1NZKA

Crystal structure of a multiple mutant (l44f, l73v, v109l, l111i, c117v) of human acidic fibroblast growth factor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQFQLSAESVGEVYIKSTETGQYLAMDTDGLVYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFLGIKKNGSVKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic Fibroblast Growth Factor
publication title Accommodation of a highly symmetric core within a symmetric protein superfold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 35
structure length 141
sequence length 141
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1nzkA00
3VT2A 4KBBA 2WRYA 3ZC9A 4D8HA 2AXMA 1VCLA 3N7JA 4KEKA 2VSEA 5F8YA 4KEJA 4JKQA 3ZXDA 3CA3A 3C9ZA 3FJ8A 1UPSA 1JT7A 3S8JA 5E24E 31BIA 3N0KA 1ILR1 1JLXA 4JQ0A 5JMCA 3O4DA 4J2XA 2UUSA 2FDBM 3BRGC 3BAHA 2DREA 3RSJA 5EC5A 5BP5C 3H6RB 3UD7A 4IZEA 4ZFWB 2F2FC 3NBDA 4I4RA 4IHZA 1YF8B 1HKNA 4LO2A 4D0ZA 2FGFA 2D24A 3FJBA 4G9NA 1AVXB 1YXWA 1IRAX 5HPZA 1BFCA 5D63A 3LLPA 3O5WB 1HWNB 4JKXB 1ISXA 3CA6A 3V0AB 2VLCA 3QYDA 4ZLBB 5FZUA 2LIQA 1PC8B 1BFFA 2L5XA 1EPWA 1PZZA 3UJ0A 1ISVA 4OEGA 4A7YA 1PUMB 4G6JA 2Y9FA 3IM7A 3WO4A 3OJ2A 3LTQA 4OUJA 2KLLA 3FJHA 1IJTA 1E0OA 4PC4A 3PMEA 4IONA 2AAIB 3WINA 3VT1A 2D22A 1TFMB 4EFQA 3I2AA 4H9WA 2Y9XE 1DIWA 3FJEA 3FJFA 4GAFA 2ERMA 5DZUA 3CRIA 2RG9B 4I6IA 1FMZA 4I4PA 5G00A 3CA0A 1II4A 4ENDA 1QQLA 2K4AB 5BQUA 3BRDA 4R6UB 1AF9A 4I4YA 2KKIA 5BXPA 1EYLA 1FQ9A 1G9BA 3BAQA 1XYFA 1S0BA 2HW9A 3CA1A 4EKXB 2D20A 1D0HA 1OQLB 2K8RA 3ILAA 4DEPA 2D43A 4USPA 3VSZA 3FUOA 1I1BA 4I2SA 3UDAA 3BA5A 4DCKC 4I4SA 3TC2A 4I4XA 3HBWA 1IT0A 2D7RA 3HN1A 5I1BA 3OBTA 5D62A 1RY7A 2Q3NB 3AKHA 2X2SA 1XZZA 1Z2VA 2FFVA 2KI6B 1K5UA 3HOMA 1V6VA 3A23A 2AQZA 3CU1B 4P0LA 4DENA 3HALA 4XFSA 3BA7A 2F8XC 1AVWB 2AFGA 2MIBA 2Z49A 1FMMS 5DVHA 3O4CA 3WA1A 5EG6C 4I8MA 2NVHA 4G9MA 1RZOB 4IZXA 1JQZA 4ZFYB 2VSAA 1FGAA 4GP3A 8I1BA 4J23B 1WD3A 4Q9PA 4EFPA 3NBNA 1QQKA 3UD8A 3I29B 2HZ9A 3BX1C 3VUOA 1HCDA 1TOOA 3EF2A 4XFTA 4ZKTB 1TTUA 3P53A 4ISQA 4LO1C 3AZVA 4P0JA 5BXRA 3WINC 3FJDA 4J2SA 4HA2A 4I4VA 1S0GA 5EHAA 3VEQA 3IM5A 3F1RA 2D44A 1MC9A 2RSTA 4G1RA 3BAUA 1CVSA 4QALA 4TLPA 4QC4A 1P63A 4CJMA 1DQOA 4I4OA 1PUUB 4AN7B 3NJ5A 4X3AA 1S0DA 2BFHA 5BQUC 1KNMA 4GOYA 1IILA 4I1EA 4HJJA 3P6IA 2DS0A 3AKIA 1M16A 2IHOA 4EEEB 3A22A 4A7KA 4I4UA 3AH2A 4QD2C 2M49A 3O44A 3AJ6A 4JRAA 3W9TA 1YYNA 2X2TA 2E4MA 2KH2A 3O3QA 1G82A 3AKFA 1WD4A 1G9DA 3N7LA 1JLYA 3IIRA 1Q03A 1ISZA 3A21A 1WBAA 4LO3C 4OEEA 4QO3A 4EB2B 2GZBA 2KI4A 1JT4A 1HWOB 2FO1A 2HWAA 1ISWA 1XHBA 4LO1A 3BAGA 1BLAA 1JT3A 3FUQA 4XKIA 1T9FA 2Z48A 3BAVA 3S8KA 1Z0HA 4OEFA 3BA4A 4X38A 2XOAA 1SR4A 3RMXA 3ZC8A 1G9CA 4I1BA 4LO8B 4ZBVB 1ABRB 4Q91A 1Q04A 3JRRA 4D0TA 1FWUA 1AXMA 1ONKB 7I1BA 21BIA 4X39A 2GO2A 3BADA 4LO7B 3OJMA 2ET2A 3WO3A 3SNVA 3OGFA 1FN0A 3E8LC 4IY9A 4QBCA 1MD6A 1FV3A 3ZX7A 3Q7YA 3K1XA 4AN6A 3H6SE 3H6QA 2NYYA 4LO7C 3I2XA 1FWVA 2WBCA 1Z4SA 4A7ZA 3N7MA 3NBEA 5GAQA 3O49A 4USOA 4ISRA 5BOWA 4LO3A 4JP0A 3B9UA 4IYBA 4KC3A 3IAGC 5D61A 3QR5A 5FZYA 1W3AA 3P6JA 2MC2A 3V0BA 1S0EA 3MALA 4HR6C 5BVPI 1BLDA 3FJAA 3WO2A 2NZ9A 2BEAA 4J2YA 41BIA 3BRFA 3BTAA 3FFZA 2VUAA 1TWEA 2E4MC 1IHKA 4G6MA 3WMVA 3POKA 1DZDA 1W3FA 3RTJB 3IM6A 2VXRA 3PHZA 2LIEA 2ZQNA 3F62B 1ISYA 4GAIA 4J2KA 3FJCA 2D7IA 3CRHA 1V6XA 1BA7A 1N4KA 1BASA 4XFUA 4FVVA 1YTOA 4WBCA 2NM1A 3A07A 1EV2A 4Z9WB 1YBIA 3CQAA 3R4UA 4I7IA 2Y9GA 4F83A 1SZ6B 1HWMB 2RQ9A 1WBCA 4QBVA 1TWMA 1JT5A 4Q9GA 1SR4C 4IY8A 4FGFA 4ZOTA 3CRGA 5FZZA 3UJ4A 4L4IA 4QD2B 4OWLA 3AJ5A 4JPZA 1L2HA 1V6UA 1PWAA 2J3PA 4LO0C 3FJIA 5B2HA 1J0SA 1JY0A 3Q7XA 4EFRA 1W3GA 3JUTA 3AZWA 2NP0A 1K5VA 1S0LA 2DRYA 3VWCA 3AH1A 3N7KA 4OWKA 3OBRA 5BXSA 1DFQA 5F90A 2ESUA 4GP0A 3RTIB 5JLVA 3V0BB 5BXTA 2P39A 1DFCA 4L4HA 3BAOA 1ITBA 1EVTA 1DZCA 2DRZA 3VSFA 1G9AA 3MPPG 5DSSB 3RMYA 4I3NA 3O4AA 9ILBA 1R8OA 1FV2A 3NBCA 4H04A 2ZR1B 