1O07A

Crystal structure of the complex between q120l/y150e mutant of ampc and a beta-lactam inhibitor (mxg)
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
358
structure length
355
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLLVPDEVKSSSDLLRFYQNWQPAWAPGTQRLEANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSISDNKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Aspects for Evolution of beta-Lactamases from Penicillin-Binding Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 114
structure length 355
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1o07A00
3A3IA 3VP4A 3EQVA 1YMSA 3OC2A 5EVIB 2EXBA 2Y2KA 2WYXA 4S2MA 4H8RA 1FCNA 2HP5A 1ERQA 3E2LA 2J9PA 4IBRA 3W8KA 1YLPA 1NYMA 5BOHA 2EX8A 1K55C 1PW8A 1YLTA 4KQQA 4MBHA 4EBLA 1FSYA 3DWKA 5DTSA 3Q7VB 4LV0A 1GA0A 3ZGAB 4IEDA 5EPHA 4GZBA 3UDXA 5EE8A 1RGYA 1MWUA 4GKUA 5FAQA 2X02A 4OOYA 2XH9A 4FD8A 2WZZA 1SDNA 3MXSA 4KZ6A 4LCLA 5GLAA 4RYEA 1BZAA 3WWXA 4X56A 3V39A 2P9VB 1EROA 1FCMA 5GLCA 4UAAA 2EFUA 3IXDA 1ES5A 4LCMA 4QY6A 4GN2A 4S2JA 3UDIA 1S6RA 2V20A 1IKIA 4R3JA 5CHUA 4Q8IA 3BFGA 3PBTA 3I7JA 4N1XA 1ONHA 5AQAA 1KE3A 3MZEA 1ZC2A 1I2WA 2P9VA 4B4ZA 1EWZA 4OVDA 5FSRA 4DE2A 2PU4A 3BM6A 1PZPA 4WELA 4KQRA 3UE0A 2XGNA 1W8QA 1PI4A 4PMAA 1QMEA 3MKFA 2OV5A 4DRTA 2JCHA 3O87A 2Y2LA 5CXWA 3CJMA 5HARA 1K4EA 4DDYA 5EOOA 1Q2QA 1QMFA 2XQZA 5TFQA 3VP1A 3AGDA 1IEMA 5CTMA 4PM5A 2ZC6B 3DW0A 3IHAA 5CECA 2E8IA 3PTEA 3ZG8B 1CI8A 2UWXA 2ZQ8A 3G4PA 1ESUA 1IYOA 4C6YA 2EX9A 4FH4A 3ZHHA 4OOMA 2WGIA 1BSGA 5F1GA 4E3LA 3UO9A 3FZCA 4IVIA 1ONGA 2VGJA 5G18A 4OKPA 1KVMA 1XGIA 4UA7A 1Y54A 4JXGA 5J8XA 2FFFB 2H10A 3M6HA 4P85A 4KZ8A 1E25A 1YLYA 4Y0UA 1GHPA 4DXCA 3M2JA 3WS0A 2XF3A 1O7EA 3IH9A 4OQ0A 3VP2A 3CZDA 4B4XA 4E3NA 3ZFZA 1GCEA 1XPBA 4GDBA 4UA9A 4E3JA 4C75A 3P09A 1ZKJA 1SDEA 5E2HA 4U0XA 3N8RA 3V3RA 4WZ5C 1K6RA 4MNRA 3C4OA 1KE0A 2PU2A 1MPLA 3FKVA 4BJPA 4DF6A 4FH2A 5E43A 3HBRA 4NK3A 1JWZA 4QJGA 2Y2QA 5E2GA 2J7VA 1KDWA 4PM6A 1RCJA 3IF6A 4WBGA 5JYOA 1W7FA 2C6WB 1KDSA 4N9LA 4KG5A 4P6BA 5AQ7A 3MBZA 4QD4A 2XK1A 3FV7A 4HEFA 3WS5A 1PWDA 4P0MA 2HPBA 4JBFA 3HLBA 1NZOA 3FKWA 3IXGA 4N1HA 1NY0A 4KZAA 2Y55A 4R23A 2Q9NA 1ZG6A 1G6AA 5CRFA 4Z9QA 3SH7A 5F82A 4R3BA 2H0YA 4ZTKA 3WS2A 1O07A 3C4PA 2ZQDA 1IYSA 4GNUA 4KZ4A 1JVJA 3C7UA 1TVFA 2ZMAA 4QU3A 1HTZA 3UNWA 2WKEA 4X6TA 3OPHA 3A3DA 3HUNA 4B88A 3S4XA 5CHMA 2ZM8A 5GHYA 4WZ5A 1I2SA 1MWRA 4S2OA 3ZG7B 3PAEA 1FQGA 4A5RA 4Y0TA 4R1GA 3NC8A 1FSWA 3S1YA 3OZHA 4OQGA 4KZ7A 5HAQA 5KSHA 1BTLA 2HDQA 3Q7VA 3BRMA 3Q07A 3WS1A 1XGJA 4QY5A 1L0EA 2BG1A 5CGXA 4OP8A 3E2KA 2G2UA 3GR2A 1WE4A 4CJNA 3FWLA 1BT5A 1PIOA 3ZG5A 1M6KA 5GLBA 1VQQA 5A92A 2ZQ9A 3IWQA 1K57A 1E3UA 4OH0A 4RX3A 1ALQA 3Q1FA 2HP9A 1H8YA 4E6XA 2V1ZA 2V2FF 3UPNA 4ZBEA 1ZG4A 2XFTA 5GHZA 1DJBA 3B3XA 3JYIA 2GDNA 3UDFA 2WAFA 3D4FA 4OPZA 1HD8A 1H8ZA 3O88A 1YLWA 2H0TA 1K6SA 4K0XA 5EVLA 3ZCZA 1WYCA 3WRZA 3HREA 2ZQAA 4EQIA 3VMAA 5KSCA 2QZ6A 5M18A 2VGKA 3OPLA 4OOLA 2WUQA 5TGFA 1IELA 3NDEA 2WZXA 5HAPA 1ES2A 5DF8A 4EBPA 4K0WA 3SS4A 3RJUA 3C5AA 1I5QA 4UHUA 5DVAA 3N7WA 3GRJA 1IYPA 1K56D 3HLEA 5TR7A 5AQ9A 4S2PA 3ZVTA 4E3IA 4S2LA 4YINA 2Y2JA 3OPRA 1ESIA 2J8YA 1YQSA 2RL3A 2JBFA 1JTDA 2I72A 5DF9A 4PM8A 2Y59A 1MWSA 4N92A 4RX2A 4KENB 3O3VA 5GL9A 3A3FA 3GMWA 2WGVA 2FFYA 5E2FA 1NXYA 3VFHA 3BYDA 4DKIA 4E3OA 4ZAMA 1DY6A 1DJAA 3M6BA 4HBUA 3SH9A 1K56A 3UE1A 5CHJA 4HESA 5DTTA 3BEBA 3IWIA 3ISGA 4D2OA 1SCWA 3ZNTA 4E6WA 4JF5A 5L2FA 5FQ9A 5U47A 2H5SA 4LV3A 3ZVWA 3DWZA 2XR0A 4C3QA 2ZM2A 2DRWA 4BD1A 1BULA 1H5XA 2JE5A 2P74A 4YFMA 1K54A 2ZLYA 3IQAA 3HLCA 4ZJ3A 3G35A 5I94A 5HFOA 3LO7A 2QPNA 3NI9A 1W5DA 1NYYA 1YT4A 3SS3A 1AXBA 3HUMA 1YLZA 1YMXA 4RA7A 1ERMA 2XDMA 5EVIC 2WKHA 2Y91A 1C3BA 1LI9A 3OCLA 4IVKA 1K4FA 4PM7A 5CGWA 3G2ZA 3SS5A 4UA6A 3WS4A 4JXVA 1PW1A 3UY6A 1FCOA 2IWCA 3LCEA 2Y2PA 5EUAA 4BENA 1PYYA 1KGFA 1TDLA 3HLFA 4KZ5A 4EWFA 1KVLA 1JWPA 1YM1A 1JWVA 2DCFA 3DTMA 4GD6A 5FQMA 1K55A 4ZDXA 4F94A 4JXWA 4R0QA 3G34A 4DXBA 2EFXA 5HAIA 4BLMA 1NJ4A 2Y2NA 4MEZA 1LL9A 3Q81A 3V50A 4LV2A 3WRTA 2Y2HA 1LLBA 