1NZNA

Cytosolic domain of the human mitchondrial fission protein fis1 adopts a tpr fold
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
122
structure length
122
Chain Sequence
b'HMEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRTRYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fission protein Fis1p
publication title Cytosolic domain of the human mitchondrial fission protein Fis1 adopts a TPR fold
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 53
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1nznA00
2FBNA 2XGOA 5DIZA 2UY1A 4U07A 3URZA 2YQ8A 1W3BA 1YA0A 3MA5A 2V5FA 5D0QD 4APOA 4H7XA 2XEVA 4I9CA 2DBAA 3GZ1A 4W9RA 2XGMA 1QZ2A 2UWJG 3Q4AB 3Q15A 2VGXB 3R9AB 3ASDA 2ONDA 3SZ7A 4GYYA 1HH8A 3CEQA 3RU0A 3UPVA 1ZBPA 5EX3A 3FP3A 2Q7FA 4BT8A 3CV0A 4CGWA 3CVLA 3TG5A 3MV2B 5AYWD 3QWVA 4I1AA 5A7DB 3LKUA 2C0MA 4NQ0A 1IYGA 3KD7A 4NRHB 4CDRA 2OOEA 1HZ4A 4AY5A 3QOUA 3HYMB 3LCAA 4GCOA 4BT9A 3IEGA 2L6JA 3S7JA 5JJ7A 4KYOB 4J8FA 3WXXA 4HOQA 4YNDA 3ASFA 4G26A 3BEEA 2KC7A 3QWWA 2J9QA 3QKYA 3MEKA 3OXLA 1PC2A 2GW1A 5CCMA 3CKCA 4WNDA 4UQXA 4N2QA 3FFLA 2UY1B 1KT1A 4BTAA 2PL2A 2VGYA 5LCWC 3N71A 3ASGA 1IHGA 4UI9C 3U3WA 4N3CA 4GZ5A 2KATA 5JJ6A 5FZRA 4KBQA 2HO1A 4JHRA 2KCLA 4N3AA 3NF1A 3RO2A 5FZSA 4XI9A 1NA3A 4I2ZA 2I6HA 4AY6A 4WNFA 1E96B 3LPZA 3ZHEA 4XI0A 4J8EA 1HXIA 2FI7A 4WNEA 3RIBA 2C0LA 5LCWJ 4N3BA 3S7DA 4UI9J 5ARFA 4GYWA 4G2VA 3S7BA 3GZ2A 5BNWA 5CCLA 3S7FA 4U0SA 3TGOA 5BW8C 2VQ2A 3CVQA 2LSVA 5G05C 1ELRA 3GW4A 3K9IA 3AS5A 4GCNA 3SF4A 1B89A 2JLBA 3UQ3A 3VTXA 3Q49B 5KJNA 4I17A 4GPKA 4KXKB 3ZFWA 3TG4A 4WUYA 4JL0A 4JA7A 3TAXA 4A1SA 4HORA 5FTPA 3ZPJA 3Q47B 3LY8A 3OXGA 3U4TA 4UI9K 4G25A 4HOTA 3RO3A 4XIFA 4N39A 5A6CA 2MHKA 5G05J 2FF4A 4N2SA 2E2EA 3CK7A 3PDNA 2QFCA 4RG9A 5ARGA 1NA0A 2AVPA 3QDNA 3MV3B 3RJVA 4LEUA 4AIFA 2XCCA 3KAEA 4J8DA 1OUVA 1KLXA 2HR2A 2IFUA 3LY7A 5FJYA 4BTBA 4ME2A 4J0UA 5HQ8A 1P5QA 4H7YA 2LSUA 4UQYA 2FEZA 1TJCA 4I2WA 4GZ6A 3RKVA 4HOSA 2P58C 3GYZA 3LY9A 3ZHEB 3PE4A 3OXFA 4BWRA 2VYIA 3ESKA 5BT1A 4U04A 2WPVA 4Y6WA 3Q5MA 2KCVA 1WAO1 4O6FA 2KCKA 5FT9A 5JJTA 4HOUA 2PZIA 2PQRA 5KJLA 3CVNA 2IF4A 2Y4UA 2HYZA 3MKRA 3JYSA 4YVOA 4N5CA 3LYAA 1NZNA 3ZGQA 2XCBA 1Y8MA 4U0UA 3E4BA 4B94A 3CVPA 2VGXA 3VTYA 5EKQD 4AM9A 2XGSA 4CGVA 4U0ZA 4UQZA 4WNGA 2YHCA 3EDTB 2XPIA 5C1DA 4GA0A 4Y6CA 4F3VA 2LNIA 3KS2A 4G1TA 4ABNA 3FWVA 2Y4TA 4EQFA 4JA9A 2NC9A 1QQEA 3UUXA 4GA1A 5CHEE 5D0OD 1A17A 4GZ3A 1FCHA 2PQNA 2WQHA 5G04C 3PE3A 1ELWA 5KJKA 3ULQA 5M72A 4YVQC 4IN3B 2R5SA 2VSNA 1KT0A 5EX0A 2C2LA 1WM5A 1ZU2A 5DBKA 2BUGA 3ASHA 4RG6A 3CK8A 4G24A 3CK9A 5FZQA 3ZN3A 5KJMA 2FO7A 4GA2A 3O48A 4I9EA 3AS8A 3AS4A 1XNFA 3QWPA 5HI7A 3CKBA 5G04J 4G23A 2VSYA 4GYOA
chains in the Genus database with same CATH superfamily
2GRMA 5CRUA 2IONA 2F8YA 4U07A 2DZNA 3QJZA 1Z6TA 4TXPA 4I6GA 3PREA 2J08A 4HBDA 2AXVA 2DBAA 3SO8A 1WY6A 3TWRA 4HI9A 1DC2A 2I2OA 1INZA 2VGXB 5AQ7A 3UM1A 4XKBA 2QYJA 3CEQA 3FEXA 1ZB1A 3CV0A 1V54E 4B93B 1D9SA 1JCQA 1DNPA 4U95D 1KZOA 3CVWA 3CSFA 4I1AA 3QAQA 5ANLA 5CBOA 2YINA 4E6HA 1BD8A 3IHVA 4L2YA 2QYUA 4DX5D 1IYGA 1U2VG 3SY2A 2P9PG 5AN8A 3R7QA 4XEIG 5BPPA 3JUIA 3ZW3A 4I1OB 1OWMA 3LCAA 4TUMA 2BEDA 2RG8A 2IO2C 4GTMA 5JJ7A 2L6BA 3C72A 1L5JA 2XRYA 4HOQA 3ONLA 1IQUA 4A3VA 4G26A 5AJDA 3P1UA 4FJYA 3B7BA 2KC7A 3EIQC 3PZDA 3QWWA 1S63A 1JWGA 3B7RL 1UOHA 3MEKA 3OXLA 5EYLA 1PY1A 3DPDA 3BG0B 1EDUA 4CT0A 1FVHA 4IYPA 4UQXA 3SNXA 2UY1B 5FQ6A 1QNFA 2F37A 5B3SE 2KZTB 5EYPF 4HI8A 2R05A 3TWXA 4AVXA 3UMVA 3U3WA 1K1BA 4N3CA 4GZ5A 2WXMA 5D66A 4KBQA 3FUMA 1A5EA 2V4LA 1O1TA 3NF1A 4EBAA 4XZ4A 1OY3D 1NA3A 5CERB 4NIKA 3KSQA 3ZHEA 4EZLA 3ESLA 3FUEA 3HXCA 2F0YA 3O4ZA 4ZFHA 3HXFA 4WNEA 4AOFA 4NURA 5LOZA 3D9KA 3ABLE 2WQ6A 5ARFA 4X8QA 3S7BA 4WWPA 2WM9A 3S7FA 4JW1A 4DLOA 1TEZA 5FQ8A 2LSVA 1KPSB 3EU9A 3GW4A 2ZISA 1HFAA 2WQ7A 3BUAA 3TJPA 1WDYA 1TNBA 4KXKB 3ZFWA 3PUJA 4B0ZA 4ACKA 4ACLA 4UWLA 4YDWA 3LJ3A 4JA7A 1FT2A 3TAXA 4A1SA 5FTPA 3ZPJA 3U9WA 4UI9K 3NZUA 4C9BB 3SFYA 4ANXA 3RO3A 4MBGA 2I1KA 3PH0C 3HDXA 5ENOD 4LSZE 4DX6D 3UT4A 2MOWA 4NACA 3TXMA 1OUVA 1KLXA 4J0UA 1P5QA 1HS6A 1O1SA 2LSUA 4HVBA 3AU4A 3HVEB 4HS2A 5EILA 3OAWA 1MQSA 2P2CP 2WXFA 3PZ4A 1FVFA 3PZ2A 3D9MA 4HOSA 1YYHA 3UM0A 3LVRE 4CEMA 3LY9A 2LXLA 3PE4A 3C3QA 4C0MA 3AU5A 4QFVA 3AG4E 5KCMA 4L23A 3DSWA 5HRYA 2CFUA 4K5CA 1Y6IA 2VYIA 3AG1E 3ESKA 4G8KA 4CYMD 5BT1A 5T8IA 4U04A 1HE8A 4JHJA 4F53A 1IKND 4O1OA 2KCVA 5T4YA 5JJTA 2H6IA 2PZIA 2J4DA 2DYRE 5KJLA 3CVNA 4HFGA 3FUDA 3MKRA 3B7TA 4N5CA 4YVOA 1NZNA 5B1BE 3ZEFA 3FUFA 3CR3A 3QC1A 1AWCB 4K0RA 2XGSA 2OV8A 2R59A 2KBXA 4GA0A 4Y6CA 3DEPA 3DXKG 4ABNA 3FH8A 3V31A 3HHMA 4EQFA 4JA9A 3VLFA 3RSEG 3UI2A 1N0QA 1X81A 4TV3A 1FCHA 2GRNB 1UG3A 4KZCA 4BSZB 2OEVA 3PE3A 3C5RA 4OVUA 2R5SA 4JVSA 4GTOA 3BU8A 1ZU2A 4UUCA 3HXEA 2XPYA 2AW6A 2IOLA 3NZSA 4ZHBA 3ZXSA 3ZN3A 4HLLA 2FO7A 1TN8A 4I9EA 2IU1A 1LF8A 4HXIA 4U8HA 4WWOA 1IHBA 3I3NA 3U66A 4GYOA 2ETCA 1UW4B 2WXNA 4LNUD 2XGOA 3X2QE 1HF8A 4CCAA 4LRZA 2BKKB 1YA0A 2PNNA 3MA5A 4FP7A 4H7XA 2VGEA 3ZUVB 2XGMA 3Q4AB 4G11A 4FADA 2MRIA 3QB2A 4DK5A 3R9AB 1U3CA 1O5MA 3UM3A 5FIOA 2RFAA 3SZ7A 3JCKC 4LERA 1HH8A 3FHEA 2IEJA 1N9AA 3DSVA 2XHEA 3CVUA 3FP3A 2OEWA 1N94A 1U3DA 4O60A 3JUEA 1Q2ZA 4ANUA 3S2AA 3CQGB 3MV2B 1TYQG 4ILHB 3V2XA 2BF0X 2NXPA 5A7DB 5CBNA 2C0MA 4NQ0A 3MKQA 4CDMA 2DCPA 1HU3A 4OAVB 4CDRA 2LXMA 4TXRA 4L9PA 1Z5SC 2X6KA 3UIPC 3QOUA 3DXMG 3P2BA 3PEUB 