1O07A

Crystal structure of the complex between q120l/y150e mutant of ampc and a beta-lactam inhibitor (mxg)
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
358
structure length
355
Chain Sequence
b'APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLLVPDEVKSSSDLLRFYQNWQPAWAPGTQRLEANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSISDNKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structural Aspects for Evolution of beta-Lactamases from Penicillin-Binding Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 114
structure length 355
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1o07A00
3HLWA 1K57C 4WYYA 3MXRA 5HARA 2JCHA 1QMEA 5CTMA 2ZQCA 4ZBEA 3P98A 4FSFA 1GHMA 3ZVTA 1XA1A 3NC8A 3AGFA 4IVKA 3OCLA 3UE1A 5FAOA 4ZDXA 4JKTA 3IT9A 4S2LA 5DTKA 3SH9A 4R0QA 3MZDA 1IKIA 1J9MA 3SOIA 1K4FA 3P09A 4S2KA 3V3RA 3V39A 3BM6A 3ZFZA 4Y0TA 4B4ZA 2ZMAA 3TOIA 4IVIA 5A90A 5HW3A 2PU2A 1JWPA 1XGIA 4X68A 3BFDA 3FV7A 4QD4A 5U47A 5FI2A 3O86A 5I94A 4DDSA 2BG1A 4WEKA 4H8RA 5JYOA 1IELA 1LL5A 4E3KA 5GLBA 2OSUA 4XXRA 4K0XA 4M3KA 4B88A 4JXWA 5GHZA 3MXSA 5J8XA 2Y2PA 4JPMA 4KG5A 3V3SA 1K54C 1HVBA 2C5WB 5FSRA 4OLDA 2VGJA 3OC2A 3BLSA 3ZG7B 3BEBA 1BSGA 4JXVA 1GHPA 1K25A 3HLGA 3N7WA 3HUNA 3BYDA 4GNUA 4WZ5C 5FA7A 5M18A 4X56A 3VP3A 2CC1A 3ZNTA 1EROA 1ES3A 3W4OA 1SKFA 1ES5A 2Y2LA 4N1XA 2DNSA 4X53A 2ZC6B 1IKGA 1Y54A 2ZLYA 3MZEA 4KQQA 4KZ7A 4KQRA 3SS3A 4EQIA 4QB8A 3CG5A 2EFUA 2XH9A 3G31A 2Y2NA 1VQQA 3GTCA 4KENB 3N6IA 5KZHA 1TVFA 4BD0A 3G32A 4GKUA 4GOGA 1TDLA 1PZPA 3GR2A 3UO9A 4E6WA 3Q7VB 3Q82A 4DXBA 5EOOA 3M2KA 5FQIA 2DRWA 4A5RA 2XFTA 4HEFA 3SH7A 2V2FF 4KZ3A 5M1AA 4LENA 5HAIA 5HL1A 1MWRA 4R23A 3S1YA 2HP5A 1K56D 2RL3A 3PBOA 4Y0OA 1YT4A 1MBLA 5A91A 2WZXA 3EQVA 2X01A 3Q7VA 5HAQA 4BL2A 4OPQA 3BFFA 3O88A 3WS2A 2OLUA 4LV2A 1CI9A 3NDEA 3W8KA 1IYPA 3VMAA 2WGWB 4CJNA 4S2OA 1YQSA 3C5AA 4Z9QA 2QMIA 3FKVA 2XF3A 5HFOA 4OQIA 5AQ9A 2RCXA 1NJ4A 5A93A 3WWXA 4DE1A 1N4OA 3RJUA 2QZ6A 3DTMA 2H0YA 5CEBA 2Y2HA 2XEPA 1RP5A 5FASA 2IWDA 1FR1A 1JWZA 5CGXA 1L2SA 1FCNA 1PIOA 3IXGA 4BJPA 3A3EA 1RGYA 5TR7A 1ZG6A 4UAAA 3SS5A 4MBHA 2V1ZA 2WAFA 3O3VA 3LY3A 1E4DA 4C6YA 1KVMA 4GD6A 1FCOA 5FQKA 1KE3A 1BULA 2HPBA 2A49A 1K4EA 3CMZA 1JVJA 1IYOA 4OP5A 4P0MA 3ZVWA 3HVFA 5A92A 1G6AA 4DRTA 4FH4A 3ZNYA 1ES4A 3VP2A 1H8ZA 2Z2LB 3VP0A 1PYYA 3GV9A 4PM8A 2ZJ9A 3UN7A 3IXDA 4E3MA 1I2SA 1G68A 5EVIC 1K54A 4KZ4A 2ZC7A 3IHBA 4L0LA 4PMAA 1GCEA 4Q8IA 5CHUA 1BUEA 3IH8A 4WZ5A 5EPHA 1L0DA 5DF9A 5FATA 4JF4A 3UE0A 2V20A 3WRTA 4BQMA 2FFFB 4MEZA 5E2FA 1EI5A 2FFYA 1ESUA 1ZKJA 5F1FA 2XR0A 3ZG0A 1FCMA 1N9BA 3FZCA 4N1HA 5GLAA 3RXXA 2ZQ9A 4JXGA 5FQQA 1TDGA 2Y2MA 3V50A 4HESA 3ZCZA 3AGDA 2HDSA 2ZM0A 2EXBA 3VOYA 4ID4A 5FI7A 4U3TA 1ALQA 5F1GA 4LCLA 3C4PA 4BLMA 1LHYA 2IWBA 2ZM8A 3NDGA 2WGIA 3BECA 4WM9A 4DE0A 3NCKA 5CGWA 3NI9A 3E2KA 5F83A 1CEGA 5F82A 3PBRA 4WMCA 3UPNA 1Q2QA 5CECA 2G2WA 2Y91A 1E3UA 1XA7A 3GQZA 2IWCA 1XGJA 2WAEA 3Q7ZA 3NY4A 4KG6A 4MLLA 1LI0A 4OKPA 4IBRA 3VSLA 3HLBA 4YINA 1KGEA 4HBTA 5GHXA 5TGFA 4N9KA 4OP8A 1YLTA 4GD8A 4MNRA 2Y59A 3PBSA 4IBXA 3MBZA 5EOEA 3UPPA 3VP4A 4OOMA 4BENA 2PBYA 3E2LA 3M6BA 3IH9A 4LV1A 1NZOA 4JBFA 3EQUA 3OZHA 4UA9A 4DXCA 4PM9A 3BLMA 3ITBA 4S2NC 2VGKA 1ERQA 5FQJA 4CPKA 4OOYA 1Z6FA 2ZC3B 4FCFA 4DE3A 5G18A 1MY8A 2ZD8A 3LCEA 2B5RA 4UA6A 3GRJA 5E2EA 4WEJA 3W4PA 1W7FA 3HLEA 3DWZA 4NK3A 4GN2A 1XP4A 4OH0A 4B4XA 4X55A 1MWTA 5EVIB 2EX8A 5CHMA 4RX2A 4EV4A 4KZ5A 2Y55A 3DW0A 4RX3A 1RCJA 2Y2KA 3ISGA 2Z2MB 2WZZA 2ZM2A 3ZG9B 3UNWA 4BL3A 2J9PA 3BRMA 4QY6A 2WGVA 1AXBA 1KVLA 2GDNA 2Y2OA 1ZG4A 5GLCA 1BLCA 4FH2A 5EVIA 4Y0UA 1JTDA 3CZDA 4DE2A 1BZAA 1S6RA 5GHYA 3MZFA 2JC7A 5TFQA 1ES2A 4UHUA 4R1GA 1W8QA 3G30A 3UY6A 4S2IA 1ESIA 2XLNA 1SHVA 4JLFA 5DTSA 1ONGA 4KZ6A 1NXYA 1M6KA 3IWOA 5L2FA 2ZQ7A 2Y2QA 3C4OA 4R3JA 1IYSA 3D4FA 1PW8A 4FD8A 3WRZA 3MFDA 4RVAA 1YLWA 4GB7A 4LV3A 5E2HA 1KDWA 1KDSA 3QNBA 1IYQA 5FQ9A 3G2YA 3QHYA 3ZG8B 1I5QA 1VM1A 4QHCA 4WMCD 5BOHA 3PBTA 4IEDA 3BFGA 4PM6A 3OCNA 3LEZA 1DY6A 1E3UD 2WUQA 3ZHHA 4E3NA 2PU4A 5DF8A 3LY4A 4MBKA 4KZ8A 2HDRA 1SCWA 3O87A 2OV5A 4P85A 4JXSA 4PM5A 2Y2IA 5CHJA 1S0WA 5CTNA 4EBLA 2G2UA 5D3OA 1H8YA 1NZUA 1WE4A 4U0TA 2WKIA 5KSHA 4OVDA 3GSGA 4WBGA 4ZTKA 3FKWA 1FOFA 1YLZA 3GMWA 3OPPA 4PM7A 5EUAA 2XD5A 3UE3A 3FYZA 3UDFA 5GL9A 4OOLA 1YLPA 3VP1A 3C7VA 3PAGA 1BLSA 1BLPA 3G35A 3ZDJA 3OPRA 4E3JA 5AQBA 1DJAA 1MWUA 1OMEA 1BT5A 4E3IA 4S2NA 2WADA 1CI8A 3IF6C 4NETA 3N8SA 3PAEA 5FQMA 3G34A 3ZG5A 3HBRA 4K91A 2EFXA 1SDEA 4KQOA 4OQ0A 4EWFA 3Q81A 4D2OA 3UPOA 4P6BA 4UA7A 3IF5A 2R9XA 1M40A 2ZQAA 1C3BA 5HAPA 2DCFA 2EX9A 3IWIA 2HDUA 4EUZA 4KZBA 1NRFA 1HTZA 2H10A 4S2MA 1XXMA 2XDMA 2ZQ8A 4R4RA 2ZC5B 2R9WA 5CERA 1PW1A 1LI9A 2HDQA 4KZAA 2C6WB 3BFEA 1O7EA 4RYEA 2P74A 1YLYA 2HP6A 3ITAA 3M6HA 3HUMA 4P87A 1HZOA 3FWLA 1SDNA 5EVID 1JTGA 5E2GA 3ZGAB 3DWKA 2WK0A 1L0EA 2Y2JA 3A3IA 3HL9A 3IXBA 3Q07A 5CRFA 3B3XA 1JWVA 1H5XA 5AQ7A 1YMSA 4DKIA 1K55C 3N8LA 3SS4A 2A3UA 4WZ4A 5EE8A 4U0XA 4O7DA 2X71A 3OPHA 4DF6A 4C3QA 1E25A 4R4SA 4EBNA 3LO7A 2EX6A 3WS0A 1RGZA 5E43A 2BLSA 1PWDA 1KGFA 1DJBA 4XUXA 1NYMA 3C7UA 1L0GA 4MBFA 1W5DA 4GDBA 2J8YA 4WELA 2JBFA 3W4QA 1QMFA 2ZC4B 1ERMA 4S2PA 2XGNA 4OPRA 1I2WA 1XPBA 1HD8A 3N8RA 3WS4A 3V5MA 4OQHA 2E8IA 5FI6A 5GLDA 4GZBA 4JF6A 3WS5A 4EBPA 4X6TA 2OLVA 1FSYA 1FR6A 1IEMA 1KE4A 4LV0A 1MXOA 3GVBA 3I7JA 1MKIA 4N9LA 3TSGA 4E3LA 5EECA 2QPNA 1BLHA 2H0TA 1NY0A 1YM1A 3IF6B 1PWCA 1XX2A 4KG2A 3VFFA 3VSKA 1BTLA 4DDYA 1K6RA 4E6XA 3A3FA 2XD1A 1W79A 2UWXA 1DJCA 1ONHA 2ZQDA 3IQAA 3OPLA 1FQGA 2XK1A 1TEMA 4E3OA 4KZ9A 1GA0A 1NYYA 5CXWA 5M19A 4RA7A 3VOZA 3S22A 1K6SA 2P9VB 4ZAMA 5DTTA 2EXAA 3IF6A 4ZJ2A 1U60A 4OLGA 4C75A 4QJGA 4OPYA 3HLDA 1GHIA 1WYCA 1KE0A 5DF7A 2XQZA 4R3BA 1W8YA 4HBUA 2HP9A 2EX2A 2P9VA 3HLCA 4YFMA 5HX9A 5CEDA 1GA9A 2Y4AA 1YLJA 5DVAA 5FDHA 3S4XA 4OQGA 4BD1A 2WYXA 4ZJ1A 2Q9MA 3PBQA 1CK3A 1MWSA 1XKZA 1K57A 4XUZA 1ZC2A 5KMWA 1WYBA 3RXWA 5FAPA 1K38A 1Q2PA 3BFCA 3HREA 3HUOA 3JYIA 4S2JA 5KSCA 2H5SA 2Y2GA 4LCMA 1L0FA 2XFSA 3M2JA 2WGWA 1LLBA 3TG9A 1PWGA 3IWQA 2WKEA 1FSWA 4Y7PA 3IXHA 1PI4A 1K55A 3HLFA 3PBNA 3PTEA 1PZOA 4K0WA 2WKHA 4OONA 4QU3A 4F94A 3UDIA 3G4PA 1CEFA 3A3JA 5EVLA 5FAQA 4X69A 3Q1FA 2J9OA 3IHAA 3N4IA 3MKEA 4OPZA 3SH8A 1EWZA 4N92A 3CJMA 3G2ZA 3VFHA 5CGSA 5AQAA 3WS1A 2I72A 4ZJ3A 5JYPA 1KGGA 2X02A 3UDXA 1PI5A 1O07A 3NIAA 4PPRA 3A3DA 1LL9A 4QY5A 2JE5A 1MPLA 3QNCA 1K56A 4GDNA 5IHVA 2Q9NA 3AGEA 3NBLA 2J7VA 1YMXA 4JF5A 3MKFA
chains in the Genus database with same CATH superfamily
