1NZ8A

Solution structure of the n-utilization substance g (nusg) n-terminal (ngn) domain from thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
119
Chain Sequence
SIEWYAVHTLVGQEEKAKANLEKRIKAFGLQDKIFQVLIPTEEVVELREGGKKEVVRKKLFPGYLFIQMDLGDEEEPNEAWEVVRGTPGITGFVGAGMRPVPLSPDEVRHILEVSGLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and sequence comparisons arising from the solution structure of the transcription elongation factor NusG from Thermus thermophilus
pubmed doi rcsb
molecule keywords TRANSCRIPTION ANTITERMINATION PROTEIN NUSG
molecule tags Transcription
source organism Thermus thermophilus
total genus 18
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02357 NusG Transcription termination factor nusG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1nz8A00
4ZN1A 2LQ8A 1M1GA 3H7HB 1NPRA 3LPEA 3QQCD 2OUGA 2K06A 3P8BB 1NZ8A 3EWGA 4ZN3A 2EXUA 1NPPA 2XHCA 1M1HA
chains in the Genus database with same CATH superfamily
1WG4A 1HBUA 3OL6A 3RBZA 4QIVA 3MI7X 1N6QA 3CD7A 1S10A 1JXEA 4ZVPB 3DXSX 1QTNB 4LMZA 4ES2A 1KFDA 3ILJA 1FFGB 4I1TA 4DR6F 2MQ8A 3SSSA 4JUZA 5ETSA 1HNXJ 4KO0B 2DO0A 4JI7F 1FKOB 3V6DB 1SIWB 3VCDA 4URSA 4ZVSB 2ATLA 1XC9A 3OTCA 2C2NA 2R7RA 3KOAA 3A3OB 4N76A 2DH7A 1C0TA 2OPRB 4RNHA 3G8TA 4C0HA 3KLIB 1IJEB 4Q44A 1FRIA 3HZEA 4KGKA 4XO0A 2OKQA 3H5XA 2AT1B 5ETQA 4QR1A 1LFWA 4JI2F 5EX0A 5KFUA 3RGIA 2BJ8A 2FJBB 2VA3A 2QL5B 4YB7A 1RCXB 1D9FA 2WB1D 4CH7A 1U1RA 2M8HA 1NEEA 3W5XA 4OV6A 2YQ0A 2YKNA 1PILA 1M5SA 2DCUB 2V63A 2VOOA 1DARA 4CZCA 3GR1A 1FA0A 3NY0A 5T7LA 3KMQA 4WWSA 2HZVA 4ATNA 2HFSA 4NLDA 4S0MA 1L3KA 3M8PB 3HJVA 5K20B 1ICEB 2KDOA 1KOHA 3KLHA 4CLPA 4EO8A 3F0NA 3CO0P 2EPIA 1HPZA 2LXUA 3LAMA 2ZOMA 2R9LA 2NYHA 1CQNA 1IKYA 1TL7A 1ROFA 4J7CA 2ASLA 4DR3F 4PKDB 4X64J 3EZOA 1HBUB 4UTGA 1SBRA 3VAHA 3D6FB 4CO0A 1UAWA 2LQ9A 2KJWA 2UU9F 2VDIA 4RLEA 1TL5A 2QSWA 4WKYA 2AV5A 5G4DA 1O8BA 1Z4UA 1IQZA 3MAQA 3PKYA 2NXEA 3OW2R 3PFEA 2BUNA 3DRPA 1S9GB 4E0DA 2R7SA 3PO4A 2YKOA 4ZN1A 2KTQA 5DZ7A 3NWGA 3I5AA 2YNIA 2XGQA 5HQ8A 1Q79A 1SL2A 1C0TB 1WG5A 3MOJB 1WJ9A 2IA6A 2XZWA 7AT1B 1N5YA 3HKWA 3KG4A 3PXGa 2MXYA 2ZC3A 2ZWPA 4C3LA 1C0UA 1N33F 3CCVS 2Q43A 4WP8A 2C22A 1UJ6A 4KGXB 1CULB 4GMKA 2UXDF 4ED0A 4C8LA 5B0DA 2NQPA 2GIRA 3HHEA 2FYXA 2YKNB 3BQ2A 2JEFA 2DBBA 4I7FA 3FZBA 4WCEQ 4ZKAA 4ECZA 1VBYA 1DQAA 4UOHA 2HQ3A 3T1HJ 2V8GA 4MK7A 2C42A 3FBCA 4X4TA 3D5MA 5KG5A 4X4SA 5HVGA 1GAOA 2FZGB 5HL7Q 3M9MB 5KFRA 3LGMA 3CUNA 1J5OA 1KN6A 3ONQA 4CI0B 2BQRA 2AGPA 2E29A 2J9CA 5D15A 4CP5A 2VOPA 3S01A 1ZPWX 1IBLF 2DHHA 1IKYB 1TL7B 3AOCA 2N7YA 2LEAA 2MSSA 2VBZA 4YHHJ 1NJIT 4OLOA 2AMCB 4JV5J 4PG5A 1G6BA 3VQSA 1PJ7A 2R8KA 2GC8A 4U96A 2VPWB 2R7QA 4OX9F 3T5KA 3K5PA 3EXYA 3TR5A 4CO2A 2SXLA 1Q95G 1RISA 4L76A 4NCBA 3DRPB 1FDNA 4YQWA 3DHXA 2E9ZA 3AT1B 4F4KA 5EWEA 2HSEB 3H4DA 4YR0A 4MYTA 3GCWP 2CJQA 1U0HB 4HDGA 1UVNA 2GA7A 2O01C 3R3TA 1OMSA 2BKPA 2IRYA 5KFQA 2EKNA 2O3DA 3OFGA 5E41A 1IWGA 1RHQB 1VQPS 3J81Y 1N5YB 1Q8BA 2Z0GA 4M5IA 1RT5A 1U48A 1U4BA 2YX4A 1WF1A 1WORA 5BYSA 4ZVUB 1GEHA 4LREA 4U6PA 2U1AA 1C0UB 2KZMA 3T5HA 3ILIA 4HT7A 2B4OA 4O3QA 4ZJLA 4B9NA 1YTYA 2PDAA 3UR0A 2JVOA 2DO4A 1VBKA 1NJZA 2DR7A 3BJYA 5F8MA 2ZITA 1SC4B 4I7FB 2W7OA 5J2MA 4U7UK 4Q43A 5JUMA 4FYYB 4M5LA 1CJUA 1ELOA 2B56A 1TKDA 5A8KA 3CWJA 4USMA 1ZBTA 3LP1A 3I55S 2VQEF 3OTOF 3LPEA 4TVAB 3WC2A 2B6AB 1IR2A 3D4JA 1WI8A 4ZPWR 1EKRA 5KFOA 2K8GA 2N4DA 1V5VA 2J0WA 1UTAA 1I94J 2CPXA 3M30A 3GIRA 4QBUA 5H9FJ 1BLUA 1WD6A 3TARA 1SH2A 4WK3A 2ROGA 3NCQA 2BABA 4N7TA 4X2BA 1MMDA 1X4FA 1TP7A 2MQNA 4HLBA 1Y4ZB 4DUYJ 3NS6A 3EWGA 3L4BC 4DPXA 3QIDA 3T3FA 4LFAF 2RUGA 3JB9k 3ILLA 2JC0A 3MMAA 2H5EA 4Y2AA 2JDJA 1HNVA 3BREA 3CMES 1GFWB 2LDIA 3DLLQ 1ZZFA 3MFIA 2JRSA 4DV6J 4ANCA 1OPZA 5JMNA 1YI2S 7FDRA 5L46A 4JI3F 3RB6A 1IBKF 4M95A 1NH8A 1B7FA 3H8YA 3NEKA 3L7PA 3MCSA 4OI4A 2OAUA 2NXCA 2QZ8A 3CNQP 3V6HA 1HHTP 1AB8A 3H5YA 3G4SS 1RT5B 4DWIA 5CZXA 1SUQA 2KHCA 3SQOP 2K7JA 1JKHA 3J7A1 3MPYA 1ZYQA 1ZM9A 1GMUA 4F4XA 2C3MA 1RCOB 4NCGA 4FVMA 1XR5A 4M5DA 2BE7D 5DQHA 4KSEB 2OJ3A 2Z2ZA 3QFWA 1Q8KA 1S79A 1RBOB 3TZWA 1F2GA 2WBMA 2HFUA 3D0GE 3NGUA 1I51B 3H98A 2YH1A 5J2MB 3N5FA 3D7SB 2MZ1A 3D3BJ 4WE1A 3TZXA 5A8KB 4J9MA 4QR0A 3GE9A 3LP1B 3OHAA 1RWPB 1RYSA 4HT5A 2KFNA 4TN2A 1FFWB 4WPAA 1WOPA 2VASA 1RTZA 3OPKA 5RUBA 2YX7A 4LF4F 1RU2A 1RLDA 2RRAA 1TK8A 3R27A 1FVQA 1S59A 2PN6A 2V9KA 1UEVA 3EPGA 2RDIA 2QLWA 3CJSA 4P74A 4ZLNA 1GX6A 1XMOJ 4WIIA 2DB1A 5AXLA 3FRYA 2XGPA 5K8OA 3C3LA 5F9LA 3HHLA 2P6SA 3A8JA 1FJGJ 3GWCA 4OJGA 4LRDA 2EK1A 3MMAB 1OWXA 1HNVB 2I6WA 2VA2A 5J1NA 2JEJA 4IRKA 1LWEB 1V3SA 1Q7YT 1UP1A 4KH0B 1WEYA 3AD9C 1MN9A 4NI2B 4NLTA 4LIRA 4MMOA 3NS7B 1H7XA 3W9HA 2FVRA 2JHEA 4U9RA 1SJ4P 2DNMA 3I82A 2BW2A 2CQ0A 4QYZK 2AIRB 2MZJA 2GJIA 3CDAA 3L7UA 4ERDA 1KQGB 1DJ0A 2COLA 2V69A 2LXFA 3PJXA 1SUQB 3RB3A 2GX8A 2R2TA 1JKHB 2VFVA 4ZDNA 4Y6IA 3S1TA 4NCGB 4M5DB 4ENOA 2HZCA 2OFGX 5DM7Q 5DGAA 1YRTA 2IRUA 3CD6S 2DXDA 3KHLA 4DHVA 2CPIA 4URQU 3HKZD 2QC3A 3EMTA 4WYLA 3T9NA 3J7YU 4WE1B 4YUDA 1C1CA 3IBWA 5CYMA 1UZDA 1WTBA 1U7LA 1P9YA 3DYAA 3P4UB 4ZPVR 5HK4A 1GX5A 4WBFA 4IOBA 5E5NA 5BR8J 3OBIA 3M2VA 1LWXA 4LFCF 1H3DA 3CMQA 3RW6A 4IQMA 5CCMA 2YKPA 5KFGA 2IM2A 4ED1A 2P5VA 2GZOA 4HR2A 3CSKA 3SYZA 1BGXT 2J7WA 2AW0A 3EZUA 1SQFA 1D8ZA 3HHLB 3W62A 1F9EB 3G96A 1MWQA 2VICA 1V3ZA 3W7BA 4OI3A 4FBTA 5F3ZA 4DSKA 1Q78A 3FCHA 4GVBA 1S97A 3US5A 4C11A 5C25A 1JLGA 5SUHA 4YDXA 2MKJA 3KG1A 3OV7A 3CCRS 4C97A 1UKUA 3KDNA 5KFEA 5KFIA 1GXUA 2V67A 2YNHB 3QSYB 3HPOA 1JK9B 4QU6A 4B3SF 5EDWA 1N4LA 5CYQB 3E2EA 4ZLLA 3NCRA 2IM1A 1RAGB 2B9WA 5KFFA 3HMJG 2RS8A 4LFBF 1MG7A 1FE0A 1RADB 2FVQA 3BN7A 5SZTA 3SXLA 5ETVA 1S1WA 1GMWA 1NMEB 3Q8UA 1ZZNA 2NCKL 3D2WA 2XSJA 5FLXY 3FJ2A 1U45A 4DFPA 2CIMA 5FJ4A 4OHWA 3KFWX 2G0JA 2DNPA 4MH8A 2ASJA 2CJAA 3T41A 4U8YA 2ZZTA 4DUZJ 1EKSA 5CH7B 3N6NA 4NYOA 1T3OA 3UDVA 5U47A 1T9XA 2R7XA 1VS3A 1XBWA 1VC5A 1C1CB 5DGBA 5CYMB 1EJ7L 4NWBA 3UN3A 2Y9HA 9ATCB 4A8SA 3DYAB 2FGCA 2K2PA 4DS4A 1EIYB 2RIJA 1HLWA 4HTJA 3MCOA 2HIQA 5AE2A 1D0EA 3KUEA 4ZVFA 4MK9A 2CJYB 2XI2A 4RW9B 1GNKA 3MCNA 1NZ8A 1RAFB 3TVYA 4OYOA 3SSQA 1URNA 4LF7F 2HQIA 5LSLA 1YIJS 1JQGA 3MR5A 3CJKA 3EVMA 5DLFA 2Q79A 5J1EA 2VG6B 4PPZA 4KKOA 2QMXA 4R8UA 4CYUA 4IFYA 1R0AA 4R0JA 4C11B 1JLGB 3U02A 1BE4A 1S4FA 4J9QA 5F0WA 1SJRA 2DNQA 1N5SA 3TI0A 2FY1A 2WHOA 3BYRA 3DI6A 2FC9A 3V6JA 4DEZA 2GO9A 4MIAA 3QIPB 4HHUA 2UVWA 4BHQA 1GMWD 1Q8LA 4PUOB 2XMAA 2OEJA 4A46A 1RT3A 1S1WB 3BO2A 3PEJA 4KC5A 5B08A 2ZH9A 1ZAVA 1YSJA 1YZ7A 4ZVHA 1NJYA 4F4YA 3R1HA 3KLGA 3CJRA 5DETA 5BYQA 2FLPA 3JS9A 4ECWA 1AYEA 1DY3A 4Z2XA 2M8DB 3ENWA 1N8RT 4B3TJ 2DHXA 1UEKA 1HI0P 2GQ2A 1YKWA 4DUTA 2OD4A 1FKAF 1SIZA 3JAMU 4N56A 4DV5J 4AQYJ 1T03B 1FKPA 2XO6A 2DGWA 4F0KA 3HK2A 3GIMA 3BYPA 2DNHA 1OYEA 1CJKB 1WOOA 4GVLA 3CCZA 3QLHB 5GAGI 1QAJA 5J2NB 3CDWA 2DTJA 2HNYA 5CZVA 5F8IA 1LK5A 1KVIA 1RI7A 2C2RA 2LQ5A 2DNRA 4B9TA 2B8PA 1M5PC 5HMWA 4RNOA 2VPXB 4MKVA 2CPHA 4WTOB 4ZPDA 1DFDA 2WW8A 1CEZA 4WU2A 1SB6A 3M1VA 4EEYA 5KFCA 4HI2A 1XEZA 1IUJA 3CJKB 1HW8A 2E44A 1JLFA 2K3IA 1UJ5A 4R8UB 1RLCL 4CYUB 2LEPA 5L1IA 3E01A 3CEDA 4IFYB 1R0AB 1RHJB 5DO2A 1NAQA 2P6TA 4K59A 1X5SA 1GTEA 2APOA 4QWBA 3CCWA 4USWA 1KHWA 2J6TA 1UFWA 4XPCA 3VAIA 3DI6B 2R8JA 4X4OA 3NNAA 4WFZA 2XY6A 2GVDA 2CAJA 3QT5A 3AOAA 4AL6A 3TEGA 2ZJRQ 1RU1A 4HVZA 3UN5A 1RT3B 4ZN3A 5JJBA 3P8BB 3ZC4A 2QFIA 4OHZA 4DLEA 1CJVB 2Y8YA 4YOEA 4EMDA 2KL8A 2ZWOA 4OYAA 2AGQA 1YX2A 3I0RB 4DV0J 1NJXA 2BR0A 2MJNA 1C2PA 4X62J 1ACMB 4ID8A 4YB6A 1T95A 1RHUB 2E7WA 3C16B 1KFSA 3DKDA 2V2ZA 1UVMA 4K4VA 3Q8YA 3HSJA 4LSNA 4ZPTR 2M2BA 3OQ2A 3VF0B 3Q8VA 2NXNA 1HMVA 3T6JA 1FKPB 1X4HA 4C0OC 4DR2F 1CLFA 3R6GB 4OX6A 3CJ2A 2XS5A 3WX4A 4RNNA 2ZH1A 5ETOA 2VONA 1PYOB 1SJQA 2DT9A 4CM0A 3GYNA 2B8QA 2HNYB 4XAKA 2L08A 2J8AA 4J9NA 1X8DA 1Q5YA 3JSBA 4DCJB 1VQNS 3C19A 1ULRA 4WFYA 1TAQA 5DG7A 1T05A 4ES1A 2ZH2A 4ED6A 3PM9A 5K14A 2HHXA 4QYRA 2XTJP 1GMVA 3JSYA 2NSCA 1KSPA 4RR5A 1SC1B 3JQMA 2XHCA 1RKJA 3E01B 1NK0A 3K5NA 2L48A 5ETPA 3BGLA 3PYEA 4L75A 4NLQA 5HI7A 3A3PB 2HQCA 3N4WA 1R3NA 3FBBA 2YKMA 1HD1A 3ITHA 3UFCX 3BEGB 4C9DA 2CJBA 4YS2A 2DGXA 4ZP8A 3BGUA 1G7CB 4HYKA 4PG4A 1W25A 3DLEA 1Q82T 4IDKB 3CD0A 2GVDB 4H4MA 2FHMA 2YTCA 2HHWA 1Y3JA 1YBTA 1WC6A 2IM3A 3MM6A 2NREA 2D41A 2BM0A 4K2XA 4B17A 3ETMA 4EI2A 1VRUA 2O1PA 3R6LB 1HFEL 3SZ2A 3IR6B 1KDNA 2RQMA 5B0GA 1TZ0A 2GHWA 5ETMA 3JTPA 2VG5A 3C6TA 3HHLC 3S7RA 1TTHB 3PW7A 2WVDA 2IM0A 3OVSA 5KFNA 4ZVEA 1LK7A 3DRSA 5IT9Y 2PT0A 2RRBA 3BQ0A 4W92B 2MYFA 2H1YA 1A9NB 3MTJA 1FHTA 3BB5A 3W9IA 3BSNA 4TKTA 4NMLA 3OR2A 3N5BA 2E1PA 4DCPB 4MTPA 5IWAJ 2POKA 2X1AA 3ZZRA 2PMZD 1TELA 3GFYA 3M9NB 1QTMA 3NGTA 2IA0A 3R2DJ 2DRDA 1HARA 4DR1J 2LMIA 2ACMA 3PRBA 5LJ5Y 4C8MA 4DN9A 2V2VA 3L7OA 1AUDA 2RVJA 3NAIA 2QFJA 2AWZA 1U6ZA 1GXLA 4RWXA 1WEXA 2MGZA 2OUGA 3G6XA 3NS5A 1VQ4S 2M7SA 1SXLA 2NPIA 1KS2A 4RBVA 2GMLA 2YKMB 1XMBA 3ITHB 1NM2A 2HS4A 4ECSA 1UWAA 2DY1A 1D9AA 2WSEC 3HT0A 2E1MC 4WU3A 4Z7CA 1NO8A 3DLEB 4V1Ak 5L39A 2VG7A 4YFUA 2WBRA 3DOLB 1YQHA 4P71A 2ABYA 3PYDA 1TL3A 3MM6B 2E5LJ 1X0FA 1VRUB 5HLFA 1AT1B 1P1LA 2GGPB 1YBUA 2XBPA 4F02A 3CCUS 4WFBQ 4L3KA 1MNEA 2A1BA 2RU3A 5HVFA 2VG5B 3C6TB 1FE4A 3U7JA 4KT0C 4V19X 1GK8A 3K59A 5C24A 3MM9A 5DDPC 4YHHF 4NA2A 2QX0A 3UCGA 4O44A 2J76E 4OYXA 1RTJA 3KK2A 2N82B 5K9FA 1HWLA 2ZEJA 2DVIA 2MZQA 3M8QA 4CLYA 4Y00A 3I5BA 1S1VA 5DLGA 4YR2A 2HBZB 3OR2B 8AT1B 2BZ2A 3W8GA 3C8YA 3A12A 1N5TA 3TAMA 1QAIA 3U1LA 4E8UA 2CDQA 3MPUB 3VVUA 1YJVA 1X4GA 1FXDA 1UZHA 3V6KA 4L74A 1RTDA 4ED4A 3H5UA 3BSAA 2QEXS 3EDRB 2JLGA 3HSDA 4U67Q 4OZ5A 2OP5A 2IPOB 2JSXA 2EEYA 1RUSA 3MEDB 1FRXA 1KC8T 1WF2A 3AAWB 3GB0A 4P52A 2Y0BB 1WTFA 1ZTWA 2YX1A 3J81U 1PAUB 2W2QP 2E1AA 2EFGA 2CQDA 4KBIA 2GV1A 4DCOB 1Y0HA 1W2IA 3CCMS 2EFVA 2MGZB 1HR0J 2Q6BA 2C2MB 3AXKA 1REVB 3NBPB 5I4MA 4P9SA 4USVA 3CTRA 2FVCA 2MTLA 1RTIA 3QZ8A 4CLLA 1SQEA 2DITA 3BS9A 4FS2A 3ISNC 4AT1B 3NOCA 4GO5X 2L41A 2DRAA 4PWDB 2XYPB 2ZH5A 4DR4J 3K5LA 2DD8S 3TZZA 4XTTA 1FRJA 1QLNA 5A8RA 2NR0A 4C0BA 3K8VA 4F25A 1TL3B 3H2UB 1U2RA 3DOKB 1UW4A 4C8NA 5HLFB 2KT3A 4QWCA 4KR0B 1Q4RA 