1T4QA 3VT0A 1BFGA 2BEBA 2ZQOA 1AVUA 4Z8SB 1DJSB 1IOBA 1I1EA 5DUYA 4IQPA 2QN4A 3D7WB 3FGMA 4F34A 5FNWA 2D23A 1V6WA 2NTDA 4II0A 4LO0A 1A8DA 4KEIA 2K43A 4OWJA 1JTCA 4I37A 2IWTB 2D1ZA 2VU9A 1CE7B 5BP5A 1NZKA 3ZXGA 3HSMA 3UD9A 2F2FA 2QYIB 2P23A 1BFBA 3R4SA 3PG0A 4ZA3B 3OJVA 3OGGA 1R8NA 4P6AA 1Q1UA 4YOLA 3AKGA 3PUBA 3CA5A 4ZGRB 1AFCA 3CA4A 3H6RA 1BARA 3FJ9A 3T8SA 6I1BA 3BB2A 4QKRA 4GOVA 5FNXA 4X37A 1HWPB 3AH4A 5F8SA 2Y9WC 3Q7WA 1DLLA 3WMUA 3FJKA 1HCEA 1GGPB 1TIEA 2FFUA 1S0FA 3HMYA 1RG8A 4LO2C 1F31A 1DQGA 1IRPA 2I1BA 4OW4A 1AVAC 4P0KA 2Q9XA 3V0AA 2YUGA 4I4QA 2R9KB 1TP0A 1QXMA 3CAHA 2HWMA 1RMLA 4JAWA 3KMVA 4I0YA 3V79C 2MLLB 4QKSA 5F8WA 1HIBA 1XG6A 1NUNA 3FJJA 1S0CA 4I96A 4ZFUB 3O4OA 1M2TB 2VXTI 3O4BA
chains in the Genus database with same CATH superfamily
3VT2A 4KBBA 2WRYA 3ZC9A 4D8HA 2AXMA 1VCLA 3N7JA 4KEKA 2VSEA 5F8YA 4KEJA 4JKQA 3ZXDA 3CA3A 3C9ZA 3FJ8A 1UPSA 1JT7A 3S8JA 5E24E 31BIA 3N0KA 1ILR1 1JLXA 4JQ0A 5JMCA 3O4DA 4J2XA 2UUSA 2FDBM 3BRGC 3BAHA 2DREA 3RSJA 5EC5A 5BP5C 3H6RB 3UD7A 4IZEA 4ZFWB 2F2FC 3NBDA 4I4RA 4IHZA 1YF8B 1HKNA 4LO2A 4D0ZA 2FGFA 2D24A 3FJBA 4G9NA 1AVXB 1YXWA 1IRAX 5HPZA 1BFCA 5D63A 3LLPA 3O5WB 1HWNB 4JKXB 1ISXA 4MZGB 3CA6A 3V0AB 2VLCA 3QYDA 4ZLBB 5FZUA 2LIQA 1PC8B 1BFFA 2L5XA 4MZHA 1EPWA 1PZZA 3UJ0A 1ISVA 4OEGA 4A7YA 1PUMB 4G6JA 2Y9FA 3IM7A 3WO4A 3OJ2A 3LTQA 4OUJA 2KLLA 3FJHA 1IJTA 1E0OA 4PC4A 3PMEA 4IONA 2AAIB 3WINA 3VT1A 2D22A 1TFMB 4EFQA 4H75A 3I2AA 4H9WA 2Y9XE 1DIWA 3FJEA 3FJFA 4GAFA 2ERMA 5DZUA 3CRIA 2RG9B 4I6IA 1FMZA 4I4PA 5G00A 3CA0A 1II4A 4ENDA 1QQLA 2K4AB 5BQUA 3BRDA 4R6UB 1AF9A 4I4YA 2KKIA 5BXPA 1EYLA 1FQ9A 1G9BA 3BAQA 1XYFA 1S0BA 2HW9A 3CA1A 4EKXB 2D20A 1D0HA 1OQLB 2K8RA 3ILAA 4DEPA 2D43A 4USPA 3VSZA 3FUOA 1I1BA 4I2SA 3UDAA 3BA5A 4DCKC 4I4SA 3TC2A 4I4XA 3HBWA 1IT0A 2D7RA 3HN1A 5I1BA 3OBTA 5D62A 1RY7A 2Q3NB 3AKHA 2X2SA 1XZZA 1Z2VA 2FFVA 2KI6B 1K5UA 3HOMA 1V6VA 3A23A 2AQZA 3CU1B 4P0LA 4DENA 3HALA 4XFSA 3BA7A 2F8XC 1AVWB 2AFGA 2MIBA 2Z49A 1FMMS 5DVHA 3O4CA 3WA1A 5EG6C 4I8MA 2NVHA 4G9MA 1RZOB 4IZXA 1JQZA 4ZFYB 2VSAA 1FGAA 4GP3A 8I1BA 4J23B 1WD3A 4Q9PA 4EFPA 3NBNA 1QQKA 3UD8A 3I29B 2HZ9A 3BX1C 3VUOA 1HCDA 1TOOA 3EF2A 4XFTA 4ZKTB 1TTUA 3P53A 4ISQA 4LO1C 3AZVA 4P0JA 5BXRA 3WINC 3FJDA 4J2SA 4HA2A 4I4VA 1S0GA 5EHAA 3VEQA 3IM5A 3F1RA 2D44A 1MC9A 2RSTA 4G1RA 3BAUA 1CVSA 4QALA 4TLPA 4QC4A 1P63A 4CJMA 1DQOA 4I4OA 1PUUB 4AN7B 3NJ5A 4X3AA 1S0DA 2BFHA 5BQUC 1KNMA 4GOYA 1IILA 4I1EA 4HJJA 3P6IA 2DS0A 3AKIA 1M16A 2IHOA 4EEEB 3A22A 4A7KA 4I4UA 3AH2A 4QD2C 2M49A 3O44A 3AJ6A 4JRAA 3W9TA 1YYNA 2X2TA 2E4MA 2KH2A 3O3QA 1G82A 3AKFA 1WD4A 1G9DA 3N7LA 1JLYA 3IIRA 1Q03A 1ISZA 3A21A 1WBAA 4LO3C 4OEEA 4QO3A 4EB2B 2GZBA 2KI4A 1JT4A 1HWOB 2FO1A 2HWAA 1ISWA 1XHBA 4LO1A 3BAGA 1BLAA 1JT3A 3FUQA 4XKIA 1T9FA 2Z48A 3BAVA 3S8KA 1Z0HA 4OEFA 3BA4A 4X38A 2XOAA 1SR4A 3RMXA 3ZC8A 1G9CA 4I1BA 4LO8B 4ZBVB 1ABRB 4Q91A 1Q04A 3JRRA 4D0TA 1FWUA 1AXMA 1ONKB 7I1BA 21BIA 4X39A 2GO2A 3BADA 4LO7B 3OJMA 2ET2A 3WO3A 3SNVA 3OGFA 1FN0A 3E8LC 4IY9A 4QBCA 1MD6A 1FV3A 3ZX7A 3Q7YA 3K1XA 4AN6A 3H6SE 3H6QA 2NYYA 4LO7C 3I2XA 1FWVA 2WBCA 1Z4SA 4A7ZA 3N7MA 3NBEA 5GAQA 3O49A 4USOA 4ISRA 5BOWA 4LO3A 4JP0A 3B9UA 4IYBA 4KC3A 3IAGC 5D61A 3QR5A 5FZYA 1W3AA 3P6JA 4MZFB 2MC2A 3V0BA 1S0EA 3MALA 4HR6C 5BVPI 1BLDA 3FJAA 3WO2A 2NZ9A 2BEAA 4J2YA 41BIA 3BRFA 3BTAA 3FFZA 2VUAA 1TWEA 2E4MC 1IHKA 4G6MA 3WMVA 3POKA 1DZDA 1W3FA 3RTJB 3IM6A 2VXRA 3PHZA 2LIEA 2ZQNA 3F62B 1ISYA 4GAIA 4J2KA 3FJCA 2D7IA 3CRHA 1V6XA 1BA7A 1N4KA 1BASA 4XFUA 4FVVA 1YTOA 4WBCA 2NM1A 3A07A 1EV2A 4Z9WB 1YBIA 3CQAA 3R4UA 4I7IA 2Y9GA 4F83A 1SZ6B 1HWMB 2RQ9A 1WBCA 4QBVA 1TWMA 1JT5A 4Q9GA 1SR4C 4IY8A 4FGFA 4ZOTA 3CRGA 5FZZA 3UJ4A 4L4IA 4QD2B 4OWLA 3AJ5A 4JPZA 1L2HA 1V6UA 1PWAA 2J3PA 4LO0C 3FJIA 5B2HA 1J0SA 1JY0A 3Q7XA 4EFRA 1W3GA 3JUTA 3AZWA 2NP0A 1K5VA 1S0LA 2NS2A 2DRYA 3VWCA 3AH1A 3N7KA 4OWKA 