3HLWA 4CLCB 2BTFP 3NULA 3P98A 1GHMA 3ZVTA 4BMWA 2VEAA 1W63Q 3OCLA 2IA2A 4ZDXA 3IT9A 4GHIA 1IKIA 4MN5A 3SOIA 3ZFZA 3V39A 5U47A 3FV7A 4P6ZM 4DDSA 5I94A 3UB8A 1LL5A 2XA7M 3A0VA 5GHZA 3MXSA 1TD5A 2O9BA 4KG5A 4GLQA 3V3SA 2C5WB 4EEPA 3T4TA 4WZ5C 2B02A 3LI9A 3EEHA 3BQ8A 2HV1A 3W4OA 1TS8A 1H0MA 1ES5A 3TRCA 2DMWA 4KZ7A 1IKGA 4YOFA 4KQRA 1T19A 3CG5A 2XH9A 4X1MA 4BD0A 2W27A 4GKUA 4GOGA 3F1NB 3G6OA 3GR2A 3UO9A 3Q7VB 3D3OA 4EERA 4KZ3A 2JKRM 2Z6CA 4R23A 1CQAA 1K56D 5C5KA 3T1QB 5A91A 5HAQA 4BL2A 4OPQA 4L9EA 3O88A 4LV2A 4GS9A 4I39A 3VMAA 1NRJA 5HSQA 4Z9QA 2QMIA 4EESA 1NJ4A 5A93A 3L7HA 4I3JA 3QP5A 5CEBA 2Y2HA 1F5MA 1PIOA 3A3EA 1ZG6A 3BQAA 1E4DA 4C6YA 2L1MA 2EA9A 4HIAA 1BULA 2A49A 1JVJA 4OP5A 4O0PA 3HVFA 2D01A 2WKQA 3EGDC 2W3HA 1PYYA 4MN7A 4PM8A 3UN7A 4E3MA 2W3EA 3IHBA 4HJ3A 4L0LA 1BUEA 5DF9A 1DP9A 2V20A 5E2FA 2FFYA 2B18A 5F1FA 4N1HA 4JXGA 5FQQA 4RQ9A 2EXBA 5FI7A 4U3TA 5EVEA 3T1SA 2JKGA 3SZTA 1Q2QA 2QYBA 2G2WA 2Q0OA 2Y91A 2IWCA 3Q7ZA 4OKPA 3NY4A 3VSLA 4MLLA 1LI0A 4IBRA 1KGEA 4HBTA 5DJTA 4N9KA 4OP8A 1VETB 2G7UA 3MSHA 2OWHA 4ARZA 2HJ9C 4LV1A 3CUEA 2Z6DA 4ME4A 3MF0A 4DXCA 3PYPA 1SKOA 2YKFA 5FQJA 5HWWA 5L09A 1MY8A 2ZD8A 4PHTA 4XT2A 2JKFA 5E2EA 1W7FA 3DWZA 4GN2A 4ETZA 1MWTA 3T1RA 4RX2A 3DW0A 3ISGA 2Z2MB 4BL3A 2J9PA 1KVLA 1Y28A 1FIKA 5GLCA 5EVIA 1S6RA 4G3WA 3MZFA 5TFQA 1ES2A 2XLNA 4DN0A 3D72A 5HDCA 4GJ4A 4LRZE 5DTSA 1NWZA 4KZ6A 3IWOA 2VV8A 4EEUA 3C4OA 4F3LB 1PW8A 3EEAA 1LSXA 1YLWA 4GB7A 3G2YA 3QHYA 3IS2B 4Q0HA 2JKRI 4X25A 5KIZA 1GSXA 1VM1A 3PBTA 5HWTA 4PM6A 3ZHHA 5DF8A 3E0YA 3LY4A 2HDRA 3O87A 4JXSA 2Y2IA 1S0WA 1MKMA 5CTNA 5AVEA 3T12B 4OVDA 4ZTKA 4DE3A 4PM7A 3UDFA 1N9OA 2XD5A 4OOLA 4BBTA 3VP1A 1BLSA 3ZDJA 3T4JA 1OMEA 4L9GA 3N8SA 3PAEA 3U2AA 4K91A 3RH8B 4EUVA 4UA7A 3IF5A 2R9XA 2ZQAA 3MR0A 4AFIA 3IWIA 1XXMA 2ZQ8A 3CPTA 4R4RA 1UWPX 2ZC5B 2R9WA 2HDQA 4KZAA 3BFEA 1O7EA 3F1OA 5EVID 3DWKA 3JVVA 2WK0A 3IXBA 1CF0A 1D1JA 3MQQA 2HF6A 5AQ7A 3SS4A 5EE8A 4U0XA 4O7DA 2X71A 4C3QA 3LO7A 2EX6A 5E43A 2BLSA 1DJBA 2QJ5A 2H28A 4MBFA 2ZC4B 4ZRRA 3E4OA 2OLVA 1FSYA 5DKLA 4B9OA 4E3LA 2QPNA 1NY0A 1PWCA 5DJUA 1BTLA 4DDYA 1K6RA 1XJ2A 4K08A 2XK1A 4KZ9A 1GA0A 3UB5P 3S22A 4ZAMA 1DRMA 5TBMB 4OLGA 4C75A 4EU0A 2O9CA 1GHIA 2VGLS 3KYQA 1KE0A 3F1PA 4NXBA 2K2NA 4YFMA 3S7PA 5DKKA 2KOIA 3S7OA 4ZJ1A 2A24B 1XKZA 1ZC2A 1F9IA 1S1ZA 4Y17A 1G5UA 4S2JA 5CX7A 1YKDA 1L0FA 3V67A 2WGWA 3IWQA 1OTEA 1K55A 3HLFA 1G6OA 1PZOA 3LICA 4K0WA 2WKHA 4QU3A 3BY9A 2XA7S 3A3JA 4X69A 3Q1FA 3MKEA 4OPZA 5CGSA 1TS6A 3LR4A 1ZHHB 1KGGA 2X02A 4MMNA 3U4LP 1D7EA 1PI5A 4ESPA 5HWVA 4PPRA 2JE5A 4GDNA 3QNCA 1H8MA 1MPLA 2J7VA 4GHIB 4WYYA 3MQ0A 5HARA 2ZQCA 5J3WA 2PD7A 5FAOA 3SH9A 3DTEA 1J9MA 3P09A 4S2KA 1VEUA 2ZMAA 5A90A 1JWPA 2PT7A 5FEGA 4X68A 3BFDA 2PYRA 2BG1A 1NLYA 2P04A 4E3KA 5GLBA 4XXRA 4M3KA 4B88A 5J8XA 4JPMA 2MJ6A 1HVBA 3BLSA 1JNUA 3BEBA 1BSGA 1K0KA 3HLGA 3HUNA 4GNUA 2KX6A 1FILA 3VP3A 3ZNTA 2ZL1A 1ES3A 3MQOA 1SKFA 3VE3A 4QWOA 1TF1A 2ZC6B 2ZLYA 4KQQA 3KX0X 4EQIA 2EFUA 2Y2NA 1VQQA 4DJ3A 3GTCA 4KENB 1TDLA 3MJQA 1PZPA 5EOOA 3M2KA 2DRWA 4GS9B 4HEFA 5M1AA 5HAIA 1MWRA 3S1YA 5FL3A 1OTDA 1YT4A 1MBLA 3VV4A 3EQVA 4HHDA 2OAP1 1TS0A 2A2LA 3MFXA 3DBAA 3W8KA 1IYPA 3CUEC 5AJGA 3T4SA 2RCXA 3WWXA 4DE1A 1IOUA 2QZ6A 2H0YA 1OT9A 2XEPA 4NEED 2CMNA 5TR7A 4UAAA 1PNEA 1KE3A 2PAVP 1IYOA 3P01A 5A92A 3VP2A 3VP0A 2VGLM 1I2SA 5EVIC 1K54A 2ZC7A 1LT0A 1GCEA 5CHUA 5FATA 3UE0A 2JN7A 2EWVA 4GCZA 1ESUA 1ZKJA 2V0WA 2XR0A 3FZCA 5L10A 3RXXA 4UEYA 5F69A 2Y2MA 2HDSA 2Y8HA 3CITA 1LHYA 1ACFA 2WGIA 3NCKA 3NI9A 3T1XA 4WMCA 4ARZB 1OTIA 1E3UA 1XA7A 3GQZA 1SKOB 4JGOA 5GHXA 2J80A 4GD8A 3PBSA 4IBXA 5EOEA 3MBZA 3UB9A 3UPPA 3E2LA 5G4ZA 4JBFA 1NZOA 3OZHA 2WKPA 4FUWA 3DTIA 1KOUA 1ERQA 4OOYA 5G18A 3GRJA 3W4PA 4Q0JA 4NK3A 3UB6A 4MCWA 5EVIB 4KZ5A 4GW9A 3UNWA 1AXBA 3NJAA 2Y2OA 4Y0UA 1GSWA 3CZDA 4DE2A 3K3CA 4R1GA 1ESIA 1ONGA 2ZQ7A 4Y15A 4WF0A 3D4FA 3MFDA 4IUKA 4WLAA 4RVAA 4HOIA 1KDSA 3QNBA 3T4LA 3KO6A 4WMCD 5BOHA 3E4QA 3BFGA 4IEDA 1E3UD 2WUQA 2KDKA 3UE6A 4P85A 4PM5A 4EBLA 1NZUA 3C30A 4WBGA 3OPPA 3GMWA 3UE3A 3FYZA 1YLPA 3C7VA 1Y4OA 3FG8A 3EOIA 4LLOB 1MWUA 1BT5A 4E3IA 4S2NA 4NETA 2NUPC 3G34A 3CPTB 2GX5A 2EFXA 1SDEA 4OQ0A 2EX9A 2HDUA 2O0YA 1NRFA 2H10A 3F1OB 4KUOA 4S2MA 2PDRA 2ZOHA 1PW1A 4RYEA 4HQAA 2HP6A 3HUMA 3MS6A 2PYPA 3IX4A 1D06A 3MXQA 3HL9A 3Q07A 1BYWA 5CRFA 4R70A 3B3XA 3CAXA 3ULFA 4Z1WA 1YMSA 1K55C 1S67L 4R4SA 3TW8A 2UV0E 3CWFA 4YWZA 2ZBBA 1NYMA 3B47A 1W5DA 4GDBA 2VZWA 1PFLA 3K2NA 3LEQA 3N8RA 4OQHA 2E8IA 5FI6A 4JF6A 4EBPA 1FR6A 1MXOA 3GVBA 5HD5A 1MKIA 1ZTUA 1VHMA 3TSGA 5EECA 1BLHA 2H0TA 2JHEA 2D02A 1XX2A 3VSKA 2ZQDA 4LFUA 3F1PB 4I3AA 1DP6A 5DTTA 3IF6A 1U60A 4QJGA 5EFWA 3HLDA 4I3IA 3ZYTA 5DF7A 4R3BA 3HJIA 2HP9A 2EX2A 4L9FA 3NECA 3E4PA 3HLCA 2Y4AA 3R7WA 1YLJA 4BD1A 4LRYC 1OJ5A 4H6JA 3W2ZA 5HD3A 4XUZA 1SZVA 5KMWA 1YPRA 3RXWA 1K38A 5AVFA 2XROA 1Q2PA 3JYIA 4LCMA 2XFSA 2KLIA 2QWSA 1FSWA 2WKEA 4Y7PA 3LR0A 1OJGA 2PHYA 1T1CA 2VKSA 1YSPA 3WS1A 3A0SA 4EQ1A 1MZUA 3P7NA 3UDXA 1O07A 3DAVA 3H9WA 4CQHA 1XJ6A 3B42A 2NUTC 3AGEA 3NBLA 3L9KA 4JF5A 3MKFA 5FDSA 1K57C 1OTBA 3MXRA 1VEUB 2JCHA 1J3WA 5CTMA 4ZBEA 4EETB 4FSFA 1XA1A 3NC8A 3AGFA 4IVKA 4IHQA 2HGVA 2ZOIA 2OOLA 4JKTA 5DTKA 3PXPA 1K4FA 3V3RA 3BM6A 3TOIA 5HW3A 4IVIA 2PU2A 2ZMFA 5EM0A 4LPZA 4WEKA 3IX8A 3ZQ5A 1IELA 2OSUA 4K0XA 2J3WA 2ZL1B 3KSIA 3T4QA 5J7EA 1K54C 5FSRA 2VGJA 4JXVA 1GHPA 1K25A 3N7WA 3BYDA 5FA7A 4II7A 1EROA 2V1AA 3H7WA 2DNSA 4JGRA 3MZEA 3H82A 4QB8A 3G31A 4MDZA 1TVFA 3G32A 4PAUA 1XFNA 4E6WA 2AVXA 4HI4A 3D9YA 4DXBA 5F5YA 5FQIA 4A5RA 4Q0IA 2V2FF 5L07A 3PBOA 2RL3A 2WZXA 2X01A 4HY8A 3BFFA 4O01A 2OLUA 4CLCE 1CI9A 1TS7A 4CJNA 2PD8A 3FKVA 4OQIA 5AQ9A 1N4OA 3RJUA 5EM1A 1Z09A 1FR1A 1JWZA 2M7UA 3IXGA 4BJPA 1XJ3A 1RGYA 3SS5A 4MBHA 4IUHA 1VB6A 2WAFA 3O3VA 1KVMA 1OTAA 5FQKA 3IX3A 4P0MA 3ZVWA 1G6AA 4DRTA 4FH4A 1ES4A 3A0RA 3IXDA 1G68A 1ODVA 4KZ4A 1OPXA 2XRNA 4PMAA 1N9NA 4X1LA 4Q8IA 3IH8A 3LIAA 4WN5A 4BQMA 1EI5A 1FCMA 1N9BA 5GLAA 2ZQ9A 1TDGA 3V50A 2HZ5A 3ZCZA 3AGDA 1GSVA 4ID4A 4LCLA 2IWBA 2ZM8A 3NDGA 4O8GA 5CGWA 3E2KA 5F82A 3VOLA 5CECA 3DTKA 1LSWA 2WAEA 1XGJA 4KG6A 3HLBA 1YLTA 4MNRA 4BENA 4OOMA 2PBYA 2OWJA 3EQUA 4UA9A 2INWA 3S7NA 4PM9A 5G4YA 3BLMA 3ITBA 4S2NC 2VGKA 4MN6A 3CHWP 3FPVA 2B5RA 3RTYA 4UA6A 4WEJA 1LL8A 4X55A 2EX8A 3JPUA 2WZZA 2ZM2A 3BRMA 4NKPA 2WGVA 2GDNA 3T50A 4NXFA 1ZG4A 2M7VA 1BLCA 4FH2A 1JTDA 4WUJA 1YAXA 3GECA 5GHYA 4UHUA 3UY6A 4S2IA 3C8CA 1SHVA 2LB5A 3QP6A 4YNRA 1M6KA 5L2FA 1IYSA 2QHKA 4FD8A 3OOVA 1IYQA 5FQ9A 1I5QA 4QHCA 3OCNA 3BY8A 4E3NA 3LFVA 2PU4A 4JGQA 4KZ8A 5HPFA 2W3DA 2OV5A 5HZHA 1CJFA 5CHJA 2V1BA 5D3OA 2QJ7A 3FKWA 1FOFA 1YLZA 3O5YA 5EUAA 5GL9A 5DFXA 3PAGA 3OPRA 5AQBA 1CI8A 3IF6C 5FQMA 3ZG5A 3HBRA 4KQOA 4D2OA 4P6BA 3JVUA 4KQDA 1M40A 5HAPA 2W1TA 2DCFA 3BJNA 1HLUP 4EUZA 1HTZA 3FC7A 3LR3A 3TJZC 3CLOA 1LI9A 1YLYA 3KSGA 4KUKA 3FWLA 5E2GA 1S4SA 2Y2JA 3A3IA 3LIBA 1JWVA 1H5XA 3CI6A 4HJ6A 2A3UA 4XT2B 1E25A 3GDIA 3WS0A 1RGZA 1PWDA 4BWIA 1KGFA 1L0GA 3C7UA 4QPRA 2J8YA 4WELA 1ERMA 4S2PA 2XGNA 4OPRA 1I2WA 3WS4A 4IJGA 5GLDA 4DJ2A 4GZBA 1V9YA 3WS5A 2EWWA 4LV0A 4N9LA 3BW6A 2O9AA 1X0OA 3IF6B 2P7JA 3C2WA 3VFFA 2XD1A 3IQAA 1YSQA 1DJCA 2UWXA 3OPLA 4E3OA 2VX8A 4RA7A 2EXAA 3R7WB 3LIFA 4BBVA 1WYCA 3NOTC 4H6JB 4EXOA 3IBJA 4FTXA 2GZAA 5FEFA 5J4EA 2P9VA 5CEDA 5HX9A 