3N8SA 3VP0A 1HZOA 4OP5A 4DE0A 3ZDJA 4JXSA 3BLMA 4S2KA 5FQJA 2ZM0A 1PWGA 2DNSA 2Y2OA 4X55A 4BQMA 1XKZA 1N9BA 3HVFA 1MKIA 5IHVA 4BL3A 3UPOA 4K91A 1CK3A 2WKIA 2ZQ7A 3VOZA 3GV9A 3N6IA 5FQKA 1FR1A 2XEPA 3A3JA 4RVAA 2WGWB 5F1FA 3S22A 3LY4A 4OQHA 2C5WB 2R9WA 3IF6C 3MXRA 3NIAA 1FOFA 4QHCA 5GLDA 2JC7A 3PBOA 3Q7ZA 4DE1A 3PBQA 3LY3A 1W79A 3IXHA 2HDUA 2J9OA 2X71A 5FATA 2OLUA 4DDSA 1NRFA 3A3EA 4WYYA 2XD1A 1XXMA 5HW3A 4FCFA 3GQZA 1M40A 1SHVA 4U3TA 4WZ4A 4S2NC 1KGEA 3VSKA 2Y2IA 2IWDA 5DF7A 3SH8A 5CGSA 2ZC3B 3VOYA 3NBLA 4OPRA 1W8YA 3IT9A 2QMIA 3ZNYA 5D3OA 5FA7A 4X69A 4R4SA 3AGFA 4Y0OA 3HLGA 2XFSA 4OPQA 5A90A 5KMWA 4X68A 1BLPA 3VSLA 1ES4A 4EBNA 3TSGA 4R4RA 2OLVA 2HDRA 2WGWA 1VM1A 3BFEA 3P98A 4S2NA 1MWTA 1PZOA 1PWCA 1TDGA 3MZFA 4PPRA 1GHMA 5HX9A 5HL1A 3QNCA 5GHXA 4WM9A 3QHYA 2HDSA 1IYQA 4E3KA 1XX2A 4WMCA 3RXWA 1MBLA 2Y2MA 1TEMA 3ZG0A 4GDNA 4QB8A 4BD0A 4NETA 1GHIA 3M2KA 3OPPA 3TOIA 1E4DA 2R9XA 2B5RA 1LI0A 2Y2GA 1MY8A 2Z2LB 3IH8A 1BLCA 4KG2A 3Q82A 2IWBA 1K57C 2Y4AA 3EQUA 4EV4A 3FYZA 3ITBA 5FAPA 1K25A 3GVBA 3W4QA 3TG9A 3LEZA 3UN7A 1L0FA 4KG6A 3IHBA 3W4PA 5FI2A 5M19A 3QNBA 4E3MA 2A3UA 3BFCA 1BUEA 3CMZA 3PAGA 3IWOA 5EECA 3SOIA 4LV1A 2HP6A 3G32A 1L2SA 1CEGA 2Z2MB 3HL9A 4OPYA 1CEFA 5FI6A 2ZC5B 1L0GA 5AQBA 4ZJ1A 5DTKA 3UE3A 2PBYA 3HUOA 4MBKA 5CEBA 3VFFA 3N4IA 4OLGA 4ZJ2A 2CC1A 4JF4A 4GOGA 4KZBA 4GD8A 5FAOA 4X53A 5FI7A 5M1AA 4XXRA 1WYBA 5E2EA 1GA9A 5CTNA 1G68A 2WAEA 2Q9MA 2RCXA 1BLSA 1BLHA 1CI9A 4JLFA 4JKTA 4WEJA 4HBTA 1SKFA 3PBSA 2G2WA 1FR6A 3IXBA 1KGGA 4BL2A 3CG5A 4MLLA 1S0WA 1U60A 4S2IA 1K54C 1LL5A 3GSGA 3NCKA 4N9KA 1Q2PA 4CPKA 4DE3A 3IF5A 2XLNA 1YLJA 3VP3A 3NDGA 5FASA 5EOEA 2EXAA 3UPPA 3NY4A 4GB7A 3BFDA 1JTGA 4XUXA 3ITAA 4P87A 5FQIA 1XP4A 3G2YA 4OLDA 4KZ9A 1J9MA 2ZQCA 1OMEA 2ZJ9A 1DJCA 3W4OA 3MKEA 3N8LA 4WEKA 5EVID 3HLDA 5FQQA 5JYPA 1KE4A 3V5MA 3O86A 4Y7PA 5KZHA 1RP5A 4KZ3A 4U0TA 3AGEA 1E3UD 4PM9A 2OSUA 3BFFA 3PBRA 1K38A 3RXXA 3ZG9B 3PBNA 3BLSA 3BECA 1RGZA 4KQOA 1EI5A 5A91A 2BLSA 1N4OA 4JF6A 1XA1A 4XUZA 4OQIA 2XD5A 3G30A 3MFDA 3OCNA 3MZDA 1ES3A 4ID4A 2X01A 4IBXA 2EX6A 4FSFA 4OONA 1IKGA 2ZC7A 2EX2A 3HLWA 5FDHA 5CERA 3C7VA 4WMCD 3V3SA 1NZUA 1XA7A 5F83A 2A49A 5A93A 4JPMA 1LHYA 2ZD8A 1MXOA 3GTCA 2WK0A 4O7DA 5EVIA 2WADA 3IF6B 4L0LA 4M3KA 1Z6FA 4LENA 1HVBA 3G31A 4MBFA 4EUZA 2ZC4B 5CEDA 1L0DA 1PI5A
chains in the Genus database with same CATH superfamily
3IS2A 2W3FA 5HPFA 3QP5A 5MC7A 3EGXC 2Y2KA 3W8KA 4X1MA 1ODVA 2V0WA 4Y17A 1SKOA 1S4SA 4EBLA 2ZOIA 3DWKA 2CMNA 1PNEA 3JVVA 4LV0A 2LB5A 3ZGAB 4HH2A 2GJ3A 1MWUA 5FAQA 4KZ6A 2PD8A 5GLAA 3WWXA 4X56A 3V39A 1EROA 2W3DA 2Z6CA 4UAAA 3T12B 3B42A 4Q8IA 5J3WA 3JPUA 4N1XA 1ONHA 3LIBA 5AQAA 3LICA 4B4ZA 1EWZA 2PU4A 3TJZC 1OT6A 3CWFA 4ZRRA 1PI4A 1QMEA 3MKFA 2JCHA 2Y2LA 2ZL1A 5HARA 1K4EA 5EOOA 1Q2QA 4B93A 4PM5A 4Y13A 3VP1A 5CTMA 3U4LP 5CECA 2JHEA 3VOLA 4CLCB 1OPXA 3G4PA 1ZTUA 1G5UA 1IYOA 1TS0A 4C6YA 2PR5A 2PR6A 3S7NA 5F1GA 3UE6A 2YKFA 4MN6A 3MQOA 1H0MA 1KVMA 1E25A 1YLYA 1NWZA 1O7EA 4OQ0A 4B4XA 1H3QA 3ZFZA 1GCEA 4GDBA 4G3WA 4E3JA 1SDEA 4U0XA 4I3IA 4WZ5C 3H82B 3T4JA 5F69A 1MPLA 5E2GA 2Q0OA 4GHIA 4G3KA 1RCJA 2C6WB 5AQ7A 2VZWA 3MBZA 3R4KA 1Z09A 3TRCA 3FPVA 3WS5A 2HPBA 1NZOA 1ZG6A 1G6AA 5CRFA 2QYBA 2H0YA 3C4PA 3IX8A 1P97A 3C7UA 2D01A 1OTEA 1ACFA 4R38A 5CHMA 2INWA 4YWZA 2O9AA 2HF6A 1FQGA 1LT0A 4A5RA 3OZHA 2ZL1B 1VHMA 3WS1A 2BG1A 2V1BA 3GR2A 1WE4A 1BT5A 1XJ6A 1JNUA 3ZG5A 3DBAA 2NUTC 4KQDA 5GLBA 3IWQA 3LGOA 4RX3A 5TBMB 3Q1FA 3UPNA 1ZG4A 4CQHA 3D4FA 1UWPX 4OPZA 1H8ZA 1YLWA 4YOFA 3VMAA 2WUQA 1IELA 5DF8A 2AVXA 3GECA 3C8CA 3SS4A 3D72A 3N7WA 3ZVTA 2Y2JA 3OPRA 1YQSA 2RL3A 3RH8B 1T1CA 3B47A 2Y59A 1MWSA 1FIKA 3O3VA 2QWSA 4DKIA 1DJAA 3M6BA 4WLAA 4D2OA 3BQAA 3ZNTA 2HJEA 5L2FA 2JKGA 3ZVWA 2ZM2A 4L9FA 4F3LA 3G35A 5I94A 5HFOA 2B95A 2QPNA 1W5DA 1YT4A 1PRQA 3HUMA 1YLZA 4RA7A 1ERMA 4CLCE 2WKHA 3HJIA 1C3BA 3LUQA 4IVKA 5IU1A 1K4FA 5CGWA 1W63M 3SS5A 2JKFA 1MKMA 4UA6A 2OOLA 2UV0E 2KX6A 1PW1A 3LCEA 1TDLA 1KGFA 4EWFA 2V8CA 1YM1A 3DTMA 1K55A 4IUKA 4R0QA 5DJTA 4MEZA 3Q81A 4R70A 4MDZA 2VKSA 2PYPA 