2QY7A 3PVLA 3IEGA 1IXVA 1DCQA 2X6FA 4J8FA 3FU0A 1WG0A 2JABA 3EJNA 4YNDA 3Q78A 2P9KG 1OWLA 2LO6A 3IKOB 1MYOA 2J9QA 4ILGA 4K5BA 2Y1LE 2DIWA 3FULA 2IY0C 2YNQA 3TWVA 1PC2A 2GW1A 5CCMA 3FUHA 4WNDA 4EPZA 4N2QA 2XZTG 3FH5A 3ZIMA 1H6OA 1E8WA 3APDA 3HXBA 5LCWC 3ASGA 1IHGA 4DI3A 4U8VD 4EHMA 2X6IA 1NL4A 2KCLA 1BPOA 5BV1A 4PS8A 3R7RA 2I6HA 4AY6A 4GB9A 1O1RA 2I9CA 2EIKE 4PDXA 4XI0A 5CRVA 1HXIA 2FI7A 2DWZA 3SGHA 5LCWJ 2GRPB 2E0IA 4N3BA 5KNHD 1OT8A 1JCRA 4FLHA 5BNWA 4JXTA 4HNAD 2VTBA 2J4BA 2VSXE 4LNBA 3Q9NC 5LP0A 5BW8C 4AJWA 3KSLA 3CVQA 3ZYMA 3UKUG 3NOGD 5G05C 5ENRD 1ELRA 3SFXA 4GCNA 4KMOA 2JLBA 1H6KA 3VTXA 3D9OA 1LD8A 3Q49B 5KJNA 4TUUA 1QBQA 4GPKA 3QNKA 3F6QA 2L9BA 3CIAA 5B1AE 4BX9A 5A23A 1PAQA 4A55A 3L6AA 4F7AA 5E76A 3Q47B 3JQ0A 3U4TA 2HE0A 3L16A 4G25A 4HOTA 3ULYA 4JEHA 5G05J 2FF4A 2RD0A 5KWDA 3B7SA 3CK7A 4RG9A 2WXKA 1NA0A 2WXJA 2WXOA 3ZKJA 3MV3B 1D8EA 3MZLB 4AIFA 4A63B 2XCCA 1GW6A 3KAEA 3CGHA 4J8DA 3ASNE 4ANWA 5CECB 2HR2A 3LY7A 1JUQA 1BLXB 3J5QB 2GRRB 1TN6A 4B8AA 3T5VA 4UQYA 3G2TA 1TJCA 4BERA 4J8SA 1IQRA 2FULA 3LVQE 2F8XK 2P58C 4JZYA 1EPUA 3FU5A 3ZHEB 1N4RA 2Y3AA 2EIME 2IO3C 4U7EB 4GAAA 2XEEA 5AARA 3QK0A 5G2NA 1SQMA 3EHRA 1H2TC 4BESA 5JHBA 3W9GA 2J49A 4O6FA 3LJNA 2KCKA 2KZTA 3CHRA 2J07A 4HOUA 1N4QA 3PZ1A 2PQRA 3PZ3A 4ANVA 3PRZA 4DLQA 3T5XA 1N52A 2OCCE 2H6HA 2ILRA 2PM7A 4G8LA 3ZGQA 3I5PA 2CG3A 3RAUA 1Z3YA 5HS0A 4L2LA 4U0UA 3E4BA 3Q7FA 3U64A 4AM9A 3FTYA 3UIOC 4HRNA 3AG2E 4UQZA 2XENA 4GPMA 4WNGA 1VDYA 1S70B 3EDTB 2L0IA 2QZAA 4J6IA 1H19A 5AQAA 3LXUX 4JB8P 3BQOA 4FLBA 4I1MA 4EECA 3FY4A 2P9UG 4RVBA 4MS6A 5G55A 4DJAA 3FUKA 1QQEA 3UUXA 5D0OD 3GZSA 2PQNA 5G04C 4MLPA 2WB2A 3HIZA 3EU5A 4PS7A 3ULQA 4YVQC 3Q79A 1TR4A 5H7PA 2VSNA 4XE0A 4I6JA 4G24A 4L7TA 3AJIA 4KZ0A 2CFZA 3DBSA 4GA2A 2Y69E 2WVIA 4HQDA 3AS4A 2EQXA 3QWPA 2CG2A 1FT1A 3RRNB 3CKBA 5G04J 4M3OA 2JEKA 3CVVA 2FBNA 3L82A 5ENTD 2V4HC 3L22A 4IULA 2YQ8A 3EHNA 4AEZC 2WXQA 3PS6A 4TXQA 3FTUA 3G2SA 3JXIA 2V5FA 4APOA 5CEDB 3L54A 2IOSA 2XEVA 4I9CA 1NI1A 5AQBA 3GZ1A 4W9RA 4GMLA 3V79K 1QZ2A 1TJFA 3Q15A 4GTTA 3ZVVA 3ASDA 4ILIA 1N54A 5EIDA 2ONDA 3DWLG 5FQ4A 5CMWA 4GYYA 4BX8A 4WAFA 2VJ8A 1HX8A 4B8CB 3RU0A 4J8YA 3UPVA 3FH7A 1TN7A 3SI5A 2Q7FA 4OYSA 4M7CA 4TRQA 4XX5A 4BT8A 3CVXA 4CGWA 1SW6A 3CVLA 3TG5A 4BEPA 5AYWD 5EIBE 2BKGA 2J09A 3KEZA 4UWFA 1EF1C 3C3RA 3IXEA 4EBAG 2OOEA 4ATZD 1E8ZA 1HZ4A 3I4GA 4AY5A 4GCOA 1XGWA 2XQ0A 2IQCA 2B6CA 5C2YA 1SZ9A 3SHFA 3FEYA 4KYOB 3QARA 3EHMA 3E33A 3ASFA 3BEEA 2CHZA 1N4SA 2WXGA 4LCTA 4RQIA 4AV7A 2WMOA 1BI8B 3CLJA 4HRMB 4GZCA 3QKYA 2A5UA 3L17A 3Q7AA 1ELKA 3LDZA 4GMJA 3ZNGA 1AP7A 3CKCA 2X6HA 3OTNA 4BTAA 1KT1A 1H0AA 1S64A 5LX8A 1JCSA 2J8SD 4UI9C 2KATA 5JJ6A 2HO1A 2Y0BG 3TWUA 2RKKA 2ETBA 4N3AA 4N5QA 2P9NG 5FZSA 4D10C 1QYMA 3FTZA 1E96B 3UINC 3FDHA 3LPZA 3JXJA 2KXPC 4L1BA 1MHQA 3RIBA 5BXOA 3MYVA 3ZYKA 1TNYA 3S7DA 4CZ2D 4UI9J 4WWNA 2ZIRA 4GTSA 3TL5A 3GZ2A 5E75A 1JPLA 3AG3E 3ENEA 5FWQA 3R9MA 4U0SA 5FINA 4EZKA 2AJAA 3FU3A 4A1GA 3CHSA 3FTXA 2PM6A 3K9IA 3SF4A 3UQ3A 1B89A 5FQ7A 1MX2A 1OCRE 3FTWA 1RZ4A 2GGFA 1UJJA 4I17A 5J90A 3HXDA 3T8MA 3TG4A 4JEUA 2FO1E 4JL0A 2WXLA 3MCXA 4Q69A 1D8DA 2ZXWE 3ZU7B 1YCSB 3ASOE 4HORA 2LAHA 2GRLA 3W9FA 3CHMA 4XIFA 2MHKA 2KM4A 3SBTB 4Z68A 5AIJA 2QFCA 3V30A 5ARGA 3IBEA 3QDNA 5CMYA 4PS3A 1EYHA 1S0PA 2IFUA 5HQ8A 4H7YA 2FEZA 3NOCD 4GTQA 4I2WA 2ZU6B 4HB5A 4FULA 3E30A 3GYZA 4MRUA 3ML8A 4PH4B 4OVVA 4BWRA 4F1SA 3UKRG 2NYJA 3CHPA 5ENNA 3CHQA 3NBNB 1LTXA 2X3MA 3DSXA 3FUNA 1H2UA 3J5PA 1E8YA 5ENPD 4Y6WA 3D9PA 2VTBB 4JC8A 5FT9A 3DSTA 4GMRA 4IRUA 3NB2A 1OWPA 3KEAA 4FU3A 2IF4A 2V8SE 2HYZA 3DSUA 5BUZA 3E34A 3D3MA 2XCBA 1N11A 4DX1A 1TNOA 4JHKA 3ZXPA 4B94A 3CVPA 2VGXA 3FUIA 3VTYA 5EKQD 2ETAA 3SFZA 4CGVA 4R7LA 2YHCA 2ZGGA 4CDNA 5C1DA 1UN9A 4F3VA 5AENA 2A5EA 2R17C 4GTRA 4DX7D 5D2MC 2ZGDA 2LNIA 3KS2A 4I43A 3FWVA 1MX6A 1K1AA 2BTDA 4UWHA 2NC9A 5BV0A 3ISMC 4HLEA 4KT6B 5CHEE 4GZ3A 4RLYA 3JQ1A 5CEAA 3UTMA 1HG5A 5JA4D 5M72A 1BU9A 4JD2G 3B13A 3Q75A 1SA4A 2XEHA 5EX0A 3RRUA 1NFIE 3G2UA 2BUGA 3RRMB 3CSTA 3D9NA 3CK8A 3HG0D 4BSXA 5FZQA 4Q96A 1K3ZD 3O48A 3AS8A 4QQIA 4FA6A 2DZOA 4OAUC 3IHYA 4LG6A 5J08A 4G23A 5ITZF 1X5BA 5AQ9A 5DIZA 3TWQA 2UY1A 3CHOA 3URZA 1W3BA 3FTVA 5D0QD 3EUVA 3VLDA 2UWJG 3LS8A 3L08A 1OCCE 1OWNA 4UWGA 3UX4A 5IY5E 1MZCA 3C98A 4B89A 2LAIA 1OCOE 3FTSA 3BG1B 3I4RB 1ZBPA 5EX3A 2A4ZA 3ABME 4KVOA 4BY6A 2M63A 4LUNU 4E85A 3QWVA 3D9HA 3TWTA 1N0RA 2XZDG 3LKUA 3EIJA 4DPRA 3FU6A 3KD7A 4NRHB 3UT7A 3HYMB 1E7UA 4BT9A 3UM2A 4YDYA 3TWSA 5JHAA 2L6JA 3CVYA 2RFMA 3S7JA 2P9IG 4Q94A 3L9TA 1N4PA 3WXXA 4APFA 1UN8A 2XS8A 1OCZE 1V55E 1N95A 4GZDA 4FHJA 1JWFA 2L0TB 3ONKA 1SZAA 3FFLA 3SQVA 2PL2A 2WXHA 2VGYA 1OWOA 1DCEA 3N71A 1TNZA 2H6FA 4DRXE 3D9LA 4LNGA 5FZRA 4DI4A 3ZYLA 4ATGA 3DEOA 3PUKA 4JHRA 2EILE 2HM8A 5HKPA 3HVEA 3B7UX 3RO2A 4XI9A 4I2ZA 2R02A 1KZPA 1TNUA 4F6RD 4WNFA 5JMND 2WXPA 3DPYA 1H6PA 4J8EA 2AXUA 1BI7B 2C0LA 4GYWA 4G2VA 1OXJA 1G3NB 2H6GA 5CCLA 4O1PA 3TGOA 3HRAA 1E8XA 3UXGA 2VQ2A 3AAAC 3SBSA 5BXUA 3AS5A 3PNTB 3D9IA 3B95A 4UWKA 3SD5A 3WG7E 4CRWA 3G2WA 3NAWA 1K8KG 2XPZA 2EIJE 4EZJA 5LFAA 2B0OE 4WUYA 5T3RA 3MX3A 3LY8A 3OXGA 2AWIA 4C0EA 4AP2A 5AJLA 4HRLA 3Q9UC 4N39A 1MJ0A 4JPSA 5A6CA 4N2SA 2OVFA 4XKCA 2E2EA 1FPPA 3PDNA 2AVPA 3DRAA 3RJVA 4FC8A 4LEUA 2CHWA 2XRZA 5ENQD 5FJYA 2DVWA 4BTBA 2YHEA 4ME2A 3TWWA 5ENSD 4AXHA 3RK6A 4U63A 3G2VA 3NQPA 4RSYA 4P29A 5AAOA 4GZ6A 3ABKE 3RKVA 1SA5A 2WXIA 1SVXA 2WXRA 2GRQB 3LEWA 3OXFA 2V0PA 5KBAA 4I6EA 2EINE 4GTVA 4GTPA 3ULEG 1H2VC 1DVPA 2I1JA 1NP7A 2NSZA 3T8KA 3IV0A 1YMPA 5KNGA 2WPVA 3APCA 3Q5MA 1WAO1 4GU5A 2DYSE 4U96D 2P9LG 3ZYQA 2LUHA 2MYOA 3MJWA 3MKQB 4PUCA 4C48B 3ZRHA 2Y4UA 3TXNA 3C3OA 3JYSA 3LYAA 1E90A 4FJZA 1E7VA 1Y8MA 1RW2A 2IJGX 1MX4A 4FHKA 5ANRA 3FUJA 5EDSA 3PEVB 4U0ZA 3Q73A 4K5AB 3T9KA 2R03A 3VLEA 2XPIA 4J7WA 3MGBA 3E32A 2R2LA 3CQCB 2X6JA 4CT4A 3D9JA 4KVMA 1HO8A 4V3IA 4G1TA 2AXZA 4MKTA 2Y4TA 4BETA 4U8YD 1Z3XA 3EHQA 5EN5D 4GA1A 4DUIA 4DX2A 1A17A 2WQHA 3UT8A 4BFRA 2VSOE 3ML9A 1ELWA 5KJKA 4IN3B 4A3TA 4YDOA 2GROB 4F1PA 1KT0A 2C2LA 1WM5A 5DBKA 3ASHA 4YDEA 4RG6A 2OVBA 3L13A 3CK9A 3E37A 2XS1A 1LD7A 5KJMA 2V5QC 1HG2A 3PNLB 4K03A 2P9SG 2X38A 2CHXA 1UJKA 1XNFA 5HI7A 4URKA 3APFA 2WMNA 3V2OA 2QC9A 2VSYA 3DSSA
