1NZNA

Cytosolic domain of the human mitchondrial fission protein fis1 adopts a tpr fold
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
122
structure length
122
Chain Sequence
HMEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRTRYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cytosolic domain of the human mitchondrial fission protein Fis1 adopts a TPR fold
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords Fission protein Fis1p
total genus 53
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1nznA00
3ZN3A 4UI9J 1PC2A 2HYZA 2HR2A 2NC9A 3JYSA 1QQEA 2PQRA 3MEKA 5HQ8A 1E96B 3S7DA 5CCLA 3EDTB 4HOTA 5HI7A 4WNEA 1W3BA 3MKRA 2UY1B 2VQ2A 4U0SA 4N3AA 1B89A 3N71A 4I9EA 3AS5A 3KS2A 3PE3A 4UQXA 2IFUA 2KCLA 3AS8A 4KYOB 4U07A 3O48A 4BTAA 3PE4A 4GYYA 2Q7FA 5FZQA 2KCKA 2V5FA 3RO2A 3CVLA 4U0ZA 3QWPA 3SZ7A 2UWJG 3CKBA 4G25A 4BT8A 4BWRA 3U3WA 3LY7A 4G23A 2FI7A 4YVOA 5FJYA 5BT1A 2C0LA 5CCMA 1OUVA 1XNFA 2XGSA 3MV2B 4LEUA 4I2ZA 4G1TA 3ZFWA 2XCBA 4CGVA 4GYOA 3LPZA 4GZ5A 3S7FA 3VTYA 3ULQA 3TGOA 3WXXA 4Y6CA 4GA0A 3ZHEB 5G05C 1Y8MA 2C2LA 4BTBA 4GCOA 5KJLA 3LYAA 3LKUA 2PZIA 1IHGA 3LCAA 2J9QA 3QWVA 5A7DB 4G26A 4HOUA 3MV3B 1FCHA 3RO3A 3S7JA 2BUGA 2Y4UA 3IEGA 4GZ3A 3MA5A 4J0UA 4APOA 4XIFA 3VTXA 1ELRA 2Y4TA 5FT9A 3SF4A 3OXLA 5BNWA 5JJTA 1KLXA 1KT1A 5M72A 4YNDA 3GZ1A 4WNFA 1HH8A 1NA3A 3GZ2A 4UQZA 2FO7A 3GYZA 2KCVA 2XPIA 4KXKB 4UI9C 2XGOA 3Q49B 5DBKA 2VGXA 5FTPA 5G04J 3TAXA 4HOSA 2LSUA 4RG9A 5A6CA 3E4BA 3ASFA 3CVPA 3Q4AB 4JA9A 3R9AB 2UY1A 2GW1A 4WUYA 4GYWA 4CDRA 5CHEE 3Q5MA 1NZNA 4RG6A 1WM5A 5DIZA 3ASDA 5AYWD 1A17A 4AIFA 2WPVA 3RKVA 2FEZA 3FWVA 4XI9A 4XI0A 3TG4A 4GPKA 1ZU2A 2FF4A 2I6HA 2VSYA 2MHKA 3FFLA 1ELWA 3CK7A 3QKYA 3KAEA 2WQHA 3Q15A 4GCNA 4JHRA 4N3BA 4UQYA 4I1AA 5EKQD 5G04C 1ZBPA 4F3VA 4N39A 4N3CA 4N2QA 2PL2A 4G2VA 4HORA 2LNIA 1IYGA 5FZRA 3HYMB 2KATA 4AY5A 5JJ7A 3ESKA 4U04A 5FZSA 3OXGA 1YA0A 2VGXB 3QDNA 3ASGA 3FP3A 4GA1A 4G24A 2AVPA 4H7YA 4J8FA 4UI9K 3ZPJA 4BT9A 4N2SA 3KD7A 3CKCA 4J8EA 2VSNA 2XGMA 3CV0A 3Q47B 4HOQA 3LY9A 2E2EA 2P58C 4GA2A 4GZ6A 3AS4A 3OXFA 4I2WA 4O6FA 4NRHB 5BW8C 3UUXA 3CK8A 2VGYA 2XCCA 5KJKA 3ZGQA 3PDNA 1HZ4A 2ONDA 2YHCA 4KBQA 3NF1A 4U0UA 4W9RA 3UQ3A 5D0OD 3RJVA 4EQFA 3RU0A 3CK9A 4H7XA 2R5SA 2LSVA 2DBAA 2JLBA 3BEEA 2XEVA 5G05J 4NQ0A 2PQNA 4A1SA 5LCWJ 4YVQC 3S7BA 3UPVA 4JA7A 4WNDA 3TG5A 4AY6A 5ARFA 1HXIA 5EX3A 3CVQA 5EX0A 5JJ6A 1KT0A 5C1DA 3QWWA 4CGWA 5KJMA 4ABNA 1NA0A 1P5QA 4B94A 4Y6WA 3CVNA 4JL0A 2L6JA 2YQ8A 5KJNA 5ARGA 1TJCA 4IN3B 4N5CA 2VYIA 1WAO1 2HO1A 3LY8A 2C0MA 2KC7A 3QOUA 4I17A 4ME2A 1QZ2A 3K9IA 2QFCA 4WNGA 5D0QD 5LCWC 2OOEA 3ASHA 3CEQA 3URZA 2FBNA 3GW4A 4I9CA 3ZHEA 3RIBA 4J8DA 4AM9A 3U4TA 2IF4A
chains in the Genus database with same CATH superfamily
4XEIG 3L22A 4KT6B 1Z6TA 3DRAA 3MKQB 5HI7A 4XE0A 1K1AA 3LVQE 3FEXA 5FQ4A 5AN8A 1LD8A 3NQPA 3D9PA 4U0ZA 3QWPA 3PS6A 5FJYA 3EIQC 2X6FA 3HG0D 1QNFA 3TWRA 3L08A 2WQ6A 1RZ4A 3DEPA 4I43A 5KNGA 2XS8A 1EYHA 3HHMA 1D9SA 1Q2ZA 3WG7E 3IKOB 5E76A 2EQXA 1HX8A 4OAUC 4J8SA 2FEZA 4XI9A 3C98A 3SF4A 3G2WA 2PM6A 3HVEA 2WXMA 1UG3A 4GZCA 2EINE 1MHQA 2XZDG 4GA1A 4G24A 2V5QC 1OWPA 3D3MA 3CV0A 3T8MA 5BXUA 2XCCA 2YHCA 4W9RA 3V2XA 1O5MA 4A1SA 1TNUA 1BPOA 5EX0A 4GMJA 2BKGA 2WMOA 4NURA 3CSFA 5CBNA 5ENRD 4N5CA 2VYIA 2HO1A 2Y3AA 4YDWA 4WWPA 2FBNA 3X2QE 3U64A 1QQEA 1N94A 1E8YA 4U96D 3SGHA 3FU6A 3DWLG 1TN7A 4LEUA 4A55A 3TGOA 4G8LA 3WXXA 5G05C 1ELKA 2C2LA 3QWVA 2IO2C 1OWNA 3VTXA 3AU4A 2GRQB 4ATGA 3DXKG 3HRAA 2KCVA 3MJWA 3ABME 4K03A 4QFVA 4CT4A 2I1KA 4WUYA 3KSQA 3Q5MA 1N9AA 3ASDA 3TJPA 3SNXA 4PS3A 4AV7A 4UWKA 4I1AA 5FZSA 3EIJA 3I3NA 5BUZA 3ZPJA 4BT9A 2XGMA 3ULEG 5KJKA 1VDYA 3UQ3A 3BG1B 3RU0A 3L6AA 3FHEA 2Y0BG 4HVBA 3UIPC 3AG3E 5EX3A 3QWWA 1OCZE 5ENTD 2B6CA 4DLOA 3CVWA 1X5BA 1SZAA 4JD2G 1EPUA 4C48B 2AJAA 2X6IA 5ITZF 1OT8A 4U8VD 3MEKA 2B0OE 3FU0A 5EIBE 2R05A 1S0PA 3IXEA 4GMLA 4N5QA 3C72A 1GW6A 4KYOB 4BX9A 5B1BE 1OWMA 3CKBA 1OUVA 4I1MA 4I2ZA 2LAIA 2XCBA 4J6IA 1EF1C 2WXFA 3G2TA 4J7WA 3MA5A 4XIFA 2QZAA 5CBOA 3MCXA 4U95D 2IONA 4I6GA 4KXKB 5T8IA 3SQVA 4JA9A 4HRMB 3SHFA 4IYPA 1UN8A 3MKQA 3JCKC 3TXNA 4AEZC 5EKQD 4TV3A 4N3CA 5CMWA 1IYGA 3FUNA 4XKBA 1YA0A 3C5RA 1N4RA 4FA6A 1MJ0A 1AP7A 3CHQA 2DWZA 4I6JA 4BFRA 2VTBA 3CIAA 5KWDA 3Q78A 3BEEA 4AVXA 2P9UG 2IEJA 4R7LA 5ENQD 3TL5A 5FQ7A 3CVXA 1PAQA 4XZ4A 1UN9A 2YQ8A 1FVFA 5LCWC 3QARA 1JCRA 2IF4A 4OVVA 3DBSA 5AQ9A 4TUUA 3OAWA 3AS5A 4ZFHA 3UKRG 2V5FA 3EHQA 3Q75A 3C3RA 4URKA 3G2SA 4BTBA 2LO6A 3LCAA 2Y1LE 4KZCA 3FUFA 1HO8A 1QBQA 4DX1A 2FO1E 1X81A 3RRUA 2WMNA 4RLYA 3V79K 1NA3A 5FTPA 5G04J 2AXVA 3JUIA 3ZRHA 3DEOA 1OWLA 3UI2A 1OCOE 2XPYA 3VLEA 4DX6D 2J49A 5EN5D 2ILRA 3ESKA 4OYSA 4ILHB 4KVOA 3LJ3A 2CFUA 4NRHB 1JUQA 4CDNA 1HZ4A 3ISMC 4Q69A 3TWSA 4LRZA 1H2UA 4O60A 2PM7A 2WXGA 3KEZA 3FU5A 2J4DA 3SFZA 4Y6WA 4HI8A 2QC9A 4GTOA 4I17A 2QFCA 4B8CB 4DUIA 4HS2A 4UWLA 4CEMA 4GTMA 4Z68A 3U4TA 2HR2A 3UIOC 1E96B 5KCMA 1OY3D 2DZNA 3PE3A 4BX8A 4CT0A 4U8HA 5CEAA 3Q7AA 2AW6A 4L7TA 1K1BA 2WM9A 3PNLB 1OXJA 1Z5SC 3FUDA 3IHVA 4OAVB 1JWGA 1Y8MA 5KJLA 4FU3A 2BEDA 3D9NA 2R2LA 3ZNGA 4GZ3A 4JEHA 4F1SA 1HU3A 4EPZA 4DLQA 2L6BA 2FO7A 3GYZA 2XGOA 5DBKA 1LD7A 3Q4AB 4YDYA 3EU5A 1N95A 1H6PA 2OEVA 3KAEA 3Q15A 1MX6A 1ZBPA 3HIZA 5D66A 3HYMB 4TRQA 3QDNA 2XS1A 3FUEA 1DNPA 3UT4A 1TR4A 2OVFA 2ETAA 4JW1A 1BI8B 2XRZA 4GTSA 4ILGA 1TNBA 5FINA 5BV1A 4IN3B 3LY8A 3ZKJA 3D9MA 1MX2A 1TNZA 4M7CA 