2J3TD 1T1AA 5HDDA 3S4XA 5IS1A 2Q9MA 3PBQA 3NOPC 2FZ0A 1UWNX 5FAPA 2PR6A 3HREA 3BFCA 2Y2GA 3UMDA 2YKHA 1PWGA 3TG9A 2K7SA 1MC0A 3PBNA 3PTEA 3UMEA 1A0KA 4OONA 2P08A 5EVLA 3LUQA 2J9OA 3IHAA 3QP2A 3IBRA 5F68A 3T4OA 4EW7A 3G2ZA 3OLOA 5AQAA 4R38A 2I72A 5JYPA 5DFYA 3NIAA 3A3DA 1LL9A 4QY5A 5A8BA 2HJEA 3K3DA 5HL6A 1QMEA 4B93A 1G28A 3UE1A 4HJ4A 4S2LA 4R0QA 1H3QA 3MZDA 4CLCA 2V0UA 4Y13A 4Y0TA 4B4ZA 2W3GA 1XGIA 4QD4A 5FI2A 3O86A 4H8RA 5JYOA 2V8FA 4JXWA 2Y2PA 3H7WB 4OLDA 3OC2A 3H82B 3ZG7B 2M1CA 5M18A 4X56A 2CC1A 2XSSA 3BWLA 5HPIA 4PKYG 2Y2LA 1DP8A 2W3FA 4N1XA 4X53A 3LI8A 1Y54A 3SS3A 3NHQA 2PR5A 3N6IA 5KZHA 4G3KA 5I5LA 3S7QA 3OBFA 4WL9A 3Q82A 1T1BA 2VA0A 2XFTA 3SH7A 4LENA 5HL1A 2HP5A 4Y0OA 3F1NA 3Q7VA 3WS2A 4BBUA 3NDEA 2WGWB 3T4KA 4S2OA 1YQSA 3C5AA 2XF3A 5HFOA 4HNBA 3DTMA 4CLCD 3QP1A 1RP5A 5FASA 2IWDA 5CGXA 2W1RA 3LGOA 1L2SA 1FCNA 4UQIS 2VV7A 2V1ZA 3LY3A 2JKTM 4GD6A 1FCOA 2HPBA 1S1YA 5MC7A 1K4EA 3CMZA 3QP8A 3PR6A 3ZNYA 5IT5A 1H8ZA 2Z2LB 1NLZA 3GV9A 5LBRA 2ZJ9A 5EV0A 2PBDP 3EGXC 1EW0A 3LR5A 4WZ5A 5EPHA 1L0DA 4JF4A 1N9LA 3WRTA 2FFFB 4MEZA 5F6AA 3ZG0A 2QKPA 4HESA 2ZM0A 3VOYA 2VV6A 1ALQA 5F1GA 3C4PA 4G3VA 4BLMA 3BECA 4WM9A 4DE0A 3LIEA 2I9VA 5F83A 1CEGA 5TJJA 3PBRA 3UPNA 4Y3IA 2L0WA 1W63M 1STZA 1XJ4A 4YINA 2B95A 5TGFA 2VLGA 2Y59A 3VP4A 3M6BA 3IH9A 2VJWA 2WKRA 2ZMVA 2O99A 5IU1A 4CPKA 1Z6FA 2ZC3B 4FCFA 1VETA 1F98A 1V9ZA 3LCEA 3HLEA 2PRFA 1OT6A 1XP4A 4OH0A 4B4XA 2J3TC 5CHMA 1P9WA 4EV4A 2Y55A 4RX3A 1RCJA 2Y2KA 3ZG9B 4QY6A 2V8CA 4Y5FA 5L8MA 3VE4A 1BZAA 4I5SA 2JC7A 1UGUA 2Y79A 1W8QA 3G30A 4JLFA 2GNXA 1NXYA 3UB7A 2Y2QA 3R4KA 4R3JA 3WRZA 4LV3A 5E2HA 1KDWA 3ZG8B 3LEZA 1DY6A 4F3LA 4HP4A 4MBKA 1SCWA 3IS2A 2G2UA 1H8YA 1WE4A 4U0TA 2WKIA 5KSHA 3GSGA 3KSFA 4HH3A 3PHYA 4FOFA 4NG2A 1BLPA 3G35A 4LGWA 4P6ZS 4E3JA 2W1TB 1DJAA 4R3AA 2WADA 4JGPA 4LRXC 2JKTI 1P97A 4EWFA 4I38A 3Q81A 3UPOA 1C3BA 5K5BA 4KZBA 4NXGA 3KYEA 2XDMA 4HH2A 3LIDA 4UQIM 3SW1A 5CERA 1L3LA 2C6WB 1S4RA 1T18A 3KYZA 2P74A 3ITAA 3M6HA 4P87A 1HZOA 1SDNA 1JTGA 3ZGAB 3C38A 1L0EA 2ACGA 1F2KA 3ICYA 4DKIA 4DMZA 3N8LA 4WZ4A 4DF6A 4EBNA 3OPHA 1IFQA 2GJ3A 4NXEA 4XUXA 2JBFA 3W4QA 1QMFA 2LB9A 1XPBA 4Y2FA 1HD8A 2V9AA 3FPWA 3RFBA 3V5MA 4E04A 3B33A 3EWKA 4X6TA 1IEMA 1KE4A 3LYXA 2W0NA 1LSVA 3I7JA 2R78A 2K31A 1YM1A 3TE8A 4KG2A 3E98A 3KSHA 4E6XA 3A3FA 1W79A 1ONHA 2BASA 1FQGA 1TEMA 5CXWA 1NYYA 5M19A 1WA9A 1P0ZA 4CLCC 3VOZA 1K6SA 1P9RA 2P9VB 1AWIA 4ZJ2A 4OPYA 3HCYA 2XQZA 4R6LA 1W8YA 4HBUA 1GA9A 5TBMA 3HJKA 5DVAA 5FDHA 4OQGA 2WYXA 4HP9A 3NOUC 1CK3A 1MWSA 1K57A 4D60A 1WYBA 3HUOA 5KSCA 2H5SA 4PKYA 2A24A 3M2JA 1LLBA 2FH5A 1S66L 3IXHA 1PI4A 4F94A 3UDIA 2E8JA 3G4PA 1CEFA 5FAQA 3N4IA 2VK3A 3SH8A 1EWZA 4N92A 3CJMA 3VFHA 4ZJ3A 3QP4A 4ETXA 2L4RA 1XFQA 1K56A 2OAQ1 5IHVA 2Q9NA 1PRQA 5HDSA 1YMXA 4M4XA 3MMHA
chains in the Genus database with same CATH topology
3HLWA 1K57C 4WYYA 3MXRA 5HARA 2JCHA 1QMEA 5CTMA 2ZQCA 4ZBEA 3P98A 4FSFA 1GHMA 3ZVTA 1XA1A 3NC8A 3AGFA 4IVKA 3OCLA 3UE1A 5FAOA 4ZDXA 4JKTA 3IT9A 4S2LA 5DTKA 3SH9A 4R0QA 3MZDA 1IKIA 1J9MA 3SOIA 1K4FA 3P09A 4S2KA 3V3RA 3V39A 3BM6A 3ZFZA 4Y0TA 4B4ZA 2ZMAA 3TOIA 4IVIA 5A90A 5HW3A 2PU2A 1JWPA 1XGIA 4X68A 3BFDA 3FV7A 4QD4A 5U47A 5FI2A 3O86A 5I94A 4DDSA 2BG1A 4WEKA 4H8RA 5JYOA 1IELA 1LL5A 4E3KA 5GLBA 2OSUA 4XXRA 4K0XA 4M3KA 4B88A 4JXWA 5GHZA 3MXSA 5J8XA 2Y2PA 4JPMA 4KG5A 3V3SA 1K54C 1HVBA 2C5WB 5FSRA 4OLDA 2VGJA 3OC2A 3BLSA 3ZG7B 3BEBA 1BSGA 4JXVA 1GHPA 1K25A 3HLGA 3N7WA 3HUNA 3BYDA 4GNUA 4WZ5C 5FA7A 5M18A 4X56A 3VP3A 2CC1A 3ZNTA 1EROA 1ES3A 3W4OA 1SKFA 1ES5A 2Y2LA 4N1XA 2DNSA 4X53A 2ZC6B 1IKGA 1Y54A 2ZLYA 3MZEA 4KQQA 4KZ7A 4KQRA 3SS3A 4EQIA 4QB8A 3CG5A 2EFUA 2XH9A 3G31A 2Y2NA 1VQQA 3GTCA 4KENB 3N6IA 5KZHA 1TVFA 4BD0A 3G32A 4GKUA 4GOGA 1TDLA 1PZPA 3GR2A 3UO9A 4E6WA 3Q7VB 3Q82A 4DXBA 5EOOA 3M2KA 5FQIA 2DRWA 4A5RA 2XFTA 4HEFA 3SH7A 2V2FF 4KZ3A 5M1AA 4LENA 5HAIA 5HL1A 1MWRA 4R23A 3S1YA 2HP5A 1K56D 2RL3A 3PBOA 4Y0OA 1YT4A 1MBLA 5A91A 2WZXA 3EQVA 2X01A 3Q7VA 5HAQA 4BL2A 4OPQA 3BFFA 3O88A 3WS2A 2OLUA 4LV2A 1CI9A 3NDEA 3W8KA 1IYPA 3VMAA 2WGWB 4CJNA 4S2OA 1YQSA 3C5AA 4Z9QA 2QMIA 3FKVA 2XF3A 5HFOA 4OQIA 5AQ9A 2RCXA 1NJ4A 5A93A 3WWXA 4DE1A 1N4OA 3RJUA 2QZ6A 3DTMA 2H0YA 5CEBA 2Y2HA 2XEPA 1RP5A 5FASA 2IWDA 1FR1A 1JWZA 5CGXA 1L2SA 1FCNA 1PIOA 3IXGA 4BJPA 3A3EA 1RGYA 5TR7A 1ZG6A 4UAAA 3SS5A 4MBHA 2V1ZA 2WAFA 3O3VA 3LY3A 1E4DA 4C6YA 1KVMA 4GD6A 1FCOA 5FQKA 1KE3A 1BULA 2HPBA 2A49A 1K4EA 3CMZA 1JVJA 1IYOA 4OP5A 4P0MA 3ZVWA 3HVFA 5A92A 1G6AA 4DRTA 4FH4A 3ZNYA 1ES4A 3VP2A 1H8ZA 2Z2LB 3VP0A 1PYYA 3GV9A 4PM8A 2ZJ9A 3UN7A 3IXDA 4E3MA 1I2SA 1G68A 5EVIC 1K54A 4KZ4A 2ZC7A 3IHBA 4L0LA 4PMAA 1GCEA 4Q8IA 5CHUA 1BUEA 3IH8A 4WZ5A 5EPHA 1L0DA 5DF9A 5FATA 4JF4A 3UE0A 2V20A 3WRTA 4BQMA 2FFFB 4MEZA 5E2FA 1EI5A 2FFYA 1ESUA 1ZKJA 5F1FA 2XR0A 3ZG0A 1FCMA 1N9BA 3FZCA 4N1HA 5GLAA 3RXXA 2ZQ9A 4JXGA 5FQQA 1TDGA 2Y2MA 3V50A 4HESA 3ZCZA 3AGDA 2HDSA 2ZM0A 2EXBA 3VOYA 4ID4A 5FI7A 4U3TA 1ALQA 5F1GA 4LCLA 3C4PA 4BLMA 1LHYA 2IWBA 2ZM8A 3NDGA 2WGIA 3BECA 4WM9A 4DE0A 3NCKA 5CGWA 3NI9A 3E2KA 5F83A 1CEGA 5F82A 3PBRA 4WMCA 3UPNA 1Q2QA 5CECA 2G2WA 2Y91A 1E3UA 1XA7A 3GQZA 2IWCA 1XGJA 2WAEA 3Q7ZA 3NY4A 4KG6A 4MLLA 1LI0A 4OKPA 4IBRA 3VSLA 3HLBA 4YINA 1KGEA 4HBTA 5GHXA 5TGFA 4N9KA 4OP8A 1YLTA 4GD8A 4MNRA 2Y59A 3PBSA 4IBXA 3MBZA 5EOEA 3UPPA 3VP4A 4OOMA 4BENA 2PBYA 3E2LA 3M6BA 3IH9A 4LV1A 1NZOA 4JBFA 3EQUA 3OZHA 4UA9A 4DXCA 4PM9A 3BLMA 3ITBA 4S2NC 2VGKA 1ERQA 5FQJA 4CPKA 4OOYA 1Z6FA 2ZC3B 4FCFA 4DE3A 5G18A 1MY8A 2ZD8A 3LCEA 2B5RA 4UA6A 3GRJA 5E2EA 4WEJA 3W4PA 1W7FA 3HLEA 3DWZA 4NK3A 4GN2A 1XP4A 4OH0A 4B4XA 4X55A 1MWTA 5EVIB 2EX8A 5CHMA 4RX2A 4EV4A 4KZ5A 2Y55A 3DW0A 4RX3A 1RCJA 2Y2KA 3ISGA 2Z2MB 2WZZA 2ZM2A 3ZG9B 3UNWA 4BL3A 2J9PA 3BRMA 4QY6A 2WGVA 1AXBA 1KVLA 2GDNA 2Y2OA 1ZG4A 5GLCA 1BLCA 4FH2A 5EVIA 4Y0UA 1JTDA 3CZDA 4DE2A 1BZAA 1S6RA 5GHYA 3MZFA 2JC7A 5TFQA 1ES2A 4UHUA 4R1GA 1W8QA 3G30A 3UY6A 4S2IA 1ESIA 2XLNA 1SHVA 4JLFA 5DTSA 1ONGA 4KZ6A 1NXYA 1M6KA 3IWOA 5L2FA 2ZQ7A 2Y2QA 3C4OA 4R3JA 1IYSA 3D4FA 1PW8A 4FD8A 3WRZA 3MFDA 4RVAA 1YLWA 4GB7A 4LV3A 5E2HA 1KDWA 1KDSA 3QNBA 1IYQA 5FQ9A 3G2YA 3QHYA 3ZG8B 1I5QA 1VM1A 4QHCA 4WMCD 5BOHA 3PBTA 4IEDA 3BFGA 4PM6A 3OCNA 3LEZA 1DY6A 1E3UD 2WUQA 3ZHHA 4E3NA 2PU4A 5DF8A 3LY4A 4MBKA 4KZ8A 2HDRA 1SCWA 3O87A 2OV5A 4P85A 4JXSA 4PM5A 2Y2IA 5CHJA 1S0WA 5CTNA 4EBLA 2G2UA 5D3OA 1H8YA 1NZUA 1WE4A 4U0TA 2WKIA 5KSHA 4OVDA 3GSGA 4WBGA 4ZTKA 3FKWA 1FOFA 1YLZA 3GMWA 3OPPA 4PM7A 5EUAA 2XD5A 3UE3A 3FYZA 3UDFA 5GL9A 4OOLA 1YLPA 3VP1A 3C7VA 3PAGA 1BLSA 1BLPA 3G35A 3ZDJA 3OPRA 4E3JA 5AQBA 1DJAA 1MWUA 1OMEA 1BT5A 4E3IA 4S2NA 2WADA 1CI8A 3IF6C 4NETA 3N8SA 3PAEA 5FQMA 3G34A 3ZG5A 3HBRA 4K91A 2EFXA 1SDEA 4KQOA 4OQ0A 4EWFA 3Q81A 4D2OA 3UPOA 4P6BA 4UA7A 3IF5A 2R9XA 1M40A 2ZQAA 1C3BA 5HAPA 2DCFA 2EX9A 3IWIA 2HDUA 4EUZA 4KZBA 1NRFA 1HTZA 2H10A 4S2MA 1XXMA 2XDMA 2ZQ8A 4R4RA 2ZC5B 2R9WA 