chains in the Genus database with same CATH topology
1UW4B 2WXNA 3CVVA 2FBNA 2XGOA 2GRMA 2IONA 5DIZA 2UY1A 3L22A 4IULA 3CHOA 4U07A 3URZA 1HF8A 2YQ8A 4CCAA 3EHNA 4LRZA 1W3BA 4AEZC 2WXQA 3QJZA 1YA0A 3PS6A 1Z6TA 3FTUA 3G2SA 3MA5A 2V5FA 4I6GA 3PREA 2J08A 3FTVA 4FP7A 5D0QD 4APOA 3L54A 4H7XA 2AXVA 2IOSA 2XEVA 4I9CA 2DBAA 3GZ1A 4GMLA 4W9RA 1WY6A 3VLDA 2XGMA 1QZ2A 2UWJG 3LS8A 3Q4AB 3L08A 4G11A 2WQ7A 1TJFA 3Q15A 4FADA 2I2OA 1OWNA 3ZVVA 2MRIA 2VGXB 3QB2A 4UWGA 3R9AB 3ASDA 1U3CA 4ILIA 3UX4A 4DK5A 1N54A 2ONDA 3SZ7A 5FQ4A 3JCKC 5CMWA 4GYYA 4LERA 1HH8A 3C98A 4B89A 4BX8A 2LAIA 4WAFA 3FHEA 2VJ8A 3FTSA 4XKBA 1HX8A 4B8CB 3BG1B 3CEQA 3FEXA 3RU0A 3I4RB 2XHEA 3UPVA 3FH7A 3CVUA 1ZBPA 5EX3A 3FP3A 3SI5A 2Q7FA 4OYSA 2A4ZA 4TRQA 3CV0A 4XX5A 4BT8A 1U3DA 4CGWA 3CVXA 1DNPA 3CVLA 4ANUA 4KVOA 3TG5A 3S2AA 3CQGB 3MV2B 5AYWD 3CVWA 4BY6A 2M63A 3CSFA 4LUNU 4E85A 3QWVA 4I1AA 2J09A 3QAQA 5ANLA 4ILHB 2YINA 4E6HA 2BF0X 2NXPA 3IHVA 3KEZA 5A7DB 4UWFA 1EF1C 4L2YA 3LKUA 2C0MA 4NQ0A 3MKQA 3EIJA 4CDMA 1IYGA 2DCPA 4DPRA 3FU6A 3KD7A 1HU3A 4NRHB 4CDRA 3UT7A 4EBAG 3R7QA 5BPPA 2OOEA 2X6KA 1E8ZA 1HZ4A 3I4GA 3JUIA 4AY5A 3QOUA 3ZW3A 3HYMB 3P2BA 3PEUB 4I1OB 1OWMA 2QY7A 1E7UA 3LCAA 4GCOA 4BT9A 1XGWA 2XQ0A 3PVLA 3IEGA 2RG8A 2IQCA 5JHAA 2L6JA 2X6FA 3CVYA 5C2YA 3S7JA 5JJ7A 1SZ9A 3SHFA 3FEYA 4KYOB 4Q94A 3QARA 4J8FA 3WXXA 3EHMA 1L5JA 3FU0A 4APFA 2XRYA 3EJNA 4HOQA 4YNDA 3ASFA 3ONLA 1IQUA 1UN8A 4A3VA 4G26A 3BEEA 1OWLA 5AJDA 2LO6A 3IKOB 2CHZA 3P1UA 4FJYA 3EIQC 2KC7A 2WXGA 2J9QA 3PZDA 3QWWA 4LCTA 4AV7A 4ILGA 2WMOA 1JWGA 3B7RL 2DIWA 3CLJA 3FULA 4GZDA 2YNQA 4GZCA 3QKYA 3MEKA 4FHJA 3I3NA 3OXLA 1PY1A 3DPDA 1PC2A 1JWFA 2A5UA 3BG0B 1EDUA 3L17A 2GW1A 1ELKA 3LDZA 4GMJA 4CT0A 2L0TB 1FVHA 4IYPA 5CCMA 3FUHA 3CKCA 3ONKA 4WNDA 4EPZA 4UQXA 4N2QA 1SZAA 2X6HA 3FFLA 3OTNA 3SNXA 2UY1B 1KT1A 3FH5A 4BTAA 3ZIMA 1H0AA 1E8WA 3APDA 2PL2A 2WXHA 2VGYA 1QNFA 5FQ6A 5LX8A 1OWOA 5LCWC 3N71A 2KZTB 3ASGA 1IHGA 4DI3A 4AVXA 4UI9C 3UMVA 3U3WA 4N3CA 3D9LA 1INZA 4GZ5A 2KATA 2WXMA 5JJ6A 2X6IA 5FZRA 4DI4A 3ZYLA 4KBQA 4ATGA 3FUMA 2HO1A 3PUKA 2V4LA 4JHRA 2HM8A 2KCLA 4N3AA 1BPOA 3HVEA 3NF1A 4EBAA 4XZ4A 3B7UX 4PS8A 3RO2A 5FZSA 4XI9A 1NA3A 4I2ZA 4D10C 3R7RA 3FTZA 2I6HA 4AY6A 4WNFA 1E96B 4GB9A 2WXPA 3FDHA 3LPZA 2I9CA 3ZHEA 4EZLA 4PDXA 3ESLA 4XI0A 3FUEA 4J8EA 3O4ZA 1HXIA 2FI7A 2AXUA 4WNEA 4AOFA 4L1BA 4NURA 3SGHA 5LOZA 1MHQA 3RIBA 3D9KA 2C0LA 5LCWJ 3MYVA 3ZYKA 2E0IA 4N3BA 3S7DA 2WQ6A 4UI9J 5ARFA 4WWNA 4GYWA 4G2VA 3S7BA 3TL5A 3GZ2A 4FLHA 4WWPA 5BNWA 2WM9A 1JPLA 4JXTA 5E75A 2VTBA 3ENEA 5FWQA 2J4BA 2VSXE 3S7FA 5CCLA 4JW1A 4U0SA 3TGOA 5LP0A 4DLOA 4EZKA 5BW8C 1TEZA 1E8XA 3FU3A 4A1GA 4AJWA 3CHSA 2VQ2A 3CVQA 5FQ8A 2LSVA 3FTXA 3ZYMA 5G05C 2PM6A 1ELRA 3GW4A 3K9IA 3SBSA 1HFAA 3AS5A 4GCNA 3SF4A 1B89A 2JLBA 4KMOA 5FQ7A 3TJPA 3FTWA 1H6KA 3UQ3A 3VTXA 3D9OA 3PNTB 2GGFA 3D9IA 3Q49B 5KJNA 4TUUA 1UJJA 4UWKA 3SD5A 4I17A 4CRWA 3T8MA 3G2WA 5J90A 4GPKA 4KXKB 3ZFWA 3TG4A 3PUJA 4B0ZA 2XPZA 3QNKA 4JEUA 4ACKA 4ACLA 4EZJA 2L9BA 3CIAA 4UWLA 4WUYA 4JL0A 4BX9A 5LFAA 2WXLA 3MCXA 4Q69A 5T3RA 5A23A 3MX3A 1PAQA 3LJ3A 4JA7A 3TAXA 4A1SA 4A55A 3L6AA 4HORA 5FTPA 2LAHA 3ZPJA 4F7AA 2GRLA 5E76A 3Q47B 3JQ0A 3LY8A 3OXGA 3U4TA 3U9WA 4UI9K 3NZUA 5BV1A 3L16A 2AWIA 4G25A 4HOTA 4C0EA 4C9BB 4AP2A 4ANXA 3RO3A 5AJLA 3CHMA 4XIFA 4N39A 5A6CA 2MHKA 4JPSA 4JEHA 5G05J 2FF4A 2RD0A 4N2SA 2OVFA 4XKCA 2KM4A 2I1KA 2E2EA 3PH0C 3SBTB 3B7SA 3HDXA 3CK7A 3PDNA 5AIJA 2QFCA 4RG9A 2WXKA 1NA0A 3IBEA 2WXJA 5ARGA 2WXOA 2AVPA 3QDNA 3MV3B 3MZLB 5CMYA 3UT4A 3RJVA 4FC8A 4PS3A 4LEUA 2CHWA 4AIFA 2MOWA 2XCCA 4NACA 3TXMA 1GW6A 3KAEA 3CGHA 4J8DA 1EYHA 4ANWA 2XRZA 1OUVA 1KLXA 1S0PA 2HR2A 2IFUA 3LY7A 5FJYA 4BTBA 2YHEA 4ME2A 4J0UA 5HQ8A 1JUQA 1P5QA 4H7YA 4AXHA 3RK6A 1HS6A 4U63A 4B8AA 2LSUA 3G2VA 3NQPA 4UQYA 3T5VA 2FEZA 4HVBA 3AU4A 3G2TA 3HVEB 4HS2A 4RSYA 4P29A 1TJCA 3OAWA 4I2WA 1MQSA 2ZU6B 4GZ6A 2WXFA 4J8SA 1IQRA 1FVFA 3RKVA 3D9MA 4HOSA 2FULA 2WXIA 3LVQE 4FULA 2P58C 4JZYA 1EPUA 3FU5A 3LVRE 4CEMA 2WXRA 3GYZA 3LY9A 3ZHEB 3LEWA 4MRUA 2Y3AA 3ML8A 3OXFA 3PE4A 4PH4B 3AU5A 4OVVA 4C0MA 4QFVA 2V0PA 4BWRA 4I6EA 4F1SA 4GAAA 5KCMA 4L23A 3CHPA 3QK0A 2CFUA 5ENNA 1H2VC 3CHQA 1DVPA 5G2NA 1SQMA 2X3MA 2I1JA 3FUNA 1H2TC 1H2UA 1NP7A 2NSZA 5JHBA 1Y6IA 2VYIA 3ESKA 5BT1A 1E8YA 5T8IA 4U04A 1HE8A 3IV0A 4JHJA 2WPVA 4Y6WA 4F53A 3APCA 3D9PA 2J49A 3Q5MA 2KCVA 1WAO1 2VTBB 4O6FA 4JC8A 4GU5A 2KCKA 5FT9A 2KZTA 5T4YA 3CHRA 2J07A 5JJTA 4HOUA 2PZIA 2PQRA 2J4DA 4ANVA 3PRZA 4DLQA 3T5XA 4IRUA 5KJLA 1OWPA 3ZYQA 1N52A 3CVNA 3MJWA 4FU3A 2IF4A 3MKQB 4HFGA 4PUCA 3FUDA 2ILRA 2V8SE 3ZRHA 2Y4UA 