5AENA 3JUEA 3RIBA 4J8DA 3E33A 4A63B 5HS0A 3S7DA 1MZCA 1H6OA 4HBDA 2IFUA 1OCRE 1FT2A 3F6QA 3LXUX 2IU1A 2EILE 1BI7B 1JCQA 5B3SE 1FPPA 4G11A 4BESA 3QJZA 1V54E 4HI9A 4V3IA 5ENOD 1O1SA 3Q49B 3FH7A 2WVIA 4HRLA 1YMPA 5AIJA 3TWUA 3CVYA 5DIZA 1FT1A 3CHPA 5ENSD 2F8XK 2X6KA 4N3BA 1TN6A 3Q9NC 5FZRA 3AU5A 3HXEA 3NZSA 4O6FA 3AS4A 5T3RA 1BLXB 1NI1A 5ARFA 4B94A 2WB2A 3CR3A 4RQIA 4EBAG 1D8DA 1TJCA 4TUMA 4C0MA 3C3QA 3FTUA 4A1GA 3GW4A 4BWRA 3ZXSA 4KVMA 3V2OA 1L5JA 1Z3YA 2BF0X 3DSUA 3AS8A 4JB8P 4K5BA 4BETA 5EYPF 3SFXA 2I1JA 1JPLA 3J5QB 4JC8A 5BT1A 5FQ6A 3SBSA 1WY6A 3D9OA 2KXPC 4ANVA 4HOUA 2GRRB 4APOA 3T9KA 2Y4TA 1N4SA 4B93B 3CHMA 4FULA 5M72A 1LF8A 2DVWA 3PZ1A 1S64A 2P9SG 5ANRA 3TAXA 1TNOA 2GW1A 2VSXE 3QNKA 4GYWA 4CDRA 2WXKA 3FTZA 4GTTA 2MRIA 2I6HA 3HXCA 3G2UA 3MX3A 3ZXPA 4G8KA 3D9JA 4I2WA 2X6HA 3D9HA 4NACA 3HDXA 2LSVA 4L2YA 2L0TB 4EECA 2WQ7A 3E30A 2L6JA 5ARGA 3PH0C 5ENPD 3FUHA 5LFAA 4U8YD 1UW4B 2VQ2A 1B89A 3U9WA 4D10C 2OV8A 4L1BA 4JHKA 3UTMA 4LNGA 4YVOA 2A5EA 5BV0A 1Z3XA 3JQ0A 2XEEA 2I9CA 2PZIA 3BUAA 5A7DB 4G26A 3ONKA 3RO3A 3NB2A 3SI5A 2Y4UA 4J0UA 4JXTA 4CCAA 3PNTB 4FLBA 2IOLA 2WXOA 4MRUA 5FIOA 2GROB 3BG0B 2F8YA 1NFIE 1HF8A 2GGFA 4F53A 5T4YA 4PH4B 3KEAA 2MHKA 3CHSA 3CK7A 2WXJA 3PEVB 2R03A 4G2VA 3S2AA 2ZXWE 1UJKA 3UT8A 4JEUA 3FUMA 4GA2A 2P58C 5BW8C 3G2VA 3PRZA 2A5UA 3RJVA 2GRPB 4GU5A 2H6FA 4GTQA 3L16A 4CGWA 5JMND 5JA4D 2GRLA 4BY6A 3DSWA 3ASNE 4JL0A 4U63A 4ME2A 3K9IA 2IQCA 3LDZA 5D0QD 4UUCA 4XKCA 4AM9A 2HYZA 4A3TA 3ZUVB 3D9KA 2RD0A 2YHEA 4AOFA 3ZYQA 2BKKB 5BXOA 1UOHA 3FEYA 4I9EA 3KS2A 5HRYA 3P2BA 4BTAA 3VLDA 3FTVA 2KCKA 3RSEG 2VSOE 3CVLA 3FTXA 4Q94A 4XX5A 5CCMA 1TN8A 3Q7FA 1E8WA 4GYOA 2J08A 3PZDA 2J09A 3SBTB 3LKUA 3UXGA 4FLHA 3B7BA 5EIDA 4UWFA 1SZ9A 1KT1A 1HH8A 2WXQA 4ANUA 4UI9C 3ENEA 2EIJE 4RG9A 3R9AB 3AJIA 4BERA 2H6HA 1A17A 2RFAA 3EUVA 4AIFA 3APDA 4JHRA 4UQYA 2QY7A 2R17C 4RSYA 4HORA 3ZW3A 4EZJA 3LY9A 2E2EA 3AG1E 3OXFA 2RFMA 3CK9A 2H6GA 5JHAA 2KZTB 1JCSA 3PZ2A 1RW2A 2AXZA 5JJ6A 3V31A 1AWCB 5CERB 3CQCB 4E6HA 5KJNA 4UQZA 3FUJA 3D9IA 1KZPA 3KSLA 4EHMA 3MYVA 1PC2A 3FDHA 5CRUA 4FC8A 1K8KG 4U07A 5A23A 3ABKE 1S63A 2Q7FA 3ABLE 3FH8A 3LY7A 1MYOA 1XNFA 2X38A 2GRNB 3SD5A 4TXRA 1O1RA 2J8SD 5CRVA 2X6JA 3QAQA 3ESLA 4BSXA 2V0PA 2CG3A 1KLXA 4YNDA 5EYLA 3I4GA 3E4BA 4MLPA 3CVPA 4DI3A 2WXHA 4L2LA 3NOGD 5CHEE 5IY5E 2F0YA 2FF4A 2VSYA 3FFLA 3QC1A 4EZKA 3FTSA 2WQHA 3UT7A 1Y6IA 3CHOA 4HLEA 4CYMD 5C2YA 4LNBA 4J8FA 4H7YA 1IHBA 2MOWA 1YYHA 3SY2A 2QYUA 2ONDA 2XRYA 5D0OD 2R59A 4AJWA 2R5SA 2DBAA 4JA7A 5D2MC 3TG5A 1HXIA 4PS7A 3CVQA 5C1DA 1KT0A 4ANWA 2CFZA 1N52A 2V4HC 3L82A 1TEZA 3ZN3A 3L13A 1DVPA 2DYRE 4ACLA 3DSSA 1JWFA 2OEWA 4WWNA 4GTRA 1W3BA 1HFAA 3FH5A 2R02A 3W9GA 2I2OA 4U7EB 2P9LG 1E8ZA 1IKND 1KZOA 4DX2A 4DPRA 4UWGA 4FHJA 3S7FA 3U66A 4MKTA 4Q96A 1LTXA 2J07A 2J9QA 4GZDA 5J08A 3MV3B 3PUJA 2JEKA 5AQBA 1OCCE 3FTYA 3GZ2A 2CHZA 2AXUA 3LJNA 3E32A 4TXPA 4AP2A 1NZNA 4APFA 4XI0A 5EILA 3QKYA 4GCNA 4HQDA 2ZIRA 2ZISA 1V55E 4DJAA 4N2QA 1O1TA 3ZYMA 4B8AA 4AY5A 5JJ7A 4U04A 2GRMA 3IV0A 4ANXA 3I5PA 2ZU6B 4U0UA 2XENA 3UM0A 4L23A 4GTPA 2XEVA 2PQNA 3APFA 4WNDA 3L9TA 4A3VA 3E37A 4JPSA 4LSZE 1P5QA 4FJZA 3FUIA 3FUKA 3Q79A 3T5XA 2IJGX 3ASHA 4ACKA 1PY1A 4DX7D 2ZGGA 5G55A 2DIWA 3CQGB 4QQIA 3NAWA 3AAAC 3CHRA 4GPMA 5JHBA 1SQMA 4K0RA 3SZ7A 5LX8A 3U3WA 2UWJG 4F7AA 2XGSA 4GMRA 4G1TA 4K5CA 3VTYA 1DC2A 2YINA 1IHGA 3B13A 1IQUA 3TWWA 3R9MA 1FCHA 2BUGA 2NSZA 3BQOA 1ELRA 3JXJA 3PZ4A 2IOSA 2VGXA 4MS6A 3RAUA 4JZYA 3APCA 2LXLA 4YDOA 1HG2A 1WM5A 1H2VC 2WPVA 1YCSB 3RKVA 2XEHA 5G04C 4F3VA 3FULA 1MQSA 1SA5A 1N11A 3FY4A 4O1PA 1IQRA 4X8QA 5LOZA 4CDMA 3TWVA 2X3MA 3OXGA 4UI9K 5H7PA 3FP3A 1HE8A 3UUXA 2P2CP 3UMVA 2YNQA 4KBQA 4FP7A 1DCEA 2AWIA 4PDXA 2NXPA 3UINC 4DI4A 2EIKE 1QZ2A 1BD8A 1MX4A 2OOEA 4PS8A 4I9CA 1H6KA 3PEUB 3R7RA 1A5EA 2NC9A 4ZHBA 3AG4E 5HQ8A 2XPZA 3DSVA 5AQAA 5CCLA 3PREA 3VLFA 3MKRA 3ULYA 3N71A 2P9IG 1EDUA 3O48A 3EHRA 1QYMA 4WWOA 2C0LA 2Y69E 2XZTG 4UWHA 3LPZA 4GZ5A 3O4ZA 2BTDA 2L9BA 4HRNA 4TXQA 3ZYKA 3CGHA 3IHYA 3IEGA 2KM4A 3HXDA 3OXLA 2CHWA 1TYQG 2LAHA 1N4QA 2QYJA 2LSUA 1TNYA 3ASFA 1INZA 4DRXE 4I6EA 1N0RA 5AYWD 2WXNA 1BU9A 1K3ZD 4LUNU 4L9PA 1ELWA 4N39A 3NBNB 1E7UA 5AARA 2VGXB 2VSNA 3Q47B 3L17A 4GZ6A 2JABA 2E0IA 3DSTA 3NF1A 4NIKA 3EHMA 1HG5A 2H6IA 2VGEA 4ABNA 1NA0A 2LXMA 4JVSA 1H2TC 4EBAA 4LNUD 3QOUA 2C0MA 2KC7A 1H0AA 4GB9A 3URZA 2J4BA 2XHEA 4HXIA 5CECB 3ASOE 2RKKA 1UJJA 3GZSA 2WXRA 3ZVVA 5EDSA 1SW6A 4HOTA 4U0SA 2CG2A 4FHKA 3E34A 1U2VG 4KMOA 4UQXA 2KCLA 5B1AE 1HS6A 4K5AB 3QK0A 5FZQA 3RO2A 5AAOA 1N4PA 4LG6A 1SVXA 4G23A 2FI7A 3MV2B 3LVRE 4CGVA 4DK5A 3ULQA 4Y6CA 3ZHEB 3CLJA 4GCOA 4PUCA 2FULA 1TJFA 3TWTA 1DCQA 4F6RD 1E90A 5BNWA 4DX5D 4EZLA 3GZ1A 4WNFA 2XPIA 3T5VA 3FU3A 3NOCD 3UM1A 1H19A 4HLLA 3EHNA 3MGBA 1NP7A 4GPKA 3AG2E 3SFYA 3R7QA 4BEPA 3RK6A 3UX4A 2LNIA 2KZTA 1OWOA 4HFGA 2AVPA 2NYJA 3QB2A 3J5PA 3CKCA 4IRUA 1E7VA 3SO8A 3UKUG 3ZGQA 3DXMG 5CEDB 3ZEFA 1XGWA 2F37A 5G05J 1E8XA 5LCWJ 3UPVA 3HXFA 3EU9A 3LS8A 5AJLA 1U3CA 2WXPA 3L54A 1WAO1 4BSZB 3CEQA 4AXHA 5FQ8A 4C9BB 4E85A 4UI9J 3JYSA 3NZUA 4M3OA 5LP0A 4WNEA 3ONLA 3CVUA 2UY1B 2KBXA 2RG8A 4GYYA 1WDYA 3T8KA 4GA0A 2HM8A 1N0QA 3LYAA 3CVVA 1N54A 2A4ZA 3DSXA 4WAFA 4P29A 3TWQA 4CZ2D 2OVBA 3I4RB 5E75A 3ZU7B 4GAAA 4RVBA 3C3OA 3RRMB 5KBAA 2PNNA 1SA4A 4OVUA 5HKPA 3IBEA 4HOSA 3JQ1A 2EIME 3FWVA 3ZYLA 3PUKA 3B7RL 3Q73A 1U3DA 3TXMA 2KATA 4KZ0A 3EJNA 5AJDA 3JXIA 3KD7A 4J8EA 2P9NG 2V8SE 1D8EA 3UM2A 4B0ZA 2VGYA 2ZGDA 3ML8A 2HE0A 4H7XA 2VTBB 3B95A 4LERA 3S7BA 5J90A 3B7UX 2WXIA 2L0IA 4YDEA 4HNAD 3Q9UC 5KNHD 4O1OA 2LUHA 3D9LA 4FADA 2DCPA 3BU8A 2IO3C 4WNGA 5JJTA 2PQRA 4HB5A 4ATZD 2VJ8A 3LEWA 3EDTB 2CHXA 4N3AA 2M63A 2ETCA 4FJYA 5BPPA 4J8YA 3PE4A 4BT8A 3ML9A 4G25A 3HVEB 3PZ3A 3ZFWA 3W9FA 2V4LA 1WG0A 2ETBA 4GTVA 3DPDA 4I1OB 2P9KG 3MZLB 1FVHA 5FT9A 1ZB1A 5G2NA 4B89A 4MBGA 4LCTA 2DYSE 3B7SA 1G3NB 5A6CA 1KPSB 3P1UA 2UY1A 2MYOA 1NL4A 5ANLA 4RG6A 4IULA 1IXVA 4C0EA 3TG4A 1ZU2A 3S7JA 2P9PG 5AQ7A 2PL2A 5FWQA 5ENNA 3CSTA 3FTWA 3TWXA 3ASGA 4N2SA 3B7TA 4CRWA 3RRNB 2DZOA 3ZIMA 4HOQA 3UM3A 3CK8A 3PDNA 4EQFA 2XQ0A 4JHJA 4F1PA 2JLBA 4NQ0A 4YVQC 4AY6A 1S70B 3PVLA 5CMYA 3HXBA 5KJMA 4ILIA 2IY0C 2OCCE 3OTNA 3DPYA 3CVNA 3V30A 2WXLA 3ZHEA