5CERA 1PW1A 1LI9A 2HDQA 4KZAA 2C6WB 3BFEA 1O7EA 4RYEA 2P74A 1YLYA 2HP6A 3ITAA 3M6HA 3HUMA 4P87A 1HZOA 3FWLA 1SDNA 5EVID 1JTGA 5E2GA 3ZGAB 3DWKA 2WK0A 1L0EA 2Y2JA 3A3IA 3HL9A 3IXBA 3Q07A 5CRFA 3B3XA 1JWVA 1H5XA 5AQ7A 1YMSA 4DKIA 1K55C 3N8LA 3SS4A 2A3UA 4WZ4A 5EE8A 4U0XA 4O7DA 2X71A 3OPHA 4DF6A 4C3QA 1E25A 4R4SA 4EBNA 3LO7A 2EX6A 3WS0A 1RGZA 5E43A 2BLSA 1PWDA 1KGFA 1DJBA 4XUXA 1NYMA 3C7UA 1L0GA 4MBFA 1W5DA 4GDBA 2J8YA 4WELA 2JBFA 3W4QA 1QMFA 2ZC4B 1ERMA 4S2PA 2XGNA 4OPRA 1I2WA 1XPBA 1HD8A 3N8RA 3WS4A 3V5MA 4OQHA 2E8IA 5FI6A 5GLDA 4GZBA 4JF6A 3WS5A 4EBPA 4X6TA 2OLVA 1FSYA 1FR6A 1IEMA 1KE4A 4LV0A 1MXOA 3GVBA 3I7JA 1MKIA 4N9LA 3TSGA 4E3LA 5EECA 2QPNA 1BLHA 2H0TA 1NY0A 1YM1A 3IF6B 1PWCA 1XX2A 4KG2A 3VFFA 3VSKA 1BTLA 4DDYA 1K6RA 4E6XA 3A3FA 2XD1A 1W79A 2UWXA 1DJCA 1ONHA 2ZQDA 3IQAA 3OPLA 1FQGA 2XK1A 1TEMA 4E3OA 4KZ9A 1GA0A 1NYYA 5CXWA 5M19A 4RA7A 3VOZA 3S22A 1K6SA 2P9VB 4ZAMA 5DTTA 2EXAA 3IF6A 4ZJ2A 1U60A 4OLGA 4C75A 4QJGA 4OPYA 3HLDA 1GHIA 1WYCA 1KE0A 5DF7A 2XQZA 4R3BA 1W8YA 4HBUA 2HP9A 2EX2A 2P9VA 3HLCA 4YFMA 5HX9A 5CEDA 1GA9A 2Y4AA 1YLJA 5DVAA 5FDHA 3S4XA 4OQGA 4BD1A 2WYXA 4ZJ1A 2Q9MA 3PBQA 1CK3A 1MWSA 1XKZA 1K57A 4XUZA 1ZC2A 5KMWA 1WYBA 3RXWA 5FAPA 1K38A 1Q2PA 3BFCA 3HREA 3HUOA 3JYIA 4S2JA 5KSCA 2H5SA 2Y2GA 4LCMA 1L0FA 2XFSA 3M2JA 2WGWA 1LLBA 3TG9A 1PWGA 3IWQA 2WKEA 1FSWA 4Y7PA 3IXHA 1PI4A 1K55A 3HLFA 3PBNA 3PTEA 1PZOA 4K0WA 2WKHA 4OONA 4QU3A 4F94A 3UDIA 3G4PA 1CEFA 3A3JA 5EVLA 5FAQA 4X69A 3Q1FA 2J9OA 3IHAA 3N4IA 3MKEA 4OPZA 3SH8A 1EWZA 4N92A 3CJMA 3G2ZA 3VFHA 5CGSA 5AQAA 3WS1A 2I72A 4ZJ3A 5JYPA 1KGGA 2X02A 3UDXA 1PI5A 1O07A 3NIAA 4PPRA 3A3DA 1LL9A 4QY5A 2JE5A 1MPLA 3QNCA 1K56A 4GDNA 5IHVA 2Q9NA 3AGEA 3NBLA 2J7VA 1YMXA 4JF5A 3MKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HLW A;  1K57 C;  4WYY A;  3MXR A;  5HAR A;  2JCH A;  1QME A;  5CTM A;  2ZQC A;  4ZBE A;  3P98 A;  4FSF A;  1GHM A;  3ZVT A;  1XA1 A;  3NC8 A;  3AGF A;  4IVK A;  3OCL A;  3UE1 A;  5FAO A;  4ZDX A;  4JKT A;  3IT9 A;  4S2L A;  5DTK A;  3SH9 A;  4R0Q A;  3MZD A;  1IKI A;  1J9M A;  3SOI A;  1K4F A;  3P09 A;  4S2K A;  3V3R A;  3V39 A;  3BM6 A;  3ZFZ A;  4Y0T A;  4B4Z A;  2ZMA A;  3TOI A;  4IVI A;  5A90 A;  5HW3 A;  2PU2 A;  1JWP A;  1XGI A;  4X68 A;  3BFD A;  3FV7 A;  4QD4 A;  5U47 A;  5FI2 A;  3O86 A;  5I94 A;  4DDS A;  2BG1 A;  4WEK A;  4H8R A;  5JYO A;  1IEL A;  1LL5 A;  4E3K A;  5GLB A;  2OSU A;  4XXR A;  4K0X A;  4M3K A;  4B88 A;  4JXW A;  5GHZ A;  3MXS A;  5J8X A;  2Y2P A;  4JPM A;  4KG5 A;  3V3S A;  1K54 C;  1HVB A;  2C5W B;  5FSR A;  4OLD A;  2VGJ A;  3OC2 A;  3BLS A;  3ZG7 B;  3BEB A;  1BSG A;  4JXV A;  1GHP A;  1K25 A;  3HLG A;  3N7W A;  3HUN A;  3BYD A;  4GNU A;  4WZ5 C;  5FA7 A;  5M18 A;  4X56 A;  3VP3 A;  2CC1 A;  3ZNT A;  1ERO A;  1ES3 A;  3W4O A;  1SKF A;  1ES5 A;  2Y2L A;  4N1X A;  2DNS A;  4X53 A;  2ZC6 B;  1IKG A;  1Y54 A;  2ZLY A;  3MZE A;  4KQQ A;  4KZ7 A;  4KQR A;  3SS3 A;  4EQI A;  4QB8 A;  3CG5 A;  2EFU A;  2XH9 A;  3G31 A;  2Y2N A;  1VQQ A;  3GTC A;  4KEN B;  3N6I A;  5KZH A;  1TVF A;  4BD0 A;  3G32 A;  4GKU A;  4GOG A;  1TDL A;  1PZP A;  3GR2 A;  3UO9 A;  4E6W A;  3Q7V B;  3Q82 A;  4DXB A;  5EOO A;  3M2K A;  5FQI A;  2DRW A;  4A5R A;  2XFT A;  4HEF A;  3SH7 A;  2V2F F;  4KZ3 A;  5M1A A;  4LEN A;  5HAI A;  5HL1 A;  1MWR A;  4R23 A;  3S1Y A;  2HP5 A;  1K56 D;  2RL3 A;  3PBO A;  4Y0O A;  1YT4 A;  1MBL A;  5A91 A;  2WZX A;  3EQV A;  2X01 A;  3Q7V A;  5HAQ A;  4BL2 A;  4OPQ A;  3BFF A;  3O88 A;  3WS2 A;  2OLU A;  4LV2 A;  1CI9 A;  3NDE A;  3W8K A;  1IYP A;  3VMA A;  2WGW B;  4CJN A;  4S2O A;  1YQS A;  3C5A A;  4Z9Q A;  2QMI A;  3FKV A;  2XF3 A;  5HFO A;  4OQI A;  5AQ9 A;  2RCX A;  1NJ4 A;  5A93 A;  3WWX A;  4DE1 A;  1N4O A;  3RJU A;  2QZ6 A;  3DTM A;  2H0Y A;  5CEB A;  2Y2H A;  2XEP A;  1RP5 A;  5FAS A;  2IWD A;  1FR1 A;  1JWZ A;  5CGX A;  1L2S A;  1FCN A;  1PIO A;  3IXG A;  4BJP A;  3A3E A;  1RGY A;  5TR7 A;  1ZG6 A;  4UAA A;  3SS5 A;  4MBH A;  2V1Z A;  2WAF A;  3O3V A;  3LY3 A;  1E4D A;  4C6Y A;  1KVM A;  4GD6 A;  1FCO A;  5FQK A;  1KE3 A;  1BUL A;  2HPB A;  2A49 A;  1K4E A;  3CMZ A;  1JVJ A;  1IYO A;  4OP5 A;  4P0M A;  3ZVW A;  3HVF A;  5A92 A;  1G6A A;  4DRT A;  4FH4 A;  3ZNY A;  1ES4 A;  3VP2 A;  1H8Z A;  2Z2L B;  3VP0 A;  1PYY A;  3GV9 A;  4PM8 A;  2ZJ9 A;  3UN7 A;  3IXD A;  4E3M A;  1I2S A;  1G68 A;  5EVI C;  1K54 A;  4KZ4 A;  2ZC7 A;  3IHB A;  4L0L A;  4PMA A;  1GCE A;  4Q8I A;  5CHU A;  1BUE A;  3IH8 A;  4WZ5 A;  5EPH A;  1L0D A;  5DF9 A;  5FAT A;  4JF4 A;  3UE0 A;  2V20 A;  3WRT A;  4BQM A;  2FFF B;  4MEZ A;  5E2F A;  1EI5 A;  2FFY A;  1ESU A;  1ZKJ A;  5F1F A;  2XR0 A;  3ZG0 A;  1FCM A;  1N9B A;  3FZC A;  4N1H A;  5GLA A;  3RXX A;  2ZQ9 A;  4JXG A;  5FQQ A;  1TDG A;  2Y2M A;  3V50 A;  4HES A;  3ZCZ A;  3AGD A;  2HDS A;  2ZM0 A;  2EXB A;  3VOY A;  4ID4 A;  5FI7 A;  4U3T A;  1ALQ A;  5F1G A;  4LCL A;  3C4P A;  4BLM A;  1LHY A;  2IWB A;  2ZM8 A;  3NDG A;  2WGI A;  3BEC A;  4WM9 A;  4DE0 A;  3NCK A;  5CGW A;  3NI9 A;  3E2K A;  5F83 A;  1CEG A;  5F82 A;  3PBR A;  4WMC A;  3UPN A;  1Q2Q A;  5CEC A;  2G2W A;  2Y91 A;  1E3U A;  1XA7 A;  3GQZ A;  2IWC A;  1XGJ A;  2WAE A;  3Q7Z A;  3NY4 A;  4KG6 A;  4MLL A;  1LI0 A;  4OKP A;  4IBR A;  3VSL A;  3HLB A;  4YIN A;  1KGE A;  4HBT A;  5GHX A;  5TGF A;  4N9K A;  4OP8 A;  1YLT A;  4GD8 A;  4MNR A;  2Y59 A;  3PBS A;  4IBX A;  3MBZ A;  5EOE A;  3UPP A;  3VP4 A;  4OOM A;  4BEN A;  2PBY A;  3E2L A;  3M6B A;  3IH9 A;  4LV1 A;  1NZO A;  4JBF A;  3EQU A;  3OZH A;  4UA9 A;  4DXC A;  4PM9 A;  3BLM A;  3ITB A;  4S2N C;  2VGK A;  1ERQ A;  5FQJ A;  4CPK A;  4OOY A;  1Z6F A;  2ZC3 B;  4FCF A;  4DE3 A;  5G18 A;  1MY8 A;  2ZD8 A;  3LCE A;  2B5R A;  4UA6 A;  3GRJ A;  5E2E A;  4WEJ A;  3W4P A;  1W7F A;  3HLE A;  3DWZ A;  4NK3 A;  4GN2 A;  1XP4 A;  4OH0 A;  4B4X A;  4X55 A;  1MWT A;  5EVI B;  2EX8 A;  5CHM A;  4RX2 A;  4EV4 A;  4KZ5 A;  2Y55 A;  3DW0 A;  4RX3 A;  1RCJ A;  2Y2K A;  3ISG A;  2Z2M B;  2WZZ A;  2ZM2 A;  3ZG9 B;  3UNW A;  4BL3 A;  2J9P A;  3BRM A;  4QY6 A;  2WGV A;  1AXB A;  1KVL A;  2GDN A;  2Y2O A;  1ZG4 A;  5GLC A;  1BLC A;  4FH2 A;  5EVI A;  4Y0U A;  1JTD A;  3CZD A;  4DE2 A;  1BZA A;  1S6R A;  5GHY A;  3MZF A;  2JC7 A;  5TFQ A;  1ES2 A;  4UHU A;  4R1G A;  1W8Q A;  3G30 A;  3UY6 A;  4S2I A;  1ESI A;  2XLN A;  1SHV A;  4JLF A;  5DTS A;  1ONG A;  4KZ6 A;  1NXY A;  1M6K A;  3IWO A;  5L2F A;  2ZQ7 A;  2Y2Q A;  3C4O A;  4R3J A;  1IYS A;  3D4F A;  1PW8 A;  4FD8 A;  3WRZ A;  3MFD A;  4RVA A;  1YLW A;  4GB7 A;  4LV3 A;  5E2H A;  1KDW A;  1KDS A;  3QNB A;  1IYQ A;  5FQ9 A;  3G2Y A;  3QHY A;  3ZG8 B;  1I5Q A;  1VM1 A;  4QHC A;  4WMC D;  5BOH A;  3PBT A;  4IED A;  3BFG A;  4PM6 A;  3OCN A;  3LEZ A;  1DY6 A;  1E3U D;  2WUQ A;  3ZHH A;  4E3N A;  2PU4 A;  5DF8 