3OBRA 5BXSA 1DFQA 5F90A 2ESUA 4GP0A 3RTIB 5JLVA 3V0BB 5BXTA 2P39A 1DFCA 4L4HA 3BAOA 1ITBA 1EVTA 1DZCA 2DRZA 3VSFA 1G9AA 3MPPG 5DSSB 3RMYA 4I3NA 3O4AA 9ILBA 1R8OA 1FV2A 3NBCA 4H04A 2ZR1B 1T4QA 3VT0A 1BFGA 2BEBA 2ZQOA 1AVUA 4Z8SB 1DJSB 1IOBA 1I1EA 5DUYA 4IQPA 2QN4A 3D7WB 3FGMA 4F34A 5FNWA 2D23A 1V6WA 2NTDA 4II0A 4LO0A 1A8DA 4KEIA 2K43A 4OWJA 1JTCA 4I37A 2IWTB 2D1ZA 2VU9A 4UY4A 1CE7B 5BP5A 1NZKA 3ZXGA 3HSMA 3UD9A 2F2FA 2QYIB 2P23A 1BFBA 3R4SA 3PG0A 4ZA3B 3OJVA 3OGGA 1R8NA 4P6AA 1Q1UA 4YOLA 3AKGA 3PUBA 3CA5A 4ZGRB 1AFCA 3CA4A 3H6RA 1BARA 3FJ9A 3T8SA 6I1BA 3BB2A 4QKRA 4GOVA 5FNXA 4X37A 1HWPB 3AH4A 5F8SA 2Y9WC 3Q7WA 1DLLA 3WMUA 3FJKA 1HCEA 1GGPB 1TIEA 2FFUA 1S0FA 3HMYA 1RG8A 4LO2C 1F31A 1DQGA 1IRPA 2I1BA 4OW4A 1AVAC 4P0KA 2Q9XA 3V0AA 2YUGA 4I4QA 2R9KB 1TP0A 1QXMA 3CAHA 2HWMA 1RMLA 4JAWA 3KMVA 4I0YA 3V79C 2MLLB 4QKSA 5F8WA 1HIBA 1XG6A 1NUNA 3FJJA 1S0CA 4I96A 4ZFUB 3O4OA 1M2TB 2VXTI 3O4BA
chains in the Genus database with same CATH topology
3VT2A 4KBBA 2WRYA 3ZC9A 4D8HA 2AXMA 1VCLA 3N7JA 4KEKA 2VSEA 5F8YA 4KEJA 4JKQA 3ZXDA 3CA3A 3C9ZA 3FJ8A 1UPSA 1JT7A 3S8JA 5E24E 31BIA 3N0KA 1ILR1 1JLXA 4JQ0A 5JMCA 3O4DA 4J2XA 2UUSA 2FDBM 3BRGC 3BAHA 2DREA 3RSJA 5EC5A 5BP5C 3H6RB 3UD7A 4IZEA 4ZFWB 2F2FC 3NBDA 4I4RA 4IHZA 1YF8B 1HKNA 4LO2A 4D0ZA 2FGFA 2D24A 3FJBA 4G9NA 1AVXB 1YXWA 1IRAX 5HPZA 1BFCA 5D63A 3LLPA 3O5WB 1HWNB 4JKXB 1ISXA 4MZGB 3CA6A 3V0AB 2VLCA 3QYDA 4ZLBB 5FZUA 2LIQA 1PC8B 1BFFA 2L5XA 4MZHA 1EPWA 1PZZA 3UJ0A 1ISVA 4OEGA 4A7YA 1PUMB 4G6JA 2Y9FA 3IM7A 3WO4A 3OJ2A 3LTQA 4OUJA 2KLLA 3FJHA 1IJTA 1E0OA 4PC4A 3PMEA 4IONA 2AAIB 3WINA 3VT1A 2D22A 1TFMB 4EFQA 4H75A 3I2AA 4H9WA 2Y9XE 1DIWA 3FJEA 3FJFA 4GAFA 2ERMA 5DZUA 3CRIA 2RG9B 4I6IA 1FMZA 4I4PA 5G00A 3CA0A 1II4A 4ENDA 1QQLA 2K4AB 5BQUA 3BRDA 4R6UB 1AF9A 4I4YA 2KKIA 5BXPA 1EYLA 1FQ9A 1G9BA 3BAQA 1XYFA 1S0BA 2HW9A 3CA1A 4EKXB 2D20A 1D0HA 1OQLB 2K8RA 3ILAA 4DEPA 2D43A 4USPA 3VSZA 3FUOA 1I1BA 4I2SA 3UDAA 3BA5A 4DCKC 4I4SA 3TC2A 4I4XA 3HBWA 1IT0A 2D7RA 3HN1A 5I1BA 3OBTA 5D62A 1RY7A 2Q3NB 3AKHA 2X2SA 1XZZA 1Z2VA 2FFVA 2KI6B 1K5UA 3HOMA 1V6VA 3A23A 2AQZA 3CU1B 4P0LA 4DENA 3HALA 4XFSA 3BA7A 2F8XC 1AVWB 2AFGA 2MIBA 2Z49A 1FMMS 5DVHA 3O4CA 3WA1A 5EG6C 4I8MA 2NVHA 4G9MA 1RZOB 4IZXA 1JQZA 4ZFYB 2VSAA 1FGAA 4GP3A 8I1BA 4J23B 1WD3A 4Q9PA 4EFPA 3NBNA 1QQKA 3UD8A 3I29B 2HZ9A 3BX1C 3VUOA 1HCDA 1TOOA 3EF2A 4XFTA 4ZKTB 1TTUA 3P53A 4ISQA 4LO1C 3AZVA 4P0JA 5BXRA 3WINC 3FJDA 4J2SA 4HA2A 4I4VA 1S0GA 5EHAA 3VEQA 3IM5A 3F1RA 2D44A 1MC9A 2RSTA 4G1RA 3BAUA 1CVSA 4QALA 4TLPA 4QC4A 1P63A 4CJMA 1DQOA 4I4OA 1PUUB 4AN7B 3NJ5A 4X3AA 1S0DA 2BFHA 5BQUC 1KNMA 4GOYA 1IILA 4I1EA 4HJJA 3P6IA 2DS0A 3AKIA 1M16A 2IHOA 4EEEB 3A22A 4A7KA 4I4UA 3AH2A 4QD2C 2M49A 3O44A 3AJ6A 4JRAA 3W9TA 1YYNA 2X2TA 2E4MA 2KH2A 3O3QA 1G82A 3AKFA 1WD4A 1G9DA 3N7LA 1JLYA 3IIRA 1Q03A 1ISZA 3A21A 1WBAA 4LO3C 4OEEA 4QO3A 4EB2B 2GZBA 2KI4A 1JT4A 1HWOB 2FO1A 2HWAA 1ISWA 1XHBA 4LO1A 3BAGA 1BLAA 1JT3A 3FUQA 4XKIA 1T9FA 2Z48A 3BAVA 3S8KA 1Z0HA 4OEFA 3BA4A 4X38A 2XOAA 1SR4A 3RMXA 3ZC8A 1G9CA 4I1BA 4LO8B 4ZBVB 1ABRB 4Q91A 1Q04A 3JRRA 4D0TA 1FWUA 1AXMA 1ONKB 7I1BA 21BIA 4X39A 2GO2A 3BADA 4LO7B 3OJMA 2ET2A 3WO3A 3SNVA 3OGFA 1FN0A 3E8LC 4IY9A 4QBCA 1MD6A 1FV3A 3ZX7A 3Q7YA 3K1XA 4AN6A 3H6SE 3H6QA 2NYYA 4LO7C 3I2XA 1FWVA 2WBCA 1Z4SA 4A7ZA 3N7MA 3NBEA 5GAQA 3O49A 4USOA 4ISRA 5BOWA 4LO3A 4JP0A 3B9UA 4IYBA 4KC3A 3IAGC 5D61A 3QR5A 5FZYA 1W3AA 3P6JA 4MZFB 2MC2A 3V0BA 1S0EA 3MALA 4HR6C 5BVPI 1BLDA 3FJAA 3WO2A 2NZ9A 2BEAA 4J2YA 41BIA 3BRFA 3BTAA 3FFZA 2VUAA 1TWEA 2E4MC 1IHKA 4G6MA 3WMVA 3POKA 1DZDA 1W3FA 3RTJB 3IM6A 2VXRA 3PHZA 2LIEA 2ZQNA 3F62B 1ISYA 4GAIA 4J2KA 3FJCA 2D7IA 3CRHA 1V6XA 1BA7A 1N4KA 1BASA 4XFUA 4FVVA 1YTOA 4WBCA 2NM1A 3A07A 1EV2A 4Z9WB 1YBIA 3CQAA 3R4UA 4I7IA 2Y9GA 4F83A 1SZ6B 1HWMB 2RQ9A 1WBCA 4QBVA 1TWMA 1JT5A 4Q9GA 1SR4C 4IY8A 4FGFA 4ZOTA 