Q81 T;  2ZOM A;  1TTH B;  1SIZ A;  4W4M A;  2ZJP Q;  3HHN B;  4IUF A;  2CAJ A;  2PEH A;  3BDE A;  3DXS X;  4FPI A;  2V4J A;  3DYA B;  3LGH A;  5F8H A;  3RUB L;  1BMQ B;  4RR5 A;  1EZZ B;  2C2R A;  2N82 B;  1IVZ A;  1BQX A;  2JC0 A;  2OPS A;  3FFI B;  4C3M A;  1I1G A;  2LXF A;  1R8H A;  4R25 A;  1HBU A;  2NYH A;  2VBZ A;  4H54 A;  1JLQ A;  4CLT A;  2GGP B;  2RRN A;  4ZKA A;  4DSK A;  1CSJ A;  1S1W B;  3CD5 A;  1V9O A;  2PI4 A;  3UFC X;  2HAI A;  2OSQ A;  4FBT A;  4B3O B;  2W4P A;  3SIP B;  2AJ4 A;  4FPR A;  5DRK A;  4IG3 B;  4CCH A;  2D74 B;  1JIH A;  2DGW A;  3WZ0 A;  4IFY B;  4NL5 A;  1VLY A;  3B4D A;  3CME S;  2B5J B;  2QGF B;  5IFM A;  1MU2 A;  3HD2 A;  4M5I A; 
#chains in the Genus database with same CATH homology
 2LQ8 A;  4ZN3 A;  1M1G A;  1NPP A;  1M1H A;  1NZ8 A;  2OUG A;  3H7H B;  3QQC D;  3P8B B;  1NPR A;  2K06 A;  3EWG A;  2XHC A;  2EXU A;  4ZN1 A;  3LPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...