3N8SA 3T4LA 1HZOA 4Q0IA 4JXSA 3BLMA 5FQJA 4RQ9A 3UPOA 4Y5FA 4BL3A 1CK3A 3UB8A 4FOFA 3MXRA 3CPTA 5GLDA 2JC7A 4DE1A 2J3WA 3LY3A 3LFVA 1W79A 2J9OA 2KDKA 3NOTC 4I3AA 3IX3A 3A3EA 4WYYA 3LIDA 5HW3A 3GQZA 1XJ4A 1GSXA 2ZC3B 3NBLA 3IT9A 2QMIA 4X69A 4R4SA 3KSFA 4Y0OA 4OPQA 2XFSA 5A90A 5KMWA 1XFQA 4X68A 3VSLA 3P98A 1MWTA 1PZOA 5GHXA 3A0SA 1S1YA 2JN7A 2J3TC 2VJWA 3M2KA 1P9WA 2Y2GA 2Z2LB 1BLCA 4KG2A 3Q82A 2VX8A 2JKTI 5FAPA 4EEUA 3MJQA 1EW0A 3W4QA 5HSQA 4KG6A 3W4PA 5FI2A 3QNBA 4E3MA 3BFCA 4FUWA 3CMZA 3IWOA 2HP6A 1S1ZA 2Z2MB 2ZC5B 5DTKA 1HLUP 2CC1A 5HZHA 3MSHA 5FAOA 4X53A 3VE4A 2ZMFA 1XJ2A 4XXRA 1G68A 2WAEA 3ICYA 1CI9A 4HBTA 1SKFA 5DKKA 4O01A 4KUOA 1P0ZA 4GJ4A 3LR5A 4DE3A 4HY8A 3NDGA 4AFIA 5FASA 2EXAA 3RTYA 3NY4A 4P87A 2ZQCA 1OMEA 1DJCA 1OTDA 3HLDA 1KE4A 2D02A 4Y7PA 3IX4A 4MN5A 1E3UD 3BFFA 3RXXA 1MZUA 3BECA 1EI5A 3EWKA 2H28A 4OQIA 2XD5A 1ES3A 4ID4A 2EX6A 4OONA 2ZC7A 4WL9A 2MJ6A 2A49A 4LRYC 3T4KA 4QPRA 4JPMA 4HHDA 3GTCA 2WK0A 3FG8A 4L0LA 3A0RA 3G31A 1L0DA 1PI5A 3DTKA 3B33A 3MR0A 2J9PA 1K55C 1PW8A 1YLTA 4MBHA 3C30A 5DJUA 1GA0A 5EPHA 1TS8A 4GZBA 2OWHA 5FDSA 2WZZA 1SDNA 3MXSA 4EERA 4RYEA 1BZAA 5EV0A 2P9VB 1FCMA 4LCMA 4BWIA 2PD7A 3BFGA 3PBTA 3BW6A 3QP4A 1YSPA 3E4OA 1I2WA 4EETB 3UB6A 3BM6A 3F1PA 3UE0A 2GNXA 3HJKA 4DDYA 2XQZA 1IEMA 2E8IA 3GDIA 3PTEA 2A24B 2UWXA 4IJGA 5L09A 3ZHHA 1N9OA 5FEGA 3FZCA 1XGIA 4JXGA 2QJ7A 4DXCA 3WS0A 3BJNA 4MMNA 5E2HA 1OJ5A 3C4OA 1KE0A 2XSSA 1VEUA 4NK3A 2Y2QA 3R7WA 4P6BA 4O8GA 4QD4A 3HLBA 4N1HA 4R23A 2FH5A 2Q9NA 4HQAA 3WS2A 1O07A 3CHWP 4KZ4A 2XA7M 1TVFA 1NLYA 2J80A 3NOUC 2R78A 1CQAA 3HUNA 4B88A 2VV8A 4WZ5A 3ZG7B 4R1GA 3S1YA 4H6JA 1S66L 2HDQA 3Q7VA 3BRMA 5CGXA 4I39A 3E2KA 2G2UA 4CJNA 5K5BA 3FWLA 2M1CA 1P9RA 1M6KA 5A92A 4G3VA 1K57A 5KIZA 4E6XA 5GHZA 3UDFA 4NXFA 4WUJA 2WAFA 1CF0A 1WA9A 2HJ9C 3ZCZA 4K0XA 4GS9B 2PRFA 2ZBBA 3WRZA 4BBUA 3LR3A 5AVEA 5HAPA 4M4XA 4OOLA 3DAVA 4EBPA 1VEUB 1VB6A 5G4YA 2K31A 2IA2A 1IYPA 1K56D 2O9CA 3QP8A 4S2LA 1ESIA 2I72A 4NEED 4RX2A 2JKRM 5GL9A 5E2FA 1NXYA 1X0OA 3FPWA 4ZAMA 3SH9A 4HBUA 3UE1A 5CHJA 3LR0A 4HESA 3IWIA 4D60A 4X1LA 4ARZB 3E4PA 3VE3A 3H9WA 4BD1A 1H5XA 2JE5A 2P74A 1K54A 2O99A 3IQAA 3CI6A 4KUKA 3DTIA 1NYYA 3E98A 2V8FA 5EVIC 4PKYG 3MQ0A 4PM7A 3G2ZA 3WS4A 3UY6A 4BENA 3CITA 1KVLA 4GD6A 2DCFA 2W3HA 5FQMA 4CLCC 4ZDXA 2P04A 2EFXA 3KYQA 2Y2NA 3CLOA 1LSXA 1LL9A 4BMWA 4LV2A 3VP0A 3ZDJA 2VLGA 2DNSA 4X55A 4BQMA 1N9BA 2ZQ7A 3OOVA 2L0WA 3A0VA 5F1FA 3LY4A 4OQHA 3NIAA 1FOFA 1F9IA 4QHCA 5IS1A 1LSWA 3IS2B 5FATA 4DDSA 4FCFA 1SHVA 4GW9A 4U3TA 3VSKA 1TS7A 2IWDA 3HLGA 1BLPA 3EEHA 4EBNA 3UB5P 2L4RA 1VM1A 2WGWA 4S2NA 3KSHA 5HX9A 1GHMA 4WM9A 1G6OA 3EOIA 3QHYA 4LFUA 4E3KA 1T1BA 5FL3A 4WMCA 3ZG0A 4GDNA 3F1NB 4QB8A 3OPPA 3L7HA 2B5RA 2M7UA 1MY8A 2IWBA 3EQUA 4PHTA 4R3AA 3FYZA 3TG9A 1L0FA 3LIFA 3BQ8A 2A3UA 3T4OA 1BUEA 3G32A 1L2SA 2VV6A 3HL9A 1CEFA 2KOIA 1STZA 3UE3A 4OLGA 4JF4A 4GD8A 4JKTA 1BLSA 1BLHA 1ZHHB 3PBSA 3JVUA 4HP4A 3GSGA 3NCKA 4EXOA 3S7PA 5HWVA 1A0KA 3UPPA 4GB7A 3BFDA 2PBDP 2GX5A 1XP4A 4OLDA 4KZ9A 1J9MA 3MKEA 4WEKA 5FQQA 5EVID 3V5MA 1L3LA 4P6ZS 4U0TA 3AGEA 2OSUA 3PBRA 2Z6DA 5F6AA 4K08A 5F68A 4KQOA 5A91A 1N4OA 2LB9A 1XA1A 3L9KA 3G30A 2XA7S 3OCNA 3S7OA 2OAQ1 4EU0A 2X01A 3G6OA 1G28A 4FSFA 2FZ0A 1IKGA 3HLWA 4GHIB 5FDHA 3C7VA 5F83A 5L07A 3K2NA 3BWLA 3MMHA 2WKQA 5EVIA 2WADA 1Z6FA 4UQIS 4EUZA 3BY8A 2ZC4B 5CEDA 2XROA 3EQVA 4JGRA 5EVIB 4S2MA 1FCNA 2HP5A 1ERQA 3E2LA 4GCZA 4IBRA 2GZAA 2VA0A 2PHYA 3K3CA 2EX8A 2BTFP 4CLCA 4KQQA 1NRJA 2G7UA 1V9YA 5L8MA 3Q7VB 2V0UA 3BY9A 4IEDA 3UDXA 3F1PB 2X02A 3MF0A 1F5MA 4OOYA 4FD8A 4UQIM 5GLCA 5FEFA 2EFUA 3IXDA 1ES5A 4QY6A 3UB9A 2V20A 4R3JA 3I7JA 3MZEA 2EA9A 3QP1A 4WELA 4KQRA 2XGNA 1W8QA 4DRTA 2OV5A 5CXWA 1W63Q 1QMFA 5TFQA 3IHAA 3V67A 3ZG8B 1CI8A 4EW7A 4JGPA 4FH4A 1D1JA 2W3EA 4OOMA 2WGIA 4E3LA 3UO9A 3EEAA 4IVIA 1DP8A 1V9ZA 3T1QB 4UA7A 1Y54A 4Y0UA 3M6HA 4P85A 4KZ8A 1OT9A 2XF3A 3VP2A 2VK3A 3IH9A 2QHKA 1T1AA 2W3GA 5AJGA 4UA9A 3IBRA 1ZKJA 1K6RA 4MNRA 3U2AA 2PU2A 4FH2A 4QJGA 3LYXA 4ETZA 4WBGA 5JYOA 2B02A 1W7FA 4N9LA 1S67L 4NXBA 4HI4A 