A;  3LY4 A;  4MBK A;  4KZ8 A;  2HDR A;  1SCW A;  3O87 A;  2OV5 A;  4P85 A;  4JXS A;  4PM5 A;  2Y2I A;  5CHJ A;  1S0W A;  5CTN A;  4EBL A;  2G2U A;  5D3O A;  1H8Y A;  1NZU A;  1WE4 A;  4U0T A;  2WKI A;  5KSH A;  4OVD A;  3GSG A;  4WBG A;  4ZTK A;  3FKW A;  1FOF A;  1YLZ A;  3GMW A;  3OPP A;  4PM7 A;  5EUA A;  2XD5 A;  3UE3 A;  3FYZ A;  3UDF A;  5GL9 A;  4OOL A;  1YLP A;  3VP1 A;  3C7V A;  3PAG A;  1BLS A;  1BLP A;  3G35 A;  3ZDJ A;  3OPR A;  4E3J A;  5AQB A;  1DJA A;  1MWU A;  1OME A;  1BT5 A;  4E3I A;  4S2N A;  2WAD A;  1CI8 A;  3IF6 C;  4NET A;  3N8S A;  3PAE A;  5FQM A;  3G34 A;  3ZG5 A;  3HBR A;  4K91 A;  2EFX A;  1SDE A;  4KQO A;  4OQ0 A;  4EWF A;  3Q81 A;  4D2O A;  3UPO A;  4P6B A;  4UA7 A;  3IF5 A;  2R9X A;  1M40 A;  2ZQA A;  1C3B A;  5HAP A;  2DCF A;  2EX9 A;  3IWI A;  2HDU A;  4EUZ A;  4KZB A;  1NRF A;  1HTZ A;  2H10 A;  4S2M A;  1XXM A;  2XDM A;  2ZQ8 A;  4R4R A;  2ZC5 B;  2R9W A;  5CER A;  1PW1 A;  1LI9 A;  2HDQ A;  4KZA A;  2C6W B;  3BFE A;  1O7E A;  4RYE A;  2P74 A;  1YLY A;  2HP6 A;  3ITA A;  3M6H A;  3HUM A;  4P87 A;  1HZO A;  3FWL A;  1SDN A;  5EVI D;  1JTG A;  5E2G A;  3ZGA B;  3DWK A;  2WK0 A;  1L0E A;  2Y2J A;  3A3I A;  3HL9 A;  3IXB A;  3Q07 A;  5CRF A;  3B3X A;  1JWV A;  1H5X A;  5AQ7 A;  1YMS A;  4DKI A;  1K55 C;  3N8L A;  3SS4 A;  2A3U A;  4WZ4 A;  5EE8 A;  4U0X A;  4O7D A;  2X71 A;  3OPH A;  4DF6 A;  4C3Q A;  1E25 A;  4R4S A;  4EBN A;  3LO7 A;  2EX6 A;  3WS0 A;  1RGZ A;  5E43 A;  2BLS A;  1PWD A;  1KGF A;  1DJB A;  4XUX A;  1NYM A;  3C7U A;  1L0G A;  4MBF A;  1W5D A;  4GDB A;  2J8Y A;  4WEL A;  2JBF A;  3W4Q A;  1QMF A;  2ZC4 B;  1ERM A;  4S2P A;  2XGN A;  4OPR A;  1I2W A;  1XPB A;  1HD8 A;  3N8R A;  3WS4 A;  3V5M A;  4OQH A;  2E8I A;  5FI6 A;  5GLD A;  4GZB A;  4JF6 A;  3WS5 A;  4EBP A;  4X6T A;  2OLV A;  1FSY A;  1FR6 A;  1IEM A;  1KE4 A;  4LV0 A;  1MXO A;  3GVB A;  3I7J A;  1MKI A;  4N9L A;  3TSG A;  4E3L A;  5EEC A;  2QPN A;  1BLH A;  2H0T A;  1NY0 A;  1YM1 A;  3IF6 B;  1PWC A;  1XX2 A;  4KG2 A;  3VFF A;  3VSK A;  1BTL A;  4DDY A;  1K6R A;  4E6X A;  3A3F A;  2XD1 A;  1W79 A;  2UWX A;  1DJC A;  1ONH A;  2ZQD A;  3IQA A;  3OPL A;  1FQG A;  2XK1 A;  1TEM A;  4E3O A;  4KZ9 A;  1GA0 A;  1NYY A;  5CXW A;  5M19 A;  4RA7 A;  3VOZ A;  3S22 A;  1K6S A;  2P9V B;  4ZAM A;  5DTT A;  2EXA A;  3IF6 A;  4ZJ2 A;  1U60 A;  4OLG A;  4C75 A;  4QJG A;  4OPY A;  3HLD A;  1GHI A;  1WYC A;  1KE0 A;  5DF7 A;  2XQZ A;  4R3B A;  1W8Y A;  4HBU A;  2HP9 A;  2EX2 A;  2P9V A;  3HLC A;  4YFM A;  5HX9 A;  5CED A;  1GA9 A;  2Y4A A;  1YLJ A;  5DVA A;  5FDH A;  3S4X A;  4OQG A;  4BD1 A;  2WYX A;  4ZJ1 A;  2Q9M A;  3PBQ A;  1CK3 A;  1MWS A;  1XKZ A;  1K57 A;  4XUZ A;  1ZC2 A;  5KMW A;  1WYB A;  3RXW A;  5FAP A;  1K38 A;  1Q2P A;  3BFC A;  3HRE A;  3HUO A;  3JYI A;  4S2J A;  5KSC A;  2H5S A;  2Y2G A;  4LCM A;  1L0F A;  2XFS A;  3M2J A;  2WGW A;  1LLB A;  3TG9 A;  1PWG A;  3IWQ A;  2WKE A;  1FSW A;  4Y7P A;  3IXH A;  1PI4 A;  1K55 A;  3HLF A;  3PBN A;  3PTE A;  1PZO A;  4K0W A;  2WKH A;  4OON A;  4QU3 A;  4F94 A;  3UDI A;  3G4P A;  1CEF A;  3A3J A;  5EVL A;  5FAQ A;  4X69 A;  3Q1F A;  2J9O A;  3IHA A;  3N4I A;  3MKE A;  4OPZ A;  3SH8 A;  1EWZ A;  4N92 A;  3CJM A;  3G2Z A;  3VFH A;  5CGS A;  5AQA A;  3WS1 A;  2I72 A;  4ZJ3 A;  5JYP A;  1KGG A;  2X02 A;  3UDX A;  1PI5 A;  1O07 A;  3NIA A;  4PPR A;  3A3D A;  1LL9 A;  4QY5 A;  2JE5 A;  1MPL A;  3QNC A;  1K56 A;  4GDN A;  5IHV A;  2Q9N A;  3AGE A;  3NBL A;  2J7V A;  1YMX A;  4JF5 A;  3MKF A; 
#chains in the Genus database with same CATH topology
 3HLW A;  4CLC B;  2BTF P;  3NUL A;  3P98 A;  1GHM A;  3ZVT A;  4BMW A;  2VEA A;  1W63 Q;  3OCL A;  2IA2 A;  4ZDX A;  3IT9 A;  4GHI A;  1IKI A;  4MN5 A;  3SOI A;  3ZFZ A;  3V39 A;  5U47 A;  3FV7 A;  4P6Z M;  4DDS A;  5I94 A;  3UB8 A;  1LL5 A;  2XA7 M;  3A0V A;  5GHZ A;  3MXS A;  1TD5 A;  2O9B A;  4KG5 A;  4GLQ A;  3V3S A;  2C5W B;  4EEP A;  3T4T A;  4WZ5 C;  2B02 A;  3LI9 A;  3EEH A;  3BQ8 A;  2HV1 A;  3W4O A;  1TS8 A;  1H0M A;  1ES5 A;  3TRC A;  2DMW A;  4KZ7 A;  1IKG A;  4YOF A;  4KQR A;  1T19 A;  3CG5 A;  2XH9 A;  4X1M A;  4BD0 A;  2W27 A;  4GKU A;  4GOG A;  3F1N B;  3G6O A;  3GR2 A;  3UO9 A;  3Q7V B;  3D3O A;  4EER A;  4KZ3 A;  2JKR M;  2Z6C A;  4R23 A;  1CQA A;  1K56 D;  5C5K A;  3T1Q B;  5A91 A;  5HAQ A;  4BL2 A;  4OPQ A;  4L9E A;  3O88 A;  4LV2 A;  4GS9 A;  4I39 A;  3VMA A;  1NRJ A;  5HSQ A;  4Z9Q A;  2QMI A;  4EES A;  1NJ4 A;  5A93 A;  3L7H A;  4I3J A;  3QP5 A;  5CEB A;  2Y2H A;  1F5M A;  1PIO A;  3A3E A;  1ZG6 A;  3BQA A;  1E4D A;  4C6Y A;  2L1M A;  2EA9 A;  4HIA A;  1BUL A;  2A49 A;  1JVJ A;  4OP5 A;  4O0P A;  3HVF A;  2D01 A;  2WKQ A;  3EGD C;  2W3H A;  1PYY A;  4MN7 A;  4PM8 A;  3UN7 A;  4E3M A;  2W3E A;  3IHB A;  4HJ3 A;  4L0L A;  1BUE A;  5DF9 A;  1DP9 A;  2V20 A;  5E2F A;  2FFY A;  2B18 A;  5F1F A;  4N1H A;  4JXG A;  5FQQ A;  4RQ9 A;  2EXB A;  5FI7 A;  4U3T A;  5EVE A;  3T1S A;  2JKG A;  3SZT A;  1Q2Q A;  2QYB A;  2G2W A;  2Q0O A;  2Y91 A;  2IWC A;  3Q7Z A;  4OKP A;  3NY4 A;  3VSL A;  4MLL A;  1LI0 A;  4IBR A;  1KGE A;  4HBT A;  5DJT A;  4N9K A;  4OP8 A;  1VET B;  2G7U A;  3MSH A;  2OWH A;  4ARZ A;  2HJ9 C;  4LV1 A;  3CUE A;  2Z6D A;  4ME4 A;  3MF0 A;  4DXC A;  3PYP A;  1SKO A;  2YKF A;  5FQJ A;  5HWW A;  5L09 A;  1MY8 A;  2ZD8 A;  4PHT A;  4XT2 A;  2JKF A;  5E2E A;  1W7F A;  3DWZ A;  4GN2 A;  4ETZ A;  1MWT A;  3T1R A;  4RX2 A;  3DW0 A;  3ISG A;  2Z2M B;  4BL3 A;  2J9P A;  1KVL A;  1Y28 A;  1FIK A;  5GLC A;  5EVI A;  1S6R A;  4G3W A;  3MZF A;  5TFQ A;  1ES2 A;  2XLN A;  4DN0 A;  3D72 A;  5HDC A;  4GJ4 A;  4LRZ E;  5DTS A;  1NWZ A;  4KZ6 A;  3IWO A;  2VV8 A;  4EEU A;  3C4O A;  4F3L B;  1PW8 A;  3EEA A;  1LSX A;  1YLW A;  4GB7 A;  3G2Y A;  3QHY A;  3IS2 B;  4Q0H A;  2JKR I;  4X25 A;  5KIZ A;  1GSX A;  1VM1 A;  3PBT A;  5HWT A;  4PM6 A;  3ZHH A;  5DF8 A;  3E0Y A;  3LY4 A;  2HDR A;  3O87 A;  4JXS A;  2Y2I A;  1S0W A;  1MKM A;  5CTN A;  5AVE A;  3T12 B;  4OVD A;  4ZTK A;  4DE3 A;  4PM7 A;  3UDF A;  1N9O A;  2XD5 A;  4OOL A;  4BBT A;  3VP1 A;  1BLS A;  3ZDJ A;  3T4J A;  1OME A;  4L9G A;  3N8S A;  3PAE A;  3U2A A;  4K91 A;  3RH8 B;  4EUV A;  4UA7 A;  3IF5 A;  2R9X A;  2ZQA A;  3MR0 A;  4AFI A;  3IWI A;  1XXM A;  2ZQ8 A;  3CPT A;  4R4R A;  1UWP X;  2ZC5 B;  2R9W A;  2HDQ A;  4KZA A;  3BFE A;  1O7E A;  3F1O A;  5EVI D;  3DWK A;  3JVV A;  2WK0 A;  3IXB A;  1CF0 A;  1D1J A;  3MQQ A;  2HF6 A;  5AQ7 A;  3SS4 A;  5EE8 A;  4U0X A;  4O7D A;  2X71 A;  4C3Q A;  3LO7 A;  2EX6 A;  5E43 A;  2BLS A;  1DJB A;  2QJ5 A;  2H28 A;  4MBF A;  2ZC4 B;  4ZRR A;  3E4O A;  2OLV A;  1FSY A;  5DKL A;  4B9O A;  4E3L A;  2QPN A;  1NY0 A;  1PWC A;  5DJU A;  1BTL A;  4DDY A;  1K6R A;  1XJ2 A;  4K08 A;  2XK1 A;  4KZ9 A;  1GA0 