3TXNA 2HYZA 3MKRA 2PM7A 3JYSA 5BUZA 3B7TA 4N5CA 3LYAA 4YVOA 1NZNA 1E90A 4FJZA 3ZGQA 3D3MA 2XCBA 3I5PA 1E7VA 2CG3A 3FUFA 1Y8MA 1Z3YA 3ZEFA 4L2LA 4U0UA 3E4BA 3CR3A 4JHKA 4B94A 2IJGX 3CVPA 2VGXA 3QC1A 4FHKA 5ANRA 3FUIA 3U64A 3VTYA 5EKQD 3FUJA 5EDSA 4K0RA 3FTYA 4AM9A 2XGSA 3PEVB 3SFZA 4CGVA 4U0ZA 4UQZA 4WNGA 1VDYA 2OV8A 4R7LA 2YHCA 3VLEA 3EDTB 4CDNA 2XPIA 2L0IA 2R59A 5C1DA 1UN9A 4J6IA 4GA0A 3MGBA 4Y6CA 1H19A 3CQCB 4F3VA 5AENA 2R17C 2X6JA 3LXUX 4CT4A 3D9JA 2LNIA 4FLBA 4I1MA 4KVMA 4EECA 3FY4A 1HO8A 3KS2A 4I43A 4V3IA 4G1TA 4ABNA 3FH8A 3FWVA 2AXZA 4MKTA 4RVBA 2Y4TA 4MS6A 3HHMA 5G55A 4EQFA 1Z3XA 2BTDA 4JA9A 4UWHA 3VLFA 2NC9A 5BV0A 4DJAA 3FUKA 1QQEA 3UUXA 4HLEA 4GA1A 4KT6B 4TV3A 5CHEE 5D0OD 1A17A 3GZSA 4GZ3A 1FCHA 2PQNA 1UG3A 4KZCA 2WQHA 5G04C 3PE3A 4MLPA 3UT8A 4BFRA 2WB2A 2VSOE 3HIZA 3JQ1A 3ML9A 1HG5A 4PS7A 1ELWA 5KJKA 3ULQA 5M72A 4OVUA 4YVQC 4IN3B 4A3TA 2R5SA 3B13A 2VSNA 1KT0A 4JVSA 4XE0A 5EX0A 2C2LA 1WM5A 1ZU2A 3RRUA 5DBKA 3G2UA 3RRMB 3ASHA 2BUGA 3CSTA 3D9NA 4I6JA 4RG6A 2XPYA 2OVBA 2AW6A 3CK8A 4G24A 3L13A 4L7TA 3CK9A 2IOLA 3NZSA 4BSXA 4KZ0A 5FZQA 2CFZA 3ZXSA 3ZN3A 3DBSA 5KJMA 4Q96A 2FO7A 4GA2A 1HG2A 3O48A 4I9EA 3PNLB 4K03A 2WVIA 2IU1A 3AS8A 2X38A 1LF8A 2CHXA 4HXIA 4U8HA 1UJKA 4FA6A 3AS4A 1XNFA 4WWOA 2EQXA 3QWPA 2CG2A 5HI7A 3IHYA 3APFA 3RRNB 2WMNA 3CKBA 5G04J 4URKA 5J08A 4G23A 4M3OA 2JEKA 2VSYA 1X5BA 3U66A 4GYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBN A;  2XGO A;  5DIZ A;  2UY1 A;  4U07 A;  3URZ A;  2YQ8 A;  1W3B A;  1YA0 A;  3MA5 A;  2V5F A;  5D0Q D;  4APO A;  4H7X A;  2XEV A;  4I9C A;  2DBA A;  3GZ1 A;  4W9R A;  2XGM A;  1QZ2 A;  2UWJ G;  3Q4A B;  3Q15 A;  2VGX B;  3R9A B;  3ASD A;  2OND A;  3SZ7 A;  4GYY A;  1HH8 A;  3CEQ A;  3RU0 A;  3UPV A;  1ZBP A;  5EX3 A;  3FP3 A;  2Q7F A;  4BT8 A;  3CV0 A;  4CGW A;  3CVL A;  3TG5 A;  3MV2 B;  5AYW D;  3QWV A;  4I1A A;  5A7D B;  3LKU A;  2C0M A;  4NQ0 A;  1IYG A;  3KD7 A;  4NRH B;  4CDR A;  2OOE A;  1HZ4 A;  4AY5 A;  3QOU A;  3HYM B;  3LCA A;  4GCO A;  4BT9 A;  3IEG A;  2L6J A;  3S7J A;  5JJ7 A;  4KYO B;  4J8F A;  3WXX A;  4HOQ A;  4YND A;  3ASF A;  4G26 A;  3BEE A;  2KC7 A;  3QWW A;  2J9Q A;  3QKY A;  3MEK A;  3OXL A;  1PC2 A;  2GW1 A;  5CCM A;  3CKC A;  4WND A;  4UQX A;  4N2Q A;  3FFL A;  2UY1 B;  1KT1 A;  4BTA A;  2PL2 A;  2VGY A;  5LCW C;  3N71 A;  3ASG A;  1IHG A;  4UI9 C;  3U3W A;  4N3C A;  4GZ5 A;  2KAT A;  5JJ6 A;  5FZR A;  4KBQ A;  2HO1 A;  4JHR A;  2KCL A;  4N3A A;  3NF1 A;  3RO2 A;  5FZS A;  4XI9 A;  1NA3 A;  4I2Z A;  2I6H A;  4AY6 A;  4WNF A;  1E96 B;  3LPZ A;  3ZHE A;  4XI0 A;  4J8E A;  1HXI A;  2FI7 A;  4WNE A;  3RIB A;  2C0L A;  5LCW J;  4N3B A;  3S7D A;  4UI9 J;  5ARF A;  4GYW A;  4G2V A;  3S7B A;  3GZ2 A;  5BNW A;  5CCL A;  3S7F A;  4U0S A;  3TGO A;  5BW8 C;  2VQ2 A;  3CVQ A;  2LSV A;  5G05 C;  1ELR A;  3GW4 A;  3K9I A;  3AS5 A;  4GCN A;  3SF4 A;  1B89 A;  2JLB A;  3UQ3 A;  3VTX A;  3Q49 B;  5KJN A;  4I17 A;  4GPK A;  4KXK B;  3ZFW A;  3TG4 A;  4WUY A;  4JL0 A;  4JA7 A;  3TAX A;  4A1S A;  4HOR A;  5FTP A;  3ZPJ A;  3Q47 B;  3LY8 A;  3OXG A;  3U4T A;  4UI9 K;  4G25 A;  4HOT A;  3RO3 A;  4XIF A;  4N39 A;  5A6C A;  2MHK A;  5G05 J;  2FF4 A;  4N2S A;  2E2E A;  3CK7 A;  3PDN A;  2QFC A;  4RG9 A;  5ARG A;  1NA0 A;  2AVP A;  3QDN A;  3MV3 B;  3RJV A;  4LEU A;  4AIF A;  2XCC A;  3KAE A;  4J8D A;  1OUV A;  1KLX A;  2HR2 A;  2IFU A;  3LY7 A;  5FJY A;  4BTB A;  4ME2 A;  4J0U A;  5HQ8 A;  1P5Q A;  4H7Y A;  2LSU A;  4UQY A;  2FEZ A;  1TJC A;  4I2W A;  4GZ6 A;  3RKV A;  4HOS A;  2P58 C;  3GYZ A;  3LY9 A;  3ZHE B;  3PE4 A;  3OXF A;  4BWR A;  2VYI A;  3ESK A;  5BT1 A;  4U04 A;  2WPV A;  4Y6W A;  3Q5M A;  2KCV A;  1WAO 1;  4O6F A;  2KCK A;  5FT9 A;  5JJT A;  4HOU A;  2PZI A;  2PQR A;  5KJL A;  3CVN A;  2IF4 A;  2Y4U A;  2HYZ A;  3MKR A;  3JYS A;  4YVO A;  4N5C A;  3LYA A;  1NZN A;  3ZGQ A;  2XCB A;  1Y8M A;  4U0U A;  3E4B A;  4B94 A;  3CVP A;  2VGX A;  3VTY A;  5EKQ D;  4AM9 A;  2XGS A;  4CGV A;  4U0Z A;  4UQZ A;  4WNG A;  2YHC A;  3EDT B;  2XPI A;  5C1D A;  4GA0 A;  4Y6C A;  4F3V A;  2LNI A;  3KS2 A;  4G1T A;  4ABN A;  3FWV A;  2Y4T A;  4EQF A;  4JA9 A;  2NC9 A;  1QQE A;  3UUX A;  4GA1 A;  5CHE E;  5D0O D;  1A17 A;  4GZ3 A;  1FCH A;  2PQN A;  2WQH A;  5G04 C;  3PE3 A;  1ELW A;  5KJK A;  3ULQ A;  5M72 A;  4YVQ C;  4IN3 B;  2R5S A;  2VSN A;  1KT0 A;  5EX0 A;  2C2L A;  1WM5 A;  1ZU2 A;  5DBK A;  2BUG A;  3ASH A;  4RG6 A;  3CK8 A;  4G24 A;  3CK9 A;  5FZQ A;  3ZN3 A;  5KJM A;  2FO7 A;  4GA2 A;  3O48 A;  4I9E A;  3AS8 A;  3AS4 A;  1XNF A;  3QWP A;  5HI7 A;  3CKB A;  5G04 J;  4G23 A;  2VSY A;  4GYO A; 
#chains in the Genus database with same CATH topology