1PWDA 2YKHA 3FKWA 4S2JA 3IXGA 1NY0A 4KZAA 2HZ5A 4Z9QA 3SH7A 3KX0X 4R3BA 5EVEA 4YNRA 5F82A 4ZTKA 4WN5A 2ZQDA 4GNUA 4LGWA 3C38A 4I38A 3UNWA 2WKEA 2O9BA 5G4ZA 3S4XA 4PAUA 2ZM8A 1I2SA 4S2OA 1YPRA 3PAEA 4Y0TA 3P7NA 4KZ7A 5HDCA 1OTIA 5CX7A 1VQQA 2ZQ9A 4CLCD 2K2NA 1E3UA 1ALQA 1LSVA 2HP9A 1H8YA 2V1ZA 4ZBEA 2XFTA 2GDNA 5TJJA 1TS6A 3O88A 4ESPA 2H0TA 1K6SA 5HDDA 3HREA 4EQIA 5KSCA 2QZ6A 5M18A 3OPLA 5TGFA 3HCYA 1I5QA 2JKRI 4R6LA 3GRJA 3HLEA 4EUVA 2J8YA 2JBFA 1JTDA 5DF9A 3D3OA 3MQQA 4N92A 3GMWA 1DY6A 4HH3A 1K56A 5DTTA 1PFLA 3ISGA 3NHQA 2I9VA 4E6WA 5FQ9A 1Y4OA 5U47A 2H5SA 4LV3A 2XR0A 1BULA 2ZLYA 3HLCA 4ZJ3A 4PKYA 1DP9A 1S4RA 3CUEC 3NI9A 2A24A 1YMXA 2KLIA 3T1RA 1LI9A 3LIEA 4DJ2A 4JXVA 1KOUA 2WKPA 2Y2PA 5EUAA 3HLFA 4KZ5A 1JWPA 3KO6A 4F94A 3UMDA 4DXBA 4XT2B 3V50A 3WRTA 2Y2HA 4P6ZM 1LLBA 1FILA 4OP5A 4DE0A 3UMEA 4S2KA 2Y2OA 3HVFA 5EM0A 1MKIA 5IHVA 4K91A 5J7EA 2WKIA 3VOZA 3GV9A 5FQKA 4XT2A 2V1AA 2V9AA 4EESA 2R9WA 1AWIA 2PAVP 3Q7ZA 3PBQA 3IXHA 2HDUA 1YSQA 1XFNA 3D9YA 2XD1A 1XXMA 1MC0A 2Y2IA 1SKOB 3ZQ5A 5CGSA 3ULFA 4OPRA 3NULA 2P7JA 3ZNYA 1YKDA 5J4EA 3T4SA 4HJ4A 4IHQA 3AGFA 1ES4A 1PWCA 5HL1A 2ZOHA 3QNCA 1XX2A 3RXWA 1MBLA 1TEMA 4BD0A 2QKPA 1GHIA 1E4DA 2R9XA 1LI0A 3IH8A 2W27A 3CPTB 1GSVA 3KYEA 1K57C 4EV4A 1K25A 3GVBA 3LEZA 3UN7A 2EWVA 3PAGA 3T4TA 1SZVA 1CEGA 5HD3A 3LR4A 2VEAA 4ZJ1A 4MBKA 4L9EA 5FI7A 5M1AA 5E2EA 1GA9A 5CTNA 2Q9MA 4JLFA 5HD5A 4WEJA 3IXBA 4BL2A 4IUHA 5IT5A 1S0WA 3SZTA 4S2IA 4NKPA 1K54C 3MS6A 1LL5A 4N9KA 1F98A 4H6JB 1Q2PA 2PDRA 5EM1A 4CPKA 1F2KA 3IF5A 2L1MA 3NOPC 4Q0JA 5EOEA 1JTGA 4XUXA 5FQIA 3G2YA 3NJAA 5HWWA 2ZJ9A 4LRZE 3W4OA 3N8LA 1OJGA 2W1RA 1RP5A 3ZG9B 1K38A 3RFBA 3CAXA 4BBTA 1N9NA 2EX2A 4B9OA 5CERA 3H82A 3V3SA 1XA7A 3LI9A 1OTAA 3KSGA 5A93A 1MXOA 2ZD8A 4O7DA 4LRXC 1HVBA 4MBFA 5TBMA 4DN0A 3A3IA 3VP4A 1YMSA 3C2WA 3OC2A 2EXBA 2WYXA 4Y2FA 4H8RA 4HIAA 3UB7A 1YLPA 1NYMA 5BOHA 4NG2A 1FSYA 2EWWA 5DTSA 1LL8A 5C5KA 5A8BA 1UGUA 5HL6A 3NECA 4X25A 2VV7A 1RGYA 5EE8A 4GKUA 1T18A 1YAXA 4QWOA 1Y28A 2XH9A 4LCLA 2M7VA 4EEPA 4E04A 2E8JA 4GN2A 3UDIA 1S6RA 1IKIA 5CHUA 4DMZA 1IFQA 1KE3A 3O5YA 3W2ZA 1ZC2A 2P9VA 3FC7A 4OVDA 5FSRA 3QP6A 4DE2A 1PZPA 1NLZA 4PMAA 3O87A 3CJMA 3T1XA 3PHYA 3AGDA 2ZC6B 3DW0A 4JGOA 3T1SA 4ARZA 2ZQ8A 1ESUA 4WF0A 2EX9A 4HJ6A 3LEQA 1BSGA 1ONGA 2VGJA 5G18A 4OKPA 3E0YA 5J8XA 2FFFB 2H10A 4NXEA 1GHPA 3M2JA 3CZDA 4E3NA 1XPBA 4HOIA 4C75A 3P09A 1VETA 3N8RA 3V3RA 3LIAA 3FKVA 4BJPA 4DF6A 5F5YA 5E43A 3HBRA 4Q0HA 1JWZA 1H8MA 2J7VA 1KDWA 1N9LA 4PM6A 2DMWA 3IF6A 5HPIA 1KDSA 4KG5A 2QJ5A 2XK1A 3FV7A 4HEFA 4MN7A 1DP6A 4P0MA 4JBFA 2Y55A 2ACGA 2W1TA 3PYPA 3PXPA 1IOUA 1IYSA 1JVJA 2ZMAA 4QU3A 2Y79A 1HTZA 1TF1A 4X6TA 3OPHA 3A3DA 5GHYA 1MWRA 5L10A 3KSIA 3NC8A 1FSWA 4OQGA 5HAQA 5KSHA 1BTLA 3Q07A 1J3WA 1XGJA 4QY5A 1L0EA 4OP8A 1OTBA 1PIOA 4DJ3A 4LPZA 5I5LA 4OH0A 2V2FF 2J3TD 1TD5A 1DJBA 4Z1WA 3B3XA 3JYIA 1HD8A 1BYWA 5EVLA 1WYCA 2ZQAA 2VGKA 3NDEA 2WZXA 1ES2A 2PYRA 2W0NA 4K0WA 3RJUA 3C5AA 4UHUA 5DVAA 3MXQA 1VETB 5TR7A 5AQ9A 4S2PA 4E3IA 4YINA 4PM8A 4KENB 2W1TB 3A3FA 2WGVA 2FFYA 4E3OA 3VFHA 3BYDA 3F1OB 4I5SA 3F1NA 5LBRA 3BEBA 2P08A 1SCWA 4JF5A 2ZMVA 2JKTM 2B18A 4C3QA 3DWZA 2DRWA 4HJ3A 4JGQA 4YFMA 3LO7A 4GS9A 3S7QA 1AXBA 3SS3A 5HDSA 2XDMA 2Y91A 3OCLA 1CJFA 4NXGA 1FCOA 2IWCA 4Y3IA 1PYYA 1JWVA 2XRNA 4JXWA 2OWJA 3G34A 5HAIA 4BLMA 5DKLA 1NJ4A 3IBJA 2ZM0A 1PWGA 1XKZA 3H7WA 3N6IA 4ME4A 1FR1A 4MCWA 2XEPA 3A3JA 4RVAA 2WGWB 3S22A 3VV4A 4L9GA 2C5WB 2BASA 3IF6C 5EFWA 3T4QA 4FTXA 3PBOA 2PT7A 2X71A 5DFXA 2OLUA 1NRFA 3KYZA 1T19A 1M40A 4WZ4A 4BBVA 3EGDC 1XJ3A 1KGEA 4S2NC 5DF7A 4GLQA 3SH8A 3DTEA 3PR6A 3VOYA 1W8YA 2A2LA 2HV1A 5D3OA 5FA7A 2O0YA 4UEYA 3MFXA 2HGVA 3TSGA 4R4RA 2OLVA 2HDRA 3BFEA 3MZFA 4PPRA 1TDGA 2HDSA 1IYQA 4HNBA 2Y2MA 1K0KA 4NETA 3TOIA 4O0PA 3OBFA 5DFYA 3T50A 2Y4AA 2Y8HA 3ITBA 4EQ1A 3IHBA 5M19A 3H7WB 5EECA 3SOIA 4LV1A 2K7SA 4OPYA 5FI6A 3SW1A 1D06A 5AQBA 1L0GA 4ETXA 2PBYA 3HUOA 5CEBA 3VFFA 3N4IA 4ZJ2A 4HP9A 4GOGA 4KZBA 1WYBA 2VGLS 2RCXA 2VGLM 2G2WA 1FR6A 1KGGA 3CG5A 4MLLA 1UWNX 1U60A 3K3DA 3CUEA 3ZYTA 2XLNA 1YLJA 3VP3A 3ITAA 3QP2A 4I3JA 1GSWA 4Y15A 5JYPA 5KZHA 3O86A 4KZ3A 4PM9A 5HWTA 3PBNA 3BLSA 2OAP1 1RGZA 2BLSA 4JF6A 4XUZA 4LLOB 3MFDA 3TW8A 3MZDA 3F1OA 4IBXA 4F3LB 3E4QA 4WMCD 3LI8A 2WKRA 5AVFA 1NZUA 3TE8A 1D7EA 3OLOA 1LHYA 3R7WB 3IF6B 4II7A 1DRMA 4M3KA 4LENA 2NUPC 3P01A