4ZS6A 4DX7A 2CNKB 3VAKA 4F7VA 1U1LA 1I94F 3IFEA 4EGLA 1L3TA 2DXEA 4JI5F 1CG2A 3N01A 3MFHA 2WVFA 2V34A 3AH6A 1W7WA 5C24B 3MM9B 4C8OA 2KVQE 4DUYF 1RKIA 3IWNC 2NXUA 2H4WB 3M4XA 3ZZ0A 1H98A 1LQ9A 5HMXA 4ED2A 3DDIA 2BXJA 1ITPA 4P7TA 4EK2A 3PRDA 4F0MA 4QQBA 1PCAA 1QUPA 1S1VB 2Y1LB 1T9YA 2XB2D 3CJ5A 4DV6F 4F2SA 3QSIA 2MY7A 1Y11A 5KFJA 1HBNA 2QTWA 7FD1A 1FXLA 4L73A 2ZJQQ 4NLVA 3O1LA 4LIWA 5T14A 1RHKB 2HPUA 3PW5A 3IMQJ 3NKYA 2VL1A 1I3OB 5HVHA 2AHOB 3S6EA 1CSJA 5KFAA 3TOQA 3PZPA 3ICLA 5D78A 2ZFHA 1MWZA 4TYAA 3DOMA 3DLKB 2BJ3A 4DPOA 3A8IA 2CJXB 2I5JA 1HKAA 2MHEA 1IBMJ 5HQMA 4ILMA 5C42A 3QO9B 4F0HA 2ZC4A 4GKKJ 3T19A 1P8GA 2H5IB 1VQYA 1R6YA 1EX8A 1YK9A 3PR4A 3OLAA 4DFKA 4OX8A 1XQIA 2HK2A 4B02A 1RWXB 2I2YA 4FNHA 3W66A 3GZ7A 1RTIB 1UWBA 1YWXA 4NXNF 1F0XA 4I2PB 1CPZA 1U1KA 1RGVA 3IA0A 2QV6A 2AZ1A 1LW0B 4Y2IA 2EWHA 1Y9OA 2V8HA 2XEXA 4I6WA 4K4TA 3GIKA 3PRVA 3NNCA 1ZA1B 5A8RB 3CCJS 3H25A 1VQ8S 2FZKB 3PCOB 2AEJA 2XMWA 3W9JA 1IKXA 4DXLA 3HXMA 1M1HA 1S4EA 1X4AA 1RHRB 1RT4B 4ZPAA 2CZ9A 1R0CB 2V6AA 4CO4A 1AW0A 3D1OA 2DGSA 1NPPA 3QJPA 1XMOF 3MGJA 3UE2A 1VIXA 1V3RA 2MZTA 4B3MJ 3UNGC 4A8MP 1U47A 3KXDA 2GJFA 2MQPA 2VPYB 1QE1A 4F2RA 3PVXA 2RQKA 2D3ZA 4X65J 4K4UA 3IC1A 4CH1A 4A8FA 3MUVP 4R25A 2FGOA 2OD6A 5ETTA 3VAJA 3CT9A 4A8QA 1HNZF 4FXDA 1C4CA 1JLBA 2ZJPQ 4OI0A 3THTA 3UW1A 2UXCJ 1HBNB 2KYZA 2ZM6J 4J9UE 2ERRA 3CDEA 2VB6A 3SCJE 5KOWA 3G8SA 4EYHB 4K2JA 1N32F 4IR1A 3PJWA 4RW4B 1BQNB 4UOCA 4NLSA 3DOMB 1QY7A 5D6GA 3RUBL 3NCPA 4K5RA 4LF6F 3LQVA 3EE3A 1WC3A 3VGVA 1M5OC 4UZBA 1FTRA 2YQ3A 1BQMB 1JJ4A 1KKHA 1OQ6A 2F5GA 4PAAA 1YJRA 2ZBIA 4BLGA 4RPFA 3DM2A 3CD5A 4DL2A 4I67A 1TU0B 4DL3A 1VC6A 5CD4H 1UWBB 2XMUA 3AFGA 1KP6A 3I0SA 3POTB 1PJ5A 5F8LA 2RRNA 5KFTA 3SI8A 1T9TA 5GMDA 4GKJJ 3BR9A 1N52B 2D3UA 2WTFA 4NEZA 3B4DA 2RKIA 2EKYA 2KXFA 5L9XA 4DL7A 4KHMA 2NLWA 1IKXB 2QA4S 1FERA 4NZ0A 5BR8F 1M5KC 3LAKA 1TK0A 4DV1J 1Y5IB 2X1GA 1O6XA 2IHR1 1RACB 2JLEA 3LUYA 1VISA 3DRRB 2MLYA 4QU7A 1NUEA 1PAEX 3EX7B 1N88A 3L95X 1YJTA 3BDPA 2DHGA 4ITSA 2OELA 5DQIA 2O67A 4IQXA 3OXFA 3QMQA 4NA1A 4PZVA 2VKZG 2BRKA 3UCUP 5KFHA 1RAAB 1JXLA 4PG8A 3UQSA 2B9YA 4USKA 4MKAA 3M6XA 3EM1A 4IYQA 2DJWA 5ETKA 4DL0C 4DSIA 2C3UA 4B9LA 2CPJA 3M2RA 1JLBB 4UQTA 1VQMS 1UVKA 2CKWA 1QSYA 1RWOB 5LSRA 1RTHA 3BKUA 3RBEA 2KM8B 3FSXA 3ZZYA 2F1FA 3CMAS 3GFZA 3IN5A 2R7WA 2XMJA 5AT1B 1NKEA 1FEEA 4TY8A 3SEOA 4ELVA 1R7IA 3IAS9 1V6HA 1HNIA 2F40A 1U24A 1B0TA 4PXCA 5HBMA 3KJVA 2AZ3A 5FLXU 4I4BA 3T1AA 3PW4A 2RS2A 2V4RA 1J5EF 3DM2B 2DHAA 3I31A 4A4JA 5GAHI 3K58A 1T94A 1JLCA 4DLGA 3DLHA 3H7HB 2H65B 3MXHP 1XR7A 2PE8A 3I0SB 4YY3F 2QLXA 5L1KA 3WIVA 3MR2A 4M5JA 4N47A 1F5CA 5IC4B 4ZA1A 4JI2J 2VZ9A 2UV8A 2MKSA 1H2VZ 4IFVB 1NK6A 2RKIB 1X60A 4LSLA 1TKZA 1Q7LB 2YPZA 1NK8A 2KU7A 1H2UX 4BBYA 4HH0A 3LW5C 1R8HA 2HHHJ 3CC7S 3ETOA 1DLOA 3V2UC 1E6YA 4G1IA 2OSRA 2DNZA 3RG6A 2W24A 4I0WA 2W8LA 2WAQD 2E5JA 4FS1A 2CQCA 4K4SA 4LBIA 4DL4A 3EJMA 2CPFA 2UUCJ 3DNCA 4CT8A 5GAEI 3AB4B 2Y0SD 3SQGB 3MHYA 3H20A 1WSRA 1FD8A 4DSJA 4JI4J 1T02A 1IKWA 3QGPA 4FKYA 4XDCA 4KH1B 2RDJA 3MMBB 2J7UA 3OR1A 5J1PA 4USHA 4OZLA 2R2SA 2XMKA 1NB2A 4B3OA 2PC6A 3M2RB 3HULA 4DR3J 1XMQJ 1RAEB 2NS1B 4OJHA 1NDKA 2C1EB 1VK8A 1LOUA 2VC0A 3RW7A 1X31C 1TV6B 4YEAA 3WDOA 2OSQA 4ANEA 1F5BA 1RTHB 3PV8A 2MKIA 2ASDA 2IY5B 4DFMA 3DXBA 2EG2A 1U1OA 2KFZA 3LWLA 1LNQA 3CJ0A 1TR0A 3DC2A 2C2KB 1S5ZA 4TY8B 1F1BB 2BQ3A 1HNIB 1S76D 2ROEA 2KG0A 2OI2A 1WC1A 3TO8A 2JLFA 5HBMB 1S7HA 3KJVB 4OI6A 3L3CA 1A6LA 3M8WA 1FT8A 2XHWA 3T5JA 2R8GA 2XSFA 3PDNA 5FIIA 5F9NA 1R0BG 1JLCB 1RAOA 2ZOFA 3FC9A 3DLGB 2UVUA 1JLAA 5CHCB 5A8WA 2LQJA 4KFBA 2G1DA 4PXBA 1N33J 4KGMA 4MJKA 1Y7PA 3BH7B 4RUCA 1N56A 5ETLA 4ZVGA 3K5MA 4LSLB 1TKZB 1F5AA 2AJ2A 4C4WA 2FLOA 3ZO7A 4OFZA 1DLOB 1E6YB 3ZTQA 4MYUA 2BANA 1XIQA 3J7Z5 1T9VA 1S0MA 3KHHA 1P9QC 5D4NA 3FNNA 1BC6A 2VUGA 2XI3A 5H9EK 1D3WA 1WKJA 2FHJA 2PMWA 1OJ4A 2DH9A 4DR7J 4PCQA 2XULA 3G82A 4C98A 2JVRA 4X66F 4XDDA 1IN0A 1E6VA 4ZLJA 3FQLA 1GT8A 3NMAA 2YWGA 3FUYA 4QYZJ 4DX5A 4AFFA 1UVLA 1IBLJ 3OR1B 4WKRA 1RXOB 1IBCB 2F4VF 2JEIA 1XK8A 4B3OB 2D3O1 3V4IA 3UI3A 5KG0A 4CLZA 2CPDA 2HNDA 4OJ3A 3UR3C 3RR7A 3OD2A 1K8AT 4IR9A 1YHQS 4OX9J 3FK4A 3CC4S 3OXGA 5E3QA 5KFVA 1QAYA 2OIHA 3KJNB 2GIQA 2WB4A 3VZIA 1KLNA 1RT7A 3R5AA 3A3NB 2V4JA 1Q86T 3D1QA 3U27A 1M5VC 4C2MA 1IJFB 1Y00A 3GJTB 1U1PA 4JI6J 1K47A 2IVFB 3DGPA 2W2PP 3GR0A 5B09A 4X62F 3I56S 3W61A 1YRUA 4DX6A 3UDLA 4ECVA 4WZMA 1KRPA 4F50A 1KHVA 2BACA 1QM9A 1JLAB 3MEGA 2WVBA 3DLBA 3VGUA 1EB0A 4D3GA 3OJUA 4Q0BA 3W65A 4U8VA 2B3TB 2BM1A 1NNDA 2Q1LA 2AKWB 2UUBJ 3CW2C 1U0SA 4P2FA 2LVWA 2VQFJ 4J9RA 2BANB 4N5SA 2FHJD 2VIHA 2I1RA 3Q24A 1G2EA 4LBPA 3OLBA 1S6OA 2A0FB 2KXHA 4JI8J 4KHPJ 2XC9A 4CLUA 3UPFA 1VGYA 2DISA 4YMEA 5KT2A 1EHWA 4HACA 4NRUA 3P6YC 5C7PA 3RBXA 2DEJA 1F60B 1YZ6A 3G82B 1SH0A 3D1HA 4K4ZA 1YJWS 1E6VB 2VHGA 3KMSA 3UCZP 1RBLA 4L72B 4MFBA 2AGOA 2DR6A 1N6QB 3ET6A 3Q89A 4U7CA 1HBOA 4BWMA 1ZAXA 2FHKA 3IRWP 1MMNA 1OYDA 3QGHA 1S12A 2AYMA 1UA0A 3NRBA 2H4YB 1UETA 2HNDB 2HAFA 5KFDA 3LA0A 2FJDB 4M5KA 4PWWA 3M32A 3RAMA 4RW8A 2QL9B 1HIYA 3MPDA 3AOBA 3U1NA 4PEOA 2B0GA 4PYDA 4IRCA 2ZE2A 3TVKA 4KE5A 4MAKA 3RRGA 3SV4A 2F3JA 2V4JB 4QWEA 4O3OA 1WDTA 1YLXA 3SSRA 1IBKJ 3N6LA 3OFFA 2QRRA 2W01A 5KAKA 4DSEA 1U49A 2HHQA 1RJJA 3DN9A 1SCJB 4OZNA 3R7SB 3KLEA 2CRLA 2QLJB 1AFIA 4I6YA 2F8EX 2E5GA 5I3PA 3C2PA 3MEGB 3FEYB 2RILA 5IT9U 4LF2A 1VRTA 3GLJA 2F9DA 2PFDA 3GG0A 2LA6A 1FI4A 5T7LB 4UZCA 5IWAF 5LXYA 1FK9A 5AJ3F 1GH8A 5KT5A 2H48B 4IUFA 1L3SA 2KM8C 3ZZZA 5F0UA 3W5ZA 1VYAA 4O3RA 1NPRA 2XM3A 2BEFA 3KLHB 4RX6A 3IG1A 1HPZB 2P9EA 4DR1F 4ETXA 3HD1A 4J37A 3PJ9A 1NSQA 2ZBCA 4K4WA 2M3DA 2RF2A 1S0NA 1U09A 4YR3A 3GJRB 2JH3A 5A2QY 3GJQB 1DRZA 4LF4J 2HK3A 5D4LA 2BE9B 3ET6B 4FYXB 1HBOB 4AL7A 3TAPA 1R8AA 2E1CA 3OFEA 3P5TL 2W4CA 2GIFA 2X51A 3I87A 3O44A 2Z2MA 3HX9A 3VVTA 2LDYA 1GXTA 3TA0A 3BSCA 2VFUA 3HVTA 1Q16B 1I1GA 4UY85 5E3RA 2P8IA 4X4RA 2RH3A 4J90A 3D68A 2VJUA 1YBAA 4RW8B 1AZSA 2R4FA 2R8HA 3OHBA 3W2VA 3MPWA 4CLFA 2YNIB 2E5LF 1BD6A 5B0AA 3F73A 1PKUA 3KK3A 5D3GA 5I3QA 1S6UA 4ECUA 2CQHA 4DF8A 2F4FA 2XZDB 3NGRA 2MMYA 1M0SA 3GYXB 2N4CA 2HQFA 3T1YJ 2PD1A 3HDSA 1QSLA 1OY6A 4P6QA 3DU5A 4DV3F 1N36F 2B4VA 1C1BA 1R27B 1U6FA 3GFHA 4DI6A 1BWEA 4Q7AA 3HHKA 4OYMA 4CH0S 4IH5A 4J9SA 3I4PA 2W1BA 2DR5A 1VRTB 2Y1JA 3HF5A 2DNNA 5DG8A 4BC9A 1TMMA 2K7KA 3NP5A 2ZH3A 3W63A 3GQCA 5LMNJ 1M1GA 4ED7A 2QLBB 4TLQA 5LSOA 1BMQB 2HQDA 4CNZA 2ALZA 3KYLA 3HCXA 3AJ2A 2MLXA 2V8VA 3K0JA 2ILYA 3MPVA 2AU0A 2HHVA 2VPZB 4Z7YA 2BJ9A 1J5OB 2E5HA 1NHVA 3IG1B 1O5JA 3CCTA 4JV1A 2DRBA 2ROPA 1X5TA 1VR6A 1FDDA 1HQ2A 1R6VA 4PXEA 4USIA 2DXFA 4V19J 2HVHA 2B43A 2RF2B 4ZIWA 2W25A 1OSDA 3C14A 2DGOA 3EGVA 4OZJA 2UUAJ 1LXJA 2CJ9A 1KONA 3D6MB 1HR0F 1FX4A 1WC5A 3BGRA 2W4PA 4OMFG 4W98A 2FPHX 2XYHB 3KUGA 1TK5A 3MECA 2GS8A 2JX2A 1Q5VA 4DBQA 3NOGA 3I4HX 5HJXA 1RAHB 3TJ8A 1LXNA 4JYAJ 4J9OA 1CVJA 1S6PA 3GV7B 2GCFA 3HVTB 5HATA 3MEKA 4DR4F 3TNVA 4B9UA 4QJVA 2DY9A 4P72A 2UZAA 4K5SA 1XJWB 3OUYA 4K4XA 1VQKS 2MLZA 1IM6A 3ZTSA 1QDUB 3W2VB 5HMYA 3TUZC 4CLWA 3CIZA 1RYRA 1SVDA 5DZ6A 4EYIB 4ER8A 3OL7A 3KK3B 4P2MA 4CRJA 2D1CA 3AXMA 5D3GB 1YRXA 3CPWR 2L3MA 2WVEA 5KT7A 4B3SJ 1MU2A 4FN5A 3DFEA 2V68A 3WBZA 3SCLE 3ULHA 2PEHA 2NXJA 3VALA 5LOQA 1N5VA 3ISZA 3JSMA 5EGYA 3QRQA 1C1BB 4MIBA 2BQUA 5J2PA 3A13A 2W9BA 3NGSA 3P96A 1EQMA 1CJUB 1L5UA 4YP3A 3BR8A 4OI1A 2WOMA 3MMCA 3R7NB 2UXBF 4LF5J 3LH2S 3K8WA 4F67A 1RQ0A 2KN4A 1FDBA 4I69A 2DNLA 3TEHB 4LF9J 1CQMA 1O51A 3F44A 4ECQA 2JFDA 3P5BP 4RUHA 3EVWA 4M5GA 5ETNA 4DX8H 1ZOTA 1MWYA 3M30B 3BSOA 3FDSA 4K4YA 4FPRA 1JX4A 1IBMF 4KV8A 4ZMMA 4A8KA 4C8KA 4NLPA 4UW2A 3PX6A 1Z1ZA 2ATCB 2F65A 4L3NA 4HDHA 2YWFA 4NYZA 3Q8RB 3K89A 1VJQA 1V5IB 1XNQJ 4C48A 1VK3A 1F9FA 3VAFA 3BGRB 3FEZA 2FJAB 2VFRA 4Q45A 2FTRA 2YKQA 1MROA 4AXIA 1ZTTA 5CYJA 1SJFA 2YNGA 1S6PB 3SBMA 2XNQA 2KI2A 3W5YA 1H74A 5DQGA 1Q53A 1VBZA 2VD3A 3OUYB 4A8WA 2IJNA 2W2MP 2AQ4A 2E1RA 1LV5A 1RAIB 1F9HA 2CJKA 2BJ7A 4DS5A 1K1SA 3T9ZA 3PEHA 1Y5NB 2HHTA 2AJ0A 1XERA 4HI1A 3BN4A 4LJMA 3KUHA 1R8CA 4IH6A 2W2OP 4MKBA 5KFMA 1WOSA 3AD7C 4AD6A 3OFHA 4B3MF 2Z2LA 3LP0A 4EFAC 4ZCMA 4X65F 1SJ1A 4F36A 1D09B 3MR7A 5J2PB 4FF1A 3HZGA 2O5DA 2NYIA 1FO1A 4P7VA 2GHPA 3KLFA 4PPDA 2WOMB 3MMCB 4X4UA 1DTTA 2WVCA 1TUGB 3HFVA 2UXCF 1NKBA 4ZVOB 1L3VA 2ZM6F 1FNMA 3TANA 3NG8A 5F8GA 3GSIA 1VQ5S 2ZDPA 4TNOA 4RJVA 2X7IA 2ZHOA 5D0EA 4GO7X 8RUCA 2PO4A 2IIHA 4B9SA 1UPMB 3GV5B 3VQTA 2NUHA 2XY5A 1MLAA 4KV8B 3V6DA 3K57A 2MQMA 3QZ7A 2CQ3A 1HHSA 2ZBPA 4PYAA 4EUVA 3V5RA 2DGVA 2V5HG 2KRRA 1OO0B 2OPRA 4QR2A 3DLJA 1NDCA 3M7VA 3J80Y 2YNGB 4HEA9 2PA8D 3M9OB 2GQQA 3BPSP 3THVA 1TVRA 2NSBA 1DAXA 4E2FB 3AJDA 2EBEA 2KZZA 4FPIA 2BOAA 5FDLA 2ILZA 5HJYA 3PYFA 2W4DA 2YKAA 3CCSS 3PO5A 3SFUA 3R7BB 5HANA 3QJLA 3EGNA 5IZHA 2V4QA 3O6QA 2XS7A 2BMBA 2W2NP 2AJ1A 2X3DA 3CJ4A 2HIYA 3LGNA 5HN0A 2KYXA 4IO1A 1N54B 3Q23A 3LP0B 3I96A 2MKHA 4Y28C 3MAHA 5EHHA 2NZCA 4H54A 5M2PA 4LR8A 4CO3A 2A10A 2ZKUA 3M6UA 4LF1A 1MSWD 4NASA 3LALA 2XO7A 5B7WA 1S48A 3WX8A 3HVAA 5KFSA 4N8NA 2MZSA 3CJ8A 5IQQA 1RWKB 5KT3A 5LXRA 2EI5A 3M2VB 4NXMJ 1NJWA 1ZPVA 2OGUA 4OYPA 2QGFB 1SPBP 5DM6Q 4NLWA 1F2HA 1UL3A 4BCAA 4DR2J 1BXNA 5D77A 4RUAA 1HNWJ 4DV7F 1S9GA 4OJ1A 3SV3A 4F3QA 1I6JA 2J0XA 2H9ZA 4G3IA 1Z2ZA 1MW7A 2CFXA 2HVDA 4O23A 1R89A 4TLRA 1TAUA 2RSQA 3DDNA 1FWKA 3HJFA 4CCHA 2EFQA 5D0HA 2VC1A 3CB4A 4A8OA 4GVBB 5HQLA 2ZVIA 5C25B 1AFJA 4CLKA 4M63A 4ECTA 3H42A 3TX8A 3H90A 5ADZA 5KFKA 3O8WA 4OHYA 2MJUA 4NCAA 1TVRB 2UV8G 4J9PA 3TJ9A 3H59A 3EPIA 3WQPA 3VV2B 4ELTA 4KPCA 4ELUA 2IYGA 4OYWA 2QA2A 5FDLB 1KNZA 3KNGA 1VBXA 2XS2A 1CULA 3L09A 3EGZA 2WONA 3TW0A 2HHHF 1RT6A 4USTA 2H51B 1X4CA 1KD1T 1JJCB 2CNLB 3OVBA 2HVIA 5KOXA 3KNAA 3MUMP 1AROP 2XSJB 4F26A 1A7GE 4DV4F 2BOPA 3I9V9 1EAYC 2B9EA 2UUCF 1NDLA 3B54A 1RWVB 2OFHX 3UD3P 4OIXA 1YJNS 3J7YI 4UQGA 3M6WA 2JEGA 4JI4F 1KLMA 2EBGA 3ILOA 2JL9A 3N28A 2KFYA 3UDEA 3RAXA 3AQOA 1HQUA 2J0QD 4JBCA 5D4PA 1YJ7A 1XMQF 4CM2A 5T41A 4WJBA 2FHOB 3AQPA 1LWFA 3HVRA 3G6VA 2D74B 4LF8J 5KFPA 1S1TA 4WFNQ 3I32A 4Q8EA 3WZ0A 2HFZA 4RKUC 3TQ1A 4RNMA 1VHFA 4ECYA 1TKTA 