chains in the Genus database with same CATH topology
2HYZA 2HR2A 3L22A 2NC9A 4KT6B 3D9KA 4A3TA 1Z6TA 5HQ8A 2XPZA 2RD0A 2YHEA 1E96B 3MKQB 5CCLA 3PREA 4AOFA 3VLFA 5HI7A 3ZYQA 5KCMA 4XE0A 3MKRA 3FEYA 3N71A 4I9EA 3LVQE 3FEXA 3KS2A 5JJ7A 3PE3A 1EDUA 5FQ4A 3P2BA 4BTAA 3VLDA 3O48A 4BX8A 4CT0A 3FTVA 4U8HA 2KCKA 3D9PA 3NQPA 4WWOA 2VSOE 2AW6A 3CVLA 3FTXA 3QWPA 4L7TA 4Q94A 4U0ZA 4XX5A 2WM9A 3PS6A 5FJYA 5CCMA 2C0LA 3EIQC 2X6FA 3PNLB 4UWHA 1E8WA 4GYOA 3FUDA 2J08A 3IHVA 3LPZA 4GZ5A 1JWGA 1QNFA 3O4ZA 2BTDA 3PZDA 2J09A 3SBTB 1Y8MA 5KJLA 2L9BA 4FU3A 3LKUA 3L08A 2WQ6A 3ZYKA 3D9NA 3CGHA 3IHYA 3IEGA 4GZ3A 4FLHA 4JEHA 2KM4A 4F1SA 1HU3A 4I43A 4UWFA 1SZ9A 3OXLA 2CHWA 4EPZA 4DLQA 1KT1A 2LAHA 1EYHA 3HHMA 1HH8A 2WXQA 4ANUA 2FO7A 3GYZA 4UI9C 2XGOA 3ENEA 5DBKA 2LSUA 4RG9A 3ASFA 3Q4AB 1INZA 3R9AB 3IKOB 4I6EA 5E76A 5AYWD 1A17A 2EQXA 2WXNA 1HX8A 4AIFA 4LUNU 4J8SA 2FEZA 4XI9A 3APDA 3C98A 3SF4A 3G2WA 4JHRA 1ELWA 3KAEA 3Q15A 4UQYA 2QY7A 2PM6A 3HVEA 1ZBPA 2R17C 3HIZA 2WXMA 4N39A 4RSYA 1UG3A 4HORA 4GZCA 1E7UA 1MHQA 3HYMB 4TRQA 3QDNA 2VGXB 4GA1A 3FUEA 4G24A 1DNPA 3UT4A 4EZKA 3ZW3A 1OWPA 4EZJA 3D3MA 2VSNA 3CV0A 3L17A 3Q47B 3LY9A 2E2EA 4GZ6A 3T8MA 3OXFA 2OVFA 2XCCA 2E0IA 2YHCA 4W9RA 3NF1A 3CK9A 3EHMA 4JW1A 2XRZA 4A1SA 5JHAA 1BPOA 2KZTB 1HG5A 4ILGA 2AXZA 5EX0A 5JJ6A 4GMJA 2WMOA 4ABNA 1NA0A 4NURA 3CSFA 4JVSA 1H2TC 5BV1A 3CQCB 4E6HA 4EBAA 5KJNA 4IN3B 4N5CA 2VYIA 4UQZA 2HO1A 2Y3AA 2C0MA 2KC7A 3LY8A 3FUJA 1H0AA 3D9IA 3D9MA 3QOUA 4GB9A 4WWPA 3URZA 2J4BA 2XHEA 4HXIA 2FBNA 5AENA 3RIBA 4J8DA 1UJJA 3GZSA 1PC2A 3MYVA 2WXRA 3FDHA 3U64A 1QQEA 3S7DA 1E8YA 3SGHA 3ZVVA 5EDSA 4HOTA 4U0SA 2CG2A 4FC8A 4FHKA 3FU6A 4KMOA 4UQXA 2IFUA 2KCLA 4U07A 5A23A 1HS6A 3QK0A 2Q7FA 5FZQA 3RO2A 3FH8A 3LY7A 4G23A 2FI7A 1XNFA 3MV2B 4LEUA 2X38A 3SD5A 3LVRE 3LXUX 4A55A 4DK5A 4CGVA 3TGOA 2IU1A 3ULQA 3WXXA 4Y6CA 3ZHEB 5G05C 1ELKA 2C2LA 3CLJA 4GCOA 4PUCA 5ENNA 2FULA 2X6JA 3QWVA 1TJFA 3QAQA 1OWNA 3ESLA 4G11A 3QJZA 1E90A 4BSXA 3VTXA 3AU4A 2V0PA 2CG3A 5BNWA 1KLXA 4V3IA 4EZLA 4YNDA 3GZ1A 4ATGA 4WNFA 2KCVA 2XPIA 3T5VA 3MJWA 3Q49B 3FH7A 3FU3A 2WVIA 3I4GA 4K03A 3E4BA 4MLPA 1H19A 3CVPA 4QFVA 4CT4A 2I1KA 2WXHA 4DI3A 5AIJA 4L2LA 4WUYA 5CHEE 3EHNA 3Q5MA 3CVYA 5DIZA 3ASDA 3MGBA 3TJPA 3CHPA 1NP7A 4GPKA 3SNXA 2FF4A 2VSYA 3FFLA 4PS3A 2X6KA 3FTSA 3QC1A 4N3BA 2WQHA 3R7QA 4AV7A 3UT7A 4UWKA 1Y6IA 4I1AA 3RK6A 3UX4A 3CHOA 4HLEA 2LNIA 5C2YA 5FZRA 2KZTA 5FZSA 1OWOA 4HFGA 3EIJA 3I3NA 4J8FA 3AU5A 3ZPJA 2AVPA 4H7YA 4BT9A 5BUZA 3QB2A 3CKCA 4IRUA 1E7VA 2XGMA 3NZSA 4O6FA 3AS4A 2MOWA 5KJKA 3ZGQA 1VDYA 2ONDA 2XRYA 3UQ3A 5D0OD 3BG1B 2R59A 3RU0A 5T3RA 3L6AA 3ZEFA 1XGWA 2R5SA 2DBAA 4AJWA 5G05J 3FHEA 1E8XA 5LCWJ 3UPVA 4JA7A 3TG5A 4HVBA 5ARFA 1HXIA 3LS8A 3CVQA 4PS7A 5EX3A 1KT0A 4ANWA 3QWWA 5C1DA 2CFZA 1N52A 5AJLA 4B94A 4DLOA 1U3CA 3CR3A 3CVWA 2WB2A 2WXPA 1X5BA 4EBAG 1SZAA 3L54A 1TJCA 1TEZA 1WAO1 4C0MA 3FTUA 3ZN3A 3L13A 1DVPA 3CEQA 4AXHA 1EPUA 4A1GA 3GW4A 5FQ8A 4C9BB 4ACLA 4BWRA 4E85A 4UI9J 2X6IA 1JWFA 3JYSA 3NZUA 3MEKA 3ZXSA 3FU0A 4M3OA 4KVMA 4WWNA 5LP0A 1L5JA 1S0PA 1Z3YA 4WNEA 3ONLA 1W3BA 3CVUA 2UY1B 1HFAA 2BF0X 3FH5A 4GMLA 1GW6A 3AS8A 4KYOB 4BX9A 2RG8A 1OWMA 4GYYA 3CKBA 2I1JA 1JPLA 2I2OA 4JC8A 5BT1A 1E8ZA 1OUVA 4I1MA 4I2ZA 2LAIA 2XCBA 4DPRA 4UWGA 4FHJA 3S7FA 3U66A 4MKTA 4Q96A 4GA0A 5FQ6A 4J6IA 1EF1C 2HM8A 2WXFA 1WY6A 3SBSA 3LYAA 3CVVA 1N54A 3G2TA 2J07A 2A4ZA 2J9QA 3D9OA 4GZDA 4ANVA 4HOUA 5J08A 3MV3B 4WAFA 3MA5A 3PUJA 4P29A 4APOA 4XIFA 2Y4TA 3MCXA 2OVBA 3I4RB 2JEKA 5E75A 3CHMA 2IONA 3FTYA 4GAAA 4FULA 4RVBA 5M72A 3RRMB 4OVUA 1LF8A 3GZ2A 4I6GA 4KXKB 5ANRA 2CHZA 3IBEA 3TAXA 5T8IA 2AXUA 4HOSA 3JQ1A 4JA9A 2GW1A 3SHFA 2VSXE 4IYPA 1UN8A 3QNKA 4GYWA 4CDRA 4AP2A 1NZNA 3MKQA 2WXKA 3FTZA 3JCKC 4APFA 3FWVA 4XI0A 2MRIA 2I6HA 3TXNA 3ZYLA 3QKYA 4GCNA 4AEZC 3PUKA 5EKQD 3B7RL 4TV3A 1U3DA 4N3CA 4DJAA 4N2QA 5CMWA 1IYGA 3ZYMA 3FUNA 2KATA 3G2UA 4KZ0A 3EJNA 4XKBA 3TXMA 4U04A 5AJDA 3MX3A 4B8AA 1YA0A 4AY5A 2GRMA 3IV0A 4ANXA 4FA6A 3KD7A 4J8EA 2V8SE 3CHQA 3D9JA 4I2WA 4B0ZA 3I5PA 2X6HA 4I6JA 2VGYA 4BFRA 2ZU6B 4U0UA 3ML8A 2VTBA 4L23A 4NACA 3HDXA 3CIAA 4H7XA 2LSVA 2VTBB 4LERA 3BEEA 2XEVA 2PQNA 4AVXA 3APFA 3S7BA 4R7LA 4WNDA 3TL5A 4L2YA 3B7UX 2WXIA 5FQ7A 2L0IA 5J90A 2L0TB 4A3VA 4EECA 4JPSA 3CVXA 1PAQA 1P5QA 4FJZA 2WQ7A 3D9LA 4XZ4A 2DCPA 4FADA 1UN9A 3FUIA 2L6JA 2YQ8A 3ZHEA 5ARGA 3FUKA 1FVFA 3PH0C 4WNGA 3T5XA 5LCWC 2IJGX 3ASHA 4ACKA 3FUHA 5LFAA 5JJTA 1PY1A 3QARA 2IF4A 4OVVA 2PQRA 1UW4B 5G55A 3DBSA 2VJ8A 3LEWA 3EDTB 2DIWA 4TUUA 3OAWA 2VQ2A 2CHXA 4N3AA 1B89A 3CQGB 3AS5A 3U9WA 2M63A 4D10C 2OV8A 4FJYA 4L1BA 5BPPA 