3CRGA 5FZZA 3UJ4A 4L4IA 4QD2B 4OWLA 3AJ5A 4JPZA 1L2HA 1V6UA 1PWAA 2J3PA 4LO0C 3FJIA 5B2HA 1J0SA 1JY0A 3Q7XA 4EFRA 1W3GA 3JUTA 3AZWA 2NP0A 1K5VA 1S0LA 2NS2A 2DRYA 3VWCA 3AH1A 3N7KA 4OWKA 3OBRA 5BXSA 1DFQA 5F90A 2ESUA 4GP0A 3RTIB 5JLVA 3V0BB 5BXTA 2P39A 1DFCA 4L4HA 3BAOA 1ITBA 1EVTA 1DZCA 2DRZA 3VSFA 1G9AA 3MPPG 5DSSB 3RMYA 4I3NA 3O4AA 9ILBA 1R8OA 1FV2A 3NBCA 4H04A 2ZR1B 1T4QA 3VT0A 1BFGA 2BEBA 2ZQOA 1AVUA 4Z8SB 1DJSB 1IOBA 1I1EA 5DUYA 4IQPA 2QN4A 3D7WB 3FGMA 4F34A 5FNWA 2D23A 1V6WA 2NTDA 4II0A 4LO0A 1A8DA 4KEIA 2K43A 4OWJA 1JTCA 4I37A 2IWTB 2D1ZA 2VU9A 4UY4A 1CE7B 5BP5A 1NZKA 3ZXGA 3HSMA 3UD9A 2F2FA 2QYIB 2P23A 1BFBA 3R4SA 3PG0A 4ZA3B 3OJVA 3OGGA 1R8NA 4P6AA 1Q1UA 4YOLA 3AKGA 3PUBA 3CA5A 4ZGRB 1AFCA 3CA4A 3H6RA 1BARA 3FJ9A 3T8SA 6I1BA 3BB2A 4QKRA 4GOVA 5FNXA 4X37A 1HWPB 3AH4A 5F8SA 2Y9WC 3Q7WA 1DLLA 3WMUA 3FJKA 1HCEA 1GGPB 1TIEA 2FFUA 1S0FA 3HMYA 1RG8A 4LO2C 1F31A 1DQGA 1IRPA 2I1BA 4OW4A 1AVAC 4P0KA 2Q9XA 3V0AA 2YUGA 4I4QA 2R9KB 1TP0A 1QXMA 3CAHA 2HWMA 1RMLA 4JAWA 3KMVA 4I0YA 3V79C 2MLLB 4QKSA 5F8WA 1HIBA 1XG6A 1NUNA 3FJJA 1S0CA 4I96A 4ZFUB 3O4OA 1M2TB 2VXTI 3O4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VT2 A;  4KBB A;  2WRY A;  3ZC9 A;  4D8H A;  2AXM A;  1VCL A;  3N7J A;  4KEK A;  2VSE A;  5F8Y A;  4KEJ A;  4JKQ A;  3ZXD A;  3CA3 A;  3C9Z A;  3FJ8 A;  1UPS A;  1JT7 A;  3S8J A;  5E24 E;  31BI A;  3N0K A;  1ILR 1;  1JLX A;  4JQ0 A;  5JMC A;  3O4D A;  4J2X A;  2UUS A;  2FDB M;  3BRG C;  3BAH A;  2DRE A;  3RSJ A;  5EC5 A;  5BP5 C;  3H6R B;  3UD7 A;  4IZE A;  4ZFW B;  2F2F C;  3NBD A;  4I4R A;  4IHZ A;  1YF8 B;  1HKN A;  4LO2 A;  4D0Z A;  2FGF A;  2D24 A;  3FJB A;  4G9N A;  1AVX B;  1YXW A;  1IRA X;  5HPZ A;  1BFC A;  5D63 A;  3LLP A;  3O5W B;  1HWN B;  4JKX B;  1ISX A;  3CA6 A;  3V0A B;  2VLC A;  3QYD A;  4ZLB B;  5FZU A;  2LIQ A;  1PC8 B;  1BFF A;  2L5X A;  1EPW A;  1PZZ A;  3UJ0 A;  1ISV A;  4OEG A;  4A7Y A;  1PUM B;  4G6J A;  2Y9F A;  3IM7 A;  3WO4 A;  3OJ2 A;  3LTQ A;  4OUJ A;  2KLL A;  3FJH A;  1IJT A;  1E0O A;  4PC4 A;  3PME A;  4ION A;  2AAI B;  3WIN A;  3VT1 A;  2D22 A;  1TFM B;  4EFQ A;  3I2A A;  4H9W A;  2Y9X E;  1DIW A;  3FJE A;  3FJF A;  4GAF A;  2ERM A;  5DZU A;  3CRI A;  2RG9 B;  4I6I A;  1FMZ A;  4I4P A;  5G00 A;  3CA0 A;  1II4 A;  4END A;  1QQL A;  2K4A B;  5BQU A;  3BRD A;  4R6U B;  1AF9 A;  4I4Y A;  2KKI A;  5BXP A;  1EYL A;  1FQ9 A;  1G9B A;  3BAQ A;  1XYF A;  1S0B A;  2HW9 A;  3CA1 A;  4EKX B;  2D20 A;  1D0H A;  1OQL B;  2K8R A;  3ILA A;  4DEP A;  2D43 A;  4USP A;  3VSZ A;  3FUO A;  1I1B A;  4I2S A;  3UDA A;  3BA5 A;  4DCK C;  4I4S A;  3TC2 A;  4I4X A;  3HBW A;  1IT0 A;  2D7R A;  3HN1 A;  5I1B A;  3OBT A;  5D62 A;  1RY7 A;  2Q3N B;  3AKH A;  2X2S A;  1XZZ A;  1Z2V A;  2FFV A;  2KI6 B;  1K5U A;  3HOM A;  1V6V A;  3A23 A;  2AQZ A;  3CU1 B;  4P0L A;  4DEN A;  3HAL A;  4XFS A;  3BA7 A;  2F8X C;  1AVW B;  2AFG A;  2MIB A;  2Z49 A;  1FMM S;  5DVH A;  3O4C A;  3WA1 A;  5EG6 C;  4I8M A;  2NVH A;  4G9M A;  1RZO B;  4IZX A;  1JQZ A;  4ZFY B;  2VSA A;  1FGA A;  4GP3 A;  8I1B A;  4J23 B;  1WD3 A;  4Q9P A;  4EFP A;  3NBN A;  1QQK A;  3UD8 A;  3I29 B;  2HZ9 A;  3BX1 C;  3VUO A;  1HCD A;  1TOO A;  3EF2 A;  4XFT A;  4ZKT B;  1TTU A;  3P53 A;  4ISQ A;  4LO1 C;  3AZV A;  4P0J A;  5BXR A;  3WIN C;  3FJD A;  4J2S A;  4HA2 A;  4I4V A;  1S0G A;  5EHA A;  3VEQ A;  3IM5 A;  3F1R A;  2D44 A;  1MC9 A;  2RST A;  4G1R A;  3BAU A;  1CVS A;  4QAL A;  4TLP A;  4QC4 A;  1P63 A;  4CJM A;  1DQO A;  4I4O A;  1PUU B;  4AN7 B;  3NJ5 A;  4X3A A;  1S0D A;  2BFH A;  5BQU C;  1KNM A;  4GOY A;  1IIL A;  4I1E A;  4HJJ A;  3P6I A;  2DS0 A;  3AKI A;  1M16 A;  2IHO A;  4EEE B;  3A22 A;  4A7K A;  4I4U A;  3AH2 A;  4QD2 C;  2M49 A;  3O44 A;  3AJ6 A;  4JRA A;  3W9T A;  1YYN A;  2X2T A;  2E4M A;  2KH2 A;  3O3Q A;  1G82 A;  3AKF