chains in the Genus database with same CATH topology
3A3IA 3VP4A 3EQVA 1YMSA 3OC2A 5EVIB 2EXBA 2Y2KA 2WYXA 4S2MA 4H8RA 1FCNA 2HP5A 1ERQA 3E2LA 2J9PA 4IBRA 3W8KA 1YLPA 1NYMA 5BOHA 2EX8A 1K55C 1PW8A 1YLTA 4KQQA 4MBHA 4EBLA 1FSYA 3DWKA 5DTSA 3Q7VB 4LV0A 1GA0A 3ZGAB 4IEDA 5EPHA 4GZBA 3UDXA 5EE8A 1RGYA 1MWUA 4GKUA 5FAQA 2X02A 4OOYA 2XH9A 4FD8A 2WZZA 1SDNA 3MXSA 4KZ6A 4LCLA 5GLAA 4RYEA 1BZAA 3WWXA 4X56A 3V39A 2P9VB 1EROA 1FCMA 5GLCA 4UAAA 2EFUA 3IXDA 1ES5A 4LCMA 4QY6A 4GN2A 4S2JA 3UDIA 1S6RA 2V20A 1IKIA 4R3JA 5CHUA 4Q8IA 3BFGA 3PBTA 3I7JA 4N1XA 1ONHA 5AQAA 1KE3A 3MZEA 1ZC2A 1I2WA 2P9VA 4B4ZA 1EWZA 4OVDA 5FSRA 4DE2A 2PU4A 3BM6A 1PZPA 4WELA 4KQRA 3UE0A 2XGNA 1W8QA 1PI4A 4PMAA 1QMEA 3MKFA 2OV5A 4DRTA 2JCHA 3O87A 2Y2LA 5CXWA 3CJMA 5HARA 1K4EA 4DDYA 5EOOA 1Q2QA 1QMFA 2XQZA 5TFQA 3VP1A 3AGDA 1IEMA 5CTMA 4PM5A 2ZC6B 3DW0A 3IHAA 5CECA 2E8IA 3PTEA 3ZG8B 1CI8A 2UWXA 2ZQ8A 3G4PA 1ESUA 1IYOA 4C6YA 2EX9A 4FH4A 3ZHHA 4OOMA 2WGIA 1BSGA 5F1GA 4E3LA 3UO9A 3FZCA 4IVIA 1ONGA 2VGJA 5G18A 4OKPA 1KVMA 1XGIA 4UA7A 1Y54A 4JXGA 5J8XA 2FFFB 2H10A 3M6HA 4P85A 4KZ8A 1E25A 1YLYA 4Y0UA 1GHPA 4DXCA 3M2JA 3WS0A 2XF3A 1O7EA 3IH9A 4OQ0A 3VP2A 3CZDA 4B4XA 4E3NA 3ZFZA 1GCEA 1XPBA 4GDBA 4UA9A 4E3JA 4C75A 3P09A 1ZKJA 1SDEA 5E2HA 4U0XA 3N8RA 3V3RA 4WZ5C 1K6RA 4MNRA 3C4OA 1KE0A 2PU2A 1MPLA 3FKVA 4BJPA 4DF6A 4FH2A 5E43A 3HBRA 4NK3A 1JWZA 4QJGA 2Y2QA 5E2GA 2J7VA 1KDWA 4PM6A 1RCJA 3IF6A 4WBGA 5JYOA 1W7FA 2C6WB 1KDSA 4N9LA 4KG5A 4P6BA 5AQ7A 3MBZA 4QD4A 2XK1A 3FV7A 4HEFA 3WS5A 1PWDA 4P0MA 2HPBA 4JBFA 3HLBA 1NZOA 3FKWA 3IXGA 4N1HA 1NY0A 4KZAA 2Y55A 4R23A 2Q9NA 1ZG6A 1G6AA 5CRFA 4Z9QA 3SH7A 5F82A 4R3BA 2H0YA 4ZTKA 3WS2A 1O07A 3C4PA 2ZQDA 1IYSA 4GNUA 4KZ4A 1JVJA 3C7UA 1TVFA 2ZMAA 4QU3A 1HTZA 3UNWA 2WKEA 4X6TA 3OPHA 3A3DA 3HUNA 4B88A 3S4XA 5CHMA 2ZM8A 5GHYA 4WZ5A 1I2SA 1MWRA 4S2OA 3ZG7B 3PAEA 1FQGA 4A5RA 4Y0TA 4R1GA 3NC8A 1FSWA 3S1YA 3OZHA 4OQGA 4KZ7A 5HAQA 5KSHA 1BTLA 2HDQA 3Q7VA 3BRMA 3Q07A 3WS1A 1XGJA 4QY5A 1L0EA 2BG1A 5CGXA 4OP8A 3E2KA 2G2UA 3GR2A 1WE4A 4CJNA 3FWLA 1BT5A 1PIOA 3ZG5A 1M6KA 5GLBA 1VQQA 5A92A 2ZQ9A 3IWQA 1K57A 1E3UA 4OH0A 4RX3A 1ALQA 3Q1FA 2HP9A 1H8YA 4E6XA 2V1ZA 2V2FF 3UPNA 4ZBEA 1ZG4A 2XFTA 5GHZA 1DJBA 3B3XA 3JYIA 2GDNA 3UDFA 2WAFA 3D4FA 4OPZA 1HD8A 1H8ZA 3O88A 1YLWA 2H0TA 1K6SA 4K0XA 5EVLA 3ZCZA 1WYCA 3WRZA 3HREA 2ZQAA 4EQIA 3VMAA 5KSCA 2QZ6A 5M18A 2VGKA 3OPLA 4OOLA 2WUQA 5TGFA 1IELA 3NDEA 2WZXA 5HAPA 1ES2A 5DF8A 4EBPA 4K0WA 3SS4A 3RJUA 3C5AA 1I5QA 4UHUA 5DVAA 3N7WA 3GRJA 1IYPA 1K56D 3HLEA 5TR7A 5AQ9A 4S2PA 3ZVTA 4E3IA 4S2LA 4YINA 2Y2JA 3OPRA 1ESIA 2J8YA 1YQSA 2RL3A 2JBFA 1JTDA 2I72A 5DF9A 4PM8A 2Y59A 1MWSA 4N92A 4RX2A 4KENB 3O3VA 5GL9A 3A3FA 3GMWA 2WGVA 2FFYA 5E2FA 1NXYA 3VFHA 3BYDA 4DKIA 4E3OA 4ZAMA 1DY6A 1DJAA 3M6BA 4HBUA 3SH9A 1K56A 3UE1A 5CHJA 4HESA 5DTTA 3BEBA 3IWIA 3ISGA 4D2OA 1SCWA 3ZNTA 4E6WA 4JF5A 5L2FA 5FQ9A 5U47A 2H5SA 4LV3A 3ZVWA 3DWZA 2XR0A 4C3QA 2ZM2A 2DRWA 4BD1A 1BULA 1H5XA 2JE5A 2P74A 4YFMA 1K54A 2ZLYA 3IQAA 3HLCA 4ZJ3A 3G35A 5I94A 5HFOA 3LO7A 2QPNA 3NI9A 1W5DA 1NYYA 1YT4A 3SS3A 1AXBA 3HUMA 1YLZA 1YMXA 4RA7A 1ERMA 2XDMA 5EVIC 2WKHA 2Y91A 1C3BA 1LI9A 3OCLA 4IVKA 1K4FA 4PM7A 5CGWA 3G2ZA 3SS5A 4UA6A 3WS4A 4JXVA 1PW1A 3UY6A 1FCOA 2IWCA 3LCEA 2Y2PA 5EUAA 4BENA 1PYYA 1KGFA 1TDLA 3HLFA 4KZ5A 4EWFA 1KVLA 1JWPA 1YM1A 1JWVA 2DCFA 3DTMA 4GD6A 5FQMA 1K55A 4ZDXA 4F94A 4JXWA 4R0QA 3G34A 4DXBA 2EFXA 5HAIA 4BLMA 1NJ4A 2Y2NA 4MEZA 1LL9A 3Q81A 3V50A 4LV2A 3WRTA 2Y2HA 1LLBA 3N8SA 3VP0A 1HZOA 4OP5A 4DE0A 3ZDJA 4JXSA 3BLMA 4S2KA 5FQJA 2ZM0A 1PWGA 2DNSA 2Y2OA 4X55A 4BQMA 1XKZA 1N9BA 3HVFA 1MKIA 5IHVA 4BL3A 3UPOA 4K91A 1CK3A 2WKIA 2ZQ7A 3VOZA 3GV9A 3N6IA 5FQKA 1FR1A 2XEPA 3A3JA 4RVAA 2WGWB 5F1FA 3S22A 3LY4A 4OQHA 2C5WB 2R9WA 3IF6C 3MXRA 3NIAA 