3PE4A 3CHRA 5JHBA 1SQMA 4K0RA 2V5FA 3SZ7A 4BT8A 5LX8A 3U3WA 2UWJG 3ML9A 4G25A 4JHKA 4YVOA 3HVEB 4F7AA 4URKA 2XGSA 4G1TA 3ZFWA 5BV0A 3VTYA 1Z3XA 3JQ0A 3G2SA 2I9CA 2V4LA 4BTBA 2LO6A 2PZIA 2YINA 1IHGA 3B13A 3LCAA 1IQUA 5A7DB 4G26A 3DPDA 3ONKA 4I1OB 1FCHA 3MZLB 3RO3A 2BUGA 2Y4UA 4KZCA 3SI5A 3FUFA 4J0UA 1HO8A 2NSZA 1FVHA 1ELRA 3RRUA 5FT9A 4JXTA 5G2NA 3PNTB 4FLBA 4B89A 4CCAA 2WMNA 4LCTA 2IOLA 2IOSA 2WXOA 1NA3A 4MRUA 3B7SA 2VGXA 5FTPA 5G04J 2AXVA 3JUIA 5A6CA 3ZRHA 4MS6A 4JZYA 3BG0B 3P1UA 2UY1A 3APCA 5ANLA 1OWLA 1HF8A 1HG2A 2GGFA 1WM5A 4IULA 1H2VC 4RG6A 4F53A 2XPYA 3VLEA 2WPVA 3RKVA 5T4YA 4C0EA 3TG4A 1ZU2A 4PH4B 3S7JA 2MHKA 3CHSA 3CK7A 5G04C 2J49A 4F3VA 3FULA 2ILRA 2WXJA 3PEVB 1MQSA 2PL2A 3FY4A 4G2VA 1IQRA 3S2AA 5LOZA 5FWQA 4CDMA 2X3MA 3CSTA 3ESKA 3FTWA 1UJKA 3OXGA 4OYSA 4UI9K 3ASGA 3FP3A 4N2SA 3B7TA 4ILHB 4CRWA 4KVOA 3UT8A 3LJ3A 4JEUA 3RRNB 3FUMA 3ZIMA 4HOQA 4GA2A 2P58C 1HE8A 2CFUA 5BW8C 3UUXA 4NRHB 3G2VA 1JUQA 2YNQA 3CK8A 3UMVA 3PDNA 3PRZA 1HZ4A 4CDNA 4KBQA 2A5UA 4EQFA 3RJVA 4Q69A 4LRZA 4GU5A 2XQ0A 4JHJA 2JLBA 4NQ0A 1H2UA 4YVQC 4FP7A 4AY6A 3PVLA 2PM7A 3L16A 5CMYA 2WXGA 2AWIA 4PDXA 4CGWA 5KJMA 4ILIA 3KEZA 2NXPA 2GRLA 2J4DA 3FU5A 3SFZA 4BY6A 3OTNA 4Y6WA 3CVNA 4JL0A 4DI4A 4U63A 4I17A 4ME2A 1QZ2A 2IQCA 2QFCA 3K9IA 3LDZA 5D0QD 4PS8A 2OOEA 4B8CB 2WXLA 4HS2A 1H6KA 4I9CA 4UWLA 4CEMA 4XKCA 4AM9A 3U4TA 3PEUB 3R7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZN3 A;  4UI9 J;  1PC2 A;  2HYZ A;  2HR2 A;  2NC9 A;  3JYS A;  1QQE A;  2PQR A;  3MEK A;  5HQ8 A;  1E96 B;  3S7D A;  5CCL A;  3EDT B;  4HOT A;  5HI7 A;  4WNE A;  1W3B A;  3MKR A;  2UY1 B;  2VQ2 A;  4U0S A;  4N3A A;  1B89 A;  3N71 A;  4I9E A;  3AS5 A;  3KS2 A;  3PE3 A;  4UQX A;  2IFU A;  2KCL A;  3AS8 A;  4KYO B;  4U07 A;  3O48 A;  4BTA A;  3PE4 A;  4GYY A;  2Q7F A;  5FZQ A;  2KCK A;  2V5F A;  3RO2 A;  3CVL A;  4U0Z A;  3QWP A;  3SZ7 A;  2UWJ G;  3CKB A;  4G25 A;  4BT8 A;  4BWR A;  3U3W A;  3LY7 A;  4G23 A;  2FI7 A;  4YVO A;  5FJY A;  5BT1 A;  2C0L A;  5CCM A;  1OUV A;  1XNF A;  2XGS A;  3MV2 B;  4LEU A;  4I2Z A;  4G1T A;  3ZFW A;  2XCB A;  4CGV A;  4GYO A;  3LPZ A;  4GZ5 A;  3S7F A;  3VTY A;  3ULQ A;  3TGO A;  3WXX A;  4Y6C A;  4GA0 A;  3ZHE B;  5G05 C;  1Y8M A;  2C2L A;  4BTB A;  4GCO A;  5KJL A;  3LYA A;  3LKU A;  2PZI A;  1IHG A;  3LCA A;  2J9Q A;  3QWV A;  5A7D B;  4G26 A;  4HOU A;  3MV3 B;  1FCH A;  3RO3 A;  3S7J A;  2BUG A;  2Y4U A;  3IEG A;  4GZ3 A;  3MA5 A;  4J0U A;  4APO A;  4XIF A;  3VTX A;  1ELR A;  2Y4T A;  5FT9 A;  3SF4 A;  3OXL A;  5BNW A;  5JJT A;  1KLX A;  1KT1 A;  5M72 A;  4YND A;  3GZ1 A;  4WNF A;  1HH8 A;  1NA3 A;  3GZ2 A;  4UQZ A;  2FO7 A;  3GYZ A;  2KCV A;  2XPI A;  4KXK B;  4UI9 C;  2XGO A;  3Q49 B;  5DBK A;  2VGX A;  5FTP A;  5G04 J;  3TAX A;  4HOS A;  2LSU A;  4RG9 A;  5A6C A;  3E4B A;  3ASF A;  3CVP A;  3Q4A B;  4JA9 A;  3R9A B;  2UY1 A;  2GW1 A;  4WUY A;  4GYW A;  4CDR A;  5CHE E;  3Q5M A;  1NZN A;  4RG6 A;  1WM5 A;  5DIZ A;  3ASD A;  5AYW D;  1A17 A;  4AIF A;  2WPV A;  3RKV A;  2FEZ A;  3FWV A;  4XI9 A;  4XI0 A;  3TG4 A;  4GPK A;  1ZU2 A;  2FF4 A;  2I6H A;  2VSY A;  2MHK A;  3FFL A;  1ELW A;  3CK7 A;  3QKY A;  3KAE A;  2WQH A;  3Q15 A;  4GCN A;  4JHR A;  4N3B A;  4UQY A;  4I1A A;  5EKQ D;  5G04 C;  1ZBP A;  4F3V A;  4N39 A;  4N3C A;  4N2Q A;  2PL2 A;  4G2V A;  4HOR A;  2LNI A;  1IYG A;  5FZR A;  3HYM B;  2KAT A;  4AY5 A;  5JJ7 A;  3ESK A;  4U04 A;  5FZS A;  3OXG A;  1YA0 A;  2VGX B;  3QDN A;  3ASG A;  3FP3 A;  4GA1 A;  4G24 A;  2AVP A;  4H7Y A;  4J8F A;  4UI9 K;  3ZPJ A;  4BT9 A;  4N2S A;  3KD7 A;  3CKC A;  4J8E A;  2VSN A;  2XGM A;  3CV0 A;  3Q47 B;  4HOQ A;  3LY9 A;  2E2E A;  2P58 C;  4GA2 A;  4GZ6 A;  3AS4 A;  3OXF A;  4I2W A;  4O6F A;  4NRH B;  5BW8 C;  3UUX A;  3CK8 A;  2VGY A;  2XCC A;  5KJK A;  3ZGQ A;  3PDN A;  1HZ4 A;  2OND A;  2YHC A;  4KBQ A;  3NF1 A;  4U0U A;  4W9R A;  3UQ3 A;  5D0O D;  3RJV A;  4EQF A;  3RU0 A;  3CK9 A;  4H7X A;  2R5S A;  2LSV A;  2DBA A;  2JLB A;  3BEE A;  2XEV A;  5G05 J;  4NQ0 A;  2PQN A;  4A1S A;  5LCW J;  4YVQ C;  3S7B A;  3UPV A;  4JA7 A;  4WND A;  3TG5 A;  4AY6 A;  5ARF A;  1HXI A;  5EX3 A;  3CVQ A;  5EX0 A;  5JJ6 A;  1KT0 A;  5C1D A;  3QWW A;  4CGW A;  5KJM A;  4ABN A;  1NA0 A;  1P5Q A;  4B94 A;  4Y6W A;  3CVN A;  4JL0 A;  2L6J A;  2YQ8 A;  5KJN A;  5ARG A;  1TJC A;  4IN3 B;  4N5C A;  2VYI A;  1WAO 1;  2HO1 A;  3LY8 A;  2C0M A;  2KC7 A;  3QOU A;  4I17 A;  4ME2 A;  1QZ2 A;  3K9I A;  2QFC A;  4WNG A;  5D0Q D;  5LCW C;  2OOE A;  3ASH A;  3CEQ A;  3URZ A;  2FBN A;  3GW4 A;  4I9C A;  3ZHE A;  3RIB A;  4J8D A;  4AM9 A;  3U4T A;  2IF4 A; 
#chains in the Genus database with same CATH topology