A;  1WD4 A;  1G9D A;  3N7L A;  1JLY A;  3IIR A;  1Q03 A;  1ISZ A;  3A21 A;  1WBA A;  4LO3 C;  4OEE A;  4QO3 A;  4EB2 B;  2GZB A;  2KI4 A;  1JT4 A;  1HWO B;  2FO1 A;  2HWA A;  1ISW A;  1XHB A;  4LO1 A;  3BAG A;  1BLA A;  1JT3 A;  3FUQ A;  4XKI A;  1T9F A;  2Z48 A;  3BAV A;  3S8K A;  1Z0H A;  4OEF A;  3BA4 A;  4X38 A;  2XOA A;  1SR4 A;  3RMX A;  3ZC8 A;  1G9C A;  4I1B A;  4LO8 B;  4ZBV B;  1ABR B;  4Q91 A;  1Q04 A;  3JRR A;  4D0T A;  1FWU A;  1AXM A;  1ONK B;  7I1B A;  21BI A;  4X39 A;  2GO2 A;  3BAD A;  4LO7 B;  3OJM A;  2ET2 A;  3WO3 A;  3SNV A;  3OGF A;  1FN0 A;  3E8L C;  4IY9 A;  4QBC A;  1MD6 A;  1FV3 A;  3ZX7 A;  3Q7Y A;  3K1X A;  4AN6 A;  3H6S E;  3H6Q A;  2NYY A;  4LO7 C;  3I2X A;  1FWV A;  2WBC A;  1Z4S A;  4A7Z A;  3N7M A;  3NBE A;  5GAQ A;  3O49 A;  4USO A;  4ISR A;  5BOW A;  4LO3 A;  4JP0 A;  3B9U A;  4IYB A;  4KC3 A;  3IAG C;  5D61 A;  3QR5 A;  5FZY A;  1W3A A;  3P6J A;  2MC2 A;  3V0B A;  1S0E A;  3MAL A;  4HR6 C;  5BVP I;  1BLD A;  3FJA A;  3WO2 A;  2NZ9 A;  2BEA A;  4J2Y A;  41BI A;  3BRF A;  3BTA A;  3FFZ A;  2VUA A;  1TWE A;  2E4M C;  1IHK A;  4G6M A;  3WMV A;  3POK A;  1DZD A;  1W3F A;  3RTJ B;  3IM6 A;  2VXR A;  3PHZ A;  2LIE A;  2ZQN A;  3F62 B;  1ISY A;  4GAI A;  4J2K A;  3FJC A;  2D7I A;  3CRH A;  1V6X A;  1BA7 A;  1N4K A;  1BAS A;  4XFU A;  4FVV A;  1YTO A;  4WBC A;  2NM1 A;  3A07 A;  1EV2 A;  4Z9W B;  1YBI A;  3CQA A;  3R4U A;  4I7I A;  2Y9G A;  4F83 A;  1SZ6 B;  1HWM B;  2RQ9 A;  1WBC A;  4QBV A;  1TWM A;  1JT5 A;  4Q9G A;  1SR4 C;  4IY8 A;  4FGF A;  4ZOT A;  3CRG A;  5FZZ A;  3UJ4 A;  4L4I A;  4QD2 B;  4OWL A;  3AJ5 A;  4JPZ A;  1L2H A;  1V6U A;  1PWA A;  2J3P A;  4LO0 C;  3FJI A;  5B2H A;  1J0S A;  1JY0 A;  3Q7X A;  4EFR A;  1W3G A;  3JUT A;  3AZW A;  2NP0 A;  1K5V A;  1S0L A;  2DRY A;  3VWC A;  3AH1 A;  3N7K A;  4OWK A;  3OBR A;  5BXS A;  1DFQ A;  5F90 A;  2ESU A;  4GP0 A;  3RTI B;  5JLV A;  3V0B B;  5BXT A;  2P39 A;  1DFC A;  4L4H A;  3BAO A;  1ITB A;  1EVT A;  1DZC A;  2DRZ A;  3VSF A;  1G9A A;  3MPP G;  5DSS B;  3RMY A;  4I3N A;  3O4A A;  9ILB A;  1R8O A;  1FV2 A;  3NBC A;  4H04 A;  2ZR1 B;  1T4Q A;  3VT0 A;  1BFG A;  2BEB A;  2ZQO A;  1AVU A;  4Z8S B;  1DJS B;  1IOB A;  1I1E A;  5DUY A;  4IQP A;  2QN4 A;  3D7W B;  3FGM A;  4F34 A;  5FNW A;  2D23 A;  1V6W A;  2NTD A;  4II0 A;  4LO0 A;  1A8D A;  4KEI A;  2K43 A;  4OWJ A;  1JTC A;  4I37 A;  2IWT B;  2D1Z A;  2VU9 A;  1CE7 B;  5BP5 A;  1NZK A;  3ZXG A;  3HSM A;  3UD9 A;  2F2F A;  2QYI B;  2P23 A;  1BFB A;  3R4S A;  3PG0 A;  4ZA3 B;  3OJV A;  3OGG A;  1R8N A;  4P6A A;  1Q1U A;  4YOL A;  3AKG A;  3PUB A;  3CA5 A;  4ZGR B;  1AFC A;  3CA4 A;  3H6R A;  1BAR A;  3FJ9 A;  3T8S A;  6I1B A;  3BB2 A;  4QKR A;  4GOV A;  5FNX A;  4X37 A;  1HWP B;  3AH4 A;  5F8S A;  2Y9W C;  3Q7W A;  1DLL A;  3WMU A;  3FJK A;  1HCE A;  1GGP B;  1TIE A;  2FFU A;  1S0F A;  3HMY A;  1RG8 A;  4LO2 C;  1F31 A;  1DQG A;  1IRP A;  2I1B A;  4OW4 A;  1AVA C;  4P0K A;  2Q9X A;  3V0A A;  2YUG A;  4I4Q A;  2R9K B;  1TP0 A;  1QXM A;  3CAH A;  2HWM A;  1RML A;  4JAW A;  3KMV A;  4I0Y A;  3V79 C;  2MLL B;  4QKS A;  5F8W A;  1HIB A;  1XG6 A;  1NUN A;  3FJJ A;  1S0C A;  4I96 A;  4ZFU B;  3O4O A;  1M2T B;  2VXT I;  3O4B A; 
#chains in the Genus database with same CATH topology