3DCAA 4NX9A 5HMZA 2OEMA 2EW9A 3D3CJ 5MLCV 1YJUA 2ADCA 1NK5A 4XPEA 4ECRA 5GMKa 3Q8PB 1U6BA 5HO4A 2X1FA 1U1QA 5L8RC 3HP6A 1U0HA 4K0KF 2HFVA 2CNNB 1EARA 1R31A 5J1EB 4Y3CA 2RQCA 2BKOA 2FJXA 1TMJA 4KKOB 2XZTB 3Q2SC 1IQTA 1U1NA 3ZTRA 3BO4A 2IMWP 3QPIA 3IWXA 3PY8A 3OSPA 3VZHA 8ATCB 3D0HE 2WCXA 2LA4A 1VQ7S 1EP4A 4W90B 4DG1A 1NHUA 5IFMA 2WONB 3PW0A 4RZRA 3D9BA 1RT6B 3Q0AA 3FCVA 2CG4A 1S57A 3IR5B 2LEBA 1S1XA 2AEMA 1X9SA 5I3UA 1Q0NA 3Q8SB 1PG5B 2ZUAA 3E8OA 4AYBD 2EFNA 3KLGB 3RRHA 4JI0F 3RTVA 1X4BA 4DR7F 5EN1A 3MTKA 2B6AA 4Y2MA 1K0VA 2GVZA 4WZQA 2YVSA 1W2BR 2HLUA 3KKFA 1SL1A 1KLMB 4M8LA 4WXWA 5E3AA 5A6PA 3TUJC 4Q8FA 3LGHA 4RL1A 1G4CA 2KB2A 1ZS6A 1SH3A 1HQUB 4CIOA 1DURA 1SKUB 3MF5A 2RDDA 2JC1A 2AEFA 2PIIA 3FEXB 1HNXF 1XWLA 1LWFB 4P73A 4U95A 1S1TB 5DJBA 2JJ4D 3OTBA 2VJVA 4DF4A 3VAMA 2Z2YB 2XCPA 4O4RA 5KG7A 2LECA 1YDLA 1TKTB 4WYWA 3GONA 1KTVA 2QE5A 2HRYA 1FRMA 2RJZA 2UVVA 3R9LA 2U2FA 2YWKA 2BYCA 2OEKA 1SC6A 2J8SA 4HL9A 1WHXA 5AXMA 2IJRA 5D8HB 2KG1A 4F4AA 4M94A 1TUVA 3R5CA 2MB0B 4M5HA 3M1VB 1T7PA 4JI6F 3N79A 4DQRA 1JLFB 2D9PA 2D7SA 5E3CA 2A2CA 4NEYA 4ES3A 4QWAA 2QA1A 2CQ4A 2PMHA 1WKLA 3KHRA 1Q81T 2QYGA 2CNOB 3FFIA 4DPYA 1HW9A 1WEZA 1CJTA 2VKRA 4UF4A 2AX0A 4ZJOA 1EP4B 1XNRJ 4DG1B 3FZ2A 2RU9A 4Z37A 4KY3A 2UUBF 2W7PA 2M9KA 4PWUA 1RHMB 4PABA 4Y34A 3WC0A 2VQFF 1PC4A 3GU0A 2KHDA 1KQSR 3S8SA 1P6TA 1S1XB 1WHYA 4WXOA 4WFAQ 3TUPA 4ZVTB 4JI8F 5I3UB 4KHPF 1K1QA 2M70A 2RHSB 1YG0A 3KG0A 3DHWC 3FBEA 3RU0A 5LMUJ 1QVGR 1T0TV 4OZ0A 2DIVA 5DDQC 1QSSA 4DV2J 1SKRA 2GVZB 4X64F 4I68A 1V9OA 3R1LA 2PFFB 2Q66A 5KG1A 4EWTA 4LSNB 4JI5J 4DOZA 3NLCA 4XIUA 3HT3A 1HMVB 4ZIVA 3W1YC 1U1MA 2CG8A 1VJWA 5LM7E 1FJ7A 1JWWA 1WUUA 1R43A 4FF4A 4YDDB 4LVNP 3FMWA 3UD4P 3JQKA 1AXQA 3ZZUA 2QT7A 1LWEA 5E2QA 5K8PA 3CJQA 3K2YA 3GIJA 1PC5A 3R97A 4NI2A 4UUWA 4YB1P 3GYGA 2QMWA 2MY8A 3FBFA 2BJ1A 5K8MA 1FCAA 1WC0A 4QW9A 1T05B 4M1KA 5K14B 4OZ3A 3UVJA 1T11A 2XLIA 3G6YA 3IS9A 3DMJA 2CPEA 1WSVA 4B3RJ 2RB7A 2AJQA 3FQKA 3MMJA 5LT5A 1OQ3A 2DEIA 5HROA 2AYBA 4TYBA 1FRKA 3D28A 1FESA 3ZZOA 3GILA 3FFIB 3OTDA 1VIOA 4OLPA 5K8NA 2ZZNA 1CJTB 2MZRA 2N3LA 2W9AA 3T1HF 1F6TA 3H0PA 4QPTA 4H4MB 3MM7A 2HBYB 4NE9C 2K3KA 2GW8A 4NXNJ 1ZH5A 2B4PA 3D67A 1SJ3P 3CDBA 4DU7A 2DNOA 4TXSA 2RHQB 2HMIA 2XYGB 3Q83A 3GMGA 2VBWA 1KQKA 4ALZA 4JV5F 1CBKA 3NGDA 5IXUA 1HHQA 3QAEA 5A2QU 3DRSB 3ZTPA 1SV5A 2QIFA 1NSPA 2QJ3A 4P2XA 4IKAA 2A6OA 5CXTA 4R0EA 3VAGA 1U26A 1X7VA 3QBCA 2ALYB 2J9EA 2XMVA 4NLUA 3RYLA 3TZYA 1XR6A 2YXLA 3QT7A 3EZ5A 3JTNA 3ENVA 1Z2LA 3CXCR 4C8YA 1WI6A 1HWIA 1Q1KA 5GADI 1AA1B 2OTLS 4IG0A 1FTCA 5IC6B 2DIUA 4CWBA 2DPIA 1RWUA 1HNZJ 2I9SA 3H2LA 1KBRA 2KT2A 4USUA 1SKWA 3AHPA 3TAQA 2YNHA 2IDEA 1RK8A 2RUSA 4PXDA 1KWMA 3AODA 3QATA 4CT9A 4MIWA 3UVJB 4RBTA 5CYQA 4LQ9A 4QIEA 2FVPA 2WRMA 1VCTA 4ED5A 2LYVA 1DQ9A 3T1YF 1N32J 3IS9B 3DMJB 2HWTA 4JI1J 3R5JB 1S7IA 3MAAA 4HH1A 4LF6J 5J2QA 5H9EJ 3G9CA 1FF2A 2RNEA 4JV2A 5HROB 2PEBA 4LRBA 4PG7A 4ZVQB 2VBXA 3SCKE 3TUIC 2DCLA 4LRCA 2LCWA 2VG7B 3WHIA 3M2UA 5LMNF 2VFTA 3RR8A 1FWPA 4ICLA 3W3SA 1NU4A 3MM7B 3TWZA 5L9NA 4KYZA 2H3EB 3RRKA 2E9RX 1SI9A 2LLZA 4B9VA 4AXJA 2CZ4A 3QGGA 5KT6A 2E9TA 2HHPA 1FWLA 1UW9A 4QWDA 3MM5A 2Y1RI 2HMIB 3QRPA 2E7XA 4GC7A 1B3TA 4J91A 1RT1A 2PI5A 3MURP 2UUAF 4W4MA 1FJEB 2EK6A 3J7ZT 5ETRA 4O44B 1SV5B 4RBUA 4ZITA 4NRTA 1RTJB 1LEOA 1B7YB 2YQ1A 3KK2B 2W8KA 4OYIA 3KTQA 3HHLD 4RW9A 1WG1A 2CUYA 1QVFR 3TRGA 2J9DE 4K7QA 5GAGU 4KIAA 4LRFA 2OMLA 5F8NA 3M8QB 2B5JA 2DGUA 1M1KT 1QAXA 4JYAF 1D8YA 4MT1A 1VLOA 3TAMB 4PRFA 3V81A 2AD9A 4KGZB 4RO0A 2IC3A 2HEKA 2VG6A 2BDPA 1RTDB 4IG0B 5HP1A 5ITHA 3C15A 2YWWA 4MKYA 1BWVA 4DPTA 1WNEA 1WWHA 3MR6A 3O2IA 4Q5VA 3KLVA 4RNFA 2PSZA 1WHWA 3E3XA 3OJSA 5KG6A 3QIPA 2MQQA 2GMHA 4PUOA 2HZAA 3OL9A 1NRKA 3AA8A 3MAAB 3PX0A 2KO1A 3W60A 2V94A 1N34J 5J2QB 1VQ9S 2MKKA 3R5GA 2XLJA 3THPA 2P9GA 1J5EJ 5KFLA 1FEHA 2WSFC 3M2UB 5L38A 4LF5F 4ICLB 1NKCA 4ZJQA 1U8SA 1RAJA 3PX4A 1H73A 4LF9F 2J6UA 3P49B 4L6V3 4YY3J 3PHTA 3H40A 1LW2A 2DK2A 1T03A 1QJHA 3MM5B 1QD1A 2FD2A 5DS7A 1IVZA 2R42A 2RT3A 1RT1B 1RDRA 3MD1A 1CJKA 1D9DA 4NPOA 5HSPA 3QLHA 5B0EA 5J2NA 1DHMA 2AX1A 1XNQF 3I9ZA 1FJGF 1PO6A 3HI9A 5IT4A 1BQXA 2GHVC 1NK7A 5F8HA 4M5MA 2MDAA 2ZHBA 4OQJA 2B5JB 4CLTA 1HWUA 2RD5C 2AJFE 3JXOA 2ZOGA 1Y3KA 3CF5Q 9RUBA 3V81B 2ZHAA 2ZH7A 2IC3B 2H54B 4CO1A 3HD2A 4DQSA 4ILLA 4U7UD 2Z56B 2NUUG 3VHQA 5HP1B 3RBDA 1HI1A 3MM8A 2FY8A 2MPUA 1PYTA 3C15B 6FDRA 4BWJA 5JVHQ 2Z30B 1HD0A 4BC7A 3QQCD 2CXEA 4AE5A 3HM9A 3MWBA 4DQPA 2R2UA 4KQZA 3D6HB 4EZ9A 2I5JB 2DGQA 1NXIA 5C42B 3CIMA 5CCLA 1N0UA 2P2CB 3G86A 3WIUA 2CPYA 2DR9A 2ZKTA 3MDFA 2M0GB 2QMUB 1M90T 1TFYA 1UFLA 2AYEA 2G4BA 2ASYA 5BYRA 1QUVA 1U25A 2CQGA 3KK1A 3RB0A 3SIPB 3D6TB 1YVFA 1CJVA 4FXWA 3CGIA 4NMXA 2KJVA 1GTHA 5M2RA 2CQ2A 3I0RA 1J27A 2VH7A 4I56A 2DPJA 3AD8C 4LUBA 3ISND 3QNWB 1MMLA 3C16A 2HWHA 3IGVA 3HVWA 3OT9A 2HGLA 1LW2B 2JNJA 2Y3YA 2EG1A 1VQLS 1WF0A 5IT0A 4DR5J 4Y65A 1PIEA 2LXIA 5E33A 2HW3A 2HG4A 2ADBA 2OPPA 2AYGA 2BRLA 3GP9A 1QE1B 2D69A 2G0CA 4O3NA 4P10A 1FVSA 4CLSA 4WIQA 4IO9Q 2V9WA 6FD1A 1REGX 3E51A 4GC6A 2UVRA 1SC3B 3J80U 4F4ZA 4DU8A 2MEWA 3HFZB 4X66J 4WFXA 4KGVB 4HHHA 4A48A 1YGYA 1B99A 4ILRA 2BBEA 3MM8B 2OO4A 3EICA 2RQ4A 3G71S 2MSTA 2F4VJ 2YNFA 2H5JB 4EBCA 2LKZA 4DR6J 3R2CJ 2L9NA 5E0OA 1S72S 4DL6A 2QO3A 2AP6A 3ENQA 5H9FK 1FNOA 4B08A 4ECXA 4UY8T 4NLXA 1FD2A 2FVSA 4JI7J 3Q22A 3OXLA 2ACYA 3CDUA 1O0PA 2BJDA 4IDKA 1B64A 1FX2A 3R5DA 4LR9A 4G65A 5E7OB 3CCES 3BKFA 3LPYA 3QFHA 1T8EA 2L9WA 4DUZF 4I2QA 2B9XA 2QN6B 3C6UA 3KK1B 2ZNYA 5DG9A 2BVZA 2M5YA 3IO1A 2IVMA 4AUKA 2JZ5A 2KKHA 3CJTA 3IGNA 2HNZA 4QZVB 3A8KA 2K06A 2X3GA 1ZETA 4FVCA 5EWGA 4QIWD 4LT6A 4QW8A 1KEKA 3MCMA 2F9JA 1HL6A 4NXMF 2V8DA 3IAM9 1TFWA 2MHNA 2HS3A 5C2CA 2HHSA 1RE1B 3IXQA 1KVJA 5F3TA 2MQOA 1JJHA 3ZNUA 1HNWF 5D0GA 2G2ZA 1UPPA 1F3FA 2OPPB 1RZMA 3ADAC 4OV1A 2VBYA 3IM9A 2DKOB 2FIUA 3BGFA 3IR7B 2WSCC 5GADU 3M6VA 2LFVA 2CADA 1HBMA 2KH9A 3TVZA 1K73T 1KR4A 2XQCA 5E3PA 4ZOSA 3EGWB 2W9CA 4BS2A 3KHGA 1TUWA 2FB0A 2G9OA 2OTJS 2FJWA 3EUNA 4ZPCA 2R8IA 1WDDA 2UU9J 5KG4A 2I38A 2YNFB 1R8PA 2J0SD 1XN9A 4X4QA 2QYCA 2IJFA 2D3OR 3LWMA 3PFOA 2BE2A 2DGTA 1JNRB 1H2TZ 2BX6A 2CZVC 6AT1B 2R7VA 3TA1A 3PIPQ 1RABB 3DOLA 4KAIA 3UDCA 4HKQA 1ZA2B 1UVJA 3KWMA 3ZFVA 5DDRC 2G2YA 3JTOA 4ZCIA 3A1YG 4I2QB 4WF9Q 2YBVA 2ZH4A 3UD5A 1NB7A 4MK8A 3C6UB 2GGPA 4B3TF 4YN3B 3SDEA 4P75A 3T6BA 3PKMA 3IBFB 2C3OA 3I6PA 3HLUA 1VRQC 4UT4A 3FSIA 2C2EA 2XWYA 5A0YA 4DV5F 4AQYF 3RJMB 5IS2A 2HNZB 2E5IA 1PGZA 1FXRA 2CYYA 3N9UC 2VF3A 1DQ8A 3CJ3A 2YWEA 2GO8A 2R7TA 3TJAA 3R5BA 3BQ1A 2UXDJ 2F8MA 4F04B 4ID5A 4LF8F 3R8YA 2DR8A 2HRTA 1FRHA 1LKZA 3PTWA 4ZLPA 3F56A 1HQEA 1H6KX 2FJEB 3LF0A 1PJ6A 3Q8QB 5AJ3J 1T9WA 2I0XA 2BV3A 5IV3A 1IKVA 3DRXA 4ZP6A 3FCWA 4HTIA 2C28A 3KJFB 2XLKA 2HQGA 1SKSA 4IG3A 2AJ4A 4DQQA 5KFXA 2Y1IA 2J5AA 3LP2A 1WELA 1IKWB 4FBUA 2ZBRA 4KPYA 1OS5A 2VV5A 3GSDA 3MEDA 4G1QA 2NZ4A 1HBMB 1NCLA 4H4KA 1S6QA 3VWSA 2W9CB 3CCQS 2R7UA 1IXKA 4RU9A 5EX3A 3X1LB 4NZ6A 3K7RA 2ZH6A 1REVA 3NBPA 4NLOA 4UUXA 4JV0A 1NHKL 2B7CB 3P3DA 1NDPA 4K8RA 2G0IA 4N77A 2BE2B 2FLLA 4LVOP 2OPSA 4PWDA 1NK4A 4DQIA 2GMJA 2A2DA 3PR5B 5CA5A 1CS4A 2OHDA 3W2WA 4ZK7M 1OY8A 1X9WA 2DNKA 2GFFA 1H72C 4R5PA 4OL8A 1YJ9S 2Y8WA 3M8SA 4E98A 1PSDA 3DOKA 2CA9A 1N5QA 4JP8A 1FRLA 3VGTA 4DV0F 2J9DA 1H38A 3ZZPA 2CWXA 4KHRA 2IBKA 2C2ZB 5JVGQ 3SDEB 4FKXA 5A8WB 4KFBB 3QRRA 4FP9A 3RAQA 4DZ6A 1IR0A 2HFOA 5A0YB 5D4OA 4IRDA 4DZDA 5KG2A 1RA7A 1OY9A 3OSNA 2KT5A 2G13A 4M5NA 2GAGC 3RZAA 4DV3J 1N36J 3BBBA 4ID5B 3Q86A 2YY3A 3ZTOA 2FJVA 3GCXP 5CQGA 3TYTA 2Z57B 2DHSA 2IFXA 2M88A 3IP0A 4NLYA 2HFNA 2J6SA 1HQEB 5KTQA 1RT2A 2KXNB 4OYBA 1L3UA 1BUXA 3DRYA 1X9MA 1NSKL 5B0CA 1B0VA 2IRXA 2VQEJ 3OTOJ 2C2DA 1DZ5A 1IR1A 4C3MA 1IKVB 3LTOA 4WK1A 1HWJA 2F63A 1JJ2R 2B51A 4ZP7A 4IG3B 3TX0A 2JWNA 3LP2B 3QAUA 1URRA 3DLKA 3CVKA 4J9KA 2EFPA 2CQ1A 4G1QB 5A6WA 3GIIA 3FSYA 4EBEA 1JLEA 1B4SA 2HS0A 3V4IB 1S6QB 3QO9A 3MOZA 4O0NA 4N41A 1T9UA 1NK9A 3OVAA 5EWFA 3A8EA 3MZIA 4LFAJ 1S1UA 2KRBA 1X4EA 1XNRF 1F3VA 3BV8A 4I2PA 3BPDA 1JB0C 2ZVSA 2B7BB 1JLQA 1VC0A 1RT7B 1LW0A 2OPSB 3PW2A 1NH7A 1G1XA 4JI3J 5D0RA 3J81j 2QLFB 5K5MA 3G8QA 2HURA 2QSFA 1WACA 1CS4B 3W2WB 5LMUF 3BBFA 3D54A 2M52A 1UVIA 4UOFA 4R5PB 3QJJA 3B82A 4J9LA 4DV2F 3HHNB 3GV8B 1X0PA 1B70B 4A47A 3OL8A 4B9MA 3DGPB 3BM7A 3IWLA 1VQSA 4CTAA 4A8XA 4RUBA 2DNGA 4ANDA 3BZQA 2R2RA 3UWTA 5THWA 1RP5A 4NL5A 4FZVA 1RT4A 2GJ2A 3H4BA 2D9OA 1APSA 1FDAA 4UOGA 4X84A 2R3VA 4Y2KA 1K0TA 4EU0A 4OHXA 3D66A 2E7VA 2AF6A 4Q0BB 3C66A 4URGA 5CD4A 3QYYA 3G2XA 2PI4A 5L1LA 1TL1A 2XY7A 1RWWB 4PQAA 2RE1A 2IMOA 4DMZA 1BY9A 3JSRA 4N8OA 1U8WA 1K9MT 2ZH8A 1RT2B 2DNYA 2UXBJ 2ZZMA 4HACB 4Y0FA 5I42A 4C6AA 3DGVA 4LBHA 1JMTA 1PBAA 3AB2B 2ZD1A 3SCIE 4IH7A 3QWUA 1NBEB 4TQRA 1ZM2A 2BW7A 2E66A 4PQUA 2W7AA 2CPZA 3HFKA 5C2GA 1ZAWA 4RW4A 4MFBB 1BQNA 1R8BA 2UUTA 4B3RF 1DBDA 1ZM3A 4C8ZA 1EQ0A 1G3OA 2LQBA 4FYVB 2ZDOA 2A3JA 5AE1A 1TL4A 5CAAA 1WHVA 1JLEB 3QGIA 1BQMA 1VOMA 1VHIA 3BGOP 3BF4A 1C4AA 1Y5LB 2EC2A 3KJQB 3QT8A 1NLKL 3ENAA 4ED3A 5BJRA 1S1UB 5AE3A 3M32B 1N0VC 4ZVRB 2EC0A 4KJIA 1WC4A 3M8ZA 4F3OA 5AXNA 1SL0A 3POTA 2UUWA 2ZE2B 2LU2A 2LQ8A 1KTQA 1JLQB 5IQ6A 5IV4A 4ZHRA 4KTQA 3H5SA 2A6MA 2CQPA 1X5PA 5GAHU 3X3UA 5IM0A 3EVOA 1W26A 4C7QA 1UMJA 1FNXH 2IYIA 3G87A 1TKXA 3M8YA 4CDIA 2HGMA 2FLNA 2VODA 1LFPA 2NPFA 2IBOA 4CTAB 3NNHA 3KLEB 4XK8C 4O3PA 1NSAA 4OYZA 3CO9A 1I5OB 1OSCA 3HSGA 3DRRA 2WW4A 2BKNA 1Q8IA 4I64A 4NYPA 3BBCA 1S99A 3K17A 4WP9A 1X5OA 2LU1A 1YITS 3C46A 4RWWA 5DRKA 1U02A 3OTEA 1RA6A 1FK9B 2EXUA 1H0HB 4Y2CA 3GTYX 1TL1B 3NMRA 1VDHA 4WTYA 5M2UA 5GAEU 3U1MA 4RU2A 3I5CA 2C3YA 2FQQB 4O4GA 1JIHA 2HVZA 4QIGA 3FKBA 1D1UA 4J5OA 1S49A 5I42B 3LANA 2VU5A 1AUSL 4QCLA 2G1HA 4NLGA 1VI7A 2Z4PA 5AXKA 2ZD1B 2QA4G 3T5LA 4LFCJ 5L1JA 3W64A 3IRXA 4PQUB 3Q2TC 2HLTA 1IWAA 4JI1F 3MD3A 3CE8A 2R7OA 1VLYA 4DSLA 2VDHA 4OHVA 3FRZA 2V8PA 3M05A 3NXZA 5BXIA 3M8RA 2IAJA 3B6BA 3KDOA 3O3LA 3AJ1A 4X4NA 2HRUA 3VR1A 2FDNA 1ZM4A 2FZCB 3MEEA 5HAOA 2V2QA 4H4OA 1IM4A 1HI8A 4O0IA 1AZSB 5F8JA 2XNRA 2X1BA 5KFBA 4LR7A 1CC8A 2N7CA 2WK4A 2KVIA 1EETA 2RMLA 3N0VA 