1FOFA 4QHCA 5GLDA 2JC7A 3PBOA 3Q7ZA 4DE1A 3PBQA 3LY3A 1W79A 3IXHA 2HDUA 2J9OA 2X71A 5FATA 2OLUA 4DDSA 1NRFA 3A3EA 4WYYA 2XD1A 1XXMA 5HW3A 4FCFA 3GQZA 1M40A 1SHVA 4U3TA 4WZ4A 4S2NC 1KGEA 3VSKA 2Y2IA 2IWDA 5DF7A 3SH8A 5CGSA 2ZC3B 3VOYA 3NBLA 4OPRA 1W8YA 3IT9A 2QMIA 3ZNYA 5D3OA 5FA7A 4X69A 4R4SA 3AGFA 4Y0OA 3HLGA 2XFSA 4OPQA 5A90A 5KMWA 4X68A 1BLPA 3VSLA 1ES4A 4EBNA 3TSGA 4R4RA 2OLVA 2HDRA 2WGWA 1VM1A 3BFEA 3P98A 4S2NA 1MWTA 1PZOA 1PWCA 1TDGA 3MZFA 4PPRA 1GHMA 5HX9A 5HL1A 3QNCA 5GHXA 4WM9A 3QHYA 2HDSA 1IYQA 4E3KA 1XX2A 4WMCA 3RXWA 1MBLA 2Y2MA 1TEMA 3ZG0A 4GDNA 4QB8A 4BD0A 4NETA 1GHIA 3M2KA 3OPPA 3TOIA 1E4DA 2R9XA 2B5RA 1LI0A 2Y2GA 1MY8A 2Z2LB 3IH8A 1BLCA 4KG2A 3Q82A 2IWBA 1K57C 2Y4AA 3EQUA 4EV4A 3FYZA 3ITBA 5FAPA 1K25A 3GVBA 3W4QA 3TG9A 3LEZA 3UN7A 1L0FA 4KG6A 3IHBA 3W4PA 5FI2A 5M19A 3QNBA 4E3MA 2A3UA 3BFCA 1BUEA 3CMZA 3PAGA 3IWOA 5EECA 3SOIA 4LV1A 2HP6A 3G32A 1L2SA 1CEGA 2Z2MB 3HL9A 4OPYA 1CEFA 5FI6A 2ZC5B 1L0GA 5AQBA 4ZJ1A 5DTKA 3UE3A 2PBYA 3HUOA 4MBKA 5CEBA 3VFFA 3N4IA 4OLGA 4ZJ2A 2CC1A 4JF4A 4GOGA 4KZBA 4GD8A 5FAOA 4X53A 5FI7A 5M1AA 4XXRA 1WYBA 5E2EA 1GA9A 5CTNA 1G68A 2WAEA 2Q9MA 2RCXA 1BLSA 1BLHA 1CI9A 4JLFA 4JKTA 4WEJA 4HBTA 1SKFA 3PBSA 2G2WA 1FR6A 3IXBA 1KGGA 4BL2A 3CG5A 4MLLA 1S0WA 1U60A 4S2IA 1K54C 1LL5A 3GSGA 3NCKA 4N9KA 1Q2PA 4CPKA 4DE3A 3IF5A 2XLNA 1YLJA 3VP3A 3NDGA 5FASA 5EOEA 2EXAA 3UPPA 3NY4A 4GB7A 3BFDA 1JTGA 4XUXA 3ITAA 4P87A 5FQIA 1XP4A 3G2YA 4OLDA 4KZ9A 1J9MA 2ZQCA 1OMEA 2ZJ9A 1DJCA 3W4OA 3MKEA 3N8LA 4WEKA 5EVID 3HLDA 5FQQA 5JYPA 1KE4A 3V5MA 3O86A 4Y7PA 5KZHA 1RP5A 4KZ3A 4U0TA 3AGEA 1E3UD 4PM9A 2OSUA 3BFFA 3PBRA 1K38A 3RXXA 3ZG9B 3PBNA 3BLSA 3BECA 1RGZA 4KQOA 1EI5A 5A91A 2BLSA 1N4OA 4JF6A 1XA1A 4XUZA 4OQIA 2XD5A 3G30A 3MFDA 3OCNA 3MZDA 1ES3A 4ID4A 2X01A 4IBXA 2EX6A 4FSFA 4OONA 1IKGA 2ZC7A 2EX2A 3HLWA 5FDHA 5CERA 3C7VA 4WMCD 3V3SA 1NZUA 1XA7A 5F83A 2A49A 5A93A 4JPMA 1LHYA 2ZD8A 1MXOA 3GTCA 2WK0A 4O7DA 5EVIA 2WADA 3IF6B 4L0LA 4M3KA 1Z6FA 4LENA 1HVBA 3G31A 4MBFA 4EUZA 2ZC4B 5CEDA 1L0DA 1PI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A3I A;  3VP4 A;  3EQV A;  1YMS A;  3OC2 A;  5EVI B;  2EXB A;  2Y2K A;  2WYX A;  4S2M A;  4H8R A;  1FCN A;  2HP5 A;  1ERQ A;  3E2L A;  2J9P A;  4IBR A;  3W8K A;  1YLP A;  1NYM A;  5BOH A;  2EX8 A;  1K55 C;  1PW8 A;  1YLT A;  4KQQ A;  4MBH A;  4EBL A;  1FSY A;  3DWK A;  5DTS A;  3Q7V B;  4LV0 A;  1GA0 A;  3ZGA B;  4IED A;  5EPH A;  4GZB A;  3UDX A;  5EE8 A;  1RGY A;  1MWU A;  4GKU A;  5FAQ A;  2X02 A;  4OOY A;  2XH9 A;  4FD8 A;  2WZZ A;  1SDN A;  3MXS A;  4KZ6 A;  4LCL A;  5GLA A;  4RYE A;  1BZA A;  3WWX A;  4X56 A;  3V39 A;  2P9V B;  1ERO A;  1FCM A;  5GLC A;  4UAA A;  2EFU A;  3IXD A;  1ES5 A;  4LCM A;  4QY6 A;  4GN2 A;  4S2J A;  3UDI A;  1S6R A;  2V20 A;  1IKI A;  4R3J A;  5CHU A;  4Q8I A;  3BFG A;  3PBT A;  3I7J A;  4N1X A;  1ONH A;  5AQA A;  1KE3 A;  3MZE A;  1ZC2 A;  1I2W A;  2P9V A;  4B4Z A;  1EWZ A;  4OVD A;  5FSR A;  4DE2 A;  2PU4 A;  3BM6 A;  1PZP A;  4WEL A;  4KQR A;  3UE0 A;  2XGN A;  1W8Q A;  1PI4 A;  4PMA A;  1QME A;  3MKF A;  2OV5 A;  4DRT A;  2JCH A;  3O87 A;  2Y2L A;  5CXW A;  3CJM A;  5HAR A;  1K4E A;  4DDY A;  5EOO A;  1Q2Q A;  1QMF A;  2XQZ A;  5TFQ A;  3VP1 A;  3AGD A;  1IEM A;  5CTM A;  4PM5 A;  2ZC6 B;  3DW0 A;  3IHA A;  5CEC A;  2E8I A;  3PTE A;  3ZG8 B;  1CI8 A;  2UWX A;  2ZQ8 A;  3G4P A;  1ESU A;  1IYO A;  4C6Y A;  2EX9 A;  4FH4 A;  3ZHH A;  4OOM A;  2WGI A;  1BSG A;  5F1G A;  4E3L A;  3UO9 A;  3FZC A;  4IVI A;  1ONG A;  2VGJ A;  5G18 A;  4OKP A;  1KVM A;  1XGI A;  4UA7 A;  1Y54 A;  4JXG A;  5J8X A;  2FFF B;  2H10 A;  3M6H A;  4P85 A;  4KZ8 A;  1E25 A;  1YLY A;  4Y0U A;  1GHP A;  4DXC A;  3M2J A;  3WS0 A;  2XF3 A;  1O7E A;  3IH9 A;  4OQ0 A;  3VP2 A;  3CZD A;  4B4X A;  4E3N A;  3ZFZ A;  1GCE A;  1XPB A;  4GDB A;  4UA9 A;  4E3J A;  4C75 A;  3P09 A;  1ZKJ A;  1SDE A;  5E2H A;  4U0X A;  3N8R A;  3V3R A;  4WZ5 C;  1K6R A;  4MNR A;  3C4O A;  1KE0 A;  2PU2 A;  1MPL A;  3FKV A;  4BJP A;  4DF6 A;  4FH2 