 4XEI G;  3L22 A;  4KT6 B;  1Z6T A;  3DRA A;  3MKQ B;  5HI7 A;  4XE0 A;  1K1A A;  3LVQ E;  3FEX A;  5FQ4 A;  5AN8 A;  1LD8 A;  3NQP A;  3D9P A;  4U0Z A;  3QWP A;  3PS6 A;  5FJY A;  3EIQ C;  2X6F A;  3HG0 D;  1QNF A;  3TWR A;  3L08 A;  2WQ6 A;  1RZ4 A;  3DEP A;  4I43 A;  5KNG A;  2XS8 A;  1EYH A;  3HHM A;  1D9S A;  1Q2Z A;  3WG7 E;  3IKO B;  5E76 A;  2EQX A;  1HX8 A;  4OAU C;  4J8S A;  2FEZ A;  4XI9 A;  3C98 A;  3SF4 A;  3G2W A;  2PM6 A;  3HVE A;  2WXM A;  1UG3 A;  4GZC A;  2EIN E;  1MHQ A;  2XZD G;  4GA1 A;  4G24 A;  2V5Q C;  1OWP A;  3D3M A;  3CV0 A;  3T8M A;  5BXU A;  2XCC A;  2YHC A;  4W9R A;  3V2X A;  1O5M A;  4A1S A;  1TNU A;  1BPO A;  5EX0 A;  4GMJ A;  2BKG A;  2WMO A;  4NUR A;  3CSF A;  5CBN A;  5ENR D;  4N5C A;  2VYI A;  2HO1 A;  2Y3A A;  4YDW A;  4WWP A;  2FBN A;  3X2Q E;  3U64 A;  1QQE A;  1N94 A;  1E8Y A;  4U96 D;  3SGH A;  3FU6 A;  3DWL G;  1TN7 A;  4LEU A;  4A55 A;  3TGO A;  4G8L A;  3WXX A;  5G05 C;  1ELK A;  2C2L A;  3QWV A;  2IO2 C;  1OWN A;  3VTX A;  3AU4 A;  2GRQ B;  4ATG A;  3DXK G;  3HRA A;  2KCV A;  3MJW A;  3ABM E;  4K03 A;  4QFV A;  4CT4 A;  2I1K A;  4WUY A;  3KSQ A;  3Q5M A;  1N9A A;  3ASD A;  3TJP A;  3SNX A;  4PS3 A;  4AV7 A;  4UWK A;  4I1A A;  5FZS A;  3EIJ A;  3I3N A;  5BUZ A;  3ZPJ A;  4BT9 A;  2XGM A;  3ULE G;  5KJK A;  1VDY A;  3UQ3 A;  3BG1 B;  3RU0 A;  3L6A A;  3FHE A;  2Y0B G;  4HVB A;  3UIP C;  3AG3 E;  5EX3 A;  3QWW A;  1OCZ E;  5ENT D;  2B6C A;  4DLO A;  3CVW A;  1X5B A;  1SZA A;  4JD2 G;  1EPU A;  4C48 B;  2AJA A;  2X6I A;  5ITZ F;  1OT8 A;  4U8V D;  3MEK A;  2B0O E;  3FU0 A;  5EIB E;  2R05 A;  1S0P A;  3IXE A;  4GML A;  4N5Q A;  3C72 A;  1GW6 A;  4KYO B;  4BX9 A;  5B1B E;  1OWM A;  3CKB A;  1OUV A;  4I1M A;  4I2Z A;  2LAI A;  2XCB A;  4J6I A;  1EF1 C;  2WXF A;  3G2T A;  4J7W A;  3MA5 A;  4XIF A;  2QZA A;  5CBO A;  3MCX A;  4U95 D;  2ION A;  4I6G A;  4KXK B;  5T8I A;  3SQV A;  4JA9 A;  4HRM B;  3SHF A;  4IYP A;  1UN8 A;  3MKQ A;  3JCK C;  3TXN A;  4AEZ C;  5EKQ D;  4TV3 A;  4N3C A;  5CMW A;  1IYG A;  3FUN A;  4XKB A;  1YA0 A;  3C5R A;  1N4R A;  4FA6 A;  1MJ0 A;  1AP7 A;  3CHQ A;  2DWZ A;  4I6J A;  4BFR A;  2VTB A;  3CIA A;  5KWD A;  3Q78 A;  3BEE A;  4AVX A;  2P9U G;  2IEJ A;  4R7L A;  5ENQ D;  3TL5 A;  5FQ7 A;  3CVX A;  1PAQ A;  4XZ4 A;  1UN9 A;  2YQ8 A;  1FVF A;  5LCW C;  3QAR A;  1JCR A;  2IF4 A;  4OVV A;  3DBS A;  5AQ9 A;  4TUU A;  3OAW A;  3AS5 A;  4ZFH A;  3UKR G;  2V5F A;  3EHQ A;  3Q75 A;  3C3R A;  4URK A;  3G2S A;  4BTB A;  2LO6 A;  3LCA A;  2Y1L E;  4KZC A;  3FUF A;  1HO8 A;  1QBQ A;  4DX1 A;  2FO1 E;  1X81 A;  3RRU A;  2WMN A;  4RLY A;  3V79 K;  1NA3 A;  5FTP A;  5G04 J;  2AXV A;  3JUI A;  3ZRH A;  3DEO A;  1OWL A;  3UI2 A;  1OCO E;  2XPY A;  3VLE A;  4DX6 D;  2J49 A;  5EN5 D;  2ILR A;  3ESK A;  4OYS A;  4ILH B;  4KVO A;  3LJ3 A;  2CFU A;  4NRH B;  1JUQ A;  4CDN A;  1HZ4 A;  3ISM C;  4Q69 A;  3TWS A;  4LRZ A;  1H2U A;  4O60 A;  2PM7 A;  2WXG A;  3KEZ A;  3FU5 A;  2J4D A;  3SFZ A;  4Y6W A;  4HI8 A;  2QC9 A;  4GTO A;  4I17 A;  2QFC A;  4B8C B;  4DUI A;  4HS2 A;  4UWL A;  4CEM A;  4GTM A;  4Z68 A;  3U4T A;  2HR2 A;  3UIO C;  1E96 B;  5KCM A;  1OY3 D;  2DZN A;  3PE3 A;  4BX8 A;  4CT0 A;  4U8H A;  5CEA A;  3Q7A A;  2AW6 A;  4L7T A;  1K1B A;  2WM9 A;  3PNL B;  1OXJ A;  1Z5S C;  3FUD A;  3IHV A;  4OAV B;  1JWG A;  1Y8M A;  5KJL A;  4FU3 A;  2BED A;  3D9N A;  2R2L A;  3ZNG A;  4GZ3 A;  4JEH A;  4F1S A;  1HU3 A;  4EPZ A;  4DLQ A;  2L6B A;  2FO7 A;  3GYZ A;  2XGO A;  5DBK A;  1LD7 A;  3Q4A B;  4YDY A;  3EU5 A;  1N95 A;  1H6P A;  2OEV A;  3KAE A;  3Q15 A;  1MX6 A;  1ZBP A;  3HIZ A;  5D66 A;  3HYM B;  4TRQ A;  3QDN A;  2XS1 A;  3FUE A;  1DNP A;  3UT4 A;  1TR4 A;  2OVF A;  2ETA A;  4JW1 A;  1BI8 B;  2XRZ A;  4GTS A;  4ILG A;  1TNB A;  5FIN A;  5BV1 A;  4IN3 B;  3LY8 A;  3ZKJ A;  3D9M A;  1MX2 A;  1TNZ A;  4M7C A;  5AEN A;  3JUE A;  3RIB A;  4J8D A;  3E33 A;  4A63 B;  5HS0 A;  3S7D A;  1MZC A;  1H6O A;  4HBD A;  2IFU A;  1OCR E;  1FT2 A;  3F6Q A;  3LXU X;  2IU1 A;  2EIL E;  1BI7 B;  1JCQ A;  5B3S E;  1FPP A;  4G11 A;  4BES A;  3QJZ A;  1V54 E;  4HI9 A;  4V3I A;  5ENO D;  1O1S A;  3Q49 B;  3FH7 A;  2WVI A;  4HRL A;  1YMP A;  5AIJ A;  3TWU A;  3CVY A;  5DIZ A;  1FT1 A;  3CHP A;  5ENS D;  2F8X K;  2X6K A;  4N3B A;  1TN6 A;  3Q9N C;  5FZR A;  3AU5 A;  3HXE A;  3NZS A;  4O6F A;  3AS4 A;  5T3R A;  1BLX B;  1NI1 A;  5ARF A;  4B94 A;  2WB2 A;  3CR3 A;  4RQI A;  4EBA G;  1D8D A;  1TJC A;  4TUM A;  4C0M A;  3C3Q A;  3FTU A;  4A1G A;  3GW4 A;  4BWR A;  3ZXS A;  4KVM A;  3V2O A;  1L5J A;  1Z3Y A;  2BF0 X;  3DSU A;  3AS8 A;  4JB8 P;  4K5B A;  4BET A;  5EYP F;  3SFX A;  2I1J A;  1JPL A;  3J5Q B;  4JC8 A;  5BT1 A;  5FQ6 A;  3SBS A;  1WY6 A;  3D9O A;  2KXP C;  4ANV A;  4HOU A;  2GRR B;  4APO A;  3T9K A;  2Y4T A;  1N4S A;  4B93 B;  3CHM A;  4FUL A;  5M72 A;  1LF8 A;  2DVW A;  3PZ1 A;  1S64 A;  2P9S G;  5ANR A;  3TAX A;  1TNO A;  2GW1 A;  2VSX E;  3QNK A;  4GYW A;  4CDR A;  2WXK A;  3FTZ A;  4GTT A;  2MRI A;  2I6H A;  3HXC A;  3G2U A;  3MX3 A;  3ZXP A;  4G8K A;  3D9J A;  4I2W A;  2X6H A;  3D9H A;  4NAC A;  3HDX A;  2LSV A;  4L2Y A;  2L0T B;  4EEC A;  2WQ7 A;  3E30 A;  2L6J A;  5ARG A;  3PH0 C;  5ENP D;  3FUH A;  5LFA A;  4U8Y D;  1UW4 B;  2VQ2 A;  1B89 A;  3U9W A;  4D10 C;  2OV8 A;  4L1B A;  4JHK A;  3UTM A;  4LNG A;  4YVO A;  2A5E A;  5BV0 A;  1Z3X A;  3JQ0 A;  2XEE A;  2I9C A;  2PZI A;  3BUA A;  5A7D B;  4G26 A;  3ONK A;  3RO3 A;  3NB2 A;  3SI5 A;  2Y4U A;  4J0U A;  4JXT A;  4CCA A;  3PNT B;  4FLB A;  2IOL A;  2WXO A;  4MRU A;  5FIO A;  2GRO B;  3BG0 B;  2F8Y A;  1NFI E;  1HF8 A;  2GGF A;  4F53 A;  5T4Y A;  4PH4 B;  3KEA A;  2MHK A;  3CHS A;  3CK7 A;  2WXJ A;  3PEV B;  2R03 A;  4G2V A;  3S2A A;  2ZXW E;  1UJK A;  3UT8 A;  4JEU A;  3FUM A;  4GA2 A;  2P58 C;  5BW8 C;  3G2V A;  3PRZ A;  2A5U A;  3RJV A;  2GRP B;  4GU5 A;  2H6F A;  4GTQ A;  3L16 A;  4CGW A;  5JMN D;  5JA4 D;  2GRL A;  4BY6 A;  3DSW A;  