5G0RA 2XG8A 4ZHRB 4ZP9A 3H2VE 3MR3A 4DN0A 5IM0B 2C2OB 2CVIA 4OX7A 1P1TA 4IFVA 2HVEA 2N3OA 2CWKA 2EFOA 2OLWA 5H1SV 3IBCB 1TKXB 1FFSB 4Q2MA 4LRAA 1LWCA 3NL0A 4G1PA 2B4UA 2V50A 4LFBJ 5KFZA 2JFKA 2RAQA 4RW6A 4RW7A 5JXSA 1N48A 4DDFA 2BJEA 1K44A 3DDKA 1MN7A 2J7KA 1DTQA 3QWPA 4G6VB 3AY0A 1UJ4A 3UN2A 2OH2A 3B8HA 1XTZA 2MQLA 1HA1A 3O5TB 4BDPA 2HBRB 2YPYA 3QT6A 3PG9A 3N6MA 3FVYA 3UNYA 3G6ES 2Q3PA 3P45B 3SQGA 1VQOS 4AL5A 2HHUA 2OPQA 3RB4A 4F4WA 4FF2A 3EDQB 4DL5A 5KG3A 3MMBA 3HHDA 2F7VA 4O4GB 3ZXWA 3NWRA 4DPWA 3J7AN 4ZCKA 4TU7A 1HWKA 4JB8B 4YB5A 4KB7A 1WKKA 4CNYA 5A76A 1PBUA 3GFXA 3GJSB 2BA9A 4TU8A 1TV6A 3C14B 4TY9A 1OIAA 1U2CA 4LQ3A 4USJC 4OZ1A 1UCNA 3PACA 4X4PA 4KRWA 4GKKF 1UEUA 3IRXB 4ZPBA 3W8PA 4DPUA 3LO3A 4DJBA 3VGSA 4NOHA 4O3SA 4ED8A 2Z58B 1N34F 3MECB 4OZ2A 4IOCQ 3FMBA 4DV7J 1SQGA 3FGVA 1S9EA 3IM8A 3ELHA 1T3NA 4FYWB 1Y10A 4LF7J 2V0NA 3JYTA 3BO3A 2IAJB 4C3KA 2GAHC 5LJ3Y 3MUTP 4JOUA 1VMBA 3MEEB 3PHEA 4H4OB 2XMTA 1UA1A 3HSZA 5B0FA 5DDOC 1EETB 2P9CA 3GPAA 3DLGA 5G0RB 4EO6A 4DSFA 1U2FA 4GRSA 2K1RA 1KVKA 2GQCA 2I8EA 4WP3A 4FDFA 1GQEA 1HYSA 2IVYA 2MKCA 4QIFA 2Q6CA 1MU2B 5KT4A 5GVQA 3PYGA 1LWCB 3GG1A 4QPXA 2CQIA 1UFKA 1JXVA 2V2KA 3V4MA 4NA3A 4RW6B 4RW7B 3PNIA 1S9FA 3JSMB 2ZBQA 4PR6A 2HBQB 1BHNA 3BDEA 4F8RA 1DTQB 3BKTA 1VFJA 2MKYA 4K50A 2W9BB 4DV4J 1NZAA 2DH8A 4H4KC 2VFSA 2ZUGA 1FJCA 4I6AA 2C3PA 2GNKA 2O66A 3PIOQ 2Z8QA 3ZNJ1 1S0OA 3JQJA 2XMMA 3NAHA 4X4VA 3ZZTA 5F41A 5C5JA 4Q2LA 2YH0A 2OPQB 5EUHA 1TQLA 3TA2A 3JAMY 4ZCLA 3K5OA 5B0BA 1RWMB 2QL7B 4J9VA 4LSZB 2PGCA 2HAIA 2QG9B 2FC8A 4FXVA 4CO5A 4OI2A 4KO0A 1FKOA 2EVZA 3TP2A 3BH6B 2PA3A 5FD1A 4PG6A 3D0IE 2FUG9 4EZ6A 3CC2S 3UO0A 1RBAA 2XWXA 5CABA 2UP1A 2HGNA 1B0PA 2WZ1A 3SFGA 4EBDA 1JNZB 5MAOA 3EYZA 3EXCX 4D3HA 5GMEA 2CVEA 2L9DA 1RWNB 2F8HA 1NPKA 1P27B 1MROB 4CQ1A 2XCAA 4A8YA 3HO1A 3KLIA 2HWIA 1S9EB 2ZNZA 3JYTB 2OMOA 4TQSA 1KQFB 4GKJF 2IDLA 2CDRB 3CCLS 4K0KJ 1S0VA 3F41A 4DFJA 3LOUA 3TQEA 4HHJA 4QOTA 4FF3A 2HYIB 4NZ7A 2A18A 2HKEA 1S77D 2CQBA 1KOOA 4ETZA 3A4TA 1X4DA 4DV1F 5LL6d 2K1RB 2JOQA 4FNIA 2G2OA 1VQ6S 1CC7A 1HYSB 2YWHA 4DR5F 1J2VA 1RB0A 3L9ZA 1EZZB 5IOLA 3AA9A 3SMZA 3VTIA 1PYSB 3M8PA 4P2SA 3NGKA 5KFYA 1H7WA 2DYAA 3B78A 1M5HA 1OPIA 1A0OB 1RSCA 4F3MA 3DU6A 4NLRA 4FYDA 3B4MA 4TU9A 4JI0J 3CULA 3KLFB 2M4MA 5KFWA 2LP4A 4IOAQ 1DTTB
chains in the Genus database with same CATH topology
4ZN1A 2LQ8A 1M1GA 3H7HB 1NPRA 3LPEA 3QQCD 2OUGA 2K06A 3P8BB 1NZ8A 3EWGA 4ZN3A 2EXUA 1NPPA 2XHCA 1M1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZN1 A;  2LQ8 A;  1M1G A;  3H7H B;  1NPR A;  3LPE A;  3QQC D;  2OUG A;  2K06 A;  3P8B B;  1NZ8 A;  3EWG A;  4ZN3 A;  2EXU A;  1NPP A;  2XHC A;  1M1H A; 
#chains in the Genus database with same CATH topology
 1WG4 A;  1HBU A;  3OL6 A;  3RBZ A;  4QIV A;  3MI7 X;  1N6Q A;  3CD7 A;  1S10 A;  1JXE A;  4ZVP B;  3DXS X;  1QTN B;  4LMZ A;  4ES2 A;  1KFD A;  3ILJ A;  1FFG B;  4I1T A;  4DR6 F;  2MQ8 A;  3SSS A;  4JUZ A;  5ETS A;  1HNX J;  4KO0 B;  2DO0 A;  4JI7 F;  1FKO B;  3V6D B;  1SIW B;  3VCD A;  4URS A;  4ZVS B;  2ATL A;  1XC9 A;  3OTC A;  2C2N A;  2R7R A;  3KOA A;  3A3O B;  4N76 A;  2DH7 A;  1C0T A;  2OPR B;  4RNH A;  3G8T A;  4C0H A;  3KLI B;  1IJE B;  4Q44 A;  1FRI A;  3HZE A;  4KGK A;  4XO0 A;  2OKQ A;  3H5X A;  2AT1 B;  5ETQ A;  4QR1 A;  1LFW A;  4JI2 F;  5EX0 A;  5KFU A;  3RGI A;  2BJ8 A;  2FJB B;  2VA3 A;  2QL5 B;  4YB7 A;  1RCX B;  1D9F A;  2WB1 D;  4CH7 A;  1U1R A;  2M8H A;  1NEE A;  3W5X A;  4OV6 A;  2YQ0 A;  2YKN A;  1PIL A;  1M5S A;  2DCU B;  2V63 A;  2VOO A;  1DAR A;  4CZC A;  3GR1 A;  1FA0 A;  3NY0 A;  5T7L A;  3KMQ A;  4WWS A;  2HZV A;  4ATN A;  2HFS A;  4NLD A;  4S0M A;  1L3K A;  3M8P B;  3HJV A;  5K20 B;  1ICE B;  2KDO A;  1KOH A;  3KLH A;  4CLP A;  4EO8 A;  3F0N A;  3CO0 P;  2EPI A;  1HPZ A;  2LXU A;  3LAM A;  2ZOM A;  2R9L A;  2NYH A;  1CQN A;  1IKY A;  1TL7 A;  1ROF A;  4J7C A;  2ASL A;  4DR3 F;  4PKD B;  4X64 J;  3EZO A;  1HBU B;  4UTG A;  1SBR A;  3VAH A;  3D6F B;  4CO0 A;  1UAW A;  2LQ9 A;  2KJW A;  2UU9 F;  2VDI A;  4RLE A;  1TL5 A;  2QSW A;  4WKY A;  2AV5 A;  5G4D A;  1O8B A;  1Z4U A;  1IQZ A;  3MAQ A;  3PKY A;  2NXE A;  3OW2 R;  3PFE A;  2BUN A;  3DRP A;  1S9G B;  4E0D A;  2R7S A;  3PO4 A;  2YKO A;  4ZN1 A;  2KTQ A;  5DZ7 A;  3NWG A;  3I5A A;  2YNI A;  2XGQ A;  5HQ8 A;  1Q79 A;  1SL2 A;  1C0T B;  1WG5 A;  3MOJ B;  1WJ9 A;  2IA6 A;  2XZW A;  7AT1 B;  1N5Y A;  3HKW A;  3KG4 A;  3PXG a;  2MXY A;  2ZC3 A;  2ZWP A;  4C3L A;  1C0U A;  1N33 F;  3CCV S;  2Q43 A;  4WP8 A;  2C22 A;  1UJ6 A;  4KGX B;  1CUL B;  4GMK A;  2UXD F;  4ED0 A;  4C8L A;  5B0D A;  2NQP A;  2GIR A;  3HHE A;  2FYX A;  2YKN B;  3BQ2 A;  2JEF A;  2DBB A;  4I7F A;  3FZB A;  4WCE Q;  4ZKA A;  4ECZ A;  1VBY A;  1DQA A;  4UOH A;  2HQ3 A;  3T1H J;  2V8G A;  4MK7 A;  2C42 A;  3FBC A;  4X4T A;  3D5M A;  5KG5 A;  4X4S A;  5HVG A;  1GAO A;  2FZG B;  5HL7 Q;  3M9M B;  5KFR A;  3LGM A;  3CUN A;  1J5O A;  1KN6 A;  3ONQ A;  4CI0 B;  2BQR A;  2AGP A;  2E29 A;  2J9C A;  5D15 A;  4CP5 A;  2VOP A;  3S01 A;  1ZPW X;  1IBL F;  2DHH A;  1IKY B;  1TL7 B;  3AOC A;  2N7Y A;  2LEA A;  2MSS A;  2VBZ A;  4YHH J;  1NJI T;  4OLO A;  2AMC B;  4JV5 J;  4PG5 A;  1G6B A;  3VQS A;  1PJ7 A;  2R8K A;  2GC8 A;  4U96 A;  2VPW B;  2R7Q A;  4OX9 F;  3T5K A;  3K5P A;  3EXY A;  3TR5 A;  4CO2 A;  2SXL A;  1Q95 G;  1RIS A;  4L76 A;  4NCB A;  3DRP B;  1FDN A;  4YQW A;  3DHX A;  2E9Z A;  3AT1 B;  4F4K A;  5EWE A;  2HSE B;  3H4D A;  4YR0 A;  4MYT A;  3GCW P;  2CJQ A;  1U0H B;  4HDG A;  1UVN A;  2GA7 A;  2O01 C;  3R3T A;  1OMS A;  2BKP A;  2IRY A;  5KFQ A;  2EKN A;  2O3D A;  3OFG A;  5E41 A;  1IWG A;  1RHQ B;  1VQP S;  3J81 Y;  1N5Y B;  1Q8B A;  2Z0G A;  4M5I A;  1RT5 A;  1U48 A;  1U4B A;  2YX4 A;  1WF1 A;  1WOR A;  5BYS A;  4ZVU B;  1GEH A;  4LRE A;  4U6P A;  2U1A A;  1C0U B;  2KZM A;  3T5H A;  3ILI A;  4HT7 A;  2B4O A;  4O3Q A;  4ZJL A;  4B9N A;  1YTY A;  2PDA A;  3UR0 A;  2JVO A;  2DO4 A;  1VBK A;  1NJZ A;  2DR7 A;  3BJY A;  5F8M A;  2ZIT A;  1SC4 B;  4I7F B;  2W7O A;  5J2M A;  4U7U K;  4Q43 A;  5JUM A;  4FYY B;  4M5L A;  1CJU A;  1ELO A;  2B56 A;  1TKD A;  5A8K A;  3CWJ A;  4USM A;  1ZBT A;  3LP1 A;  3I55 S;  2VQE F;  3OTO F;  3LPE A;  4TVA B;  3WC2 A;  2B6A B;  1IR2 A;  3D4J A;  1WI8 A;  4ZPW R;  1EKR A;  5KFO A;  2K8G A;  2N4D A;  1V5V A;  2J0W A;  1UTA A;  1I94 J;  2CPX A;  3M30 A;  3GIR A;  4QBU A;  5H9F J;  1BLU A;  1WD6 A;  3TAR A;  1SH2 A;  4WK3 A;  2ROG A;  3NCQ A;  2BAB A;  4N7T A;  4X2B A;  1MMD A;  1X4F A;  1TP7 A;  2MQN A;  4HLB A;  1Y4Z B;  4DUY J;  3NS6 A;  3EWG A;  3L4B C;  4DPX A;  3QID A;  3T3F A;  4LFA F;  2RUG A;  3JB9 k;  3ILL A;  2JC0 A;  3MMA A;  2H5E A;  4Y2A A;  2JDJ A;  1HNV A;  3BRE A;  3CME S;  1GFW B;  2LDI A;  3DLL Q;  1ZZF A;  3MFI A;  2JRS A;  4DV6 J;  4ANC A;  1OPZ A;  5JMN A;  1YI2 S;  7FDR A;  5L46 A;  4JI3 F;  3RB6 A;  1IBK F;  4M95 A;  1NH8 A;  1B7F A;  3H8Y A;  3NEK A;  3L7P A;  3MCS A;  4OI4 A;  2OAU A;  2NXC A;  2QZ8 A;  3CNQ P;  3V6H A;  1HHT P;  1AB8 A;  3H5Y A;  3G4S S;  1RT5 B;  4DWI A;  5CZX A;  1SUQ A;  2KHC A;  3SQO P;  2K7J A;  1JKH A;  3J7A 1;  3MPY A;  1ZYQ A;  1ZM9 A;  1GMU A;  4F4X A;  2C3M A;  1RCO B;  4NCG A;  4FVM A;  1XR5 A;  4M5D A;  2BE7 D;  5DQH A;  4KSE B;  2OJ3 A;  2Z2Z A;  3QFW A;  1Q8K A;  1S79 A;  1RBO B;  3TZW A;  1F2G A;  2WBM A;  2HFU A;  3D0G E;  3NGU A;  1I51 B;  3H98 A;  2YH1 A;  5J2M B;  3N5F A;  3D7S B;  2MZ1 A;  3D3B J;  4WE1 A;  3TZX A;  5A8K B;  4J9M A;  4QR0 A;  3GE9 A;  3LP1 B;  3OHA A;  1RWP B;  1RYS A;  4HT5 A;  2KFN A;  4TN2 A;  1FFW B;  4WPA A;  1WOP A;  2VAS A;  1RTZ A;  3OPK A;  5RUB A;  2YX7 A;  4LF4 F;  1RU2 A;  1RLD A;  2RRA A;  1TK8 A;  3R27 A;  1FVQ A;  1S59 A;  2PN6 A;  2V9K A;  1UEV A;  3EPG A;  2RDI A;  2QLW A;  3CJS A;  4P74 A;  4ZLN A;  1GX6 A;  1XMO J;  4WII A;  2DB1 A;  5AXL A;  3FRY A;  2XGP A;  5K8O A;  3C3L A;  5F9L A;  3HHL A;  2P6S A;  3A8J A;  1FJG J;  3GWC A;  4OJG A;  4LRD A;  2EK1 A;  3MMA B;  1OWX A;  1HNV B;  2I6W A;  2VA2 A;  5J1N A;  2JEJ A;  4IRK A;  1LWE B;  1V3S A;  1Q7Y T;  1UP1 A;  4KH0 B;  1WEY A;  3AD9 C;  1MN9 A;  4NI2 B;  4NLT A;  4LIR A;  4MMO A;  3NS7 B;  1H7X A;  3W9H A;  2FVR A;  2JHE A;  4U9R A;  1SJ4 P;  2DNM A;  3I82 A;  2BW2 A;  2CQ0 A;  4QYZ K;  2AIR B;  2MZJ A;  2GJI A;  3CDA A;  3L7U A;  4ERD A;  1KQG B;  1DJ0 A;  2COL A;  2V69 A;  2LXF A;  3PJX A;  1SUQ B;  3RB3 A;  2GX8 A;  2R2T A;  1JKH B;  2VFV A;  4ZDN A;  4Y6I A;  3S1T A;  4NCG B;  4M5D B;  4ENO A;  2HZC A;  2OFG X;  5DM7 Q;  5DGA A;  1YRT A;  2IRU A;  3CD6 S;  2DXD A;  3KHL A;  4DHV A;  2CPI A;  4URQ U;  3HKZ D;  2QC3 A;  3EMT A;  4WYL A;  3T9N A;  3J7Y U;  4WE1 B;  4YUD A;  1C1C A;  3IBW A;  5CYM A;  1UZD A;  1WTB A;  1U7L A;  1P9Y A;  3DYA A;  3P4U B;  4ZPV R;  5HK4 A;  1GX5 A;  4WBF A;  4IOB A;  5E5N A;  5BR8 J;  3OBI A;  3M2V A;  1LWX A;  4LFC F;  1H3D A;  3CMQ A;  3RW6 A;  4IQM A;  5CCM A;  2YKP A;  5KFG A;  2IM2 A;  4ED1 A;  2P5V A;  2GZO A;  4HR2 A;  3CSK A;  3SYZ A;  1BGX T;  2J7W A;  2AW0 A;  3EZU A;  1SQF A;  1D8Z A;  3HHL B;  3W62 A;  1F9E B;  3G96 A;  1MWQ A;  2VIC A;  1V3Z A;  3W7B A;  4OI3 A;  4FBT A;  5F3Z A;  4DSK A;  1Q78 A;  3FCH A;  4GVB A;  1S97 A;  3US5 A;  4C11 A;  5C25 A;  1JLG A;  5SUH A;  4YDX A;  2MKJ A;  3KG1 A;  3OV7 A;  3CCR S;  4C97 A;  1UKU A;  3KDN A;  5KFE A;  5KFI A;  1GXU A;  2V67 A;  2YNH B;  3QSY B;  3HPO A;  1JK9 B;  4QU6 A;  4B3S F;  5EDW A;  1N4L A;  5CYQ B;  3E2E A;  4ZLL A;  3NCR A;  2IM1 A;  1RAG B;  2B9W A;  5KFF A;  3HMJ G;  2RS8 A;  4LFB F;  1MG7 A;  1FE0 A;  1RAD B;  2FVQ A;  3BN7 A;  5SZT A;  3SXL A;  5ETV A;  1S1W A;  1GMW A;  1NME B;  3Q8U A;  1ZZN A;  2NCK L;  3D2W A;  2XSJ A;  5FLX Y;  3FJ2 A;  1U45 A;  4DFP A;  2CIM A;  5FJ4 A;  4OHW A;  3KFW X;  2G0J A;  2DNP A;  4MH8 A;  2ASJ A;  2CJA A;  3T41 A;  4U8Y A;  2ZZT A;  4DUZ J;  1EKS A;  5CH7 B;  3N6N A;  4NYO A;  1T3O A;  3UDV