 3VT2 A;  4KBB A;  2WRY A;  3ZC9 A;  4D8H A;  2AXM A;  1VCL A;  3N7J A;  4KEK A;  2VSE A;  5F8Y A;  4KEJ A;  4JKQ A;  3ZXD A;  3CA3 A;  3C9Z A;  3FJ8 A;  1UPS A;  1JT7 A;  3S8J A;  5E24 E;  31BI A;  3N0K A;  1ILR 1;  1JLX A;  4JQ0 A;  5JMC A;  3O4D A;  4J2X A;  2UUS A;  2FDB M;  3BRG C;  3BAH A;  2DRE A;  3RSJ A;  5EC5 A;  5BP5 C;  3H6R B;  3UD7 A;  4IZE A;  4ZFW B;  2F2F C;  3NBD A;  4I4R A;  4IHZ A;  1YF8 B;  1HKN A;  4LO2 A;  4D0Z A;  2FGF A;  2D24 A;  3FJB A;  4G9N A;  1AVX B;  1YXW A;  1IRA X;  5HPZ A;  1BFC A;  5D63 A;  3LLP A;  3O5W B;  1HWN B;  4JKX B;  1ISX A;  4MZG B;  3CA6 A;  3V0A B;  2VLC A;  3QYD A;  4ZLB B;  5FZU A;  2LIQ A;  1PC8 B;  1BFF A;  2L5X A;  4MZH A;  1EPW A;  1PZZ A;  3UJ0 A;  1ISV A;  4OEG A;  4A7Y A;  1PUM B;  4G6J A;  2Y9F A;  3IM7 A;  3WO4 A;  3OJ2 A;  3LTQ A;  4OUJ A;  2KLL A;  3FJH A;  1IJT A;  1E0O A;  4PC4 A;  3PME A;  4ION A;  2AAI B;  3WIN A;  3VT1 A;  2D22 A;  1TFM B;  4EFQ A;  4H75 A;  3I2A A;  4H9W A;  2Y9X E;  1DIW A;  3FJE A;  3FJF A;  4GAF A;  2ERM A;  5DZU A;  3CRI A;  2RG9 B;  4I6I A;  1FMZ A;  4I4P A;  5G00 A;  3CA0 A;  1II4 A;  4END A;  1QQL A;  2K4A B;  5BQU A;  3BRD A;  4R6U B;  1AF9 A;  4I4Y A;  2KKI A;  5BXP A;  1EYL A;  1FQ9 A;  1G9B A;  3BAQ A;  1XYF A;  1S0B A;  2HW9 A;  3CA1 A;  4EKX B;  2D20 A;  1D0H A;  1OQL B;  2K8R A;  3ILA A;  4DEP A;  2D43 A;  4USP A;  3VSZ A;  3FUO A;  1I1B A;  4I2S A;  3UDA A;  3BA5 A;  4DCK C;  4I4S A;  3TC2 A;  4I4X A;  3HBW A;  1IT0 A;  2D7R A;  3HN1 A;  5I1B A;  3OBT A;  5D62 A;  1RY7 A;  2Q3N B;  3AKH A;  2X2S A;  1XZZ A;  1Z2V A;  2FFV A;  2KI6 B;  1K5U A;  3HOM A;  1V6V A;  3A23 A;  2AQZ A;  3CU1 B;  4P0L A;  4DEN A;  3HAL A;  4XFS A;  3BA7 A;  2F8X C;  1AVW B;  2AFG A;  2MIB A;  2Z49 A;  1FMM S;  5DVH A;  3O4C A;  3WA1 A;  5EG6 C;  4I8M A;  2NVH A;  4G9M A;  1RZO B;  4IZX A;  1JQZ A;  4ZFY B;  2VSA A;  1FGA A;  4GP3 A;  8I1B A;  4J23 B;  1WD3 A;  4Q9P A;  4EFP A;  3NBN A;  1QQK A;  3UD8 A;  3I29 B;  2HZ9 A;  3BX1 C;  3VUO A;  1HCD A;  1TOO A;  3EF2 A;  4XFT A;  4ZKT B;  1TTU A;  3P53 A;  4ISQ A;  4LO1 C;  3AZV A;  4P0J A;  5BXR A;  3WIN C;  3FJD A;  4J2S A;  4HA2 A;  4I4V A;  1S0G A;  5EHA A;  3VEQ A;  3IM5 A;  3F1R A;  2D44 A;  1MC9 A;  2RST A;  4G1R A;  3BAU A;  1CVS A;  4QAL A;  4TLP A;  4QC4 A;  1P63 A;  4CJM A;  1DQO A;  4I4O A;  1PUU B;  4AN7 B;  3NJ5 A;  4X3A A;  1S0D A;  2BFH A;  5BQU C;  1KNM A;  4GOY A;  1IIL A;  4I1E A;  4HJJ A;  3P6I A;  2DS0 A;  3AKI A;  1M16 A;  2IHO A;  4EEE B;  3A22 A;  4A7K A;  4I4U A;  3AH2 A;  4QD2 C;  2M49 A;  3O44 A;  3AJ6 A;  4JRA A;  3W9T A;  1YYN A;  2X2T A;  2E4M A;  2KH2 A;  3O3Q A;  1G82 A;  3AKF A;  1WD4 A;  1G9D A;  3N7L A;  1JLY A;  3IIR A;  1Q03 A;  1ISZ A;  3A21 A;  1WBA A;  4LO3 C;  4OEE A;  4QO3 A;  4EB2 B;  2GZB A;  2KI4 A;  1JT4 A;  1HWO B;  2FO1 A;  2HWA A;  1ISW A;  1XHB A;  4LO1 A;  3BAG A;  1BLA A;  1JT3 A;  3FUQ A;  4XKI A;  1T9F A;  2Z48 A;  3BAV A;  3S8K A;  1Z0H A;  4OEF A;  3BA4 A;  4X38 A;  2XOA A;  1SR4 A;  3RMX A;  3ZC8 A;  1G9C A;  4I1B A;  4LO8 B;  4ZBV B;  1ABR B;  4Q91 A;  1Q04 A;  3JRR A;  4D0T A;  1FWU A;  1AXM A;  1ONK B;  7I1B A;  21BI A;  4X39 A;  2GO2 A;  3BAD A;  4LO7 B;  3OJM A;  2ET2 A;  3WO3 A;  3SNV A;  3OGF A;  1FN0 A;  3E8L C;  4IY9 A;  4QBC A;  1MD6 A;  1FV3 A;  3ZX7 A;  3Q7Y A;  3K1X A;  4AN6 A;  3H6S E;  3H6Q A;  2NYY A;  4LO7 C;  3I2X A;  1FWV A;  2WBC A;  1Z4S A;  4A7Z A;  3N7M A;  3NBE A;  5GAQ A;  3O49 A;  4USO A;  4ISR A;  5BOW A;  4LO3 A;  4JP0 A;  3B9U A;  4IYB A;  4KC3 A;  3IAG C;  5D61 A;  3QR5 A;  5FZY A;  1W3A A;  3P6J A;  4MZF B;  2MC2 A;  3V0B A;  1S0E A;  3MAL A;  4HR6 C;  5BVP I;  1BLD A;  3FJA A;  3WO2 A;  2NZ9 A;  2BEA A;  4J2Y A;  41BI A;  3BRF A;  3BTA A;  3FFZ A;  2VUA A;  1TWE A;  2E4M C;  1IHK A;  4G6M A;  3WMV A;  3POK A;  1DZD A;  1W3F A;  3RTJ B;  3IM6 A;  2VXR A;  3PHZ A;  2LIE A;  2ZQN A;  3F62 B;  1ISY A;  4GAI A;  4J2K A;  3FJC A;  2D7I A;  3CRH A;  1V6X A;  1BA7 A;  1N4K A;  1BAS A;  4XFU A;  4FVV A;  1YTO A;  4WBC A;  2NM1 A;  3A07 A;  1EV2 A;  4Z9W B;  1YBI A;  3CQA A;  3R4U A;  4I7I A;  2Y9G A;  4F83 A;  1SZ6 B;  1HWM B;  2RQ9 A;  1WBC A;  4QBV A;  1TWM A;  1JT5 A;  4Q9G A;  1SR4 C;  4IY8 A;  4FGF A;  4ZOT A;  3CRG A;  5FZZ A;  3UJ4 A;  4L4I A;  4QD2 B;  4OWL A;  3AJ5 A;  4JPZ A;  1L2H A;  1V6U A;  