 2GRM A;  5CRU A;  2ION A;  2F8Y A;  4U07 A;  2DZN A;  3QJZ A;  1Z6T A;  4TXP A;  4I6G A;  3PRE A;  2J08 A;  4HBD A;  2AXV A;  2DBA A;  3SO8 A;  1WY6 A;  3TWR A;  4HI9 A;  1DC2 A;  2I2O A;  1INZ A;  2VGX B;  5AQ7 A;  3UM1 A;  4XKB A;  2QYJ A;  3CEQ A;  3FEX A;  1ZB1 A;  3CV0 A;  1V54 E;  4B93 B;  1D9S A;  1JCQ A;  1DNP A;  4U95 D;  1KZO A;  3CVW A;  3CSF A;  4I1A A;  3QAQ A;  5ANL A;  5CBO A;  2YIN A;  4E6H A;  1BD8 A;  3IHV A;  4L2Y A;  2QYU A;  4DX5 D;  1IYG A;  1U2V G;  3SY2 A;  2P9P G;  5AN8 A;  3R7Q A;  4XEI G;  5BPP A;  3JUI A;  3ZW3 A;  4I1O B;  1OWM A;  3LCA A;  4TUM A;  2BED A;  2RG8 A;  2IO2 C;  4GTM A;  5JJ7 A;  2L6B A;  3C72 A;  1L5J A;  2XRY A;  4HOQ A;  3ONL A;  1IQU A;  4A3V A;  4G26 A;  5AJD A;  3P1U A;  4FJY A;  3B7B A;  2KC7 A;  3EIQ C;  3PZD A;  3QWW A;  1S63 A;  1JWG A;  3B7R L;  1UOH A;  3MEK A;  3OXL A;  5EYL A;  1PY1 A;  3DPD A;  3BG0 B;  1EDU A;  4CT0 A;  1FVH A;  4IYP A;  4UQX A;  3SNX A;  2UY1 B;  5FQ6 A;  1QNF A;  2F37 A;  5B3S E;  2KZT B;  5EYP F;  4HI8 A;  2R05 A;  3TWX A;  4AVX A;  3UMV A;  3U3W A;  1K1B A;  4N3C A;  4GZ5 A;  2WXM A;  5D66 A;  4KBQ A;  3FUM A;  1A5E A;  2V4L A;  1O1T A;  3NF1 A;  4EBA A;  4XZ4 A;  1OY3 D;  1NA3 A;  5CER B;  4NIK A;  3KSQ A;  3ZHE A;  4EZL A;  3ESL A;  3FUE A;  3HXC A;  2F0Y A;  3O4Z A;  4ZFH A;  3HXF A;  4WNE A;  4AOF A;  4NUR A;  5LOZ A;  3D9K A;  3ABL E;  2WQ6 A;  5ARF A;  4X8Q A;  3S7B A;  4WWP A;  2WM9 A;  3S7F A;  4JW1 A;  4DLO A;  1TEZ A;  5FQ8 A;  2LSV A;  1KPS B;  3EU9 A;  3GW4 A;  2ZIS A;  1HFA A;  2WQ7 A;  3BUA A;  3TJP A;  1WDY A;  1TNB A;  4KXK B;  3ZFW A;  3PUJ A;  4B0Z A;  4ACK A;  4ACL A;  4UWL A;  4YDW A;  3LJ3 A;  4JA7 A;  1FT2 A;  3TAX A;  4A1S A;  5FTP A;  3ZPJ A;  3U9W A;  4UI9 K;  3NZU A;  4C9B B;  3SFY A;  4ANX A;  3RO3 A;  4MBG A;  2I1K A;  3PH0 C;  3HDX A;  5ENO D;  4LSZ E;  4DX6 D;  3UT4 A;  2MOW A;  4NAC A;  3TXM A;  1OUV A;  1KLX A;  4J0U A;  1P5Q A;  1HS6 A;  1O1S A;  2LSU A;  4HVB A;  3AU4 A;  3HVE B;  4HS2 A;  5EIL A;  3OAW A;  1MQS A;  2P2C P;  2WXF A;  3PZ4 A;  1FVF A;  3PZ2 A;  3D9M A;  4HOS A;  1YYH A;  3UM0 A;  3LVR E;  4CEM A;  3LY9 A;  2LXL A;  3PE4 A;  3C3Q A;  4C0M A;  3AU5 A;  4QFV A;  3AG4 E;  5KCM A;  4L23 A;  3DSW A;  5HRY A;  2CFU A;  4K5C A;  1Y6I A;  2VYI A;  3AG1 E;  3ESK A;  4G8K A;  4CYM D;  5BT1 A;  5T8I A;  4U04 A;  1HE8 A;  4JHJ A;  4F53 A;  1IKN D;  4O1O A;  2KCV A;  5T4Y A;  5JJT A;  2H6I A;  2PZI A;  2J4D A;  2DYR E;  5KJL A;  3CVN A;  4HFG A;  3FUD A;  3MKR A;  3B7T A;  4N5C A;  4YVO A;  1NZN A;  5B1B E;  3ZEF A;  3FUF A;  3CR3 A;  3QC1 A;  1AWC B;  4K0R A;  2XGS A;  2OV8 A;  2R59 A;  2KBX A;  4GA0 A;  4Y6C A;  3DEP A;  3DXK G;  4ABN A;  3FH8 A;  3V31 A;  3HHM A;  4EQF A;  4JA9 A;  3VLF A;  3RSE G;  3UI2 A;  1N0Q A;  1X81 A;  4TV3 A;  1FCH A;  2GRN B;  1UG3 A;  4KZC A;  4BSZ B;  2OEV A;  3PE3 A;  3C5R A;  4OVU A;  2R5S A;  4JVS A;  4GTO A;  3BU8 A;  1ZU2 A;  4UUC A;  3HXE A;  2XPY A;  2AW6 A;  2IOL A;  3NZS A;  4ZHB A;  3ZXS A;  3ZN3 A;  4HLL A;  2FO7 A;  1TN8 A;  4I9E A;  2IU1 A;  1LF8 A;  4HXI A;  4U8H A;  4WWO A;  1IHB A;  3I3N A;  3U66 A;  4GYO A;  2ETC A;  1UW4 B;  2WXN A;  4LNU D;  2XGO A;  3X2Q E;  1HF8 A;  4CCA A;  4LRZ A;  2BKK B;  1YA0 A;  2PNN A;  3MA5 A;  4FP7 A;  4H7X A;  2VGE A;  3ZUV B;  2XGM A;  3Q4A B;  4G11 A;  4FAD A;  2MRI A;  3QB2 A;  4DK5 A;  3R9A B;  1U3C A;  1O5M A;  3UM3 A;  5FIO A;  2RFA A;  3SZ7 A;  3JCK C;  4LER A;  1HH8 A;  3FHE A;  2IEJ A;  1N9A A;  3DSV A;  2XHE A;  3CVU A;  3FP3 A;  2OEW A;  1N94 A;  1U3D A;  4O60 A;  3JUE A;  1Q2Z A;  4ANU A;  3S2A A;  3CQG B;  3MV2 B;  1TYQ G;  4ILH B;  3V2X A;  2BF0 X;  2NXP A;  5A7D B;  5CBN A;  2C0M A;  4NQ0 A;  3MKQ A;  4CDM A;  2DCP A;  1HU3 A;  4OAV B;  4CDR A;  2LXM A;  4TXR A;  4L9P A;  1Z5S C;  2X6K A;  3UIP C;  3QOU A;  3DXM G;  3P2B A;  3PEU B;  2QY7 A;  3PVL A;  3IEG A;  1IXV A;  1DCQ A;  2X6F A;  4J8F A;  3FU0 A;  1WG0 A;  2JAB A;  3EJN A;  4YND A;  3Q78 A;  2P9K G;  1OWL A;  2LO6 A;  3IKO B;  1MYO A;  2J9Q A;  4ILG A;  4K5B A;  2Y1L E;  2DIW A;  3FUL A;  2IY0 C;  2YNQ A;  3TWV A;  1PC2 A;  2GW1 A;  5CCM A;  3FUH A;  4WND A;  4EPZ A;  4N2Q A;  2XZT G;  3FH5 A;  3ZIM A;  1H6O A;  1E8W A;  3APD A;  3HXB A;  5LCW C;  3ASG A;  1IHG A;  4DI3 A;  4U8V D;  4EHM A;  2X6I A;  1NL4 A;  2KCL A;  1BPO A;  5BV1 A;  4PS8 A;  3R7R A;  2I6H A;  4AY6 A;  4GB9 A;  1O1R A;  2I9C A;  2EIK E;  4PDX A;  4XI0 A;  5CRV A;  1HXI A;  2FI7 A;  2DWZ A;  3SGH A;  5LCW J;  2GRP B;  2E0I A;  4N3B A;  5KNH D;  1OT8 A;  1JCR A;  4FLH A;  5BNW A;  4JXT A;  4HNA D;  2VTB A;  2J4B A;  2VSX E;  4LNB A;  3Q9N C;  5LP0 A;  5BW8 C;  4AJW A;  3KSL A;  3CVQ A;  3ZYM A;  3UKU G;  3NOG D;  5G05 C;  5ENR D;  1ELR A;  3SFX A;  4GCN A;  4KMO A;  2JLB A;  1H6K A;  3VTX A;  3D9O A;  1LD8 A;  3Q49 B;  5KJN A;  4TUU A;  1QBQ A;  4GPK A;  3QNK A;  3F6Q A;  2L9B A;  3CIA A;  5B1A E;  4BX9 A;  5A23 A;  1PAQ A;  4A55 A;  3L6A A;  4F7A A;  5E76 A;  3Q47 B;  3JQ0 A;  3U4T A;  2HE0 A;  3L16 A;  4G25 A;  4HOT A;  3ULY A;  4JEH A;  5G05 J;  2FF4 A;  2RD0 A;  5KWD A;  3B7S A;  3CK7 A;  4RG9 A;  2WXK A;  1NA0 A;  2WXJ A;  2WXO A;  3ZKJ A;  3MV3 B;  1D8E A;  3MZL B;  4AIF A;  4A63 B;  2XCC A;  1GW6 A;  3KAE A;  3CGH A;  4J8D A;  3ASN E;  4ANW A;  5CEC B;  2HR2 A;  3LY7 A;  1JUQ A;  1BLX B;  3J5Q B;  2GRR B;  1TN6 A;  4B8A A;  3T5V A;  4UQY A;  3G2T A;  1TJC A;  4BER A;  4J8S A;  1IQR A;  2FUL A;  3LVQ E;  2F8X K;  2P58 C;  4JZY A;  1EPU A;  3FU5 A;  3ZHE B;  1N4R A;  2Y3A A;  2EIM E;  2IO3 C;  4U7E B;  4GAA A;  2XEE A;  5AAR A;  3QK0 A;  5G2N A;  1SQM A;  3EHR A;  1H2T C;  4BES A;  5JHB A;  3W9G A;  2J49 A;  4O6F A;  3LJN A;  2KCK A;  2KZT A;  3CHR A;  2J07 A;  4HOU A;  1N4Q A;  3PZ1 A;  2PQR A;  3PZ3 A;  4ANV A;  3PRZ A;  4DLQ A;  3T5X A;  1N52 A;  2OCC E;  2H6H A;  2ILR A;  2PM7 A;  4G8L A;  3ZGQ A;  3I5P A;  2CG3 A;  3RAU A;  1Z3Y A;  5HS0 A;  4L2L A;  4U0U A;  3E4B A;  3Q7F A;  