A;  5U47 A;  1T9X A;  2R7X A;  1VS3 A;  1XBW A;  1VC5 A;  1C1C B;  5DGB A;  5CYM B;  1EJ7 L;  4NWB A;  3UN3 A;  2Y9H A;  9ATC B;  4A8S A;  3DYA B;  2FGC A;  2K2P A;  4DS4 A;  1EIY B;  2RIJ A;  1HLW A;  4HTJ A;  3MCO A;  2HIQ A;  5AE2 A;  1D0E A;  3KUE A;  4ZVF A;  4MK9 A;  2CJY B;  2XI2 A;  4RW9 B;  1GNK A;  3MCN A;  1NZ8 A;  1RAF B;  3TVY A;  4OYO A;  3SSQ A;  1URN A;  4LF7 F;  2HQI A;  5LSL A;  1YIJ S;  1JQG A;  3MR5 A;  3CJK A;  3EVM A;  5DLF A;  2Q79 A;  5J1E A;  2VG6 B;  4PPZ A;  4KKO A;  2QMX A;  4R8U A;  4CYU A;  4IFY A;  1R0A A;  4R0J A;  4C11 B;  1JLG B;  3U02 A;  1BE4 A;  1S4F A;  4J9Q A;  5F0W A;  1SJR A;  2DNQ A;  1N5S A;  3TI0 A;  2FY1 A;  2WHO A;  3BYR A;  3DI6 A;  2FC9 A;  3V6J A;  4DEZ A;  2GO9 A;  4MIA A;  3QIP B;  4HHU A;  2UVW A;  4BHQ A;  1GMW D;  1Q8L A;  4PUO B;  2XMA A;  2OEJ A;  4A46 A;  1RT3 A;  1S1W B;  3BO2 A;  3PEJ A;  4KC5 A;  5B08 A;  2ZH9 A;  1ZAV A;  1YSJ A;  1YZ7 A;  4ZVH A;  1NJY A;  4F4Y A;  3R1H A;  3KLG A;  3CJR A;  5DET A;  5BYQ A;  2FLP A;  3JS9 A;  4ECW A;  1AYE A;  1DY3 A;  4Z2X A;  2M8D B;  3ENW A;  1N8R T;  4B3T J;  2DHX A;  1UEK A;  1HI0 P;  2GQ2 A;  1YKW A;  4DUT A;  2OD4 A;  1FKA F;  1SIZ A;  3JAM U;  4N56 A;  4DV5 J;  4AQY J;  1T03 B;  1FKP A;  2XO6 A;  2DGW A;  4F0K A;  3HK2 A;  3GIM A;  3BYP A;  2DNH A;  1OYE A;  1CJK B;  1WOO A;  4GVL A;  3CCZ A;  3QLH B;  5GAG I;  1QAJ A;  5J2N B;  3CDW A;  2DTJ A;  2HNY A;  5CZV A;  5F8I A;  1LK5 A;  1KVI A;  1RI7 A;  2C2R A;  2LQ5 A;  2DNR A;  4B9T A;  2B8P A;  1M5P C;  5HMW A;  4RNO A;  2VPX B;  4MKV A;  2CPH A;  4WTO B;  4ZPD A;  1DFD A;  2WW8 A;  1CEZ A;  4WU2 A;  1SB6 A;  3M1V A;  4EEY A;  5KFC A;  4HI2 A;  1XEZ A;  1IUJ A;  3CJK B;  1HW8 A;  2E44 A;  1JLF A;  2K3I A;  1UJ5 A;  4R8U B;  1RLC L;  4CYU B;  2LEP A;  5L1I A;  3E01 A;  3CED A;  4IFY B;  1R0A B;  1RHJ B;  5DO2 A;  1NAQ A;  2P6T A;  4K59 A;  1X5S A;  1GTE A;  2APO A;  4QWB A;  3CCW A;  4USW A;  1KHW A;  2J6T A;  1UFW A;  4XPC A;  3VAI A;  3DI6 B;  2R8J A;  4X4O A;  3NNA A;  4WFZ A;  2XY6 A;  2GVD A;  2CAJ A;  3QT5 A;  3AOA A;  4AL6 A;  3TEG A;  2ZJR Q;  1RU1 A;  4HVZ A;  3UN5 A;  1RT3 B;  4ZN3 A;  5JJB A;  3P8B B;  3ZC4 A;  2QFI A;  4OHZ A;  4DLE A;  1CJV B;  2Y8Y A;  4YOE A;  4EMD A;  2KL8 A;  2ZWO A;  4OYA A;  2AGQ A;  1YX2 A;  3I0R B;  4DV0 J;  1NJX A;  2BR0 A;  2MJN A;  1C2P A;  4X62 J;  1ACM B;  4ID8 A;  4YB6 A;  1T95 A;  1RHU B;  2E7W A;  3C16 B;  1KFS A;  3DKD A;  2V2Z A;  1UVM A;  4K4V A;  3Q8Y A;  3HSJ A;  4LSN A;  4ZPT R;  2M2B A;  3OQ2 A;  3VF0 B;  3Q8V A;  2NXN A;  1HMV A;  3T6J A;  1FKP B;  1X4H A;  4C0O C;  4DR2 F;  1CLF A;  3R6G B;  4OX6 A;  3CJ2 A;  2XS5 A;  3WX4 A;  4RNN A;  2ZH1 A;  5ETO A;  2VON A;  1PYO B;  1SJQ A;  2DT9 A;  4CM0 A;  3GYN A;  2B8Q A;  2HNY B;  4XAK A;  2L08 A;  2J8A A;  4J9N A;  1X8D A;  1Q5Y A;  3JSB A;  4DCJ B;  1VQN S;  3C19 A;  1ULR A;  4WFY A;  1TAQ A;  5DG7 A;  1T05 A;  4ES1 A;  2ZH2 A;  4ED6 A;  3PM9 A;  5K14 A;  2HHX A;  4QYR A;  2XTJ P;  1GMV A;  3JSY A;  2NSC A;  1KSP A;  4RR5 A;  1SC1 B;  3JQM A;  2XHC A;  1RKJ A;  3E01 B;  1NK0 A;  3K5N A;  2L48 A;  5ETP A;  3BGL A;  3PYE A;  4L75 A;  4NLQ A;  5HI7 A;  3A3P B;  2HQC A;  3N4W A;  1R3N A;  3FBB A;  2YKM A;  1HD1 A;  3ITH A;  3UFC X;  3BEG B;  4C9D A;  2CJB A;  4YS2 A;  2DGX A;  4ZP8 A;  3BGU A;  1G7C B;  4HYK A;  4PG4 A;  1W25 A;  3DLE A;  1Q82 T;  4IDK B;  3CD0 A;  2GVD B;  4H4M A;  2FHM A;  2YTC A;  2HHW A;  1Y3J A;  1YBT A;  1WC6 A;  2IM3 A;  3MM6 A;  2NRE A;  2D41 A;  2BM0 A;  4K2X A;  4B17 A;  3ETM A;  4EI2 A;  1VRU A;  2O1P A;  3R6L B;  1HFE L;  3SZ2 A;  3IR6 B;  1KDN A;  2RQM A;  5B0G A;  1TZ0 A;  2GHW A;  5ETM A;  3JTP A;  2VG5 A;  3C6T A;  3HHL C;  3S7R A;  1TTH B;  3PW7 A;  2WVD A;  2IM0 A;  3OVS A;  5KFN A;  4ZVE A;  1LK7 A;  3DRS A;  5IT9 Y;  2PT0 A;  2RRB A;  3BQ0 A;  4W92 B;  2MYF A;  2H1Y A;  1A9N B;  3MTJ A;  1FHT A;  3BB5 A;  3W9I A;  3BSN A;  4TKT A;  4NML A;  3OR2 A;  3N5B A;  2E1P A;  4DCP B;  4MTP A;  5IWA J;  2POK A;  2X1A A;  3ZZR A;  2PMZ D;  1TEL A;  3GFY A;  3M9N B;  1QTM A;  3NGT A;  2IA0 A;  3R2D J;  2DRD A;  1HAR A;  4DR1 J;  2LMI A;  2ACM A;  3PRB A;  5LJ5 Y;  4C8M A;  4DN9 A;  2V2V A;  3L7O A;  1AUD A;  2RVJ A;  3NAI A;  2QFJ A;  2AWZ A;  1U6Z A;  1GXL A;  4RWX A;  1WEX A;  2MGZ A;  2OUG A;  3G6X A;  3NS5 A;  1VQ4 S;  2M7S A;  1SXL A;  2NPI A;  1KS2 A;  4RBV A;  2GML A;  2YKM B;  1XMB A;  3ITH B;  1NM2 A;  2HS4 A;  4ECS A;  1UWA A;  2DY1 A;  1D9A A;  2WSE C;  3HT0 A;  2E1M C;  4WU3 A;  4Z7C A;  1NO8 A;  3DLE B;  4V1A k;  5L39 A;  2VG7 A;  4YFU A;  2WBR A;  3DOL B;  1YQH A;  4P71 A;  2ABY A;  3PYD A;  1TL3 A;  3MM6 B;  2E5L J;  1X0F A;  1VRU B;  5HLF A;  1AT1 B;  1P1L A;  2GGP B;  1YBU A;  2XBP A;  4F02 A;  3CCU S;  4WFB Q;  4L3K A;  1MNE A;  2A1B A;  2RU3 A;  5HVF A;  2VG5 B;  3C6T B;  1FE4 A;  3U7J A;  4KT0 C;  4V19 X;  1GK8 A;  3K59 A;  5C24 A;  3MM9 A;  5DDP C;  4YHH F;  4NA2 A;  2QX0 A;  3UCG A;  4O44 A;  2J76 E;  4OYX A;  1RTJ A;  3KK2 A;  2N82 B;  5K9F A;  1HWL A;  2ZEJ A;  2DVI A;  2MZQ A;  3M8Q A;  4CLY A;  4Y00 A;  3I5B A;  1S1V A;  5DLG A;  4YR2 A;  2HBZ B;  3OR2 B;  8AT1 B;  2BZ2 A;  3W8G A;  3C8Y A;  3A12 A;  1N5T A;  3TAM A;  1QAI A;  3U1L A;  4E8U A;  2CDQ A;  3MPU B;  3VVU A;  1YJV A;  1X4G A;  1FXD A;  1UZH A;  3V6K A;  4L74 A;  1RTD A;  4ED4 A;  3H5U A;  3BSA A;  2QEX S;  3EDR B;  2JLG A;  3HSD A;  4U67 Q;  4OZ5 A;  2OP5 A;  2IPO B;  2JSX A;  2EEY A;  1RUS A;  3MED B;  1FRX A;  1KC8 T;  1WF2 A;  3AAW B;  3GB0 A;  4P52 A;  2Y0B B;  1WTF A;  1ZTW A;  2YX1 A;  3J81 U;  1PAU B;  2W2Q P;  2E1A A;  2EFG A;  2CQD A;  4KBI A;  2GV1 A;  4DCO B;  1Y0H A;  1W2I A;  3CCM S;  2EFV A;  2MGZ B;  1HR0 J;  2Q6B A;  2C2M B;  3AXK A;  1REV B;  3NBP B;  5I4M A;  4P9S A;  4USV A;  3CTR A;  2FVC A;  2MTL A;  1RTI A;  3QZ8 A;  4CLL A;  1SQE A;  2DIT A;  3BS9 A;  4FS2 A;  3ISN C;  4AT1 B;  3NOC A;  4GO5 X;  2L41 A;  2DRA A;  4PWD B;  2XYP B;  2ZH5 A;  4DR4 J;  3K5L A;  2DD8 S;  3TZZ A;  4XTT A;  1FRJ A;  1QLN A;  5A8R A;  2NR0 A;  4C0B A;  3K8V A;  4F25 A;  1TL3 B;  3H2U B;  1U2R A;  3DOK B;  1UW4 A;  4C8N A;  5HLF B;  2KT3 A;  4QWC A;  4KR0 B;  1Q4R A;  4ZS6 A;  4DX7 A;  2CNK B;  3VAK A;  4F7V A;  1U1L A;  1I94 F;  3IFE A;  4EGL A;  1L3T A;  2DXE A;  4JI5 F;  1CG2 A;  3N01 A;  3MFH A;  2WVF A;  2V34 A;  3AH6 A;  1W7W A;  5C24 B;  3MM9 B;  4C8O A;  2KVQ E;  4DUY F;  1RKI A;  3IWN C;  2NXU A;  2H4W B;  3M4X A;  3ZZ0 A;  1H98 A;  1LQ9 A;  5HMX A;  4ED2 A;  3DDI A;  2BXJ A;  1ITP A;  4P7T A;  4EK2 A;  3PRD A;  4F0M A;  4QQB A;  1PCA A;  1QUP A;  1S1V B;  2Y1L B;  1T9Y A;  2XB2 D;  3CJ5 A;  4DV6 F;  4F2S A;  3QSI A;  2MY7 A;  1Y11 A;  5KFJ A;  1HBN A;  2QTW A;  7FD1 A;  1FXL A;  4L73 A;  2ZJQ Q;  4NLV A;  3O1L A;  4LIW A;  5T14 A;  1RHK B;  2HPU A;  3PW5 A;  3IMQ J;  3NKY A;  2VL1 A;  1I3O B;  5HVH A;  2AHO B;  3S6E A;  1CSJ A;  5KFA A;  3TOQ A;  3PZP A;  3ICL A;  5D78 A;  2ZFH A;  1MWZ A;  4TYA A;  3DOM A;  3DLK B;  2BJ3 A;  4DPO A;  3A8I A;  2CJX B;  2I5J A;  1HKA A;  2MHE A;  1IBM J;  5HQM A;  4ILM A;  5C42 A;  3QO9 B;  4F0H A;  2ZC4 A;  4GKK J;  3T19 A;  1P8G A;  2H5I B;  1VQY A;  1R6Y A;  1EX8 A;  1YK9 A;  3PR4 A;  3OLA A;  4DFK A;  4OX8 A;  1XQI A;  2HK2 A;  4B02 A;  1RWX B;  2I2Y A;  4FNH A;  3W66 A;  3GZ7 A;  1RTI B;  1UWB A;  1YWX A;  4NXN F;  1F0X A;  4I2P B;  1CPZ A;  1U1K A;  1RGV A;  3IA0 A;  2QV6 A;  2AZ1 A;  1LW0 B;  4Y2I A;  2EWH A;  1Y9O A;  2V8H A;  2XEX A;  4I6W A;  4K4T A;  3GIK A;  3PRV A;  3NNC A;  1ZA1 B;  5A8R B;  3CCJ S;  3H25 A;  1VQ8 S;  2FZK B;  3PCO B;  2AEJ A;  2XMW A;  3W9J A;  1IKX A;  4DXL A;  3HXM A;  1M1H A;  1S4E A;  1X4A A;  1RHR B;  1RT4 B;  4ZPA A;  2CZ9 A;  1R0C B;  2V6A A;  4CO4 A;  1AW0 A;  3D1O A;  2DGS A;  1NPP A;  3QJP A;  1XMO F;  3MGJ A;  3UE2 A;  1VIX A;  1V3R A;  2MZT A;  4B3M J;  3UNG C;  4A8M P;  1U47 A;  3KXD A;  2GJF A;  2MQP A;  2VPY B;  1QE1 A;  4F2R A;  3PVX A;  2RQK A;  2D3Z A;  4X65 J;  4K4U A;  3IC1 A;  4CH1 A;  4A8F A;  3MUV P;  4R25 A;  2FGO A;  2OD6 A;  5ETT A;  3VAJ A;  3CT9 A;  4A8Q A;  1HNZ F;  4FXD A;  1C4C A;  1JLB A;  2ZJP Q;  4OI0 A;  3THT A;  3UW1 A;  2UXC J;  1HBN B;  2KYZ A;  2ZM6 J;  4J9U E;  2ERR A;  3CDE A;  2VB6 A;  3SCJ E;  5KOW A;  3G8S A;  4EYH B;  4K2J A;  1N32 F;  4IR1 A;  3PJW A;  4RW4 B;  1BQN B;  4UOC A;  4NLS A;  3DOM B;  1QY7 A;  5D6G A;  3RUB L;  3NCP A;  4K5R A;  4LF6 F;  3LQV A;  3EE3 A;  1WC3 A;  3VGV A;  1M5O C;  4UZB A;  1FTR A;  2YQ3 A;  1BQM B;  1JJ4 A;  1KKH A;  1OQ6 A;  2F5G A;  4PAA A;  1YJR A;  2ZBI A;  4BLG A;  4RPF A;  3DM2 A;  3CD5 A;  4DL2 A;  4I67 A;  1TU0 B;  4DL3 A;  1VC6 A;  5CD4 H;  1UWB B;  2XMU A;  3AFG A;  1KP6 A;  3I0S A;  3POT B;  1PJ5 A;  5F8L A;  2RRN A;  5KFT A;  3SI8 A;  1T9T A;  5GMD A;  4GKJ J;  3BR9 A;  1N52 B;  2D3U A;  2WTF A;  4NEZ A;  3B4D A;  2RKI A;  2EKY A;  2KXF A;  5L9X A;  4DL7 A;  4KHM A;  2NLW A;  1IKX B;  2QA4 S;  1FER A;  4NZ0 A;  5BR8 F;  1M5K C;  3LAK A;  1TK0 A;  4DV1 J;  1Y5I B;  2X1G A;  1O6X A;  2IHR 1;  1RAC B;  2JLE A;  3LUY A;  1VIS A;  3DRR B;  2MLY A;  4QU7 A;  1NUE A;  1PAE X;  3EX7 B;  1N88 A;  3L95 X;  1YJT A;  3BDP A;  2DHG A;  4ITS A;  2OEL A;  5DQI A;  2O67 A;  4IQX A;  3OXF A;  3QMQ A;  4NA1 A;  4PZV A;  2VKZ G;  2BRK A;  3UCU P;  5KFH A;  1RAA B;  1JXL A;  4PG8 A;  3UQS A;  2B9Y A;  4USK A;  4MKA A;  3M6X A;  3EM1 A;  4IYQ A;  2DJW A;  5ETK A;  4DL0 C;  4DSI A;  2C3U A;  4B9L A;  2CPJ A;  3M2R A;  1JLB B;  4UQT A;  1VQM S;  1UVK A;  2CKW A;  1QSY A;  1RWO B;  5LSR A;  1RTH A;  3BKU A;  3RBE A;  2KM8 B;  3FSX A;  3ZZY A;  2F1F A;  3CMA S;  3GFZ A;  3IN5 A;  2R7W A;  2XMJ A;  5AT1 B;  1NKE A;  1FEE A;  4TY8 A;  3SEO A;  4ELV A;  1R7I A;  3IAS 9;  1V6H A;  1HNI A;  2F40 A;  1U24 A;  1B0T A;  4PXC A;  5HBM A;  3KJV A;  2AZ3 A;  5FLX U;  4I4B A;  3T1A A;  3PW4 A;  2RS2 A;  2V4R A;  1J5E F;  3DM2 