3ASN E;  4JL0 A;  4U63 A;  4ME2 A;  3K9I A;  2IQC A;  3LDZ A;  5D0Q D;  4UUC A;  4XKC A;  4AM9 A;  2HYZ A;  4A3T A;  3ZUV B;  3D9K A;  2RD0 A;  2YHE A;  4AOF A;  3ZYQ A;  2BKK B;  5BXO A;  1UOH A;  3FEY A;  4I9E A;  3KS2 A;  5HRY A;  3P2B A;  4BTA A;  3VLD A;  3FTV A;  2KCK A;  3RSE G;  2VSO E;  3CVL A;  3FTX A;  4Q94 A;  4XX5 A;  5CCM A;  1TN8 A;  3Q7F A;  1E8W A;  4GYO A;  2J08 A;  3PZD A;  2J09 A;  3SBT B;  3LKU A;  3UXG A;  4FLH A;  3B7B A;  5EID A;  4UWF A;  1SZ9 A;  1KT1 A;  1HH8 A;  2WXQ A;  4ANU A;  4UI9 C;  3ENE A;  2EIJ E;  4RG9 A;  3R9A B;  3AJI A;  4BER A;  2H6H A;  1A17 A;  2RFA A;  3EUV A;  4AIF A;  3APD A;  4JHR A;  4UQY A;  2QY7 A;  2R17 C;  4RSY A;  4HOR A;  3ZW3 A;  4EZJ A;  3LY9 A;  2E2E A;  3AG1 E;  3OXF A;  2RFM A;  3CK9 A;  2H6G A;  5JHA A;  2KZT B;  1JCS A;  3PZ2 A;  1RW2 A;  2AXZ A;  5JJ6 A;  3V31 A;  1AWC B;  5CER B;  3CQC B;  4E6H A;  5KJN A;  4UQZ A;  3FUJ A;  3D9I A;  1KZP A;  3KSL A;  4EHM A;  3MYV A;  1PC2 A;  3FDH A;  5CRU A;  4FC8 A;  1K8K G;  4U07 A;  5A23 A;  3ABK E;  1S63 A;  2Q7F A;  3ABL E;  3FH8 A;  3LY7 A;  1MYO A;  1XNF A;  2X38 A;  2GRN B;  3SD5 A;  4TXR A;  1O1R A;  2J8S D;  5CRV A;  2X6J A;  3QAQ A;  3ESL A;  4BSX A;  2V0P A;  2CG3 A;  1KLX A;  4YND A;  5EYL A;  3I4G A;  3E4B A;  4MLP A;  3CVP A;  4DI3 A;  2WXH A;  4L2L A;  3NOG D;  5CHE E;  5IY5 E;  2F0Y A;  2FF4 A;  2VSY A;  3FFL A;  3QC1 A;  4EZK A;  3FTS A;  2WQH A;  3UT7 A;  1Y6I A;  3CHO A;  4HLE A;  4CYM D;  5C2Y A;  4LNB A;  4J8F A;  4H7Y A;  1IHB A;  2MOW A;  1YYH A;  3SY2 A;  2QYU A;  2OND A;  2XRY A;  5D0O D;  2R59 A;  4AJW A;  2R5S A;  2DBA A;  4JA7 A;  5D2M C;  3TG5 A;  1HXI A;  4PS7 A;  3CVQ A;  5C1D A;  1KT0 A;  4ANW A;  2CFZ A;  1N52 A;  2V4H C;  3L82 A;  1TEZ A;  3ZN3 A;  3L13 A;  1DVP A;  2DYR E;  4ACL A;  3DSS A;  1JWF A;  2OEW A;  4WWN A;  4GTR A;  1W3B A;  1HFA A;  3FH5 A;  2R02 A;  3W9G A;  2I2O A;  4U7E B;  2P9L G;  1E8Z A;  1IKN D;  1KZO A;  4DX2 A;  4DPR A;  4UWG A;  4FHJ A;  3S7F A;  3U66 A;  4MKT A;  4Q96 A;  1LTX A;  2J07 A;  2J9Q A;  4GZD A;  5J08 A;  3MV3 B;  3PUJ A;  2JEK A;  5AQB A;  1OCC E;  3FTY A;  3GZ2 A;  2CHZ A;  2AXU A;  3LJN A;  3E32 A;  4TXP A;  4AP2 A;  1NZN A;  4APF A;  4XI0 A;  5EIL A;  3QKY A;  4GCN A;  4HQD A;  2ZIR A;  2ZIS A;  1V55 E;  4DJA A;  4N2Q A;  1O1T A;  3ZYM A;  4B8A A;  4AY5 A;  5JJ7 A;  4U04 A;  2GRM A;  3IV0 A;  4ANX A;  3I5P A;  2ZU6 B;  4U0U A;  2XEN A;  3UM0 A;  4L23 A;  4GTP A;  2XEV A;  2PQN A;  3APF A;  4WND A;  3L9T A;  4A3V A;  3E37 A;  4JPS A;  4LSZ E;  1P5Q A;  4FJZ A;  3FUI A;  3FUK A;  3Q79 A;  3T5X A;  2IJG X;  3ASH A;  4ACK A;  1PY1 A;  4DX7 D;  2ZGG A;  5G55 A;  2DIW A;  3CQG B;  4QQI A;  3NAW A;  3AAA C;  3CHR A;  4GPM A;  5JHB A;  1SQM A;  4K0R A;  3SZ7 A;  5LX8 A;  3U3W A;  2UWJ G;  4F7A A;  2XGS A;  4GMR A;  4G1T A;  4K5C A;  3VTY A;  1DC2 A;  2YIN A;  1IHG A;  3B13 A;  1IQU A;  3TWW A;  3R9M A;  1FCH A;  2BUG A;  2NSZ A;  3BQO A;  1ELR A;  3JXJ A;  3PZ4 A;  2IOS A;  2VGX A;  4MS6 A;  3RAU A;  4JZY A;  3APC A;  2LXL A;  4YDO A;  1HG2 A;  1WM5 A;  1H2V C;  2WPV A;  1YCS B;  3RKV A;  2XEH A;  5G04 C;  4F3V A;  3FUL A;  1MQS A;  1SA5 A;  1N11 A;  3FY4 A;  4O1P A;  1IQR A;  4X8Q A;  5LOZ A;  4CDM A;  3TWV A;  2X3M A;  3OXG A;  4UI9 K;  5H7P A;  3FP3 A;  1HE8 A;  3UUX A;  2P2C P;  3UMV A;  2YNQ A;  4KBQ A;  4FP7 A;  1DCE A;  2AWI A;  4PDX A;  2NXP A;  3UIN C;  4DI4 A;  2EIK E;  1QZ2 A;  1BD8 A;  1MX4 A;  2OOE A;  4PS8 A;  4I9C A;  1H6K A;  3PEU B;  3R7R A;  1A5E A;  2NC9 A;  4ZHB A;  3AG4 E;  5HQ8 A;  2XPZ A;  3DSV A;  5AQA A;  5CCL A;  3PRE A;  3VLF A;  3MKR A;  3ULY A;  3N71 A;  2P9I G;  1EDU A;  3O48 A;  3EHR A;  1QYM A;  4WWO A;  2C0L A;  2Y69 E;  2XZT G;  4UWH A;  3LPZ A;  4GZ5 A;  3O4Z A;  2BTD A;  2L9B A;  4HRN A;  4TXQ A;  3ZYK A;  3CGH A;  3IHY A;  3IEG A;  2KM4 A;  3HXD A;  3OXL A;  2CHW A;  1TYQ G;  2LAH A;  1N4Q A;  2QYJ A;  2LSU A;  1TNY A;  3ASF A;  1INZ A;  4DRX E;  4I6E A;  1N0R A;  5AYW D;  2WXN A;  1BU9 A;  1K3Z D;  4LUN U;  4L9P A;  1ELW A;  4N39 A;  3NBN B;  1E7U A;  5AAR A;  2VGX B;  2VSN A;  3Q47 B;  3L17 A;  4GZ6 A;  2JAB A;  2E0I A;  3DST A;  3NF1 A;  4NIK A;  3EHM A;  1HG5 A;  2H6I A;  2VGE A;  4ABN A;  1NA0 A;  2LXM A;  4JVS A;  1H2T C;  4EBA A;  4LNU D;  3QOU A;  2C0M A;  2KC7 A;  1H0A A;  4GB9 A;  3URZ A;  2J4B A;  2XHE A;  4HXI A;  5CEC B;  3ASO E;  2RKK A;  1UJJ A;  3GZS A;  2WXR A;  3ZVV A;  5EDS A;  1SW6 A;  4HOT A;  4U0S A;  2CG2 A;  4FHK A;  3E34 A;  1U2V G;  4KMO A;  4UQX A;  2KCL A;  5B1A E;  1HS6 A;  4K5A B;  3QK0 A;  5FZQ A;  3RO2 A;  5AAO A;  1N4P A;  4LG6 A;  1SVX A;  4G23 A;  2FI7 A;  3MV2 B;  3LVR E;  4CGV A;  4DK5 A;  3ULQ A;  4Y6C A;  3ZHE B;  3CLJ A;  4GCO A;  4PUC A;  2FUL A;  1TJF A;  3TWT A;  1DCQ A;  4F6R D;  1E90 A;  5BNW A;  4DX5 D;  4EZL A;  3GZ1 A;  4WNF A;  2XPI A;  3T5V A;  3FU3 A;  3NOC D;  3UM1 A;  1H19 A;  4HLL A;  3EHN A;  3MGB A;  1NP7 A;  4GPK A;  3AG2 E;  3SFY A;  3R7Q A;  4BEP A;  3RK6 A;  3UX4 A;  2LNI A;  2KZT A;  1OWO A;  4HFG A;  2AVP A;  2NYJ A;  3QB2 A;  3J5P A;  3CKC A;  4IRU A;  1E7V A;  3SO8 A;  3UKU G;  3ZGQ A;  3DXM G;  5CED B;  3ZEF A;  1XGW A;  2F37 A;  5G05 J;  1E8X A;  5LCW J;  3UPV A;  3HXF A;  3EU9 A;  3LS8 A;  5AJL A;  1U3C A;  2WXP A;  3L54 A;  1WAO 1;  4BSZ B;  