A;  3UB5 P;  3S22 A;  4ZAM A;  1DRM A;  5TBM B;  4OLG A;  4C75 A;  4EU0 A;  2O9C A;  1GHI A;  2VGL S;  3KYQ A;  1KE0 A;  3F1P A;  4NXB A;  2K2N A;  4YFM A;  3S7P A;  5DKK A;  2KOI A;  3S7O A;  4ZJ1 A;  2A24 B;  1XKZ A;  1ZC2 A;  1F9I A;  1S1Z A;  4Y17 A;  1G5U A;  4S2J A;  5CX7 A;  1YKD A;  1L0F A;  3V67 A;  2WGW A;  3IWQ A;  1OTE A;  1K55 A;  3HLF A;  1G6O A;  1PZO A;  3LIC A;  4K0W A;  2WKH A;  4QU3 A;  3BY9 A;  2XA7 S;  3A3J A;  4X69 A;  3Q1F A;  3MKE A;  4OPZ A;  5CGS A;  1TS6 A;  3LR4 A;  1ZHH B;  1KGG A;  2X02 A;  4MMN A;  3U4L P;  1D7E A;  1PI5 A;  4ESP A;  5HWV A;  4PPR A;  2JE5 A;  4GDN A;  3QNC A;  1H8M A;  1MPL A;  2J7V A;  4GHI B;  4WYY A;  3MQ0 A;  5HAR A;  2ZQC A;  5J3W A;  2PD7 A;  5FAO A;  3SH9 A;  3DTE A;  1J9M A;  3P09 A;  4S2K A;  1VEU A;  2ZMA A;  5A90 A;  1JWP A;  2PT7 A;  5FEG A;  4X68 A;  3BFD A;  2PYR A;  2BG1 A;  1NLY A;  2P04 A;  4E3K A;  5GLB A;  4XXR A;  4M3K A;  4B88 A;  5J8X A;  4JPM A;  2MJ6 A;  1HVB A;  3BLS A;  1JNU A;  3BEB A;  1BSG A;  1K0K A;  3HLG A;  3HUN A;  4GNU A;  2KX6 A;  1FIL A;  3VP3 A;  3ZNT A;  2ZL1 A;  1ES3 A;  3MQO A;  1SKF A;  3VE3 A;  4QWO A;  1TF1 A;  2ZC6 B;  2ZLY A;  4KQQ A;  3KX0 X;  4EQI A;  2EFU A;  2Y2N A;  1VQQ A;  4DJ3 A;  3GTC A;  4KEN B;  1TDL A;  3MJQ A;  1PZP A;  5EOO A;  3M2K A;  2DRW A;  4GS9 B;  4HEF A;  5M1A A;  5HAI A;  1MWR A;  3S1Y A;  5FL3 A;  1OTD A;  1YT4 A;  1MBL A;  3VV4 A;  3EQV A;  4HHD A;  2OAP 1;  1TS0 A;  2A2L A;  3MFX A;  3DBA A;  3W8K A;  1IYP A;  3CUE C;  5AJG A;  3T4S A;  2RCX A;  3WWX A;  4DE1 A;  1IOU A;  2QZ6 A;  2H0Y A;  1OT9 A;  2XEP A;  4NEE D;  2CMN A;  5TR7 A;  4UAA A;  1PNE A;  1KE3 A;  2PAV P;  1IYO A;  3P01 A;  5A92 A;  3VP2 A;  3VP0 A;  2VGL M;  1I2S A;  5EVI C;  1K54 A;  2ZC7 A;  1LT0 A;  1GCE A;  5CHU A;  5FAT A;  3UE0 A;  2JN7 A;  2EWV A;  4GCZ A;  1ESU A;  1ZKJ A;  2V0W A;  2XR0 A;  3FZC A;  5L10 A;  3RXX A;  4UEY A;  5F69 A;  2Y2M A;  2HDS A;  2Y8H A;  3CIT A;  1LHY A;  1ACF A;  2WGI A;  3NCK A;  3NI9 A;  3T1X A;  4WMC A;  4ARZ B;  1OTI A;  1E3U A;  1XA7 A;  3GQZ A;  1SKO B;  4JGO A;  5GHX A;  2J80 A;  4GD8 A;  3PBS A;  4IBX A;  5EOE A;  3MBZ A;  3UB9 A;  3UPP A;  3E2L A;  5G4Z A;  4JBF A;  1NZO A;  3OZH A;  2WKP A;  4FUW A;  3DTI A;  1KOU A;  1ERQ A;  4OOY A;  5G18 A;  3GRJ A;  3W4P A;  4Q0J A;  4NK3 A;  3UB6 A;  4MCW A;  5EVI B;  4KZ5 A;  4GW9 A;  3UNW A;  1AXB A;  3NJA A;  2Y2O A;  4Y0U A;  1GSW A;  3CZD A;  4DE2 A;  3K3C A;  4R1G A;  1ESI A;  1ONG A;  2ZQ7 A;  4Y15 A;  4WF0 A;  3D4F A;  3MFD A;  4IUK A;  4WLA A;  4RVA A;  4HOI A;  1KDS A;  3QNB A;  3T4L A;  3KO6 A;  4WMC D;  5BOH A;  3E4Q A;  3BFG A;  4IED A;  1E3U D;  2WUQ A;  2KDK A;  3UE6 A;  4P85 A;  4PM5 A;  4EBL A;  1NZU A;  3C30 A;  4WBG A;  3OPP A;  3GMW A;  3UE3 A;  3FYZ A;  1YLP A;  3C7V A;  1Y4O A;  3FG8 A;  3EOI A;  4LLO B;  1MWU A;  1BT5 A;  4E3I A;  4S2N A;  4NET A;  2NUP C;  3G34 A;  3CPT B;  2GX5 A;  2EFX A;  1SDE A;  4OQ0 A;  2EX9 A;  2HDU A;  2O0Y A;  1NRF A;  2H10 A;  3F1O B;  4KUO A;  4S2M A;  2PDR A;  2ZOH A;  1PW1 A;  4RYE A;  4HQA A;  2HP6 A;  3HUM A;  3MS6 A;  2PYP A;  3IX4 A;  1D06 A;  3MXQ A;  3HL9 A;  3Q07 A;  1BYW A;  5CRF A;  4R70 A;  3B3X A;  3CAX A;  3ULF A;  4Z1W A;  1YMS A;  1K55 C;  1S67 L;  4R4S A;  3TW8 A;  2UV0 E;  3CWF A;  4YWZ A;  2ZBB A;  1NYM A;  3B47 A;  1W5D A;  4GDB A;  2VZW A;  1PFL A;  3K2N A;  3LEQ A;  3N8R A;  4OQH A;  2E8I A;  5FI6 A;  4JF6 A;  4EBP A;  1FR6 A;  1MXO A;  3GVB A;  5HD5 A;  1MKI A;  1ZTU A;  1VHM A;  3TSG A;  5EEC A;  1BLH A;  2H0T A;  2JHE A;  2D02 A;  1XX2 A;  3VSK A;  2ZQD A;  4LFU A;  3F1P B;  4I3A A;  1DP6 A;  5DTT A;  3IF6 A;  1U60 A;  4QJG A;  5EFW A;  3HLD A;  4I3I A;  3ZYT A;  5DF7 A;  4R3B A;  3HJI A;  2HP9 A;  2EX2 A;  4L9F A;  3NEC A;  3E4P A;  3HLC A;  2Y4A A;  3R7W A;  1YLJ A;  4BD1 A;  4LRY C;  1OJ5 A;  4H6J A;  3W2Z A;  5HD3 A;  4XUZ A;  1SZV A;  5KMW A;  1YPR A;  3RXW A;  1K38 A;  5AVF A;  2XRO A;  1Q2P A;  3JYI A;  4LCM A;  2XFS A;  2KLI A;  2QWS A;  1FSW A;  2WKE A;  4Y7P A;  3LR0 A;  1OJG A;  2PHY A;  1T1C A;  2VKS A;  1YSP A;  3WS1 A;  3A0S A;  4EQ1 A;  1MZU A;  3P7N A;  3UDX A;  1O07 A;  3DAV A;  3H9W A;  4CQH A;  1XJ6 A;  3B42 A;  2NUT C;  3AGE A;  3NBL A;  3L9K A;  4JF5 A;  3MKF A;  5FDS A;  1K57 C;  1OTB A;  3MXR A;  1VEU B;  2JCH A;  1J3W A;  5CTM A;  4ZBE A;  4EET B;  4FSF A;  1XA1 A;  3NC8 A;  3AGF A;  4IVK A;  4IHQ A;  2HGV A;  2ZOI A;  2OOL A;  4JKT A;  5DTK A;  3PXP A;  1K4F A;  3V3R A;  3BM6 A;  3TOI A;  5HW3 A;  4IVI A;  2PU2 A;  2ZMF A;  5EM0 A;  4LPZ A;  4WEK A;  3IX8 A;  3ZQ5 A;  1IEL A;  2OSU A;  4K0X A;  2J3W A;  2ZL1 B;  3KSI A;  3T4Q A;  5J7E A;  1K54 C;  5FSR A;  2VGJ A;  4JXV A;  1GHP A;  1K25 A;  3N7W A;  3BYD A;  5FA7 A;  4II7 A;  1ERO A;  2V1A A;  3H7W A;  2DNS A;  4JGR A;  3MZE A;  3H82 A;  4QB8 A;  3G31 A;  4MDZ A;  1TVF A;  3G32 A;  4PAU A;  1XFN A;  4E6W A;  2AVX A;  4HI4 A;  3D9Y A;  4DXB A;  5F5Y A;  5FQI A;  4A5R A;  4Q0I A;  2V2F F;  5L07 A;  3PBO A;  2RL3 A;  2WZX A;  2X01 A;  4HY8 A;  3BFF A;  4O01 A;  2OLU A;  4CLC E;  1CI9 A;  1TS7 A;  4CJN A;  2PD8 A;  3FKV A;  4OQI A;  5AQ9 A;  1N4O A;  3RJU A;  5EM1 A;  1Z09 A;  1FR1 A;  1JWZ A;  2M7U A;  3IXG A;  4BJP A;  1XJ3 A;  1RGY A;  3SS5 A;  4MBH A;  4IUH A;  1VB6 A;  2WAF A;  3O3V A;  1KVM A;  1OTA A;  5FQK A;  3IX3 A;  4P0M A;  3ZVW A;  1G6A A;  4DRT A;  4FH4 A;  1ES4 A;  3A0R A;  3IXD A;  1G68 A;  1ODV A;  4KZ4 A;  1OPX A;  2XRN A;  4PMA A;  1N9N A;  4X1L A;  4Q8I A;  3IH8 A;  3LIA A;  4WN5 A;  4BQM A;  1EI5 A;  1FCM A;  1N9B A;  5GLA A;  2ZQ9 A;  1TDG A;  3V50 A;  2HZ5 A;  3ZCZ A;  3AGD A;  1GSV A;  4ID4 A;  4LCL A;  2IWB A;  2ZM8 A;  3NDG A;  4O8G A;  5CGW A;  3E2K A;  5F82 A;  3VOL A;  5CEC A;  3DTK A;  1LSW A;  2WAE A;  1XGJ A;  4KG6 A;  3HLB A;  1YLT A;  4MNR A;  4BEN A;  4OOM A;  2PBY A;  2OWJ A;  3EQU A;  4UA9 A;  2INW A;  3S7N A;  4PM9 A;  5G4Y A;  3BLM A;  3ITB A;  4S2N C;  2VGK A;  4MN6 A;  3CHW P;  3FPV A;  2B5R A;  3RTY A;  4UA6 A;  4WEJ A;  1LL8 A;  4X55 A;  2EX8 A;  3JPU A;  2WZZ A;  2ZM2 A;  3BRM A;  4NKP A;  2WGV A;  2GDN A;  3T50 A;  4NXF A;  1ZG4 A;  2M7V A;  1BLC A;  4FH2 A;  1JTD A;  4WUJ A;  1YAX A;  3GEC A;  5GHY A;  4UHU A;  3UY6 A;  4S2I A;  3C8C A;  1SHV A;  2LB5 A;  3QP6 A;  4YNR A;  1M6K A;  5L2F A;  1IYS A;  2QHK A;  4FD8 A;  3OOV A;  1IYQ A;  5FQ9 A;  1I5Q A;  4QHC A;  3OCN A;  3BY8 A;  4E3N A;  3LFV A;  2PU4 A;  4JGQ A;  4KZ8 A;  5HPF A;  2W3D A;  2OV5 A;  5HZH A;  1CJF A;  5CHJ A;  2V1B A;  5D3O A;  2QJ7 A;  3FKW A;  1FOF A;  1YLZ A;  3O5Y A;  5EUA A;  5GL9 A;  5DFX A;  3PAG A;  3OPR A;  5AQB A;  1CI8 A;  3IF6 C;  5FQM A;  3ZG5 A;  3HBR A;  4KQO A;  4D2O A;  4P6B A;  3JVU A;  4KQD A;  1M40 A;  5HAP A;  2W1T A;  2DCF A;  3BJN