B;  2DHA A;  3I31 A;  4A4J A;  5GAH I;  3K58 A;  1T94 A;  1JLC A;  4DLG A;  3DLH A;  3H7H B;  2H65 B;  3MXH P;  1XR7 A;  2PE8 A;  3I0S B;  4YY3 F;  2QLX A;  5L1K A;  3WIV A;  3MR2 A;  4M5J A;  4N47 A;  1F5C A;  5IC4 B;  4ZA1 A;  4JI2 J;  2VZ9 A;  2UV8 A;  2MKS A;  1H2V Z;  4IFV B;  1NK6 A;  2RKI B;  1X60 A;  4LSL A;  1TKZ A;  1Q7L B;  2YPZ A;  1NK8 A;  2KU7 A;  1H2U X;  4BBY A;  4HH0 A;  3LW5 C;  1R8H A;  2HHH J;  3CC7 S;  3ETO A;  1DLO A;  3V2U C;  1E6Y A;  4G1I A;  2OSR A;  2DNZ A;  3RG6 A;  2W24 A;  4I0W A;  2W8L A;  2WAQ D;  2E5J A;  4FS1 A;  2CQC A;  4K4S A;  4LBI A;  4DL4 A;  3EJM A;  2CPF A;  2UUC J;  3DNC A;  4CT8 A;  5GAE I;  3AB4 B;  2Y0S D;  3SQG B;  3MHY A;  3H20 A;  1WSR A;  1FD8 A;  4DSJ A;  4JI4 J;  1T02 A;  1IKW A;  3QGP A;  4FKY A;  4XDC A;  4KH1 B;  2RDJ A;  3MMB B;  2J7U A;  3OR1 A;  5J1P A;  4USH A;  4OZL A;  2R2S A;  2XMK A;  1NB2 A;  4B3O A;  2PC6 A;  3M2R B;  3HUL A;  4DR3 J;  1XMQ J;  1RAE B;  2NS1 B;  4OJH A;  1NDK A;  2C1E B;  1VK8 A;  1LOU A;  2VC0 A;  3RW7 A;  1X31 C;  1TV6 B;  4YEA A;  3WDO A;  2OSQ A;  4ANE A;  1F5B A;  1RTH B;  3PV8 A;  2MKI A;  2ASD A;  2IY5 B;  4DFM A;  3DXB A;  2EG2 A;  1U1O A;  2KFZ A;  3LWL A;  1LNQ A;  3CJ0 A;  1TR0 A;  3DC2 A;  2C2K B;  1S5Z A;  4TY8 B;  1F1B B;  2BQ3 A;  1HNI B;  1S76 D;  2ROE A;  2KG0 A;  2OI2 A;  1WC1 A;  3TO8 A;  2JLF A;  5HBM B;  1S7H A;  3KJV B;  4OI6 A;  3L3C A;  1A6L A;  3M8W A;  1FT8 A;  2XHW A;  3T5J A;  2R8G A;  2XSF A;  3PDN A;  5FII A;  5F9N A;  1R0B G;  1JLC B;  1RAO A;  2ZOF A;  3FC9 A;  3DLG B;  2UVU A;  1JLA A;  5CHC B;  5A8W A;  2LQJ A;  4KFB A;  2G1D A;  4PXB A;  1N33 J;  4KGM A;  4MJK A;  1Y7P A;  3BH7 B;  4RUC A;  1N56 A;  5ETL A;  4ZVG A;  3K5M A;  4LSL B;  1TKZ B;  1F5A A;  2AJ2 A;  4C4W A;  2FLO A;  3ZO7 A;  4OFZ A;  1DLO B;  1E6Y B;  3ZTQ A;  4MYU A;  2BAN A;  1XIQ A;  3J7Z 5;  1T9V A;  1S0M A;  3KHH A;  1P9Q C;  5D4N A;  3FNN A;  1BC6 A;  2VUG A;  2XI3 A;  5H9E K;  1D3W A;  1WKJ A;  2FHJ A;  2PMW A;  1OJ4 A;  2DH9 A;  4DR7 J;  4PCQ A;  2XUL A;  3G82 A;  4C98 A;  2JVR A;  4X66 F;  4XDD A;  1IN0 A;  1E6V A;  4ZLJ A;  3FQL A;  1GT8 A;  3NMA A;  2YWG A;  3FUY A;  4QYZ J;  4DX5 A;  4AFF A;  1UVL A;  1IBL J;  3OR1 B;  4WKR A;  1RXO B;  1IBC B;  2F4V F;  2JEI A;  1XK8 A;  4B3O B;  2D3O 1;  3V4I A;  3UI3 A;  5KG0 A;  4CLZ A;  2CPD A;  2HND A;  4OJ3 A;  3UR3 C;  3RR7 A;  3OD2 A;  1K8A T;  4IR9 A;  1YHQ S;  4OX9 J;  3FK4 A;  3CC4 S;  3OXG A;  5E3Q A;  5KFV A;  1QAY A;  2OIH A;  3KJN B;  2GIQ A;  2WB4 A;  3VZI A;  1KLN A;  1RT7 A;  3R5A A;  3A3N B;  2V4J A;  1Q86 T;  3D1Q A;  3U27 A;  1M5V C;  4C2M A;  1IJF B;  1Y00 A;  3GJT B;  1U1P A;  4JI6 J;  1K47 A;  2IVF B;  3DGP A;  2W2P P;  3GR0 A;  5B09 A;  4X62 F;  3I56 S;  3W61 A;  1YRU A;  4DX6 A;  3UDL A;  4ECV A;  4WZM A;  1KRP A;  4F50 A;  1KHV A;  2BAC A;  1QM9 A;  1JLA B;  3MEG A;  2WVB A;  3DLB A;  3VGU A;  1EB0 A;  4D3G A;  3OJU A;  4Q0B A;  3W65 A;  4U8V A;  2B3T B;  2BM1 A;  1NND A;  2Q1L A;  2AKW B;  2UUB J;  3CW2 C;  1U0S A;  4P2F A;  2LVW A;  2VQF J;  4J9R A;  2BAN B;  4N5S A;  2FHJ D;  2VIH A;  2I1R A;  3Q24 A;  1G2E A;  4LBP A;  3OLB A;  1S6O A;  2A0F B;  2KXH A;  4JI8 J;  4KHP J;  2XC9 A;  4CLU A;  3UPF A;  1VGY A;  2DIS A;  4YME A;  5KT2 A;  1EHW A;  4HAC A;  4NRU A;  3P6Y C;  5C7P A;  3RBX A;  2DEJ A;  1F60 B;  1YZ6 A;  3G82 B;  1SH0 A;  3D1H A;  4K4Z A;  1YJW S;  1E6V B;  2VHG A;  3KMS A;  3UCZ P;  1RBL A;  4L72 B;  4MFB A;  2AGO A;  2DR6 A;  1N6Q B;  3ET6 A;  3Q89 A;  4U7C A;  1HBO A;  4BWM A;  1ZAX A;  2FHK A;  3IRW P;  1MMN A;  1OYD A;  3QGH A;  1S12 A;  2AYM A;  1UA0 A;  3NRB A;  2H4Y B;  1UET A;  2HND B;  2HAF A;  5KFD A;  3LA0 A;  2FJD B;  4M5K A;  4PWW A;  3M32 A;  3RAM A;  4RW8 A;  2QL9 B;  1HIY A;  3MPD A;  3AOB A;  3U1N A;  4PEO A;  2B0G A;  4PYD A;  4IRC A;  2ZE2 A;  3TVK A;  4KE5 A;  4MAK A;  3RRG A;  3SV4 A;  2F3J A;  2V4J B;  4QWE A;  4O3O A;  1WDT A;  1YLX A;  3SSR A;  1IBK J;  3N6L A;  3OFF A;  2QRR A;  2W01 A;  5KAK A;  4DSE A;  1U49 A;  2HHQ A;  1RJJ A;  3DN9 A;  1SCJ B;  4OZN A;  3R7S B;  3KLE A;  2CRL A;  2QLJ B;  1AFI A;  4I6Y A;  2F8E X;  2E5G A;  5I3P A;  3C2P A;  3MEG B;  3FEY B;  2RIL A;  5IT9 U;  4LF2 A;  1VRT A;  3GLJ A;  2F9D A;  2PFD A;  3GG0 A;  2LA6 A;  1FI4 A;  5T7L B;  4UZC A;  5IWA F;  5LXY A;  1FK9 A;  5AJ3 F;  1GH8 A;  5KT5 A;  2H48 B;  4IUF A;  1L3S A;  2KM8 C;  3ZZZ A;  5F0U A;  3W5Z A;  1VYA A;  4O3R A;  1NPR A;  2XM3 A;  2BEF A;  3KLH B;  4RX6 A;  3IG1 A;  1HPZ B;  2P9E A;  4DR1 F;  4ETX A;  3HD1 A;  4J37 A;  3PJ9 A;  1NSQ A;  2ZBC A;  4K4W A;  2M3D A;  2RF2 A;  1S0N A;  1U09 A;  4YR3 A;  3GJR B;  2JH3 A;  5A2Q Y;  3GJQ B;  1DRZ A;  4LF4 J;  2HK3 A;  5D4L A;  2BE9 B;  3ET6 B;  4FYX B;  1HBO B;  4AL7 A;  3TAP A;  1R8A A;  2E1C A;  3OFE A;  3P5T L;  2W4C A;  2GIF A;  2X51 A;  3I87 A;  3O44 A;  2Z2M A;  3HX9 A;  3VVT A;  2LDY A;  1GXT A;  3TA0 A;  3BSC A;  2VFU A;  3HVT A;  1Q16 B;  1I1G A;  4UY8 5;  5E3R A;  2P8I A;  4X4R A;  2RH3 A;  4J90 A;  3D68 A;  2VJU A;  1YBA A;  4RW8 B;  1AZS A;  2R4F A;  2R8H A;  3OHB A;  3W2V A;  3MPW A;  4CLF A;  2YNI B;  2E5L F;  1BD6 A;  5B0A A;  3F73 A;  1PKU A;  3KK3 A;  5D3G A;  5I3Q A;  1S6U A;  4ECU A;  2CQH A;  4DF8 A;  2F4F A;  2XZD B;  3NGR A;  2MMY A;  1M0S A;  3GYX B;  2N4C A;  2HQF A;  3T1Y J;  2PD1 A;  3HDS A;  1QSL A;  1OY6 A;  4P6Q A;  3DU5 A;  4DV3 F;  1N36 F;  2B4V A;  1C1B A;  1R27 B;  1U6F A;  3GFH A;  4DI6 A;  1BWE A;  4Q7A A;  3HHK A;  4OYM A;  4CH0 S;  4IH5 A;  4J9S A;  3I4P A;  2W1B A;  2DR5 A;  1VRT B;  2Y1J A;  3HF5 A;  2DNN A;  5DG8 A;  4BC9 A;  1TMM A;  2K7K A;  3NP5 A;  2ZH3 A;  3W63 A;  3GQC A;  5LMN J;  1M1G A;  4ED7 A;  2QLB B;  4TLQ A;  5LSO A;  1BMQ B;  2HQD A;  4CNZ A;  2ALZ A;  3KYL A;  3HCX A;  3AJ2 A;  2MLX A;  2V8V A;  3K0J A;  2ILY A;  3MPV A;  2AU0 A;  2HHV A;  2VPZ B;  4Z7Y A;  2BJ9 A;  1J5O B;  2E5H A;  1NHV A;  3IG1 B;  1O5J A;  3CCT A;  4JV1 A;  2DRB A;  2ROP A;  1X5T A;  1VR6 A;  1FDD A;  1HQ2 A;  1R6V A;  4PXE A;  4USI A;  2DXF A;  4V19 J;  2HVH A;  2B43 A;  2RF2 B;  4ZIW A;  2W25 A;  1OSD A;  3C14 A;  2DGO A;  3EGV A;  4OZJ A;  2UUA J;  1LXJ A;  2CJ9 A;  1KON A;  3D6M B;  1HR0 F;  1FX4 A;  1WC5 A;  3BGR A;  2W4P A;  4OMF G;  4W98 A;  2FPH X;  2XYH B;  3KUG A;  1TK5 A;  3MEC A;  2GS8 A;  2JX2 A;  1Q5V A;  4DBQ A;  3NOG A;  3I4H X;  5HJX A;  1RAH B;  3TJ8 A;  1LXN A;  4JYA J;  4J9O A;  1CVJ A;  1S6P A;  3GV7 B;  2GCF A;  3HVT B;  5HAT A;  3MEK A;  4DR4 F;  3TNV A;  4B9U A;  4QJV A;  2DY9 A;  4P72 A;  2UZA A;  4K5S A;  1XJW B;  3OUY A;  4K4X A;  1VQK S;  2MLZ A;  1IM6 A;  3ZTS A;  1QDU B;  3W2V B;  5HMY A;  3TUZ C;  4CLW A;  3CIZ A;  1RYR A;  1SVD A;  5DZ6 A;  4EYI B;  4ER8 A;  3OL7 A;  3KK3 B;  4P2M A;  4CRJ A;  2D1C A;  3AXM A;  5D3G B;  1YRX A;  3CPW R;  2L3M A;  2WVE A;  5KT7 A;  4B3S J;  1MU2 A;  4FN5 A;  3DFE A;  2V68 A;  3WBZ A;  3SCL E;  3ULH A;  2PEH A;  2NXJ A;  3VAL A;  5LOQ A;  1N5V A;  3ISZ A;  3JSM A;  5EGY A;  3QRQ A;  1C1B B;  4MIB A;  2BQU A;  5J2P A;  3A13 A;  2W9B A;  3NGS A;  3P96 A;  1EQM A;  1CJU B;  1L5U A;  4YP3 A;  3BR8 A;  4OI1 A;  2WOM A;  3MMC A;  3R7N B;  2UXB F;  4LF5 J;  3LH2 S;  3K8W A;  4F67 A;  1RQ0 A;  2KN4 A;  1FDB A;  4I69 A;  2DNL A;  3TEH B;  4LF9 J;  1CQM A;  1O51 A;  3F44 A;  4ECQ A;  2JFD A;  3P5B P;  4RUH A;  3EVW A;  4M5G A;  5ETN A;  4DX8 H;  1ZOT A;  1MWY A;  3M30 B;  3BSO A;  3FDS A;  4K4Y A;  4FPR A;  1JX4 A;  1IBM F;  4KV8 A;  4ZMM A;  4A8K A;  4C8K A;  4NLP A;  4UW2 A;  3PX6 A;  1Z1Z A;  2ATC B;  2F65 A;  4L3N A;  4HDH A;  2YWF A;  4NYZ A;  3Q8R B;  3K89 A;  1VJQ A;  1V5I B;  1XNQ J;  4C48 A;  1VK3 A;  1F9F A;  3VAF A;  3BGR B;  3FEZ A;  2FJA B;  2VFR A;  4Q45 A;  2FTR A;  2YKQ A;  1MRO A;  4AXI A;  1ZTT A;  5CYJ A;  1SJF A;  2YNG A;  1S6P B;  3SBM A;  2XNQ A;  2KI2 A;  3W5Y A;  1H74 A;  5DQG A;  1Q53 A;  1VBZ A;  2VD3 A;  3OUY B;  4A8W A;  2IJN A;  2W2M P;  2AQ4 A;  2E1R A;  1LV5 A;  1RAI B;  1F9H A;  2CJK A;  2BJ7 A;  4DS5 A;  1K1S A;  3T9Z A;  3PEH A;  1Y5N B;  2HHT A;  2AJ0 A;  1XER A;  4HI1 A;  3BN4 A;  4LJM A;  3KUH A;  1R8C A;  4IH6 A;  2W2O P;  4MKB A;  5KFM A;  1WOS A;  3AD7 C;  4AD6 A;  3OFH A;  4B3M F;  2Z2L A;  3LP0 A;  4EFA C;  4ZCM A;  4X65 F;  1SJ1 A;  4F36 A;  1D09 B;  3MR7 A;  5J2P B;  4FF1 A;  3HZG A;  2O5D A;  2NYI A;  1FO1 A;  4P7V A;  2GHP A;  3KLF A;  4PPD A;  2WOM B;  3MMC B;  4X4U A;  1DTT A;  2WVC A;  1TUG B;  3HFV A;  2UXC F;  1NKB A;  4ZVO B;  1L3V A;  2ZM6 F;  1FNM A;  3TAN A;  3NG8 A;  5F8G A;  3GSI A;  1VQ5 S;  2ZDP A;  4TNO A;  4RJV A;  2X7I A;  2ZHO A;  5D0E A;  4GO7 X;  8RUC A;  2PO4 A;  2IIH A;  4B9S A;  1UPM B;  3GV5 B;  3VQT A;  2NUH A;  2XY5 A;  1MLA A;  4KV8 B;  3V6D A;  3K57 A;  2MQM A;  3QZ7 A;  2CQ3 A;  1HHS A;  2ZBP A;  4PYA A;  4EUV A;  3V5R A;  2DGV A;  2V5H G;  2KRR A;  1OO0 B;  2OPR A;  4QR2 A;  3DLJ A;  1NDC A;  3M7V A;  3J80 Y;  2YNG B;  4HEA 9;  2PA8 D;  3M9O B;  2GQQ A;  3BPS P;  3THV A;  1TVR A;  2NSB A;  1DAX A;  4E2F B;  3AJD A;  2EBE A;  2KZZ A;  4FPI A;  2BOA A;  5FDL A;  2ILZ A;  5HJY A;  3PYF A;  2W4D A;  2YKA A;  3CCS S;  3PO5 A;  3SFU A;  3R7B B;  5HAN A;  3QJL A;  3EGN A;  5IZH A;  2V4Q A;  3O6Q A;  2XS7 A;  2BMB A;  2W2N P;  2AJ1 A;  2X3D A;  3CJ4 A;  2HIY A;  3LGN A;  5HN0 A;  2KYX A;  4IO1 A;  1N54 B;  3Q23 A;  3LP0 B;  3I96 A;  2MKH A;  4Y28 C;  3MAH A;  5EHH A;  2NZC A;  4H54 A;  5M2P A;  4LR8 A;  4CO3 A;  2A10 A;  2ZKU A;  3M6U A;  4LF1 A;  1MSW D;  4NAS A;  3LAL A;  2XO7 A;  5B7W A;  1S48 A;  3WX8 A;  3HVA A;  5KFS A;  4N8N A;  2MZS A;  3CJ8 A;  5IQQ A;  1RWK B;  5KT3 A;  5LXR A;  2EI5 A;  3M2V B;  4NXM J;  1NJW A;  1ZPV A;  2OGU A;  4OYP A;  2QGF B;  1SPB P;  5DM6 Q;  4NLW A;  1F2H A;  1UL3 A;  4BCA A;  4DR2 J;  1BXN A;  5D77 A;  4RUA A;  1HNW J;  4DV7 F;  1S9G A;  4OJ1 A;  3SV3 A;  4F3Q A;  1I6J A;  2J0X A;  2H9Z A;  4G3I A;  