A;  5E43 A;  3HBR A;  4NK3 A;  1JWZ A;  4QJG A;  2Y2Q A;  5E2G A;  2J7V A;  1KDW A;  4PM6 A;  1RCJ A;  3IF6 A;  4WBG A;  5JYO A;  1W7F A;  2C6W B;  1KDS A;  4N9L A;  4KG5 A;  4P6B A;  5AQ7 A;  3MBZ A;  4QD4 A;  2XK1 A;  3FV7 A;  4HEF A;  3WS5 A;  1PWD A;  4P0M A;  2HPB A;  4JBF A;  3HLB A;  1NZO A;  3FKW A;  3IXG A;  4N1H A;  1NY0 A;  4KZA A;  2Y55 A;  4R23 A;  2Q9N A;  1ZG6 A;  1G6A A;  5CRF A;  4Z9Q A;  3SH7 A;  5F82 A;  4R3B A;  2H0Y A;  4ZTK A;  3WS2 A;  1O07 A;  3C4P A;  2ZQD A;  1IYS A;  4GNU A;  4KZ4 A;  1JVJ A;  3C7U A;  1TVF A;  2ZMA A;  4QU3 A;  1HTZ A;  3UNW A;  2WKE A;  4X6T A;  3OPH A;  3A3D A;  3HUN A;  4B88 A;  3S4X A;  5CHM A;  2ZM8 A;  5GHY A;  4WZ5 A;  1I2S A;  1MWR A;  4S2O A;  3ZG7 B;  3PAE A;  1FQG A;  4A5R A;  4Y0T A;  4R1G A;  3NC8 A;  1FSW A;  3S1Y A;  3OZH A;  4OQG A;  4KZ7 A;  5HAQ A;  5KSH A;  1BTL A;  2HDQ A;  3Q7V A;  3BRM A;  3Q07 A;  3WS1 A;  1XGJ A;  4QY5 A;  1L0E A;  2BG1 A;  5CGX A;  4OP8 A;  3E2K A;  2G2U A;  3GR2 A;  1WE4 A;  4CJN A;  3FWL A;  1BT5 A;  1PIO A;  3ZG5 A;  1M6K A;  5GLB A;  1VQQ A;  5A92 A;  2ZQ9 A;  3IWQ A;  1K57 A;  1E3U A;  4OH0 A;  4RX3 A;  1ALQ A;  3Q1F A;  2HP9 A;  1H8Y A;  4E6X A;  2V1Z A;  2V2F F;  3UPN A;  4ZBE A;  1ZG4 A;  2XFT A;  5GHZ A;  1DJB A;  3B3X A;  3JYI A;  2GDN A;  3UDF A;  2WAF A;  3D4F A;  4OPZ A;  1HD8 A;  1H8Z A;  3O88 A;  1YLW A;  2H0T A;  1K6S A;  4K0X A;  5EVL A;  3ZCZ A;  1WYC A;  3WRZ A;  3HRE A;  2ZQA A;  4EQI A;  3VMA A;  5KSC A;  2QZ6 A;  5M18 A;  2VGK A;  3OPL A;  4OOL A;  2WUQ A;  5TGF A;  1IEL A;  3NDE A;  2WZX A;  5HAP A;  1ES2 A;  5DF8 A;  4EBP A;  4K0W A;  3SS4 A;  3RJU A;  3C5A A;  1I5Q A;  4UHU A;  5DVA A;  3N7W A;  3GRJ A;  1IYP A;  1K56 D;  3HLE A;  5TR7 A;  5AQ9 A;  4S2P A;  3ZVT A;  4E3I A;  4S2L A;  4YIN A;  2Y2J A;  3OPR A;  1ESI A;  2J8Y A;  1YQS A;  2RL3 A;  2JBF A;  1JTD A;  2I72 A;  5DF9 A;  4PM8 A;  2Y59 A;  1MWS A;  4N92 A;  4RX2 A;  4KEN B;  3O3V A;  5GL9 A;  3A3F A;  3GMW A;  2WGV A;  2FFY A;  5E2F A;  1NXY A;  3VFH A;  3BYD A;  4DKI A;  4E3O A;  4ZAM A;  1DY6 A;  1DJA A;  3M6B A;  4HBU A;  3SH9 A;  1K56 A;  3UE1 A;  5CHJ A;  4HES A;  5DTT A;  3BEB A;  3IWI A;  3ISG A;  4D2O A;  1SCW A;  3ZNT A;  4E6W A;  4JF5 A;  5L2F A;  5FQ9 A;  5U47 A;  2H5S A;  4LV3 A;  3ZVW A;  3DWZ A;  2XR0 A;  4C3Q A;  2ZM2 A;  2DRW A;  4BD1 A;  1BUL A;  1H5X A;  2JE5 A;  2P74 A;  4YFM A;  1K54 A;  2ZLY A;  3IQA A;  3HLC A;  4ZJ3 A;  3G35 A;  5I94 A;  5HFO A;  3LO7 A;  2QPN A;  3NI9 A;  1W5D A;  1NYY A;  1YT4 A;  3SS3 A;  1AXB A;  3HUM A;  1YLZ A;  1YMX A;  4RA7 A;  1ERM A;  2XDM A;  5EVI C;  2WKH A;  2Y91 A;  1C3B A;  1LI9 A;  3OCL A;  4IVK A;  1K4F A;  4PM7 A;  5CGW A;  3G2Z A;  3SS5 A;  4UA6 A;  3WS4 A;  4JXV A;  1PW1 A;  3UY6 A;  1FCO A;  2IWC A;  3LCE A;  2Y2P A;  5EUA A;  4BEN A;  1PYY A;  1KGF A;  1TDL A;  3HLF A;  4KZ5 A;  4EWF A;  1KVL A;  1JWP A;  1YM1 A;  1JWV A;  2DCF A;  3DTM A;  4GD6 A;  5FQM A;  1K55 A;  4ZDX A;  4F94 A;  4JXW A;  4R0Q A;  3G34 A;  4DXB A;  2EFX A;  5HAI A;  4BLM A;  1NJ4 A;  2Y2N A;  4MEZ A;  1LL9 A;  3Q81 A;  3V50 A;  4LV2 A;  3WRT A;  2Y2H A;  1LLB A;  3N8S A;  3VP0 A;  1HZO A;  4OP5 A;  4DE0 A;  3ZDJ A;  4JXS A;  3BLM A;  4S2K A;  5FQJ A;  2ZM0 A;  1PWG A;  2DNS A;  2Y2O A;  4X55 A;  4BQM A;  1XKZ A;  1N9B A;  3HVF A;  1MKI A;  5IHV A;  4BL3 A;  3UPO A;  4K91 A;  1CK3 A;  2WKI A;  2ZQ7 A;  3VOZ A;  3GV9 A;  3N6I A;  5FQK A;  1FR1 A;  2XEP A;  3A3J A;  4RVA A;  2WGW B;  5F1F A;  3S22 A;  3LY4 A;  4OQH A;  2C5W B;  2R9W A;  3IF6 C;  3MXR A;  3NIA A;  1FOF A;  4QHC A;  5GLD A;  2JC7 A;  3PBO A;  3Q7Z A;  4DE1 A;  3PBQ A;  3LY3 A;  1W79 A;  3IXH A;  2HDU A;  2J9O A;  2X71 A;  5FAT A;  2OLU A;  4DDS A;  1NRF A;  3A3E A;  4WYY A;  2XD1 A;  1XXM A;  5HW3 A;  4FCF A;  3GQZ A;  1M40 A;  1SHV A;  4U3T A;  4WZ4 A;  4S2N C;  1KGE A;  3VSK A;  2Y2I A;  2IWD A;  5DF7 A;  3SH8 A;  5CGS A;  2ZC3 B;  3VOY A;  3NBL A;  4OPR A;  1W8Y A;  3IT9 A;  2QMI A;  3ZNY A;  5D3O