A;  1HLU P;  4EUZ A;  1HTZ A;  3FC7 A;  3LR3 A;  3TJZ C;  3CLO A;  1LI9 A;  1YLY A;  3KSG A;  4KUK A;  3FWL A;  5E2G A;  1S4S A;  2Y2J A;  3A3I A;  3LIB A;  1JWV A;  1H5X A;  3CI6 A;  4HJ6 A;  2A3U A;  4XT2 B;  1E25 A;  3GDI A;  3WS0 A;  1RGZ A;  1PWD A;  4BWI A;  1KGF A;  1L0G A;  3C7U A;  4QPR A;  2J8Y A;  4WEL A;  1ERM A;  4S2P A;  2XGN A;  4OPR A;  1I2W A;  3WS4 A;  4IJG A;  5GLD A;  4DJ2 A;  4GZB A;  1V9Y A;  3WS5 A;  2EWW A;  4LV0 A;  4N9L A;  3BW6 A;  2O9A A;  1X0O A;  3IF6 B;  2P7J A;  3C2W A;  3VFF A;  2XD1 A;  3IQA A;  1YSQ A;  1DJC A;  2UWX A;  3OPL A;  4E3O A;  2VX8 A;  4RA7 A;  2EXA A;  3R7W B;  3LIF A;  4BBV A;  1WYC A;  3NOT C;  4H6J B;  4EXO A;  3IBJ A;  4FTX A;  2GZA A;  5FEF A;  5J4E A;  2P9V A;  5CED A;  5HX9 A;  2J3T D;  1T1A A;  5HDD A;  3S4X A;  5IS1 A;  2Q9M A;  3PBQ A;  3NOP C;  2FZ0 A;  1UWN X;  5FAP A;  2PR6 A;  3HRE A;  3BFC A;  2Y2G A;  3UMD A;  2YKH A;  1PWG A;  3TG9 A;  2K7S A;  1MC0 A;  3PBN A;  3PTE A;  3UME A;  1A0K A;  4OON A;  2P08 A;  5EVL A;  3LUQ A;  2J9O A;  3IHA A;  3QP2 A;  3IBR A;  5F68 A;  3T4O A;  4EW7 A;  3G2Z A;  3OLO A;  5AQA A;  4R38 A;  2I72 A;  5JYP A;  5DFY A;  3NIA A;  3A3D A;  1LL9 A;  4QY5 A;  5A8B A;  2HJE A;  3K3D A;  5HL6 A;  1QME A;  4B93 A;  1G28 A;  3UE1 A;  4HJ4 A;  4S2L A;  4R0Q A;  1H3Q A;  3MZD A;  4CLC A;  2V0U A;  4Y13 A;  4Y0T A;  4B4Z A;  2W3G A;  1XGI A;  4QD4 A;  5FI2 A;  3O86 A;  4H8R A;  5JYO A;  2V8F A;  4JXW A;  2Y2P A;  3H7W B;  4OLD A;  3OC2 A;  3H82 B;  3ZG7 B;  2M1C A;  5M18 A;  4X56 A;  2CC1 A;  2XSS A;  3BWL A;  5HPI A;  4PKY G;  2Y2L A;  1DP8 A;  2W3F A;  4N1X A;  4X53 A;  3LI8 A;  1Y54 A;  3SS3 A;  3NHQ A;  2PR5 A;  3N6I A;  5KZH A;  4G3K A;  5I5L A;  3S7Q A;  3OBF A;  4WL9 A;  3Q82 A;  1T1B A;  2VA0 A;  2XFT A;  3SH7 A;  4LEN A;  5HL1 A;  2HP5 A;  4Y0O A;  3F1N A;  3Q7V A;  3WS2 A;  4BBU A;  3NDE A;  2WGW B;  3T4K A;  4S2O A;  1YQS A;  3C5A A;  2XF3 A;  5HFO A;  4HNB A;  3DTM A;  4CLC D;  3QP1 A;  1RP5 A;  5FAS A;  2IWD A;  5CGX A;  2W1R A;  3LGO A;  1L2S A;  1FCN A;  4UQI S;  2VV7 A;  2V1Z A;  3LY3 A;  2JKT M;  4GD6 A;  1FCO A;  2HPB A;  1S1Y A;  5MC7 A;  1K4E A;  3CMZ A;  3QP8 A;  3PR6 A;  3ZNY A;  5IT5 A;  1H8Z A;  2Z2L B;  1NLZ A;  3GV9 A;  5LBR A;  2ZJ9 A;  5EV0 A;  2PBD P;  3EGX C;  1EW0 A;  3LR5 A;  4WZ5 A;  5EPH A;  1L0D A;  4JF4 A;  1N9L A;  3WRT A;  2FFF B;  4MEZ A;  5F6A A;  3ZG0 A;  2QKP A;  4HES A;  2ZM0 A;  3VOY A;  2VV6 A;  1ALQ A;  5F1G A;  3C4P A;  4G3V A;  4BLM A;  3BEC A;  4WM9 A;  4DE0 A;  3LIE A;  2I9V A;  5F83 A;  1CEG A;  5TJJ A;  3PBR A;  3UPN A;  4Y3I A;  2L0W A;  1W63 M;  1STZ A;  1XJ4 A;  4YIN A;  2B95 A;  5TGF A;  2VLG A;  2Y59 A;  3VP4 A;  3M6B A;  3IH9 A;  2VJW A;  2WKR A;  2ZMV A;  2O99 A;  5IU1 A;  4CPK A;  1Z6F A;  2ZC3 B;  4FCF A;  1VET A;  1F98 A;  1V9Z A;  3LCE A;  3HLE A;  2PRF A;  1OT6 A;  1XP4 A;  4OH0 A;  4B4X A;  2J3T C;  5CHM A;  1P9W A;  4EV4 A;  2Y55 A;  4RX3 A;  1RCJ A;  2Y2K A;  3ZG9 B;  4QY6 A;  2V8C A;  4Y5F A;  5L8M A;  3VE4 A;  1BZA A;  4I5S A;  2JC7 A;  1UGU A;  2Y79 A;  1W8Q A;  3G30 A;  4JLF A;  2GNX A;  1NXY A;  3UB7 A;  2Y2Q A;  3R4K A;  4R3J A;  3WRZ A;  4LV3 A;  5E2H A;  1KDW A;  3ZG8 B;  3LEZ A;  1DY6 A;  4F3L A;  4HP4 A;  4MBK A;  1SCW A;  3IS2 A;  2G2U A;  1H8Y A;  1WE4 A;  4U0T A;  2WKI A;  5KSH A;  3GSG A;  3KSF A;  4HH3 A;  3PHY A;  4FOF A;  4NG2 A;  1BLP A;  3G35 A;  4LGW A;  4P6Z S;  4E3J A;  2W1T B;  1DJA A;  4R3A A;  2WAD A;  4JGP A;  4LRX C;  2JKT I;  1P97 A;  4EWF A;  4I38 A;  3Q81 A;  3UPO A;  1C3B A;  5K5B A;  4KZB A;  4NXG A;  3KYE A;  2XDM A;  4HH2 A;  3LID A;  4UQI M;  3SW1 A;  5CER A;  1L3L A;  2C6W B;  1S4R A;  1T18 A;  3KYZ A;  2P74 A;  3ITA A;  3M6H A;  4P87 A;  1HZO A;  1SDN A;  1JTG A;  3ZGA B;  3C38 A;  1L0E A;  2ACG A;  1F2K A;  3ICY A;  4DKI A;  4DMZ A;  3N8L A;  4WZ4 A;  4DF6 A;  4EBN A;  3OPH A;  1IFQ A;  2GJ3 A;  4NXE A;  4XUX A;  2JBF A;  3W4Q A;  1QMF A;  2LB9 A;  1XPB A;  4Y2F A;  1HD8 A;  2V9A A;  3FPW A;  3RFB A;  3V5M A;  4E04 A;  3B33 A;  3EWK A;  4X6T A;  1IEM A;  1KE4 A;  3LYX A;  2W0N A;  1LSV A;  3I7J A;  2R78 A;  2K31 A;  1YM1 A;  3TE8 A;  4KG2 A;  3E98 A;  3KSH A;  4E6X A;  3A3F A;  1W79 A;  1ONH A;  2BAS A;  1FQG A;  1TEM A;  5CXW A;  1NYY A;  5M19 A;  1WA9 A;  1P0Z A;  4CLC C;  3VOZ A;  1K6S A;  1P9R A;  2P9V B;  1AWI A;  4ZJ2 A;  4OPY A;  3HCY A;  2XQZ A;  4R6L A;  1W8Y A;  4HBU A;  1GA9 A;  5TBM A;  3HJK A;  5DVA A;  5FDH A;  4OQG A;  2WYX A;  4HP9 A;  3NOU C;  1CK3 A;  1MWS A;  1K57 A;  4D60 A;  1WYB A;  3HUO A;  5KSC A;  2H5S A;  4PKY A;  2A24 A;  3M2J A;  1LLB A;  2FH5 A;  1S66 L;  3IXH A;  1PI4 A;  4F94 A;  3UDI A;  2E8J A;  3G4P A;  1CEF A;  5FAQ A;  3N4I A;  2VK3 A;  3SH8 A;  1EWZ A;  4N92 A;  3CJM A;  3VFH A;  4ZJ3 A;  3QP4 A;  4ETX A;  2L4R A;  1XFQ A;  1K56 A;  2OAQ 1;  5IHV A;  2Q9N A;  1PRQ A;  5HDS A;  1YMX A;  4M4X A;  3MMH A; 
#chains in the Genus database with same CATH homology
 3HLW A;  1K57 C;  4WYY A;  3MXR A;  5HAR A;  2JCH A;  1QME A;  5CTM A;  2ZQC A;  4ZBE A;  3P98 A;  4FSF A;  1GHM A;  3ZVT A;  1XA1 A;  3NC8 A;  3AGF A;  4IVK A;  3OCL A;  3UE1 A;  5FAO A;  4ZDX A;  4JKT A;  3IT9 A;  4S2L A;  5DTK A;  3SH9 A;  4R0Q A;  3MZD A;  1IKI A;  1J9M A;  3SOI A;  1K4F A;  3P09 A;  4S2K A;  3V3R A;  3V39 A;  3BM6 A;  3ZFZ A;  4Y0T A;  4B4Z A;  2ZMA A;  3TOI A;  4IVI A;  5A90 A;  5HW3 A;  2PU2 A;  1JWP A;  1XGI A;  4X68 A;  3BFD A;  3FV7 A;  4QD4 A;  5U47 A;  5FI2 A;  3O86 A;  5I94 A;  4DDS A;  2BG1 A;  4WEK A;  4H8R A;  5JYO A;  1IEL A;  1LL5 A;  4E3K A;  5GLB A;  2OSU A;  4XXR A;  4K0X A;  4M3K A;  4B88 A;  4JXW A;  5GHZ A;  3MXS A;  5J8X A;  2Y2P A;  4JPM A;  4KG5 A;  3V3S A;  1K54 C;  1HVB A;  2C5W B;  5FSR A;  4OLD A;  2VGJ A;  3OC2 A;  3BLS A;  3ZG7 B;  3BEB A;  1BSG A;  4JXV A;  1GHP A;  1K25 A;  3HLG A;  3N7W A;  3HUN A;  3BYD A;  4GNU A;  4WZ5 C;  5FA7 A;  5M18 A;  4X56 A;  3VP3 A;  2CC1 A;  3ZNT A;  1ERO A;  1ES3 A;  3W4O A;  1SKF A;  1ES5 A;  2Y2L A;  4N1X A;  2DNS A;  4X53 A;  2ZC6 B;  1IKG A;  1Y54 A;  2ZLY A;  3MZE A;  4KQQ A;  4KZ7 A;  4KQR A;  3SS3 A;  4EQI A;  4QB8 A;  3CG5 A;  2EFU A;  2XH9 A;  3G31 A;  2Y2N A;  1VQQ A;  3GTC A;  4KEN B;  3N6I A;  5KZH A;  1TVF A;  4BD0 A;  3G32 A;  4GKU A;  4GOG A;  1TDL A;  1PZP A;  3GR2 A;  3UO9 A;  4E6W A;  3Q7V B;  3Q82 A;  4DXB A;  5EOO A;  3M2K A;  5FQI A;  2DRW A;  4A5R A;  2XFT A;  4HEF A;  3SH7 A;  2V2F F;  4KZ3 A;  5M1A A;  4LEN A;  5HAI A;  5HL1 A;  1MWR A;  4R23 A;  3S1Y A;  2HP5 A;  1K56 D;  2RL3 A;  3PBO A;  4Y0O A;  1YT4 A;  1MBL A;  5A91 A;  2WZX A;  3EQV A;  2X01 A;  3Q7V A;  5HAQ A;  4BL2 A;  4OPQ A;  3BFF A;  3O88 A;  3WS2 A;  2OLU A;  4LV2 A;  1CI9 A;  3NDE A;  3W8K A;  1IYP A;  3VMA A;  2WGW B;  4CJN A;  4S2O