3U64 A;  4AM9 A;  3FTY A;  3UIO C;  4HRN A;  3AG2 E;  4UQZ A;  2XEN A;  4GPM A;  4WNG A;  1VDY A;  1S70 B;  3EDT B;  2L0I A;  2QZA A;  4J6I A;  1H19 A;  5AQA A;  3LXU X;  4JB8 P;  3BQO A;  4FLB A;  4I1M A;  4EEC A;  3FY4 A;  2P9U G;  4RVB A;  4MS6 A;  5G55 A;  4DJA A;  3FUK A;  1QQE A;  3UUX A;  5D0O D;  3GZS A;  2PQN A;  5G04 C;  4MLP A;  2WB2 A;  3HIZ A;  3EU5 A;  4PS7 A;  3ULQ A;  4YVQ C;  3Q79 A;  1TR4 A;  5H7P A;  2VSN A;  4XE0 A;  4I6J A;  4G24 A;  4L7T A;  3AJI A;  4KZ0 A;  2CFZ A;  3DBS A;  4GA2 A;  2Y69 E;  2WVI A;  4HQD A;  3AS4 A;  2EQX A;  3QWP A;  2CG2 A;  1FT1 A;  3RRN B;  3CKB A;  5G04 J;  4M3O A;  2JEK A;  3CVV A;  2FBN A;  3L82 A;  5ENT D;  2V4H C;  3L22 A;  4IUL A;  2YQ8 A;  3EHN A;  4AEZ C;  2WXQ A;  3PS6 A;  4TXQ A;  3FTU A;  3G2S A;  3JXI A;  2V5F A;  4APO A;  5CED B;  3L54 A;  2IOS A;  2XEV A;  4I9C A;  1NI1 A;  5AQB A;  3GZ1 A;  4W9R A;  4GML A;  3V79 K;  1QZ2 A;  1TJF A;  3Q15 A;  4GTT A;  3ZVV A;  3ASD A;  4ILI A;  1N54 A;  5EID A;  2OND A;  3DWL G;  5FQ4 A;  5CMW A;  4GYY A;  4BX8 A;  4WAF A;  2VJ8 A;  1HX8 A;  4B8C B;  3RU0 A;  4J8Y A;  3UPV A;  3FH7 A;  1TN7 A;  3SI5 A;  2Q7F A;  4OYS A;  4M7C A;  4TRQ A;  4XX5 A;  4BT8 A;  3CVX A;  4CGW A;  1SW6 A;  3CVL A;  3TG5 A;  4BEP A;  5AYW D;  5EIB E;  2BKG A;  2J09 A;  3KEZ A;  4UWF A;  1EF1 C;  3C3R A;  3IXE A;  4EBA G;  2OOE A;  4ATZ D;  1E8Z A;  1HZ4 A;  3I4G A;  4AY5 A;  4GCO A;  1XGW A;  2XQ0 A;  2IQC A;  2B6C A;  5C2Y A;  1SZ9 A;  3SHF A;  3FEY A;  4KYO B;  3QAR A;  3EHM A;  3E33 A;  3ASF A;  3BEE A;  2CHZ A;  1N4S A;  2WXG A;  4LCT A;  4RQI A;  4AV7 A;  2WMO A;  1BI8 B;  3CLJ A;  4HRM B;  4GZC A;  3QKY A;  2A5U A;  3L17 A;  3Q7A A;  1ELK A;  3LDZ A;  4GMJ A;  3ZNG A;  1AP7 A;  3CKC A;  2X6H A;  3OTN A;  4BTA A;  1KT1 A;  1H0A A;  1S64 A;  5LX8 A;  1JCS A;  2J8S D;  4UI9 C;  2KAT A;  5JJ6 A;  2HO1 A;  2Y0B G;  3TWU A;  2RKK A;  2ETB A;  4N3A A;  4N5Q A;  2P9N G;  5FZS A;  4D10 C;  1QYM A;  3FTZ A;  1E96 B;  3UIN C;  3FDH A;  3LPZ A;  3JXJ A;  2KXP C;  4L1B A;  1MHQ A;  3RIB A;  5BXO A;  3MYV A;  3ZYK A;  1TNY A;  3S7D A;  4CZ2 D;  4UI9 J;  4WWN A;  2ZIR A;  4GTS A;  3TL5 A;  3GZ2 A;  5E75 A;  1JPL A;  3AG3 E;  3ENE A;  5FWQ A;  3R9M A;  4U0S A;  5FIN A;  4EZK A;  2AJA A;  3FU3 A;  4A1G A;  3CHS A;  3FTX A;  2PM6 A;  3K9I A;  3SF4 A;  3UQ3 A;  1B89 A;  5FQ7 A;  1MX2 A;  1OCR E;  3FTW A;  1RZ4 A;  2GGF A;  1UJJ A;  4I17 A;  5J90 A;  3HXD A;  3T8M A;  3TG4 A;  4JEU A;  2FO1 E;  4JL0 A;  2WXL A;  3MCX A;  4Q69 A;  1D8D A;  2ZXW E;  3ZU7 B;  1YCS B;  3ASO E;  4HOR A;  2LAH A;  2GRL A;  3W9F A;  3CHM A;  4XIF A;  2MHK A;  2KM4 A;  3SBT B;  4Z68 A;  5AIJ A;  2QFC A;  3V30 A;  5ARG A;  3IBE A;  3QDN A;  5CMY A;  4PS3 A;  1EYH A;  1S0P A;  2IFU A;  5HQ8 A;  4H7Y A;  2FEZ A;  3NOC D;  4GTQ A;  4I2W A;  2ZU6 B;  4HB5 A;  4FUL A;  3E30 A;  3GYZ A;  4MRU A;  3ML8 A;  4PH4 B;  4OVV A;  4BWR A;  4F1S A;  3UKR G;  2NYJ A;  3CHP A;  5ENN A;  3CHQ A;  3NBN B;  1LTX A;  2X3M A;  3DSX A;  3FUN A;  1H2U A;  3J5P A;  1E8Y A;  5ENP D;  4Y6W A;  3D9P A;  2VTB B;  4JC8 A;  5FT9 A;  3DST A;  4GMR A;  4IRU A;  3NB2 A;  1OWP A;  3KEA A;  4FU3 A;  2IF4 A;  2V8S E;  2HYZ A;  3DSU A;  5BUZ A;  3E34 A;  3D3M A;  2XCB A;  1N11 A;  4DX1 A;  1TNO A;  4JHK A;  3ZXP A;  4B94 A;  3CVP A;  2VGX A;  3FUI A;  3VTY A;  5EKQ D;  2ETA A;  3SFZ A;  4CGV A;  4R7L A;  2YHC A;  2ZGG A;  4CDN A;  5C1D A;  1UN9 A;  4F3V A;  5AEN A;  2A5E A;  2R17 C;  4GTR A;  4DX7 D;  5D2M C;  2ZGD A;  2LNI A;  3KS2 A;  4I43 A;  3FWV A;  1MX6 A;  1K1A A;  2BTD A;  4UWH A;  2NC9 A;  5BV0 A;  3ISM C;  4HLE A;  4KT6 B;  5CHE E;  4GZ3 A;  4RLY A;  3JQ1 A;  5CEA A;  3UTM A;  1HG5 A;  5JA4 D;  5M72 A;  1BU9 A;  4JD2 G;  3B13 A;  3Q75 A;  1SA4 A;  2XEH A;  5EX0 A;  3RRU A;  1NFI E;  3G2U A;  2BUG A;  3RRM B;  3CST A;  3D9N A;  3CK8 A;  3HG0 D;  4BSX A;  5FZQ A;  4Q96 A;  1K3Z D;  3O48 A;  3AS8 A;  4QQI A;  4FA6 A;  2DZO A;  4OAU C;  3IHY A;  4LG6 A;  5J08 A;  4G23 A;  5ITZ F;  1X5B A;  5AQ9 A;  5DIZ A;  3TWQ A;  2UY1 A;  3CHO A;  3URZ A;  1W3B A;  3FTV A;  5D0Q D;  3EUV A;  3VLD A;  2UWJ G;  3LS8 A;  3L08 A;  1OCC E;  1OWN A;  4UWG A;  3UX4 A;  5IY5 E;  1MZC A;  3C98 A;  4B89 A;  2LAI A;  1OCO E;  3FTS A;  3BG1 B;  3I4R B;  1ZBP A;  5EX3 A;  2A4Z A;  3ABM E;  4KVO A;  4BY6 A;  2M63 A;  4LUN U;  4E85 A;  3QWV A;  3D9H A;  3TWT A;  1N0R A;  2XZD G;  3LKU A;  3EIJ A;  4DPR A;  3FU6 A;  3KD7 A;  4NRH B;  3UT7 A;  3HYM B;  1E7U A;  4BT9 A;  3UM2 A;  4YDY A;  3TWS A;  5JHA A;  2L6J A;  3CVY A;  2RFM A;  3S7J A;  2P9I G;  4Q94 A;  3L9T A;  1N4P A;  3WXX A;  4APF A;  1UN8 A;  2XS8 A;  1OCZ E;  1V55 E;  1N95 A;  4GZD A;  4FHJ A;  1JWF A;  2L0T B;  3ONK A;  1SZA A;  3FFL A;  3SQV A;  2PL2 A;  2WXH A;  2VGY A;  1OWO A;  1DCE A;  3N71 A;  1TNZ A;  2H6F A;  4DRX E;  3D9L A;  4LNG A;  5FZR A;  4DI4 A;  3ZYL A;  4ATG A;  3DEO A;  3PUK A;  4JHR A;  2EIL E;  2HM8 A;  5HKP A;  3HVE A;  3B7U X;  3RO2 A;  4XI9 A;  4I2Z A;  2R02 A;  1KZP A;  1TNU A;  4F6R D;  4WNF A;  5JMN D;  2WXP A;  3DPY A;  1H6P A;  4J8E A;  2AXU A;  1BI7 B;  2C0L A;  4GYW A;  4G2V A;  1OXJ A;  1G3N B;  2H6G A;  5CCL A;  4O1P A;  3TGO A;  3HRA A;  1E8X A;  3UXG A;  2VQ2 A;  3AAA C;  3SBS A;  5BXU A;  3AS5 A;  3PNT B;  3D9I A;  3B95 A;  4UWK A;  3SD5 A;  