1Z2Z A;  1MW7 A;  2CFX A;  2HVD A;  4O23 A;  1R89 A;  4TLR A;  1TAU A;  2RSQ A;  3DDN A;  1FWK A;  3HJF A;  4CCH A;  2EFQ A;  5D0H A;  2VC1 A;  3CB4 A;  4A8O A;  4GVB B;  5HQL A;  2ZVI A;  5C25 B;  1AFJ A;  4CLK A;  4M63 A;  4ECT A;  3H42 A;  3TX8 A;  3H90 A;  5ADZ A;  5KFK A;  3O8W A;  4OHY A;  2MJU A;  4NCA A;  1TVR B;  2UV8 G;  4J9P A;  3TJ9 A;  3H59 A;  3EPI A;  3WQP A;  3VV2 B;  4ELT A;  4KPC A;  4ELU A;  2IYG A;  4OYW A;  2QA2 A;  5FDL B;  1KNZ A;  3KNG A;  1VBX A;  2XS2 A;  1CUL A;  3L09 A;  3EGZ A;  2WON A;  3TW0 A;  2HHH F;  1RT6 A;  4UST A;  2H51 B;  1X4C A;  1KD1 T;  1JJC B;  2CNL B;  3OVB A;  2HVI A;  5KOX A;  3KNA A;  3MUM P;  1ARO P;  2XSJ B;  4F26 A;  1A7G E;  4DV4 F;  2BOP A;  3I9V 9;  1EAY C;  2B9E A;  2UUC F;  1NDL A;  3B54 A;  1RWV B;  2OFH X;  3UD3 P;  4OIX A;  1YJN S;  3J7Y I;  4UQG A;  3M6W A;  2JEG A;  4JI4 F;  1KLM A;  2EBG A;  3ILO A;  2JL9 A;  3N28 A;  2KFY A;  3UDE A;  3RAX A;  3AQO A;  1HQU A;  2J0Q D;  4JBC A;  5D4P A;  1YJ7 A;  1XMQ F;  4CM2 A;  5T41 A;  4WJB A;  2FHO B;  3AQP A;  1LWF A;  3HVR A;  3G6V A;  2D74 B;  4LF8 J;  5KFP A;  1S1T A;  4WFN Q;  3I32 A;  4Q8E A;  3WZ0 A;  2HFZ A;  4RKU C;  3TQ1 A;  4RNM A;  1VHF A;  4ECY A;  1TKT A;  3DCA A;  4NX9 A;  5HMZ A;  2OEM A;  2EW9 A;  3D3C J;  5MLC V;  1YJU A;  2ADC A;  1NK5 A;  4XPE A;  4ECR A;  5GMK a;  3Q8P B;  1U6B A;  5HO4 A;  2X1F A;  1U1Q A;  5L8R C;  3HP6 A;  1U0H A;  4K0K F;  2HFV A;  2CNN B;  1EAR A;  1R31 A;  5J1E B;  4Y3C A;  2RQC A;  2BKO A;  2FJX A;  1TMJ A;  4KKO B;  2XZT B;  3Q2S C;  1IQT A;  1U1N A;  3ZTR A;  3BO4 A;  2IMW P;  3QPI A;  3IWX A;  3PY8 A;  3OSP A;  3VZH A;  8ATC B;  3D0H E;  2WCX A;  2LA4 A;  1VQ7 S;  1EP4 A;  4W90 B;  4DG1 A;  1NHU A;  5IFM A;  2WON B;  3PW0 A;  4RZR A;  3D9B A;  1RT6 B;  3Q0A A;  3FCV A;  2CG4 A;  1S57 A;  3IR5 B;  2LEB A;  1S1X A;  2AEM A;  1X9S A;  5I3U A;  1Q0N A;  3Q8S B;  1PG5 B;  2ZUA A;  3E8O A;  4AYB D;  2EFN A;  3KLG B;  3RRH A;  4JI0 F;  3RTV A;  1X4B A;  4DR7 F;  5EN1 A;  3MTK A;  2B6A A;  4Y2M A;  1K0V A;  2GVZ A;  4WZQ A;  2YVS A;  1W2B R;  2HLU A;  3KKF A;  1SL1 A;  1KLM B;  4M8L A;  4WXW A;  5E3A A;  5A6P A;  3TUJ C;  4Q8F A;  3LGH A;  4RL1 A;  1G4C A;  2KB2 A;  1ZS6 A;  1SH3 A;  1HQU B;  4CIO A;  1DUR A;  1SKU B;  3MF5 A;  2RDD A;  2JC1 A;  2AEF A;  2PII A;  3FEX B;  1HNX F;  1XWL A;  1LWF B;  4P73 A;  4U95 A;  1S1T B;  5DJB A;  2JJ4 D;  3OTB A;  2VJV A;  4DF4 A;  3VAM A;  2Z2Y B;  2XCP A;  4O4R A;  5KG7 A;  2LEC A;  1YDL A;  1TKT B;  4WYW A;  3GON A;  1KTV A;  2QE5 A;  2HRY A;  1FRM A;  2RJZ A;  2UVV A;  3R9L A;  2U2F A;  2YWK A;  2BYC A;  2OEK A;  1SC6 A;  2J8S A;  4HL9 A;  1WHX A;  5AXM A;  2IJR A;  5D8H B;  2KG1 A;  4F4A A;  4M94 A;  1TUV A;  3R5C A;  2MB0 B;  4M5H A;  3M1V B;  1T7P A;  4JI6 F;  3N79 A;  4DQR A;  1JLF B;  2D9P A;  2D7S A;  5E3C A;  2A2C A;  4NEY A;  4ES3 A;  4QWA A;  2QA1 A;  2CQ4 A;  2PMH A;  1WKL A;  3KHR A;  1Q81 T;  2QYG A;  2CNO B;  3FFI A;  4DPY A;  1HW9 A;  1WEZ A;  1CJT A;  2VKR A;  4UF4 A;  2AX0 A;  4ZJO A;  1EP4 B;  1XNR J;  4DG1 B;  3FZ2 A;  2RU9 A;  4Z37 A;  4KY3 A;  2UUB F;  2W7P A;  2M9K A;  4PWU A;  1RHM B;  4PAB A;  4Y34 A;  3WC0 A;  2VQF F;  1PC4 A;  3GU0 A;  2KHD A;  1KQS R;  3S8S A;  1P6T A;  1S1X B;  1WHY A;  4WXO A;  4WFA Q;  3TUP A;  4ZVT B;  4JI8 F;  5I3U B;  4KHP F;  1K1Q A;  2M70 A;  2RHS B;  1YG0 A;  3KG0 A;  3DHW C;  3FBE A;  3RU0 A;  5LMU J;  1QVG R;  1T0T V;  4OZ0 A;  2DIV A;  5DDQ C;  1QSS A;  4DV2 J;  1SKR A;  2GVZ B;  4X64 F;  4I68 A;  1V9O A;  3R1L A;  2PFF B;  2Q66 A;  5KG1 A;  4EWT A;  4LSN B;  4JI5 J;  4DOZ A;  3NLC A;  4XIU A;  3HT3 A;  1HMV B;  4ZIV A;  3W1Y C;  1U1M A;  2CG8 A;  1VJW A;  5LM7 E;  1FJ7 A;  1JWW A;  1WUU A;  1R43 A;  4FF4 A;  4YDD B;  4LVN P;  3FMW A;  3UD4 P;  3JQK A;  1AXQ A;  3ZZU A;  2QT7 A;  1LWE A;  5E2Q A;  5K8P A;  3CJQ A;  3K2Y A;  3GIJ A;  1PC5 A;  3R97 A;  4NI2 A;  4UUW A;  4YB1 P;  3GYG A;  2QMW A;  2MY8 A;  3FBF A;  2BJ1 A;  5K8M A;  1FCA A;  1WC0 A;  4QW9 A;  1T05 B;  4M1K A;  5K14 B;  4OZ3 A;  3UVJ A;  1T11 A;  2XLI A;  3G6Y A;  3IS9 A;  3DMJ A;  2CPE A;  1WSV A;  4B3R J;  2RB7 A;  2AJQ A;  3FQK A;  3MMJ A;  5LT5 A;  1OQ3 A;  2DEI A;  5HRO A;  2AYB A;  4TYB A;  1FRK A;  3D28 A;  1FES A;  3ZZO A;  3GIL A;  3FFI B;  3OTD A;  1VIO A;  4OLP A;  5K8N A;  2ZZN A;  1CJT B;  2MZR A;  2N3L A;  2W9A A;  3T1H F;  1F6T A;  3H0P A;  4QPT A;  4H4M B;  3MM7 A;  2HBY B;  4NE9 C;  2K3K A;  2GW8 A;  4NXN J;  1ZH5 A;  2B4P A;  3D67 A;  1SJ3 P;  3CDB A;  4DU7 A;  2DNO A;  4TXS A;  2RHQ B;  2HMI A;  2XYG B;  3Q83 A;  3GMG A;  2VBW A;  1KQK A;  4ALZ A;  4JV5 F;  1CBK A;  3NGD A;  5IXU A;  1HHQ A;  3QAE A;  5A2Q U;  3DRS B;  3ZTP A;  1SV5 A;  2QIF A;  1NSP A;  2QJ3 A;  4P2X A;  4IKA A;  2A6O A;  5CXT A;  4R0E A;  3VAG A;  1U26 A;  1X7V A;  3QBC A;  2ALY B;  2J9E A;  2XMV A;  4NLU A;  3RYL A;  3TZY A;  1XR6 A;  2YXL A;  3QT7 A;  3EZ5 A;  3JTN A;  3ENV A;  1Z2L A;  3CXC R;  4C8Y A;  1WI6 A;  1HWI A;  1Q1K A;  5GAD I;  1AA1 B;  2OTL S;  4IG0 A;  1FTC A;  5IC6 B;  2DIU A;  4CWB A;  2DPI A;  1RWU A;  1HNZ J;  2I9S A;  3H2L A;  1KBR A;  2KT2 A;  4USU A;  1SKW A;  3AHP A;  3TAQ A;  2YNH A;  2IDE A;  1RK8 A;  2RUS A;  4PXD A;  1KWM A;  3AOD A;  3QAT A;  4CT9 A;  4MIW A;  3UVJ B;  4RBT A;  5CYQ A;  4LQ9 A;  4QIE A;  2FVP A;  2WRM A;  1VCT A;  4ED5 A;  2LYV A;  1DQ9 A;  3T1Y F;  1N32 J;  3IS9 B;  3DMJ B;  2HWT A;  4JI1 J;  3R5J B;  1S7I A;  3MAA A;  4HH1 A;  4LF6 J;  5J2Q A;  5H9E J;  3G9C A;  1FF2 A;  2RNE A;  4JV2 A;  5HRO B;  2PEB A;  4LRB A;  4PG7 A;  4ZVQ B;  2VBX A;  3SCK E;  3TUI C;  2DCL A;  4LRC A;  2LCW A;  2VG7 B;  3WHI A;  3M2U A;  5LMN F;  2VFT A;  3RR8 A;  1FWP A;  4ICL A;  3W3S A;  1NU4 A;  3MM7 B;  3TWZ A;  5L9N A;  4KYZ A;  2H3E B;  3RRK A;  2E9R X;  1SI9 A;  2LLZ A;  4B9V A;  4AXJ A;  2CZ4 A;  3QGG A;  5KT6 A;  2E9T A;  2HHP A;  1FWL A;  1UW9 A;  4QWD A;  3MM5 A;  2Y1R I;  2HMI B;  3QRP A;  2E7X A;  4GC7 A;  1B3T A;  4J91 A;  1RT1 A;  2PI5 A;  3MUR P;  2UUA F;  4W4M A;  1FJE B;  2EK6 A;  3J7Z T;  5ETR A;  4O44 B;  1SV5 B;  4RBU A;  4ZIT A;  4NRT A;  1RTJ B;  1LEO A;  1B7Y B;  2YQ1 A;  3KK2 B;  2W8K A;  4OYI A;  3KTQ A;  3HHL D;  4RW9 A;  1WG1 A;  2CUY A;  1QVF R;  3TRG A;  2J9D E;  4K7Q A;  5GAG U;  4KIA A;  4LRF A;  2OML A;  5F8N A;  3M8Q B;  2B5J A;  2DGU A;  1M1K T;  1QAX A;  4JYA F;  1D8Y A;  4MT1 A;  1VLO A;  3TAM B;  4PRF A;  3V81 A;  2AD9 A;  4KGZ B;  4RO0 A;  2IC3 A;  2HEK A;  2VG6 A;  2BDP A;  1RTD B;  4IG0 B;  5HP1 A;  5ITH A;  3C15 A;  2YWW A;  4MKY A;  1BWV A;  4DPT A;  1WNE A;  1WWH A;  3MR6 A;  3O2I A;  4Q5V A;  3KLV A;  4RNF A;  2PSZ A;  1WHW A;  3E3X A;  3OJS A;  5KG6 A;  3QIP A;  2MQQ A;  2GMH A;  4PUO A;  2HZA A;  3OL9 A;  1NRK A;  3AA8 A;  3MAA B;  3PX0 A;  2KO1 A;  3W60 A;  2V94 A;  1N34 J;  5J2Q B;  1VQ9 S;  2MKK A;  3R5G A;  2XLJ A;  3THP A;  2P9G A;  1J5E J;  5KFL A;  1FEH A;  2WSF C;  3M2U B;  5L38 A;  4LF5 F;  4ICL B;  1NKC A;  4ZJQ A;  1U8S A;  1RAJ A;  3PX4 A;  1H73 A;  4LF9 F;  2J6U A;  3P49 B;  4L6V 3;  4YY3 J;  3PHT A;  3H40 A;  1LW2 A;  2DK2 A;  1T03 A;  1QJH A;  3MM5 B;  1QD1 A;  2FD2 A;  5DS7 A;  1IVZ A;  2R42 A;  2RT3 A;  1RT1 B;  1RDR A;  3MD1 A;  1CJK A;  1D9D A;  4NPO A;  5HSP A;  3QLH A;  5B0E A;  5J2N A;  1DHM A;  2AX1 A;  1XNQ F;  3I9Z A;  1FJG F;  1PO6 A;  3HI9 A;  5IT4 A;  1BQX A;  2GHV C;  1NK7 A;  5F8H A;  4M5M A;  2MDA A;  2ZHB A;  4OQJ A;  2B5J B;  4CLT A;  1HWU A;  2RD5 C;  2AJF E;  3JXO A;  2ZOG A;  1Y3K A;  3CF5 Q;  9RUB A;  3V81 B;  2ZHA A;  2ZH7 A;  2IC3 B;  2H54 B;  4CO1 A;  3HD2 A;  4DQS A;  4ILL A;  4U7U D;  2Z56 B;  2NUU G;  3VHQ A;  5HP1 B;  3RBD A;  1HI1 A;  3MM8 A;  2FY8 A;  2MPU A;  1PYT A;  3C15 B;  6FDR A;  4BWJ A;  5JVH Q;  2Z30 B;  1HD0 A;  4BC7 A;  3QQC D;  2CXE A;  4AE5 A;  3HM9 A;  3MWB A;  4DQP A;  2R2U A;  4KQZ A;  3D6H B;  4EZ9 A;  2I5J B;  2DGQ A;  1NXI A;  5C42 B;  3CIM A;  5CCL A;  1N0U A;  2P2C B;  3G86 A;  3WIU A;  2CPY A;  2DR9 A;  2ZKT A;  3MDF A;  2M0G B;  2QMU B;  1M90 T;  1TFY A;  1UFL A;  2AYE A;  2G4B A;  2ASY A;  5BYR A;  1QUV A;  1U25 A;  2CQG A;  3KK1 A;  3RB0 A;  3SIP B;  3D6T B;  1YVF A;  1CJV A;  4FXW A;  3CGI A;  4NMX A;  2KJV A;  1GTH A;  5M2R A;  2CQ2 A;  3I0R A;  1J27 A;  2VH7 A;  4I56 A;  2DPJ A;  3AD8 C;  4LUB A;  3ISN D;  3QNW B;  1MML A;  3C16 A;  2HWH A;  3IGV A;  3HVW A;  3OT9 A;  2HGL A;  1LW2 B;  2JNJ A;  2Y3Y A;  2EG1 A;  1VQL S;  1WF0 A;  5IT0 A;  4DR5 J;  4Y65 A;  1PIE A;  2LXI A;  5E33 A;  2HW3 A;  2HG4 A;  2ADB A;  2OPP A;  2AYG A;  2BRL A;  3GP9 A;  1QE1 B;  2D69 A;  2G0C A;  4O3N A;  4P10 A;  1FVS A;  4CLS A;  4WIQ A;  4IO9 Q;  2V9W A;  6FD1 A;  1REG X;  3E51 A;  4GC6 A;  2UVR A;  1SC3 B;  3J80 U;  4F4Z A;  4DU8 A;  2MEW A;  3HFZ B;  4X66 J;  4WFX A;  4KGV B;  4HHH A;  4A48 A;  1YGY A;  1B99 A;  4ILR A;  2BBE A;  3MM8 B;  2OO4 A;  3EIC A;  2RQ4 A;  3G71 S;  2MST A;  2F4V J;  2YNF A;  2H5J B;  4EBC A;  2LKZ A;  4DR6 J;  3R2C J;  2L9N A;  5E0O A;  1S72 S;  4DL6 A;  2QO3 A;  2AP6 A;  3ENQ A;  5H9F K;  1FNO A;  4B08 A;  4ECX A;  4UY8 T;  4NLX A;  1FD2 A;  2FVS A;  4JI7 J;  3Q22 A;  3OXL A;  2ACY A;  3CDU A;  1O0P A;  2BJD A;  4IDK A;  1B64 A;  1FX2 A;  3R5D A;  4LR9 A;  4G65 A;  5E7O B;  3CCE S;  3BKF A;  3LPY A;  3QFH A;  1T8E A;  2L9W A;  4DUZ F;  4I2Q A;  2B9X A;  2QN6 B;  3C6U A;  3KK1 B;  2ZNY A;  5DG9 A;  2BVZ A;  2M5Y A;  3IO1 A;  2IVM A;  4AUK A;  2JZ5 A;  2KKH A;  3CJT A;  3IGN A;  2HNZ A;  4QZV B;  3A8K A;  2K06 A;  2X3G A;  1ZET A;  4FVC A;  5EWG A;  4QIW D;  4LT6 A;  4QW8 A;  1KEK A;  3MCM A;  2F9J A;  1HL6 A;  4NXM F;  2V8D A;  3IAM 9;  1TFW A;  2MHN A;  2HS3 A;  5C2C A;  2HHS A;  1RE1 B;  3IXQ A;  1KVJ A;  5F3T A;  2MQO A;  1JJH A;  3ZNU A;  1HNW F;  5D0G A;  2G2Z A;  1UPP A;  1F3F A;  2OPP B;  1RZM A;  3ADA C;  4OV1 A;  2VBY A;  3IM9 A;  2DKO B;  2FIU A;  3BGF A;  3IR7 B;  