1PWA A;  2J3P A;  4LO0 C;  3FJI A;  5B2H A;  1J0S A;  1JY0 A;  3Q7X A;  4EFR A;  1W3G A;  3JUT A;  3AZW A;  2NP0 A;  1K5V A;  1S0L A;  2NS2 A;  2DRY A;  3VWC A;  3AH1 A;  3N7K A;  4OWK A;  3OBR A;  5BXS A;  1DFQ A;  5F90 A;  2ESU A;  4GP0 A;  3RTI B;  5JLV A;  3V0B B;  5BXT A;  2P39 A;  1DFC A;  4L4H A;  3BAO A;  1ITB A;  1EVT A;  1DZC A;  2DRZ A;  3VSF A;  1G9A A;  3MPP G;  5DSS B;  3RMY A;  4I3N A;  3O4A A;  9ILB A;  1R8O A;  1FV2 A;  3NBC A;  4H04 A;  2ZR1 B;  1T4Q A;  3VT0 A;  1BFG A;  2BEB A;  2ZQO A;  1AVU A;  4Z8S B;  1DJS B;  1IOB A;  1I1E A;  5DUY A;  4IQP A;  2QN4 A;  3D7W B;  3FGM A;  4F34 A;  5FNW A;  2D23 A;  1V6W A;  2NTD A;  4II0 A;  4LO0 A;  1A8D A;  4KEI A;  2K43 A;  4OWJ A;  1JTC A;  4I37 A;  2IWT B;  2D1Z A;  2VU9 A;  4UY4 A;  1CE7 B;  5BP5 A;  1NZK A;  3ZXG A;  3HSM A;  3UD9 A;  2F2F A;  2QYI B;  2P23 A;  1BFB A;  3R4S A;  3PG0 A;  4ZA3 B;  3OJV A;  3OGG A;  1R8N A;  4P6A A;  1Q1U A;  4YOL A;  3AKG A;  3PUB A;  3CA5 A;  4ZGR B;  1AFC A;  3CA4 A;  3H6R A;  1BAR A;  3FJ9 A;  3T8S A;  6I1B A;  3BB2 A;  4QKR A;  4GOV A;  5FNX A;  4X37 A;  1HWP B;  3AH4 A;  5F8S A;  2Y9W C;  3Q7W A;  1DLL A;  3WMU A;  3FJK A;  1HCE A;  1GGP B;  1TIE A;  2FFU A;  1S0F A;  3HMY A;  1RG8 A;  4LO2 C;  1F31 A;  1DQG A;  1IRP A;  2I1B A;  4OW4 A;  1AVA C;  4P0K A;  2Q9X A;  3V0A A;  2YUG A;  4I4Q A;  2R9K B;  1TP0 A;  1QXM A;  3CAH A;  2HWM A;  1RML A;  4JAW A;  3KMV A;  4I0Y A;  3V79 C;  2MLL B;  4QKS A;  5F8W A;  1HIB A;  1XG6 A;  1NUN A;  3FJJ A;  1S0C A;  4I96 A;  4ZFU B;  3O4O A;  1M2T B;  2VXT I;  3O4B A; 
#chains in the Genus database with same CATH homology
 3VT2 A;  4KBB A;  2WRY A;  3ZC9 A;  4D8H A;  2AXM A;  1VCL A;  3N7J A;  4KEK A;  2VSE A;  5F8Y A;  4KEJ A;  4JKQ A;  3ZXD A;  3CA3 A;  3C9Z A;  3FJ8 A;  1UPS A;  1JT7 A;  3S8J A;  5E24 E;  31BI A;  3N0K A;  1ILR 1;  1JLX A;  4JQ0 A;  5JMC A;  3O4D A;  4J2X A;  2UUS A;  2FDB M;  3BRG C;  3BAH A;  2DRE A;  3RSJ A;  5EC5 A;  5BP5 C;  3H6R B;  3UD7 A;  4IZE A;  4ZFW B;  2F2F C;  3NBD A;  4I4R A;  4IHZ A;  1YF8 B;  1HKN A;  4LO2 A;  4D0Z A;  2FGF A;  2D24 A;  3FJB A;  4G9N A;  1AVX B;  1YXW A;  1IRA X;  5HPZ A;  1BFC A;  5D63 A;  3LLP A;  3O5W B;  1HWN B;  4JKX B;  1ISX A;  4MZG B;  3CA6 A;  3V0A B;  2VLC A;  3QYD A;  4ZLB B;  5FZU A;  2LIQ A;  1PC8 B;  1BFF A;  2L5X A;  4MZH A;  1EPW A;  1PZZ A;  3UJ0 A;  1ISV A;  4OEG A;  4A7Y A;  1PUM B;  4G6J A;  2Y9F A;  3IM7 A;  3WO4 A;  3OJ2 A;  3LTQ A;  4OUJ A;  2KLL A;  3FJH A;  1IJT A;  1E0O A;  4PC4 A;  3PME A;  4ION A;  2AAI B;  3WIN A;  3VT1 A;  2D22 A;  1TFM B;  4EFQ A;  4H75 A;  3I2A A;  4H9W A;  2Y9X E;  1DIW A;  3FJE A;  3FJF A;  4GAF A;  2ERM A;  5DZU A;  3CRI A;  2RG9 B;  4I6I A;  1FMZ A;  4I4P A;  5G00 A;  3CA0 A;  1II4 A;  4END A;  1QQL A;  2K4A B;  5BQU A;  3BRD A;  4R6U B;  1AF9 A;  4I4Y A;  2KKI A;  5BXP A;  1EYL A;  1FQ9 A;  1G9B A;  3BAQ A;  1XYF A;  1S0B A;  2HW9 A;  3CA1 A;  4EKX B;  2D20 A;  1D0H A;  1OQL B;  2K8R A;  3ILA A;  4DEP A;  2D43 A;  4USP A;  3VSZ A;  3FUO A;  1I1B A;  4I2S A;  3UDA A;  3BA5 A;  4DCK C;  4I4S A;  3TC2 A;  4I4X A;  3HBW A;  1IT0 A;  2D7R A;  3HN1 A;  5I1B A;  3OBT A;  5D62 A;  1RY7 A;  2Q3N B;  3AKH A;  2X2S A;  1XZZ A;  1Z2V A;  2FFV A;  2KI6 B;  1K5U A;  3HOM A;  1V6V A;  3A23 A;  2AQZ A;  3CU1 B;  4P0L A;  4DEN A;  3HAL A;  4XFS A;  3BA7 A;  2F8X C;  1AVW B;  2AFG A;  2MIB A;  2Z49 A;  1FMM S;  5DVH A;  3O4C A;  3WA1 A;  5EG6 C;  4I8M A;  2NVH A;  4G9M A;  1RZO B;  4IZX A;  1JQZ A;  4ZFY B;  2VSA A;  1FGA A;  4GP3 A;  8I1B A;  4J23 B;  1WD3 A;  4Q9P A;  4EFP A;  3NBN A;  1QQK A;  3UD8 A;  3I29 B;  2HZ9 A;  3BX1 C;  3VUO A;  1HCD A;  1TOO A;  3EF2 A;  4XFT A;  4ZKT B;  1TTU A;  3P53 A;  4ISQ A;  4LO1 C;  3AZV A;  4P0J A;  5BXR A;  3WIN C;  3FJD A;  4J2S A;  4HA2 