3WG7 E;  4CRW A;  3G2W A;  3NAW A;  1K8K G;  2XPZ A;  2EIJ E;  4EZJ A;  5LFA A;  2B0O E;  4WUY A;  5T3R A;  3MX3 A;  3LY8 A;  3OXG A;  2AWI A;  4C0E A;  4AP2 A;  5AJL A;  4HRL A;  3Q9U C;  4N39 A;  1MJ0 A;  4JPS A;  5A6C A;  4N2S A;  2OVF A;  4XKC A;  2E2E A;  1FPP A;  3PDN A;  2AVP A;  3DRA A;  3RJV A;  4FC8 A;  4LEU A;  2CHW A;  2XRZ A;  5ENQ D;  5FJY A;  2DVW A;  4BTB A;  2YHE A;  4ME2 A;  3TWW A;  5ENS D;  4AXH A;  3RK6 A;  4U63 A;  3G2V A;  3NQP A;  4RSY A;  4P29 A;  5AAO A;  4GZ6 A;  3ABK E;  3RKV A;  1SA5 A;  2WXI A;  1SVX A;  2WXR A;  2GRQ B;  3LEW A;  3OXF A;  2V0P A;  5KBA A;  4I6E A;  2EIN E;  4GTV A;  4GTP A;  3ULE G;  1H2V C;  1DVP A;  2I1J A;  1NP7 A;  2NSZ A;  3T8K A;  3IV0 A;  1YMP A;  5KNG A;  2WPV A;  3APC A;  3Q5M A;  1WAO 1;  4GU5 A;  2DYS E;  4U96 D;  2P9L G;  3ZYQ A;  2LUH A;  2MYO A;  3MJW A;  3MKQ B;  4PUC A;  4C48 B;  3ZRH A;  2Y4U A;  3TXN A;  3C3O A;  3JYS A;  3LYA A;  1E90 A;  4FJZ A;  1E7V A;  1Y8M A;  1RW2 A;  2IJG X;  1MX4 A;  4FHK A;  5ANR A;  3FUJ A;  5EDS A;  3PEV B;  4U0Z A;  3Q73 A;  4K5A B;  3T9K A;  2R03 A;  3VLE A;  2XPI A;  4J7W A;  3MGB A;  3E32 A;  2R2L A;  3CQC B;  2X6J A;  4CT4 A;  3D9J A;  4KVM A;  1HO8 A;  4V3I A;  4G1T A;  2AXZ A;  4MKT A;  2Y4T A;  4BET A;  4U8Y D;  1Z3X A;  3EHQ A;  5EN5 D;  4GA1 A;  4DUI A;  4DX2 A;  1A17 A;  2WQH A;  3UT8 A;  4BFR A;  2VSO E;  3ML9 A;  1ELW A;  5KJK A;  4IN3 B;  4A3T A;  4YDO A;  2GRO B;  4F1P A;  1KT0 A;  2C2L A;  1WM5 A;  5DBK A;  3ASH A;  4YDE A;  4RG6 A;  2OVB A;  3L13 A;  3CK9 A;  3E37 A;  2XS1 A;  1LD7 A;  5KJM A;  2V5Q C;  1HG2 A;  3PNL B;  4K03 A;  2P9S G;  2X38 A;  2CHX A;  1UJK A;  1XNF A;  5HI7 A;  4URK A;  3APF A;  2WMN A;  3V2O A;  2QC9 A;  2VSY A;  3DSS A; 
#chains in the Genus database with same CATH homology
 1UW4 B;  2WXN A;  3CVV A;  2FBN A;  2XGO A;  2GRM A;  2ION A;  5DIZ A;  2UY1 A;  3L22 A;  4IUL A;  3CHO A;  4U07 A;  3URZ A;  1HF8 A;  2YQ8 A;  4CCA A;  3EHN A;  4LRZ A;  1W3B A;  4AEZ C;  2WXQ A;  3QJZ A;  1YA0 A;  3PS6 A;  1Z6T A;  3FTU A;  3G2S A;  3MA5 A;  2V5F A;  4I6G A;  3PRE A;  2J08 A;  3FTV A;  4FP7 A;  5D0Q D;  4APO A;  3L54 A;  4H7X A;  2AXV A;  2IOS A;  2XEV A;  4I9C A;  2DBA A;  3GZ1 A;  4GML A;  4W9R A;  1WY6 A;  3VLD A;  2XGM A;  1QZ2 A;  2UWJ G;  3LS8 A;  3Q4A B;  3L08 A;  4G11 A;  2WQ7 A;  1TJF A;  3Q15 A;  4FAD A;  2I2O A;  1OWN A;  3ZVV A;  2MRI A;  2VGX B;  3QB2 A;  4UWG A;  3R9A B;  3ASD A;  1U3C A;  4ILI A;  3UX4 A;  4DK5 A;  1N54 A;  2OND A;  3SZ7 A;  5FQ4 A;  3JCK C;  5CMW A;  4GYY A;  4LER A;  1HH8 A;  3C98 A;  4B89 A;  4BX8 A;  2LAI A;  4WAF A;  3FHE A;  2VJ8 A;  3FTS A;  4XKB A;  1HX8 A;  4B8C B;  3BG1 B;  3CEQ A;  3FEX A;  3RU0 A;  3I4R B;  2XHE A;  3UPV A;  3FH7 A;  3CVU A;  1ZBP A;  5EX3 A;  3FP3 A;  3SI5 A;  2Q7F A;  4OYS A;  2A4Z A;  4TRQ A;  3CV0 A;  4XX5 A;  4BT8 A;  1U3D A;  4CGW A;  3CVX A;  1DNP A;  3CVL A;  4ANU A;  4KVO A;  3TG5 A;  3S2A A;  3CQG B;  3MV2 B;  5AYW D;  3CVW A;  4BY6 A;  2M63 A;  3CSF A;  4LUN U;  4E85 A;  3QWV A;  4I1A A;  2J09 A;  3QAQ A;  5ANL A;  4ILH B;  2YIN A;  4E6H A;  2BF0 X;  2NXP A;  3IHV A;  3KEZ A;  5A7D B;  4UWF A;  1EF1 C;  4L2Y A;  3LKU A;  2C0M A;  4NQ0 A;  3MKQ A;  3EIJ A;  4CDM A;  1IYG A;  2DCP A;  4DPR A;  3FU6 A;  3KD7 A;  1HU3 A;  4NRH B;  4CDR A;  3UT7 A;  4EBA G;  3R7Q A;  5BPP A;  2OOE A;  2X6K A;  1E8Z A;  1HZ4 A;  3I4G A;  3JUI A;  4AY5 A;  3QOU A;  3ZW3 A;  3HYM B;  3P2B A;  3PEU B;  4I1O B;  1OWM A;  2QY7 A;  1E7U A;  3LCA A;  4GCO A;  4BT9 A;  1XGW A;  2XQ0 A;  3PVL A;  3IEG A;  2RG8 A;  2IQC A;  5JHA A;  2L6J A;  2X6F A;  3CVY A;  5C2Y A;  3S7J A;  5JJ7 A;  1SZ9 A;  3SHF A;  3FEY A;  4KYO B;  4Q94 A;  3QAR A;  4J8F A;  3WXX A;  3EHM A;  1L5J A;  3FU0 A;  4APF A;  2XRY A;  3EJN A;  4HOQ A;  4YND A;  3ASF A;  3ONL A;  1IQU A;  1UN8 A;  4A3V A;  4G26 A;  3BEE A;  1OWL A;  5AJD A;  2LO6 A;  3IKO B;  2CHZ A;  3P1U A;  4FJY A;  3EIQ C;  2KC7 A;  2WXG A;  2J9Q A;  3PZD A;  3QWW A;  4LCT A;  4AV7 A;  4ILG A;  2WMO A;  1JWG A;  3B7R L;  2DIW A;  3CLJ A;  3FUL A;  4GZD A;  2YNQ A;  4GZC A;  3QKY A;  3MEK A;  4FHJ A;  3I3N A;  3OXL A;  1PY1 A;  3DPD A;  1PC2 A;  1JWF A;  2A5U A;  3BG0 B;  1EDU A;  3L17 A;  2GW1 A;  1ELK A;  3LDZ A;  4GMJ A;  4CT0 A;  2L0T B;  1FVH A;  4IYP A;  5CCM A;  3FUH A;  3CKC A;  3ONK A;  4WND A;  4EPZ A;  4UQX A;  4N2Q A;  1SZA A;  2X6H A;  3FFL A;  3OTN A;  3SNX A;  2UY1 B;  1KT1 A;  3FH5 A;  4BTA A;  3ZIM A;  1H0A A;  1E8W A;  3APD A;  2PL2 A;  2WXH A;  2VGY A;  1QNF A;  5FQ6 A;  5LX8 A;  1OWO A;  5LCW C;  3N71 A;  2KZT B;  3ASG A;  1IHG A;  4DI3 A;  4AVX A;  4UI9 C;  3UMV A;  3U3W A;  4N3C A;  3D9L A;  1INZ A;  4GZ5 A;  2KAT A;  2WXM A;  5JJ6 A;  2X6I A;  5FZR A;  4DI4 A;  3ZYL A;  4KBQ A;  4ATG A;  3FUM A;  2HO1 A;  3PUK A;  2V4L A;  4JHR A;  2HM8 A;  2KCL A;  4N3A A;  1BPO A;  3HVE A;  3NF1 A;  4EBA A;  4XZ4 A;  3B7U X;  4PS8 A;  3RO2 A;  5FZS A;  4XI9 A;  1NA3 A;  4I2Z A;  4D10 C;  3R7R A;  3FTZ A;  2I6H A;  4AY6 A;  4WNF A;  1E96 B;  4GB9 A;  2WXP A;  3FDH A;  3LPZ A;  2I9C A;  3ZHE A;  4EZL A;  4PDX A;  3ESL A;  4XI0 A;  3FUE A;  4J8E A;  3O4Z A;  1HXI A;  2FI7 A;  2AXU A;  4WNE A;  4AOF A;  4L1B A;  4NUR A;  3SGH A;  5LOZ A;  1MHQ A;  3RIB A;  3D9K A;  2C0L A;  5LCW J;  3MYV A;  3ZYK A;  2E0I