3CEQ A;  4AXH A;  5FQ8 A;  4C9B B;  4E85 A;  4UI9 J;  3JYS A;  3NZU A;  4M3O A;  5LP0 A;  4WNE A;  3ONL A;  3CVU A;  2UY1 B;  2KBX A;  2RG8 A;  4GYY A;  1WDY A;  3T8K A;  4GA0 A;  2HM8 A;  1N0Q A;  3LYA A;  3CVV A;  1N54 A;  2A4Z A;  3DSX A;  4WAF A;  4P29 A;  3TWQ A;  4CZ2 D;  2OVB A;  3I4R B;  5E75 A;  3ZU7 B;  4GAA A;  4RVB A;  3C3O A;  3RRM B;  5KBA A;  2PNN A;  1SA4 A;  4OVU A;  5HKP A;  3IBE A;  4HOS A;  3JQ1 A;  2EIM E;  3FWV A;  3ZYL A;  3PUK A;  3B7R L;  3Q73 A;  1U3D A;  3TXM A;  2KAT A;  4KZ0 A;  3EJN A;  5AJD A;  3JXI A;  3KD7 A;  4J8E A;  2P9N G;  2V8S E;  1D8E A;  3UM2 A;  4B0Z A;  2VGY A;  2ZGD A;  3ML8 A;  2HE0 A;  4H7X A;  2VTB B;  3B95 A;  4LER A;  3S7B A;  5J90 A;  3B7U X;  2WXI A;  2L0I A;  4YDE A;  4HNA D;  3Q9U C;  5KNH D;  4O1O A;  2LUH A;  3D9L A;  4FAD A;  2DCP A;  3BU8 A;  2IO3 C;  4WNG A;  5JJT A;  2PQR A;  4HB5 A;  4ATZ D;  2VJ8 A;  3LEW A;  3EDT B;  2CHX A;  4N3A A;  2M63 A;  2ETC A;  4FJY A;  5BPP A;  4J8Y A;  3PE4 A;  4BT8 A;  3ML9 A;  4G25 A;  3HVE B;  3PZ3 A;  3ZFW A;  3W9F A;  2V4L A;  1WG0 A;  2ETB A;  4GTV A;  3DPD A;  4I1O B;  2P9K G;  3MZL B;  1FVH A;  5FT9 A;  1ZB1 A;  5G2N A;  4B89 A;  4MBG A;  4LCT A;  2DYS E;  3B7S A;  1G3N B;  5A6C A;  1KPS B;  3P1U A;  2UY1 A;  2MYO A;  1NL4 A;  5ANL A;  4RG6 A;  4IUL A;  1IXV A;  4C0E A;  3TG4 A;  1ZU2 A;  3S7J A;  2P9P G;  5AQ7 A;  2PL2 A;  5FWQ A;  5ENN A;  3CST A;  3FTW A;  3TWX A;  3ASG A;  4N2S A;  3B7T A;  4CRW A;  3RRN B;  2DZO A;  3ZIM A;  4HOQ A;  3UM3 A;  3CK8 A;  3PDN A;  4EQF A;  2XQ0 A;  4JHJ A;  4F1P A;  2JLB A;  4NQ0 A;  4YVQ C;  4AY6 A;  1S70 B;  3PVL A;  5CMY A;  3HXB A;  5KJM A;  4ILI A;  2IY0 C;  2OCC E;  3OTN A;  3DPY A;  3CVN A;  3V30 A;  2WXL A;  3ZHE A; 
#chains in the Genus database with same CATH homology
 2HYZ A;  2HR2 A;  3L22 A;  2NC9 A;  4KT6 B;  3D9K A;  4A3T A;  1Z6T A;  5HQ8 A;  2XPZ A;  2RD0 A;  2YHE A;  1E96 B;  3MKQ B;  5CCL A;  3PRE A;  4AOF A;  3VLF A;  5HI7 A;  3ZYQ A;  5KCM A;  4XE0 A;  3MKR A;  3FEY A;  3N71 A;  4I9E A;  3LVQ E;  3FEX A;  3KS2 A;  5JJ7 A;  3PE3 A;  1EDU A;  5FQ4 A;  3P2B A;  4BTA A;  3VLD A;  3O48 A;  4BX8 A;  4CT0 A;  3FTV A;  4U8H A;  2KCK A;  3D9P A;  3NQP A;  4WWO A;  2VSO E;  2AW6 A;  3CVL A;  3FTX A;  3QWP A;  4L7T A;  4Q94 A;  4U0Z A;  4XX5 A;  2WM9 A;  3PS6 A;  5FJY A;  5CCM A;  2C0L A;  3EIQ C;  2X6F A;  3PNL B;  4UWH A;  1E8W A;  4GYO A;  3FUD A;  2J08 A;  3IHV A;  3LPZ A;  4GZ5 A;  1JWG A;  1QNF A;  3O4Z A;  2BTD A;  3PZD A;  2J09 A;  3SBT B;  1Y8M A;  5KJL A;  2L9B A;  4FU3 A;  3LKU A;  3L08 A;  2WQ6 A;  3ZYK A;  3D9N A;  3CGH A;  3IHY A;  3IEG A;  4GZ3 A;  4FLH A;  4JEH A;  2KM4 A;  4F1S A;  1HU3 A;  4I43 A;  4UWF A;  1SZ9 A;  3OXL A;  2CHW A;  4EPZ A;  4DLQ A;  1KT1 A;  2LAH A;  1EYH A;  3HHM A;  1HH8 A;  2WXQ A;  4ANU A;  2FO7 A;  3GYZ A;  4UI9 C;  2XGO A;  3ENE A;  5DBK A;  2LSU A;  4RG9 A;  3ASF A;  3Q4A B;  1INZ A;  3R9A B;  3IKO B;  4I6E A;  5E76 A;  5AYW D;  1A17 A;  2EQX A;  2WXN A;  1HX8 A;  4AIF A;  4LUN U;  4J8S A;  2FEZ A;  4XI9 A;  3APD A;  3C98 A;  3SF4 A;  3G2W A;  4JHR A;  1ELW A;  3KAE A;  3Q15 A;  4UQY A;  2QY7 A;  2PM6 A;  3HVE A;  1ZBP A;  2R17 C;  3HIZ A;  2WXM A;  4N39 A;  4RSY A;  1UG3 A;  4HOR A;  4GZC A;  1E7U A;  1MHQ A;  3HYM B;  4TRQ A;  3QDN A;  2VGX B;  4GA1 A;  3FUE A;  4G24 A;  1DNP A;  3UT4 A;  4EZK A;  3ZW3 A;  1OWP A;  4EZJ A;  3D3M A;  2VSN A;  3CV0 A;  3L17 A;  3Q47 B;  3LY9 A;  2E2E A;  4GZ6 A;  3T8M A;  3OXF A;  2OVF A;  2XCC A;  2E0I A;  2YHC A;  4W9R A;  3NF1 A;  3CK9 A;  3EHM A;  4JW1 A;  2XRZ A;  4A1S A;  5JHA A;  1BPO A;  2KZT B;  1HG5 A;  4ILG A;  2AXZ A;  5EX0 A;  5JJ6 A;  4GMJ A;  2WMO A;  4ABN A;  1NA0 A;  4NUR A;  3CSF A;  4JVS A;  1H2T C;  5BV1 A;  3CQC B;  4E6H A;  4EBA A;  5KJN A;  4IN3 B;  4N5C A;  2VYI A;  4UQZ A;  2HO1 A;  2Y3A A;  2C0M A;  2KC7 A;  3LY8 A;  3FUJ A;  1H0A A;  3D9I A;  3D9M A;  3QOU A;  4GB9 A;  4WWP A;  3URZ A;  2J4B A;  2XHE A;  4HXI A;  2FBN A;  5AEN A;  3RIB A;  4J8D A;  1UJJ A;  3GZS A;  1PC2 A;  3MYV A;  2WXR A;  3FDH A;  3U64 A;  1QQE A;  3S7D A;  1E8Y A;  3SGH A;  3ZVV A;  5EDS A;  4HOT A;  4U0S A;  2CG2 A;  4FC8 A;  4FHK A;  3FU6 A;  4KMO A;  4UQX A;  2IFU A;  2KCL A;  4U07 A;  5A23 A;  1HS6 A;  3QK0 A;  2Q7F A;  5FZQ A;  3RO2 A;  3FH8 A;  3LY7 A;  4G23 A;  2FI7 A;  1XNF A;  3MV2 B;  4LEU A;  2X38 A;  3SD5 A;  3LVR E;  3LXU X;  4A55 A;  4DK5 A;  4CGV A;  3TGO A;  2IU1 A;  3ULQ A;  3WXX A;  4Y6C A;  3ZHE B;  5G05 C;  1ELK A;  2C2L A;  3CLJ A;  4GCO A;  4PUC A;  5ENN A;  2FUL A;  2X6J A;  3QWV A;  1TJF A;  3QAQ A;  1OWN A;  3ESL A;  4G11 A;  3QJZ A;  1E90 A;  4BSX A;  3VTX A;  3AU4 A;  2V0P A;  2CG3 A;  5BNW A;  1KLX A;  4V3I A;  4EZL A;  4YND A;  3GZ1 A;  4ATG A;  4WNF A;  2KCV A;  2XPI A;  3T5V A;  3MJW A;  3Q49 B;  3FH7 A;  3FU3 A;  2WVI A;  3I4G A;  4K03 A;  3E4B A;  4MLP A;  1H19 A;  3CVP A;  4QFV A;  4CT4 A;  2I1K A;  2WXH A;  4DI3 A;  5AIJ A;  4L2L A;  4WUY A;  5CHE E;  3EHN A;  3Q5M A;  3CVY A;  5DIZ A;  3ASD A;  3MGB A;  3TJP A;  3CHP A;  1NP7 A;  4GPK A;  3SNX A;  2FF4 A;  2VSY A;  3FFL A;  4PS3 A;  2X6K A;  3FTS A;  3QC1 A;  4N3B A;  2WQH A;  3R7Q A;  4AV7 A;  3UT7 A;  4UWK A;  1Y6I A;  4I1A A;  3RK6 A;  3UX4 A;  3CHO A;  4HLE A;  2LNI A;  5C2Y A;  5FZR A;  2KZT A;  5FZS