A;  4I4V A;  1S0G A;  5EHA A;  3VEQ A;  3IM5 A;  3F1R A;  2D44 A;  1MC9 A;  2RST A;  4G1R A;  3BAU A;  1CVS A;  4QAL A;  4TLP A;  4QC4 A;  1P63 A;  4CJM A;  1DQO A;  4I4O A;  1PUU B;  4AN7 B;  3NJ5 A;  4X3A A;  1S0D A;  2BFH A;  5BQU C;  1KNM A;  4GOY A;  1IIL A;  4I1E A;  4HJJ A;  3P6I A;  2DS0 A;  3AKI A;  1M16 A;  2IHO A;  4EEE B;  3A22 A;  4A7K A;  4I4U A;  3AH2 A;  4QD2 C;  2M49 A;  3O44 A;  3AJ6 A;  4JRA A;  3W9T A;  1YYN A;  2X2T A;  2E4M A;  2KH2 A;  3O3Q A;  1G82 A;  3AKF A;  1WD4 A;  1G9D A;  3N7L A;  1JLY A;  3IIR A;  1Q03 A;  1ISZ A;  3A21 A;  1WBA A;  4LO3 C;  4OEE A;  4QO3 A;  4EB2 B;  2GZB A;  2KI4 A;  1JT4 A;  1HWO B;  2FO1 A;  2HWA A;  1ISW A;  1XHB A;  4LO1 A;  3BAG A;  1BLA A;  1JT3 A;  3FUQ A;  4XKI A;  1T9F A;  2Z48 A;  3BAV A;  3S8K A;  1Z0H A;  4OEF A;  3BA4 A;  4X38 A;  2XOA A;  1SR4 A;  3RMX A;  3ZC8 A;  1G9C A;  4I1B A;  4LO8 B;  4ZBV B;  1ABR B;  4Q91 A;  1Q04 A;  3JRR A;  4D0T A;  1FWU A;  1AXM A;  1ONK B;  7I1B A;  21BI A;  4X39 A;  2GO2 A;  3BAD A;  4LO7 B;  3OJM A;  2ET2 A;  3WO3 A;  3SNV A;  3OGF A;  1FN0 A;  3E8L C;  4IY9 A;  4QBC A;  1MD6 A;  1FV3 A;  3ZX7 A;  3Q7Y A;  3K1X A;  4AN6 A;  3H6S E;  3H6Q A;  2NYY A;  4LO7 C;  3I2X A;  1FWV A;  2WBC A;  1Z4S A;  4A7Z A;  3N7M A;  3NBE A;  5GAQ A;  3O49 A;  4USO A;  4ISR A;  5BOW A;  4LO3 A;  4JP0 A;  3B9U A;  4IYB A;  4KC3 A;  3IAG C;  5D61 A;  3QR5 A;  5FZY A;  1W3A A;  3P6J A;  4MZF B;  2MC2 A;  3V0B A;  1S0E A;  3MAL A;  4HR6 C;  5BVP I;  1BLD A;  3FJA A;  3WO2 A;  2NZ9 A;  2BEA A;  4J2Y A;  41BI A;  3BRF A;  3BTA A;  3FFZ A;  2VUA A;  1TWE A;  2E4M C;  1IHK A;  4G6M A;  3WMV A;  3POK A;  1DZD A;  1W3F A;  3RTJ B;  3IM6 A;  2VXR A;  3PHZ A;  2LIE A;  2ZQN A;  3F62 B;  1ISY A;  4GAI A;  4J2K A;  3FJC A;  2D7I A;  3CRH A;  1V6X A;  1BA7 A;  1N4K A;  1BAS A;  4XFU A;  4FVV A;  1YTO A;  4WBC A;  2NM1 A;  3A07 A;  1EV2 A;  4Z9W B;  1YBI A;  3CQA A;  3R4U A;  4I7I A;  2Y9G A;  4F83 A;  1SZ6 B;  1HWM B;  2RQ9 A;  1WBC A;  4QBV A;  1TWM A;  1JT5 A;  4Q9G A;  1SR4 C;  4IY8 A;  4FGF A;  4ZOT A;  3CRG A;  5FZZ A;  3UJ4 A;  4L4I A;  4QD2 B;  4OWL A;  3AJ5 A;  4JPZ A;  1L2H A;  1V6U A;  1PWA A;  2J3P A;  4LO0 C;  3FJI A;  5B2H A;  1J0S A;  1JY0 A;  3Q7X A;  4EFR A;  1W3G A;  3JUT A;  3AZW A;  2NP0 A;  1K5V A;  1S0L A;  2NS2 A;  2DRY A;  3VWC A;  3AH1 A;  3N7K A;  4OWK A;  3OBR A;  5BXS A;  1DFQ A;  5F90 A;  2ESU A;  4GP0 A;  3RTI B;  5JLV A;  3V0B B;  5BXT A;  2P39 A;  1DFC A;  4L4H A;  3BAO A;  1ITB A;  1EVT A;  1DZC A;  2DRZ A;  3VSF A;  1G9A A;  3MPP G;  5DSS B;  3RMY A;  4I3N A;  3O4A A;  9ILB A;  1R8O A;  1FV2 A;  3NBC A;  4H04 A;  2ZR1 B;  1T4Q A;  3VT0 A;  1BFG A;  2BEB A;  2ZQO A;  1AVU A;  4Z8S B;  1DJS B;  1IOB A;  1I1E A;  5DUY A;  4IQP A;  2QN4 A;  3D7W B;  3FGM A;  4F34 A;  5FNW A;  2D23 A;  1V6W A;  2NTD A;  4II0 A;  4LO0 A;  1A8D A;  4KEI A;  2K43 A;  4OWJ A;  1JTC A;  4I37 A;  2IWT B;  2D1Z A;  2VU9 A;  4UY4 A;  1CE7 B;  5BP5 A;  1NZK A;  3ZXG A;  3HSM A;  3UD9 A;  2F2F A;  2QYI B;  2P23 A;  1BFB A;  3R4S A;  3PG0 A;  4ZA3 B;  3OJV A;  3OGG A;  1R8N A;  4P6A A;  1Q1U A;  4YOL A;  3AKG A;  3PUB A;  3CA5 A;  4ZGR B;  1AFC A;  3CA4 A;  3H6R A;  1BAR A;  3FJ9 A;  3T8S A;  6I1B A;  3BB2 A;  4QKR A;  4GOV A;  5FNX A;  4X37 A;  1HWP B;  3AH4 A;  5F8S A;  2Y9W C;  3Q7W A;  1DLL A;  3WMU A;  3FJK A;  1HCE A;  1GGP B;  1TIE A;  2FFU A;  1S0F A;  3HMY A;  1RG8 A;  4LO2 C;  1F31 A;  1DQG A;  1IRP A;  2I1B A;  4OW4 A;  1AVA C;  4P0K A;  2Q9X A;  3V0A A;  2YUG A;  4I4Q A;  2R9K B;  1TP0 A;  1QXM A;  3CAH A;  2HWM A;  1RML A;  4JAW A;  3KMV A;  4I0Y A;  3V79 C;  2MLL B;  4QKS A;  5F8W A;  1HIB A;  1XG6 A;  1NUN A;  3FJJ A;  1S0C A;  4I96 A;  4ZFU B;  3O4O A;  1M2T B;  2VXT I;  3O4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...