A;  1YQS A;  3C5A A;  4Z9Q A;  2QMI A;  3FKV A;  2XF3 A;  5HFO A;  4OQI A;  5AQ9 A;  2RCX A;  1NJ4 A;  5A93 A;  3WWX A;  4DE1 A;  1N4O A;  3RJU A;  2QZ6 A;  3DTM A;  2H0Y A;  5CEB A;  2Y2H A;  2XEP A;  1RP5 A;  5FAS A;  2IWD A;  1FR1 A;  1JWZ A;  5CGX A;  1L2S A;  1FCN A;  1PIO A;  3IXG A;  4BJP A;  3A3E A;  1RGY A;  5TR7 A;  1ZG6 A;  4UAA A;  3SS5 A;  4MBH A;  2V1Z A;  2WAF A;  3O3V A;  3LY3 A;  1E4D A;  4C6Y A;  1KVM A;  4GD6 A;  1FCO A;  5FQK A;  1KE3 A;  1BUL A;  2HPB A;  2A49 A;  1K4E A;  3CMZ A;  1JVJ A;  1IYO A;  4OP5 A;  4P0M A;  3ZVW A;  3HVF A;  5A92 A;  1G6A A;  4DRT A;  4FH4 A;  3ZNY A;  1ES4 A;  3VP2 A;  1H8Z A;  2Z2L B;  3VP0 A;  1PYY A;  3GV9 A;  4PM8 A;  2ZJ9 A;  3UN7 A;  3IXD A;  4E3M A;  1I2S A;  1G68 A;  5EVI C;  1K54 A;  4KZ4 A;  2ZC7 A;  3IHB A;  4L0L A;  4PMA A;  1GCE A;  4Q8I A;  5CHU A;  1BUE A;  3IH8 A;  4WZ5 A;  5EPH A;  1L0D A;  5DF9 A;  5FAT A;  4JF4 A;  3UE0 A;  2V20 A;  3WRT A;  4BQM A;  2FFF B;  4MEZ A;  5E2F A;  1EI5 A;  2FFY A;  1ESU A;  1ZKJ A;  5F1F A;  2XR0 A;  3ZG0 A;  1FCM A;  1N9B A;  3FZC A;  4N1H A;  5GLA A;  3RXX A;  2ZQ9 A;  4JXG A;  5FQQ A;  1TDG A;  2Y2M A;  3V50 A;  4HES A;  3ZCZ A;  3AGD A;  2HDS A;  2ZM0 A;  2EXB A;  3VOY A;  4ID4 A;  5FI7 A;  4U3T A;  1ALQ A;  5F1G A;  4LCL A;  3C4P A;  4BLM A;  1LHY A;  2IWB A;  2ZM8 A;  3NDG A;  2WGI A;  3BEC A;  4WM9 A;  4DE0 A;  3NCK A;  5CGW A;  3NI9 A;  3E2K A;  5F83 A;  1CEG A;  5F82 A;  3PBR A;  4WMC A;  3UPN A;  1Q2Q A;  5CEC A;  2G2W A;  2Y91 A;  1E3U A;  1XA7 A;  3GQZ A;  2IWC A;  1XGJ A;  2WAE A;  3Q7Z A;  3NY4 A;  4KG6 A;  4MLL A;  1LI0 A;  4OKP A;  4IBR A;  3VSL A;  3HLB A;  4YIN A;  1KGE A;  4HBT A;  5GHX A;  5TGF A;  4N9K A;  4OP8 A;  1YLT A;  4GD8 A;  4MNR A;  2Y59 A;  3PBS A;  4IBX A;  3MBZ A;  5EOE A;  3UPP A;  3VP4 A;  4OOM A;  4BEN A;  2PBY A;  3E2L A;  3M6B A;  3IH9 A;  4LV1 A;  1NZO A;  4JBF A;  3EQU A;  3OZH A;  4UA9 A;  4DXC A;  4PM9 A;  3BLM A;  3ITB A;  4S2N C;  2VGK A;  1ERQ A;  5FQJ A;  4CPK A;  4OOY A;  1Z6F A;  2ZC3 B;  4FCF A;  4DE3 A;  5G18 A;  1MY8 A;  2ZD8 A;  3LCE A;  2B5R A;  4UA6 A;  3GRJ A;  5E2E A;  4WEJ A;  3W4P A;  1W7F A;  3HLE A;  3DWZ A;  4NK3 A;  4GN2 A;  1XP4 A;  4OH0 A;  4B4X A;  4X55 A;  1MWT A;  5EVI B;  2EX8 A;  5CHM A;  4RX2 A;  4EV4 A;  4KZ5 A;  2Y55 A;  3DW0 A;  4RX3 A;  1RCJ A;  2Y2K A;  3ISG A;  2Z2M B;  2WZZ A;  2ZM2 A;  3ZG9 B;  3UNW A;  4BL3 A;  2J9P A;  3BRM A;  4QY6 A;  2WGV A;  1AXB A;  1KVL A;  2GDN A;  2Y2O A;  1ZG4 A;  5GLC A;  1BLC A;  4FH2 A;  5EVI A;  4Y0U A;  1JTD A;  3CZD A;  4DE2 A;  1BZA A;  1S6R A;  5GHY A;  3MZF A;  2JC7 A;  5TFQ A;  1ES2 A;  4UHU A;  4R1G A;  1W8Q A;  3G30 A;  3UY6 A;  4S2I A;  1ESI A;  2XLN A;  1SHV A;  4JLF A;  5DTS A;  1ONG A;  4KZ6 A;  1NXY A;  1M6K A;  3IWO A;  5L2F A;  2ZQ7 A;  2Y2Q A;  3C4O A;  4R3J A;  1IYS A;  3D4F A;  1PW8 A;  4FD8 A;  3WRZ A;  3MFD A;  4RVA A;  1YLW A;  4GB7 A;  4LV3 A;  5E2H A;  1KDW A;  1KDS A;  3QNB A;  1IYQ A;  5FQ9 A;  3G2Y A;  3QHY A;  3ZG8 B;  1I5Q A;  1VM1 A;  4QHC A;  4WMC D;  5BOH A;  3PBT A;  4IED A;  3BFG A;  4PM6 A;  3OCN A;  3LEZ A;  1DY6 A;  1E3U D;  2WUQ A;  3ZHH A;  4E3N A;  2PU4 A;  5DF8 A;  3LY4 A;  4MBK A;  4KZ8 A;  2HDR A;  1SCW A;  3O87 A;  2OV5 A;  4P85 A;  4JXS A;  4PM5 A;  2Y2I A;  5CHJ A;  1S0W A;  5CTN A;  4EBL A;  2G2U A;  5D3O A;  1H8Y A;  1NZU A;  1WE4 A;  4U0T A;  2WKI A;  5KSH A;  4OVD A;  3GSG A;  4WBG A;  4ZTK A;  3FKW A;  1FOF A;  1YLZ A;  3GMW A;  3OPP A;  4PM7 A;  5EUA A;  2XD5 A;  3UE3 A;  3FYZ A;  3UDF A;  5GL9 A;  4OOL A;  1YLP A;  3VP1 A;  3C7V A;  3PAG A;  1BLS A;  1BLP A;  3G35 A;  3ZDJ A;  3OPR A;  4E3J A;  5AQB A;  1DJA A;  1MWU A;  1OME A;  1BT5 A;  4E3I A;  4S2N A;  2WAD A;  1CI8 A;  3IF6 C;  4NET A;  3N8S A;  3PAE A;  5FQM A;  3G34 A;  3ZG5 A;  3HBR A;  4K91 A;  2EFX A;  1SDE A;  4KQO A;  4OQ0 A;  4EWF A;  3Q81 A;  4D2O A;  3UPO A;  4P6B A;  4UA7 A;  3IF5 A;  2R9X A;  1M40 A;  2ZQA A;  1C3B A;  5HAP A;  2DCF A;  2EX9 A;  3IWI A;  2HDU A;  4EUZ A;  4KZB A;  1NRF A;  1HTZ A;  2H10 A;  4S2M A;  1XXM A;  2XDM A;  2ZQ8 A;  4R4R A;  2ZC5 B;  2R9W A;  5CER A;  1PW1 A;  1LI9 A;  2HDQ A;  4KZA A;  2C6W B;  3BFE A;  1O7E A;  4RYE A;  2P74 A;  1YLY A;  2HP6 A;  3ITA A;  3M6H A;  3HUM A;  4P87 A;  1HZO A;  3FWL A;  1SDN A;  5EVI D;  1JTG A;  5E2G A;  3ZGA B;  3DWK A;  2WK0 A;  1L0E A;  2Y2J A;  3A3I A;  3HL9 A;  3IXB A;  3Q07 A;  5CRF A;  3B3X A;  1JWV A;  1H5X A;  5AQ7 A;  1YMS A;  4DKI A;  1K55 C;  3N8L A;  3SS4 A;  2A3U A;  4WZ4 A;  5EE8 A;  4U0X A;  4O7D A;  2X71 A;  3OPH A;  4DF6 A;  4C3Q A;  1E25 A;  4R4S A;  4EBN A;  3LO7 A;  2EX6 A;  3WS0 A;  1RGZ A;  5E43 A;  2BLS A;  1PWD A;  1KGF A;  1DJB A;  4XUX A;  1NYM A;  3C7U A;  1L0G A;  4MBF A;  1W5D A;  4GDB A;  2J8Y A;  4WEL A;  2JBF A;  3W4Q A;  1QMF A;  2ZC4 B;  1ERM A;  4S2P A;  2XGN A;  4OPR A;  1I2W A;  1XPB A;  1HD8 A;  3N8R A;  3WS4 A;  3V5M A;  4OQH A;  2E8I A;  5FI6 A;  5GLD A;  4GZB A;  4JF6 A;  3WS5 A;  4EBP A;  4X6T A;  2OLV A;  1FSY A;  1FR6 A;  1IEM A;  1KE4 A;  4LV0 A;  1MXO A;  3GVB A;  3I7J A;  1MKI A;  4N9L A;  3TSG A;  4E3L A;  5EEC A;  2QPN A;  1BLH A;  2H0T A;  1NY0 A;  1YM1 A;  3IF6 B;  1PWC A;  1XX2 A;  4KG2 A;  3VFF A;  3VSK A;  1BTL A;  4DDY A;  1K6R A;  4E6X A;  3A3F A;  2XD1 A;  1W79 A;  2UWX A;  1DJC A;  1ONH A;  2ZQD A;  3IQA A;  3OPL A;  1FQG A;  2XK1 A;  1TEM A;  4E3O A;  4KZ9 A;  1GA0 A;  1NYY A;  5CXW A;  5M19 A;  4RA7 A;  3VOZ A;  3S22 A;  1K6S A;  2P9V B;  4ZAM A;  5DTT A;  2EXA A;  3IF6 A;  4ZJ2 A;  1U60 A;  4OLG A;  4C75 A;  4QJG A;  4OPY A;  3HLD A;  1GHI A;  1WYC A;  1KE0 A;  5DF7 A;  2XQZ A;  4R3B A;  1W8Y A;  4HBU A;  2HP9 A;  2EX2 A;  2P9V A;  3HLC A;  4YFM A;  5HX9 A;  5CED A;  1GA9 A;  2Y4A A;  1YLJ A;  5DVA A;  5FDH A;  3S4X A;  4OQG A;  4BD1 A;  2WYX A;  4ZJ1 A;  2Q9M A;  3PBQ A;  1CK3 A;  1MWS A;  1XKZ A;  1K57 A;  4XUZ A;  1ZC2 A;  5KMW A;  1WYB A;  3RXW A;  5FAP A;  1K38 A;  1Q2P A;  3BFC A;  3HRE A;  3HUO A;  3JYI A;  4S2J A;  5KSC A;  2H5S A;  2Y2G A;  4LCM A;  1L0F A;  2XFS A;  3M2J A;  2WGW A;  1LLB A;  3TG9 A;  1PWG A;  3IWQ A;  2WKE A;  1FSW A;  4Y7P A;  3IXH A;  1PI4 A;  1K55 A;  3HLF A;  3PBN A;  3PTE A;  1PZO A;  4K0W A;  2WKH A;  4OON A;  4QU3 A;  4F94 A;  3UDI A;  3G4P A;  1CEF A;  3A3J A;  5EVL A;  5FAQ A;  4X69 A;  3Q1F A;  2J9O A;  3IHA A;  3N4I A;  3MKE A;  4OPZ A;  3SH8 A;  1EWZ A;  4N92 A;  3CJM A;  3G2Z A;  3VFH A;  5CGS A;  5AQA A;  3WS1 A;  2I72 A;  4ZJ3 A;  5JYP A;  1KGG A;  2X02 A;  3UDX A;  1PI5 A;  1O07 A;  3NIA A;  4PPR A;  3A3D A;  1LL9 A;  4QY5 A;  2JE5 A;  1MPL A;  3QNC A;  1K56 A;  4GDN A;  5IHV A;  2Q9N A;  3AGE A;  3NBL A;  2J7V A;  1YMX A;  4JF5 A;  3MKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...