A;  1OWO A;  4HFG A;  3EIJ A;  3I3N A;  4J8F A;  3AU5 A;  3ZPJ A;  2AVP A;  4H7Y A;  4BT9 A;  5BUZ A;  3QB2 A;  3CKC A;  4IRU A;  1E7V A;  2XGM A;  3NZS A;  4O6F A;  3AS4 A;  2MOW A;  5KJK A;  3ZGQ A;  1VDY A;  2OND A;  2XRY A;  3UQ3 A;  5D0O D;  3BG1 B;  2R59 A;  3RU0 A;  5T3R A;  3L6A A;  3ZEF A;  1XGW A;  2R5S A;  2DBA A;  4AJW A;  5G05 J;  3FHE A;  1E8X A;  5LCW J;  3UPV A;  4JA7 A;  3TG5 A;  4HVB A;  5ARF A;  1HXI A;  3LS8 A;  3CVQ A;  4PS7 A;  5EX3 A;  1KT0 A;  4ANW A;  3QWW A;  5C1D A;  2CFZ A;  1N52 A;  5AJL A;  4B94 A;  4DLO A;  1U3C A;  3CR3 A;  3CVW A;  2WB2 A;  2WXP A;  1X5B A;  4EBA G;  1SZA A;  3L54 A;  1TJC A;  1TEZ A;  1WAO 1;  4C0M A;  3FTU A;  3ZN3 A;  3L13 A;  1DVP A;  3CEQ A;  4AXH A;  1EPU A;  4A1G A;  3GW4 A;  5FQ8 A;  4C9B B;  4ACL A;  4BWR A;  4E85 A;  4UI9 J;  2X6I A;  1JWF A;  3JYS A;  3NZU A;  3MEK A;  3ZXS A;  3FU0 A;  4M3O A;  4KVM A;  4WWN A;  5LP0 A;  1L5J A;  1S0P A;  1Z3Y A;  4WNE A;  3ONL A;  1W3B A;  3CVU A;  2UY1 B;  1HFA A;  2BF0 X;  3FH5 A;  4GML A;  1GW6 A;  3AS8 A;  4KYO B;  4BX9 A;  2RG8 A;  1OWM A;  4GYY A;  3CKB A;  2I1J A;  1JPL A;  2I2O A;  4JC8 A;  5BT1 A;  1E8Z A;  1OUV A;  4I1M A;  4I2Z A;  2LAI A;  2XCB A;  4DPR A;  4UWG A;  4FHJ A;  3S7F A;  3U66 A;  4MKT A;  4Q96 A;  4GA0 A;  5FQ6 A;  4J6I A;  1EF1 C;  2HM8 A;  2WXF A;  1WY6 A;  3SBS A;  3LYA A;  3CVV A;  1N54 A;  3G2T A;  2J07 A;  2A4Z A;  2J9Q A;  3D9O A;  4GZD A;  4ANV A;  4HOU A;  5J08 A;  3MV3 B;  4WAF A;  3MA5 A;  3PUJ A;  4P29 A;  4APO A;  4XIF A;  2Y4T A;  3MCX A;  2OVB A;  3I4R B;  2JEK A;  5E75 A;  3CHM A;  2ION A;  3FTY A;  4GAA A;  4FUL A;  4RVB A;  5M72 A;  3RRM B;  4OVU A;  1LF8 A;  3GZ2 A;  4I6G A;  4KXK B;  5ANR A;  2CHZ A;  3IBE A;  3TAX A;  5T8I A;  2AXU A;  4HOS A;  3JQ1 A;  4JA9 A;  2GW1 A;  3SHF A;  2VSX E;  4IYP A;  1UN8 A;  3QNK A;  4GYW A;  4CDR A;  4AP2 A;  1NZN A;  3MKQ A;  2WXK A;  3FTZ A;  3JCK C;  4APF A;  3FWV A;  4XI0 A;  2MRI A;  2I6H A;  3TXN A;  3ZYL A;  3QKY A;  4GCN A;  4AEZ C;  3PUK A;  5EKQ D;  3B7R L;  4TV3 A;  1U3D A;  4N3C A;  4DJA A;  4N2Q A;  5CMW A;  1IYG A;  3ZYM A;  3FUN A;  2KAT A;  3G2U A;  4KZ0 A;  3EJN A;  4XKB A;  3TXM A;  4U04 A;  5AJD A;  3MX3 A;  4B8A A;  1YA0 A;  4AY5 A;  2GRM A;  3IV0 A;  4ANX A;  4FA6 A;  3KD7 A;  4J8E A;  2V8S E;  3CHQ A;  3D9J A;  4I2W A;  4B0Z A;  3I5P A;  2X6H A;  4I6J A;  2VGY A;  4BFR A;  2ZU6 B;  4U0U A;  3ML8 A;  2VTB A;  4L23 A;  4NAC A;  3HDX A;  3CIA A;  4H7X A;  2LSV A;  2VTB B;  4LER A;  3BEE A;  2XEV A;  2PQN A;  4AVX A;  3APF A;  3S7B A;  4R7L A;  4WND A;  3TL5 A;  4L2Y A;  3B7U X;  2WXI A;  5FQ7 A;  2L0I A;  5J90 A;  2L0T B;  4A3V A;  4EEC A;  4JPS A;  3CVX A;  1PAQ A;  1P5Q A;  4FJZ A;  2WQ7 A;  3D9L A;  4XZ4 A;  2DCP A;  4FAD A;  1UN9 A;  3FUI A;  2L6J A;  2YQ8 A;  3ZHE A;  5ARG A;  3FUK A;  1FVF A;  3PH0 C;  4WNG A;  3T5X A;  5LCW C;  2IJG X;  3ASH A;  4ACK A;  3FUH A;  5LFA A;  5JJT A;  1PY1 A;  3QAR A;  2IF4 A;  4OVV A;  2PQR A;  1UW4 B;  5G55 A;  3DBS A;  2VJ8 A;  3LEW A;  3EDT B;  2DIW A;  4TUU A;  3OAW A;  2VQ2 A;  2CHX A;  4N3A A;  1B89 A;  3CQG B;  3AS5 A;  3U9W A;  2M63 A;  4D10 C;  2OV8 A;  4FJY A;  4L1B A;  5BPP A;  3PE4 A;  3CHR A;  5JHB A;  1SQM A;  4K0R A;  2V5F A;  3SZ7 A;  4BT8 A;  5LX8 A;  3U3W A;  2UWJ G;  3ML9 A;  4G25 A;  4JHK A;  4YVO A;  3HVE B;  4F7A A;  4URK A;  2XGS A;  4G1T A;  3ZFW A;  5BV0 A;  3VTY A;  1Z3X A;  3JQ0 A;  3G2S A;  2I9C A;  2V4L A;  4BTB A;  2LO6 A;  2PZI A;  2YIN A;  1IHG A;  3B13 A;  3LCA A;  1IQU A;  5A7D B;  4G26 A;  3DPD A;  3ONK A;  4I1O B;  1FCH A;  3MZL B;  3RO3 A;  2BUG A;  2Y4U A;  4KZC A;  3SI5 A;  3FUF A;  4J0U A;  1HO8 A;  2NSZ A;  1FVH A;  1ELR A;  3RRU A;  5FT9 A;  4JXT A;  5G2N A;  3PNT B;  4FLB A;  4B89 A;  4CCA A;  2WMN A;  4LCT A;  2IOL A;  2IOS A;  2WXO A;  1NA3 A;  4MRU A;  3B7S A;  2VGX A;  5FTP A;  5G04 J;  2AXV A;  3JUI A;  5A6C A;  3ZRH A;  4MS6 A;  4JZY A;  3BG0 B;  3P1U A;  2UY1 A;  3APC A;  5ANL A;  1OWL A;  1HF8 A;  1HG2 A;  2GGF A;  1WM5 A;  4IUL A;  1H2V C;  4RG6 A;  4F53 A;  2XPY A;  3VLE A;  2WPV A;  3RKV A;  5T4Y A;  4C0E A;  3TG4 A;  1ZU2 A;  4PH4 B;  3S7J A;  2MHK A;  3CHS A;  3CK7 A;  5G04 C;  2J49 A;  4F3V A;  3FUL A;  2ILR A;  2WXJ A;  3PEV B;  1MQS A;  2PL2 A;  3FY4 A;  4G2V A;  1IQR A;  3S2A A;  5LOZ A;  5FWQ A;  4CDM A;  2X3M A;  3CST A;  3ESK A;  3FTW A;  1UJK A;  3OXG A;  4OYS A;  4UI9 K;  3ASG A;  3FP3 A;  4N2S A;  3B7T A;  4ILH B;  4CRW A;  4KVO A;  3UT8 A;  3LJ3 A;  4JEU A;  3RRN B;  3FUM A;  3ZIM A;  4HOQ A;  4GA2 A;  2P58 C;  1HE8 A;  2CFU A;  5BW8 C;  3UUX A;  4NRH B;  3G2V A;  1JUQ A;  2YNQ A;  3CK8 A;  3UMV A;  3PDN A;  3PRZ A;  1HZ4 A;  4CDN A;  4KBQ A;  2A5U A;  4EQF A;  3RJV A;  4Q69 A;  4LRZ A;  4GU5 A;  2XQ0 A;  4JHJ A;  2JLB A;  4NQ0 A;  1H2U A;  4YVQ C;  4FP7 A;  4AY6 A;  3PVL A;  2PM7 A;  3L16 A;  5CMY A;  2WXG A;  2AWI A;  4PDX A;  4CGW A;  5KJM A;  4ILI A;  3KEZ A;  2NXP A;  2GRL A;  2J4D A;  3FU5 A;  3SFZ A;  4BY6 A;  3OTN A;  4Y6W A;  3CVN A;  4JL0 A;  4DI4 A;  4U63 A;  4I17 A;  4ME2 A;  1QZ2 A;  2IQC A;  2QFC A;  3K9I A;  3LDZ A;  5D0Q D;  4PS8 A;  2OOE A;  4B8C B;  2WXL A;  4HS2 A;  1H6K A;  4I9C A;  4UWL A;  4CEM A;  4XKC A;  4AM9 A;  3U4T A;  3PEU B;  3R7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...