2WSC C;  5GAD U;  3M6V A;  2LFV A;  2CAD A;  1HBM A;  2KH9 A;  3TVZ A;  1K73 T;  1KR4 A;  2XQC A;  5E3P A;  4ZOS A;  3EGW B;  2W9C A;  4BS2 A;  3KHG A;  1TUW A;  2FB0 A;  2G9O A;  2OTJ S;  2FJW A;  3EUN A;  4ZPC A;  2R8I A;  1WDD A;  2UU9 J;  5KG4 A;  2I38 A;  2YNF B;  1R8P A;  2J0S D;  1XN9 A;  4X4Q A;  2QYC A;  2IJF A;  2D3O R;  3LWM A;  3PFO A;  2BE2 A;  2DGT A;  1JNR B;  1H2T Z;  2BX6 A;  2CZV C;  6AT1 B;  2R7V A;  3TA1 A;  3PIP Q;  1RAB B;  3DOL A;  4KAI A;  3UDC A;  4HKQ A;  1ZA2 B;  1UVJ A;  3KWM A;  3ZFV A;  5DDR C;  2G2Y A;  3JTO A;  4ZCI A;  3A1Y G;  4I2Q B;  4WF9 Q;  2YBV A;  2ZH4 A;  3UD5 A;  1NB7 A;  4MK8 A;  3C6U B;  2GGP A;  4B3T F;  4YN3 B;  3SDE A;  4P75 A;  3T6B A;  3PKM A;  3IBF B;  2C3O A;  3I6P A;  3HLU A;  1VRQ C;  4UT4 A;  3FSI A;  2C2E A;  2XWY A;  5A0Y A;  4DV5 F;  4AQY F;  3RJM B;  5IS2 A;  2HNZ B;  2E5I A;  1PGZ A;  1FXR A;  2CYY A;  3N9U C;  2VF3 A;  1DQ8 A;  3CJ3 A;  2YWE A;  2GO8 A;  2R7T A;  3TJA A;  3R5B A;  3BQ1 A;  2UXD J;  2F8M A;  4F04 B;  4ID5 A;  4LF8 F;  3R8Y A;  2DR8 A;  2HRT A;  1FRH A;  1LKZ A;  3PTW A;  4ZLP A;  3F56 A;  1HQE A;  1H6K X;  2FJE B;  3LF0 A;  1PJ6 A;  3Q8Q B;  5AJ3 J;  1T9W A;  2I0X A;  2BV3 A;  5IV3 A;  1IKV A;  3DRX A;  4ZP6 A;  3FCW A;  4HTI A;  2C28 A;  3KJF B;  2XLK A;  2HQG A;  1SKS A;  4IG3 A;  2AJ4 A;  4DQQ A;  5KFX A;  2Y1I A;  2J5A A;  3LP2 A;  1WEL A;  1IKW B;  4FBU A;  2ZBR A;  4KPY A;  1OS5 A;  2VV5 A;  3GSD A;  3MED A;  4G1Q A;  2NZ4 A;  1HBM B;  1NCL A;  4H4K A;  1S6Q A;  3VWS A;  2W9C B;  3CCQ S;  2R7U A;  1IXK A;  4RU9 A;  5EX3 A;  3X1L B;  4NZ6 A;  3K7R A;  2ZH6 A;  1REV A;  3NBP A;  4NLO A;  4UUX A;  4JV0 A;  1NHK L;  2B7C B;  3P3D A;  1NDP A;  4K8R A;  2G0I A;  4N77 A;  2BE2 B;  2FLL A;  4LVO P;  2OPS A;  4PWD A;  1NK4 A;  4DQI A;  2GMJ A;  2A2D A;  3PR5 B;  5CA5 A;  1CS4 A;  2OHD A;  3W2W A;  4ZK7 M;  1OY8 A;  1X9W A;  2DNK A;  2GFF A;  1H72 C;  4R5P A;  4OL8 A;  1YJ9 S;  2Y8W A;  3M8S A;  4E98 A;  1PSD A;  3DOK A;  2CA9 A;  1N5Q A;  4JP8 A;  1FRL A;  3VGT A;  4DV0 F;  2J9D A;  1H38 A;  3ZZP A;  2CWX A;  4KHR A;  2IBK A;  2C2Z B;  5JVG Q;  3SDE B;  4FKX A;  5A8W B;  4KFB B;  3QRR A;  4FP9 A;  3RAQ A;  4DZ6 A;  1IR0 A;  2HFO A;  5A0Y B;  5D4O A;  4IRD A;  4DZD A;  5KG2 A;  1RA7 A;  1OY9 A;  3OSN A;  2KT5 A;  2G13 A;  4M5N A;  2GAG C;  3RZA A;  4DV3 J;  1N36 J;  3BBB A;  4ID5 B;  3Q86 A;  2YY3 A;  3ZTO A;  2FJV A;  3GCX P;  5CQG A;  3TYT A;  2Z57 B;  2DHS A;  2IFX A;  2M88 A;  3IP0 A;  4NLY A;  2HFN A;  2J6S A;  1HQE B;  5KTQ A;  1RT2 A;  2KXN B;  4OYB A;  1L3U A;  1BUX A;  3DRY A;  1X9M A;  1NSK L;  5B0C A;  1B0V A;  2IRX A;  2VQE J;  3OTO J;  2C2D A;  1DZ5 A;  1IR1 A;  4C3M A;  1IKV B;  3LTO A;  4WK1 A;  1HWJ A;  2F63 A;  1JJ2 R;  2B51 A;  4ZP7 A;  4IG3 B;  3TX0 A;  2JWN A;  3LP2 B;  3QAU A;  1URR A;  3DLK A;  3CVK A;  4J9K A;  2EFP A;  2CQ1 A;  4G1Q B;  5A6W A;  3GII A;  3FSY A;  4EBE A;  1JLE A;  1B4S A;  2HS0 A;  3V4I B;  1S6Q B;  3QO9 A;  3MOZ A;  4O0N A;  4N41 A;  1T9U A;  1NK9 A;  3OVA A;  5EWF A;  3A8E A;  3MZI A;  4LFA J;  1S1U A;  2KRB A;  1X4E A;  1XNR F;  1F3V A;  3BV8 A;  4I2P A;  3BPD A;  1JB0 C;  2ZVS A;  2B7B B;  1JLQ A;  1VC0 A;  1RT7 B;  1LW0 A;  2OPS B;  3PW2 A;  1NH7 A;  1G1X A;  4JI3 J;  5D0R A;  3J81 j;  2QLF B;  5K5M A;  3G8Q A;  2HUR A;  2QSF A;  1WAC A;  1CS4 B;  3W2W B;  5LMU F;  3BBF A;  3D54 A;  2M52 A;  1UVI A;  4UOF A;  4R5P B;  3QJJ A;  3B82 A;  4J9L A;  4DV2 F;  3HHN B;  3GV8 B;  1X0P A;  1B70 B;  4A47 A;  3OL8 A;  4B9M A;  3DGP B;  3BM7 A;  3IWL A;  1VQS A;  4CTA A;  4A8X A;  4RUB A;  2DNG A;  4AND A;  3BZQ A;  2R2R A;  3UWT A;  5THW A;  1RP5 A;  4NL5 A;  4FZV A;  1RT4 A;  2GJ2 A;  3H4B A;  2D9O A;  1APS A;  1FDA A;  4UOG A;  4X84 A;  2R3V A;  4Y2K A;  1K0T A;  4EU0 A;  4OHX A;  3D66 A;  2E7V A;  2AF6 A;  4Q0B B;  3C66 A;  4URG A;  5CD4 A;  3QYY A;  3G2X A;  2PI4 A;  5L1L A;  1TL1 A;  2XY7 A;  1RWW B;  4PQA A;  2RE1 A;  2IMO A;  4DMZ A;  1BY9 A;  3JSR A;  4N8O A;  1U8W A;  1K9M T;  2ZH8 A;  1RT2 B;  2DNY A;  2UXB J;  2ZZM A;  4HAC B;  4Y0F A;  5I42 A;  4C6A A;  3DGV A;  4LBH A;  1JMT A;  1PBA A;  3AB2 B;  2ZD1 A;  3SCI E;  4IH7 A;  3QWU A;  1NBE B;  4TQR A;  1ZM2 A;  2BW7 A;  2E66 A;  4PQU A;  2W7A A;  2CPZ A;  3HFK A;  5C2G A;  1ZAW A;  4RW4 A;  4MFB B;  1BQN A;  1R8B A;  2UUT A;  4B3R F;  1DBD A;  1ZM3 A;  4C8Z A;  1EQ0 A;  1G3O A;  2LQB A;  4FYV B;  2ZDO A;  2A3J A;  5AE1 A;  1TL4 A;  5CAA A;  1WHV A;  1JLE B;  3QGI A;  1BQM A;  1VOM A;  1VHI A;  3BGO P;  3BF4 A;  1C4A A;  1Y5L B;  2EC2 A;  3KJQ B;  3QT8 A;  1NLK L;  3ENA A;  4ED3 A;  5BJR A;  1S1U B;  5AE3 A;  3M32 B;  1N0V C;  4ZVR B;  2EC0 A;  4KJI A;  1WC4 A;  3M8Z A;  4F3O A;  5AXN A;  1SL0 A;  3POT A;  2UUW A;  2ZE2 B;  2LU2 A;  2LQ8 A;  1KTQ A;  1JLQ B;  5IQ6 A;  5IV4 A;  4ZHR A;  4KTQ A;  3H5S A;  2A6M A;  2CQP A;  1X5P A;  5GAH U;  3X3U A;  5IM0 A;  3EVO A;  1W26 A;  4C7Q A;  1UMJ A;  1FNX H;  2IYI A;  3G87 A;  1TKX A;  3M8Y A;  4CDI A;  2HGM A;  2FLN A;  2VOD A;  1LFP A;  2NPF A;  2IBO A;  4CTA B;  3NNH A;  3KLE B;  4XK8 C;  4O3P A;  1NSA A;  4OYZ A;  3CO9 A;  1I5O B;  1OSC A;  3HSG A;  3DRR A;  2WW4 A;  2BKN A;  1Q8I A;  4I64 A;  4NYP A;  3BBC A;  1S99 A;  3K17 A;  4WP9 A;  1X5O A;  2LU1 A;  1YIT S;  3C46 A;  4RWW A;  5DRK A;  1U02 A;  3OTE A;  1RA6 A;  1FK9 B;  2EXU A;  1H0H B;  4Y2C A;  3GTY X;  1TL1 B;  3NMR A;  1VDH A;  4WTY A;  5M2U A;  5GAE U;  3U1M A;  4RU2 A;  3I5C A;  2C3Y A;  2FQQ B;  4O4G A;  1JIH A;  2HVZ A;  4QIG A;  3FKB A;  1D1U A;  4J5O A;  1S49 A;  5I42 B;  3LAN A;  2VU5 A;  1AUS L;  4QCL A;  2G1H A;  4NLG A;  1VI7 A;  2Z4P A;  5AXK A;  2ZD1 B;  2QA4 G;  3T5L A;  4LFC J;  5L1J A;  3W64 A;  3IRX A;  4PQU B;  3Q2T C;  2HLT A;  1IWA A;  4JI1 F;  3MD3 A;  3CE8 A;  2R7O A;  1VLY A;  4DSL A;  2VDH A;  4OHV A;  3FRZ A;  2V8P A;  3M05 A;  3NXZ A;  5BXI A;  3M8R A;  2IAJ A;  3B6B A;  3KDO A;  3O3L A;  3AJ1 A;  4X4N A;  2HRU A;  3VR1 A;  2FDN A;  1ZM4 A;  2FZC B;  3MEE A;  5HAO A;  2V2Q A;  4H4O A;  1IM4 A;  1HI8 A;  4O0I A;  1AZS B;  5F8J A;  2XNR A;  2X1B A;  5KFB A;  4LR7 A;  1CC8 A;  2N7C A;  2WK4 A;  2KVI A;  1EET A;  2RML A;  3N0V A;  5G0R A;  2XG8 A;  4ZHR B;  4ZP9 A;  3H2V E;  3MR3 A;  4DN0 A;  5IM0 B;  2C2O B;  2CVI A;  4OX7 A;  1P1T A;  4IFV A;  2HVE A;  2N3O A;  2CWK A;  2EFO A;  2OLW A;  5H1S V;  3IBC B;  1TKX B;  1FFS B;  4Q2M A;  4LRA A;  1LWC A;  3NL0 A;  4G1P A;  2B4U A;  2V50 A;  4LFB J;  5KFZ A;  2JFK A;  2RAQ A;  4RW6 A;  4RW7 A;  5JXS A;  1N48 A;  4DDF A;  2BJE A;  1K44 A;  3DDK A;  1MN7 A;  2J7K A;  1DTQ A;  3QWP A;  4G6V B;  3AY0 A;  1UJ4 A;  3UN2 A;  2OH2 A;  3B8H A;  1XTZ A;  2MQL A;  1HA1 A;  3O5T B;  4BDP A;  2HBR B;  2YPY A;  3QT6 A;  3PG9 A;  3N6M A;  3FVY A;  3UNY A;  3G6E S;  2Q3P A;  3P45 B;  3SQG A;  1VQO S;  4AL5 A;  2HHU A;  2OPQ A;  3RB4 A;  4F4W A;  4FF2 A;  3EDQ B;  4DL5 A;  5KG3 A;  3MMB A;  3HHD A;  2F7V A;  4O4G B;  3ZXW A;  3NWR A;  4DPW A;  3J7A N;  4ZCK A;  4TU7 A;  1HWK A;  4JB8 B;  4YB5 A;  4KB7 A;  1WKK A;  4CNY A;  5A76 A;  1PBU A;  3GFX A;  3GJS B;  2BA9 A;  4TU8 A;  1TV6 A;  3C14 B;  4TY9 A;  1OIA A;  1U2C A;  4LQ3 A;  4USJ C;  4OZ1 A;  1UCN A;  3PAC A;  4X4P A;  4KRW A;  4GKK F;  1UEU A;  3IRX B;  4ZPB A;  3W8P A;  4DPU A;  3LO3 A;  4DJB A;  3VGS A;  4NOH A;  4O3S A;  4ED8 A;  2Z58 B;  1N34 F;  3MEC B;  4OZ2 A;  4IOC Q;  3FMB A;  4DV7 J;  1SQG A;  3FGV A;  1S9E A;  3IM8 A;  3ELH A;  1T3N A;  4FYW B;  1Y10 A;  4LF7 J;  2V0N A;  3JYT A;  3BO3 A;  2IAJ B;  4C3K A;  2GAH C;  5LJ3 Y;  3MUT P;  4JOU A;  1VMB A;  3MEE B;  3PHE A;  4H4O B;  2XMT A;  1UA1 A;  3HSZ A;  5B0F A;  5DDO C;  1EET B;  2P9C A;  3GPA A;  3DLG A;  5G0R B;  4EO6 A;  4DSF A;  1U2F A;  4GRS A;  2K1R A;  1KVK A;  2GQC A;  2I8E A;  4WP3 A;  4FDF A;  1GQE A;  1HYS A;  2IVY A;  2MKC A;  4QIF A;  2Q6C A;  1MU2 B;  5KT4 A;  5GVQ A;  3PYG A;  1LWC B;  3GG1 A;  4QPX A;  2CQI A;  1UFK A;  1JXV A;  2V2K A;  3V4M A;  4NA3 A;  4RW6 B;  4RW7 B;  3PNI A;  1S9F A;  3JSM B;  2ZBQ A;  4PR6 A;  2HBQ B;  1BHN A;  3BDE A;  4F8R A;  1DTQ B;  3BKT A;  1VFJ A;  2MKY A;  4K50 A;  2W9B B;  4DV4 J;  1NZA A;  2DH8 A;  4H4K C;  2VFS A;  2ZUG A;  1FJC A;  4I6A A;  2C3P A;  2GNK A;  2O66 A;  3PIO Q;  2Z8Q A;  3ZNJ 1;  1S0O A;  3JQJ A;  2XMM A;  3NAH A;  4X4V A;  3ZZT A;  5F41 A;  5C5J A;  4Q2L A;  2YH0 A;  2OPQ B;  5EUH A;  1TQL A;  3TA2 A;  3JAM Y;  4ZCL A;  3K5O A;  5B0B A;  1RWM B;  2QL7 B;  4J9V A;  4LSZ B;  2PGC A;  2HAI A;  2QG9 B;  2FC8 A;  4FXV A;  4CO5 A;  4OI2 A;  4KO0 A;  1FKO A;  2EVZ A;  3TP2 A;  3BH6 B;  2PA3 A;  5FD1 A;  4PG6 A;  3D0I E;  2FUG 9;  4EZ6 A;  3CC2 S;  3UO0 A;  1RBA A;  2XWX A;  5CAB A;  2UP1 A;  2HGN A;  1B0P A;  2WZ1 A;  3SFG A;  4EBD A;  1JNZ B;  5MAO A;  3EYZ A;  3EXC X;  4D3H A;  5GME A;  2CVE A;  2L9D A;  1RWN B;  2F8H A;  1NPK A;  1P27 B;  1MRO B;  4CQ1 A;  2XCA A;  4A8Y A;  3HO1 A;  3KLI A;  2HWI A;  1S9E B;  2ZNZ A;  3JYT B;  2OMO A;  4TQS A;  1KQF B;  4GKJ F;  2IDL A;  2CDR B;  3CCL S;  4K0K J;  1S0V A;  3F41 A;  4DFJ A;  3LOU A;  3TQE A;  4HHJ A;  4QOT A;  4FF3 A;  2HYI B;  4NZ7 A;  2A18 A;  2HKE A;  1S77 D;  2CQB A;  1KOO A;  4ETZ A;  3A4T A;  1X4D A;  4DV1 F;  5LL6 d;  2K1R B;  2JOQ A;  4FNI A;  2G2O A;  1VQ6 S;  1CC7 A;  1HYS B;  2YWH A;  4DR5 F;  1J2V A;  1RB0 A;  3L9Z A;  1EZZ B;  5IOL A;  3AA9 A;  3SMZ A;  3VTI A;  1PYS B;  3M8P A;  4P2S A;  3NGK A;  5KFY A;  1H7W A;  2DYA A;  3B78 A;  1M5H A;  1OPI A;  1A0O B;  1RSC A;  4F3M A;  3DU6 A;  4NLR A;  4FYD A;  3B4M A;  4TU9 A;  4JI0 J;  3CUL A;  3KLF B;  2M4M A;  5KFW A;  2LP4 A;  4IOA Q;  1DTT B; 
#chains in the Genus database with same CATH homology
 4ZN1 A;  2LQ8 A;  1M1G A;  3H7H B;  1NPR A;  3LPE A;  3QQC D;  2OUG A;  2K06 A;  3P8B B;  1NZ8 A;  3EWG A;  4ZN3 A;  2EXU A;  1NPP A;  2XHC A;  1M1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...