A;  4N3B A;  3S7D A;  2WQ6 A;  4UI9 J;  5ARF A;  4WWN A;  4GYW A;  4G2V A;  3S7B A;  3TL5 A;  3GZ2 A;  4FLH A;  4WWP A;  5BNW A;  2WM9 A;  1JPL A;  4JXT A;  5E75 A;  2VTB A;  3ENE A;  5FWQ A;  2J4B A;  2VSX E;  3S7F A;  5CCL A;  4JW1 A;  4U0S A;  3TGO A;  5LP0 A;  4DLO A;  4EZK A;  5BW8 C;  1TEZ A;  1E8X A;  3FU3 A;  4A1G A;  4AJW A;  3CHS A;  2VQ2 A;  3CVQ A;  5FQ8 A;  2LSV A;  3FTX A;  3ZYM A;  5G05 C;  2PM6 A;  1ELR A;  3GW4 A;  3K9I A;  3SBS A;  1HFA A;  3AS5 A;  4GCN A;  3SF4 A;  1B89 A;  2JLB A;  4KMO A;  5FQ7 A;  3TJP A;  3FTW A;  1H6K A;  3UQ3 A;  3VTX A;  3D9O A;  3PNT B;  2GGF A;  3D9I A;  3Q49 B;  5KJN A;  4TUU A;  1UJJ A;  4UWK A;  3SD5 A;  4I17 A;  4CRW A;  3T8M A;  3G2W A;  5J90 A;  4GPK A;  4KXK B;  3ZFW A;  3TG4 A;  3PUJ A;  4B0Z A;  2XPZ A;  3QNK A;  4JEU A;  4ACK A;  4ACL A;  4EZJ A;  2L9B A;  3CIA A;  4UWL A;  4WUY A;  4JL0 A;  4BX9 A;  5LFA A;  2WXL A;  3MCX A;  4Q69 A;  5T3R A;  5A23 A;  3MX3 A;  1PAQ A;  3LJ3 A;  4JA7 A;  3TAX A;  4A1S A;  4A55 A;  3L6A A;  4HOR A;  5FTP A;  2LAH A;  3ZPJ A;  4F7A A;  2GRL A;  5E76 A;  3Q47 B;  3JQ0 A;  3LY8 A;  3OXG A;  3U4T A;  3U9W A;  4UI9 K;  3NZU A;  5BV1 A;  3L16 A;  2AWI A;  4G25 A;  4HOT A;  4C0E A;  4C9B B;  4AP2 A;  4ANX A;  3RO3 A;  5AJL A;  3CHM A;  4XIF A;  4N39 A;  5A6C A;  2MHK A;  4JPS A;  4JEH A;  5G05 J;  2FF4 A;  2RD0 A;  4N2S A;  2OVF A;  4XKC A;  2KM4 A;  2I1K A;  2E2E A;  3PH0 C;  3SBT B;  3B7S A;  3HDX A;  3CK7 A;  3PDN A;  5AIJ A;  2QFC A;  4RG9 A;  2WXK A;  1NA0 A;  3IBE A;  2WXJ A;  5ARG A;  2WXO A;  2AVP A;  3QDN A;  3MV3 B;  3MZL B;  5CMY A;  3UT4 A;  3RJV A;  4FC8 A;  4PS3 A;  4LEU A;  2CHW A;  4AIF A;  2MOW A;  2XCC A;  4NAC A;  3TXM A;  1GW6 A;  3KAE A;  3CGH A;  4J8D A;  1EYH A;  4ANW A;  2XRZ A;  1OUV A;  1KLX A;  1S0P A;  2HR2 A;  2IFU A;  3LY7 A;  5FJY A;  4BTB A;  2YHE A;  4ME2 A;  4J0U A;  5HQ8 A;  1JUQ A;  1P5Q A;  4H7Y A;  4AXH A;  3RK6 A;  1HS6 A;  4U63 A;  4B8A A;  2LSU A;  3G2V A;  3NQP A;  4UQY A;  3T5V A;  2FEZ A;  4HVB A;  3AU4 A;  3G2T A;  3HVE B;  4HS2 A;  4RSY A;  4P29 A;  1TJC A;  3OAW A;  4I2W A;  1MQS A;  2ZU6 B;  4GZ6 A;  2WXF A;  4J8S A;  1IQR A;  1FVF A;  3RKV A;  3D9M A;  4HOS A;  2FUL A;  2WXI A;  3LVQ E;  4FUL A;  2P58 C;  4JZY A;  1EPU A;  3FU5 A;  3LVR E;  4CEM A;  2WXR A;  3GYZ A;  3LY9 A;  3ZHE B;  3LEW A;  4MRU A;  2Y3A A;  3ML8 A;  3OXF A;  3PE4 A;  4PH4 B;  3AU5 A;  4OVV A;  4C0M A;  4QFV A;  2V0P A;  4BWR A;  4I6E A;  4F1S A;  4GAA A;  5KCM A;  4L23 A;  3CHP A;  3QK0 A;  2CFU A;  5ENN A;  1H2V C;  3CHQ A;  1DVP A;  5G2N A;  1SQM A;  2X3M A;  2I1J A;  3FUN A;  1H2T C;  1H2U A;  1NP7 A;  2NSZ A;  5JHB A;  1Y6I A;  2VYI A;  3ESK A;  5BT1 A;  1E8Y A;  5T8I A;  4U04 A;  1HE8 A;  3IV0 A;  4JHJ A;  2WPV A;  4Y6W A;  4F53 A;  3APC A;  3D9P A;  2J49 A;  3Q5M A;  2KCV A;  1WAO 1;  2VTB B;  4O6F A;  4JC8 A;  4GU5 A;  2KCK A;  5FT9 A;  2KZT A;  5T4Y A;  3CHR A;  2J07 A;  5JJT A;  4HOU A;  2PZI A;  2PQR A;  2J4D A;  4ANV A;  3PRZ A;  4DLQ A;  3T5X A;  4IRU A;  5KJL A;  1OWP A;  3ZYQ A;  1N52 A;  3CVN A;  3MJW A;  4FU3 A;  2IF4 A;  3MKQ B;  4HFG A;  4PUC A;  3FUD A;  2ILR A;  2V8S E;  3ZRH A;  2Y4U A;  3TXN A;  2HYZ A;  3MKR A;  2PM7 A;  3JYS A;  5BUZ A;  3B7T A;  4N5C A;  3LYA A;  4YVO A;  1NZN A;  1E90 A;  4FJZ A;  3ZGQ A;  3D3M A;  2XCB A;  3I5P A;  1E7V A;  2CG3 A;  3FUF A;  1Y8M A;  1Z3Y A;  3ZEF A;  4L2L A;  4U0U A;  3E4B A;  3CR3 A;  4JHK A;  4B94 A;  2IJG X;  3CVP A;  2VGX A;  3QC1 A;  4FHK A;  5ANR A;  3FUI A;  3U64 A;  3VTY A;  5EKQ D;  3FUJ A;  5EDS A;  4K0R A;  3FTY A;  4AM9 A;  2XGS A;  3PEV B;  3SFZ A;  4CGV A;  4U0Z A;  4UQZ A;  4WNG A;  1VDY A;  2OV8 A;  4R7L A;  2YHC A;  3VLE A;  3EDT B;  4CDN A;  2XPI A;  2L0I A;  2R59 A;  5C1D A;  1UN9 A;  4J6I A;  4GA0 A;  3MGB A;  4Y6C A;  1H19 A;  3CQC B;  4F3V A;  5AEN A;  2R17 C;  2X6J A;  3LXU X;  4CT4 A;  3D9J A;  2LNI A;  4FLB A;  4I1M A;  4KVM A;  4EEC A;  3FY4 A;  1HO8 A;  3KS2 A;  4I43 A;  4V3I A;  4G1T A;  4ABN A;  3FH8 A;  3FWV A;  2AXZ A;  4MKT A;  4RVB A;  2Y4T A;  4MS6 A;  3HHM A;  5G55 A;  4EQF A;  1Z3X A;  2BTD A;  4JA9 A;  4UWH A;  3VLF A;  2NC9 A;  5BV0 A;  4DJA A;  3FUK A;  1QQE A;  3UUX A;  4HLE A;  4GA1 A;  4KT6 B;  4TV3 A;  5CHE E;  5D0O D;  1A17 A;  3GZS A;  4GZ3 A;  1FCH A;  2PQN A;  1UG3 A;  4KZC A;  2WQH A;  5G04 C;  3PE3 A;  4MLP A;  3UT8 A;  4BFR A;  2WB2 A;  2VSO E;  3HIZ A;  3JQ1 A;  3ML9 A;  1HG5 A;  4PS7 A;  1ELW A;  5KJK A;  3ULQ A;  5M72 A;  4OVU A;  4YVQ C;  4IN3 B;  4A3T A;  2R5S A;  3B13 A;  2VSN A;  1KT0 A;  4JVS A;  4XE0 A;  5EX0 A;  2C2L A;  1WM5 A;  1ZU2 A;  3RRU A;  5DBK A;  3G2U A;  3RRM B;  3ASH A;  2BUG A;  3CST A;  3D9N A;  4I6J A;  4RG6 A;  2XPY A;  2OVB A;  2AW6 A;  3CK8 A;  4G24 A;  3L13 A;  4L7T A;  3CK9 A;  2IOL A;  3NZS A;  4BSX A;  4KZ0 A;  5FZQ A;  2CFZ A;  3ZXS A;  3ZN3 A;  3DBS A;  5KJM A;  4Q96 A;  2FO7 A;  4GA2 A;  1HG2 A;  3O48 A;  4I9E A;  3PNL B;  4K03 A;  2WVI A;  2IU1 A;  3AS8 A;  2X38 A;  1LF8 A;  2CHX A;  4HXI A;  4U8H A;  1UJK A;  4FA6 A;  3AS4 A;  1XNF A;  4WWO A;  2EQX A;  3QWP A;  2CG2 A;  5HI7 A;  3IHY A;  3APF A;  3RRN B;  2WMN A;  3CKB A;  5G04 J;  4URK A;  5J08 A;  4G23 A;  4M3O A;  2JEK A;  2VSY A;  1X5B A;  3U66 A;  4GYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...