A;  5FA7 A;  4X69 A;  4R4S A;  3AGF A;  4Y0O A;  3HLG A;  2XFS A;  4OPQ A;  5A90 A;  5KMW A;  4X68 A;  1BLP A;  3VSL A;  1ES4 A;  4EBN A;  3TSG A;  4R4R A;  2OLV A;  2HDR A;  2WGW A;  1VM1 A;  3BFE A;  3P98 A;  4S2N A;  1MWT A;  1PZO A;  1PWC A;  1TDG A;  3MZF A;  4PPR A;  1GHM A;  5HX9 A;  5HL1 A;  3QNC A;  5GHX A;  4WM9 A;  3QHY A;  2HDS A;  1IYQ A;  4E3K A;  1XX2 A;  4WMC A;  3RXW A;  1MBL A;  2Y2M A;  1TEM A;  3ZG0 A;  4GDN A;  4QB8 A;  4BD0 A;  4NET A;  1GHI A;  3M2K A;  3OPP A;  3TOI A;  1E4D A;  2R9X A;  2B5R A;  1LI0 A;  2Y2G A;  1MY8 A;  2Z2L B;  3IH8 A;  1BLC A;  4KG2 A;  3Q82 A;  2IWB A;  1K57 C;  2Y4A A;  3EQU A;  4EV4 A;  3FYZ A;  3ITB A;  5FAP A;  1K25 A;  3GVB A;  3W4Q A;  3TG9 A;  3LEZ A;  3UN7 A;  1L0F A;  4KG6 A;  3IHB A;  3W4P A;  5FI2 A;  5M19 A;  3QNB A;  4E3M A;  2A3U A;  3BFC A;  1BUE A;  3CMZ A;  3PAG A;  3IWO A;  5EEC A;  3SOI A;  4LV1 A;  2HP6 A;  3G32 A;  1L2S A;  1CEG A;  2Z2M B;  3HL9 A;  4OPY A;  1CEF A;  5FI6 A;  2ZC5 B;  1L0G A;  5AQB A;  4ZJ1 A;  5DTK A;  3UE3 A;  2PBY A;  3HUO A;  4MBK A;  5CEB A;  3VFF A;  3N4I A;  4OLG A;  4ZJ2 A;  2CC1 A;  4JF4 A;  4GOG A;  4KZB A;  4GD8 A;  5FAO A;  4X53 A;  5FI7 A;  5M1A A;  4XXR A;  1WYB A;  5E2E A;  1GA9 A;  5CTN A;  1G68 A;  2WAE A;  2Q9M A;  2RCX A;  1BLS A;  1BLH A;  1CI9 A;  4JLF A;  4JKT A;  4WEJ A;  4HBT A;  1SKF A;  3PBS A;  2G2W A;  1FR6 A;  3IXB A;  1KGG A;  4BL2 A;  3CG5 A;  4MLL A;  1S0W A;  1U60 A;  4S2I A;  1K54 C;  1LL5 A;  3GSG A;  3NCK A;  4N9K A;  1Q2P A;  4CPK A;  4DE3 A;  3IF5 A;  2XLN A;  1YLJ A;  3VP3 A;  3NDG A;  5FAS A;  5EOE A;  2EXA A;  3UPP A;  3NY4 A;  4GB7 A;  3BFD A;  1JTG A;  4XUX A;  3ITA A;  4P87 A;  5FQI A;  1XP4 A;  3G2Y A;  4OLD A;  4KZ9 A;  1J9M A;  2ZQC A;  1OME A;  2ZJ9 A;  1DJC A;  3W4O A;  3MKE A;  3N8L A;  4WEK A;  5EVI D;  3HLD A;  5FQQ A;  5JYP A;  1KE4 A;  3V5M A;  3O86 A;  4Y7P A;  5KZH A;  1RP5 A;  4KZ3 A;  4U0T A;  3AGE A;  1E3U D;  4PM9 A;  2OSU A;  3BFF A;  3PBR A;  1K38 A;  3RXX A;  3ZG9 B;  3PBN A;  3BLS A;  3BEC A;  1RGZ A;  4KQO A;  1EI5 A;  5A91 A;  2BLS A;  1N4O A;  4JF6 A;  1XA1 A;  4XUZ A;  4OQI A;  2XD5 A;  3G30 A;  3MFD A;  3OCN A;  3MZD A;  1ES3 A;  4ID4 A;  2X01 A;  4IBX A;  2EX6 A;  4FSF A;  4OON A;  1IKG A;  2ZC7 A;  2EX2 A;  3HLW A;  5FDH A;  5CER A;  3C7V A;  4WMC D;  3V3S A;  1NZU A;  1XA7 A;  5F83 A;  2A49 A;  5A93 A;  4JPM A;  1LHY A;  2ZD8 A;  1MXO A;  3GTC A;  2WK0 A;  4O7D A;  5EVI A;  2WAD A;  3IF6 B;  4L0L A;  4M3K A;  1Z6F A;  4LEN A;  1HVB A;  3G31 A;  4MBF A;  4EUZ A;  2ZC4 B;  5CED A;  1L0D A;  1PI5 A; 
#chains in the Genus database with same CATH topology
 3IS2 A;  2W3F A;  5HPF A;  3QP5 A;  5MC7 A;  3EGX C;  2Y2K A;  3W8K A;  4X1M A;  1ODV A;  2V0W A;  4Y17 A;  1SKO A;  1S4S A;  4EBL A;  2ZOI A;  3DWK A;  2CMN A;  1PNE A;  3JVV A;  4LV0 A;  2LB5 A;  3ZGA B;  4HH2 A;  2GJ3 A;  1MWU A;  5FAQ A;  4KZ6 A;  2PD8 A;  5GLA A;  3WWX A;  4X56 A;  3V39 A;  1ERO A;  2W3D A;  2Z6C A;  4UAA A;  3T12 B;  3B42 A;  4Q8I A;  5J3W A;  3JPU A;  4N1X A;  1ONH A;  3LIB A;  5AQA A;  3LIC A;  4B4Z A;  1EWZ A;  2PU4 A;  3TJZ C;  1OT6 A;  3CWF A;  4ZRR A;  1PI4 A;  1QME A;  3MKF A;  2JCH A;  2Y2L A;  2ZL1 A;  5HAR A;  1K4E A;  5EOO A;  1Q2Q A;  4B93 A;  4PM5 A;  4Y13 A;  3VP1 A;  5CTM A;  3U4L P;  5CEC A;  2JHE A;  3VOL A;  4CLC B;  1OPX A;  3G4P A;  1ZTU A;  1G5U A;  1IYO A;  1TS0 A;  4C6Y A;  2PR5 A;  2PR6 A;  3S7N A;  5F1G A;  3UE6 A;  2YKF A;  4MN6 A;  3MQO A;  1H0M A;  1KVM A;  1E25 A;  1YLY A;  1NWZ A;  1O7E A;  4OQ0 A;  4B4X A;  1H3Q A;  3ZFZ A;  1GCE A;  4GDB A;  4G3W A;  4E3J A;  1SDE A;  4U0X A;  4I3I A;  4WZ5 C;  3H82 B;  3T4J A;  5F69 A;  1MPL A;  5E2G A;  2Q0O A;  4GHI A;  4G3K A;  1RCJ A;  2C6W B;  5AQ7 A;  2VZW A;  3MBZ A;  3R4K A;  1Z09 A;  3TRC A;  3FPV A;  3WS5 A;  2HPB A;  1NZO A;  1ZG6 A;  1G6A A;  5CRF A;  2QYB A;  2H0Y A;  3C4P A;  3IX8 A;  1P97 A;  3C7U A;  2D01 A;  1OTE A;  1ACF A;  4R38 A;  5CHM A;  2INW A;  4YWZ A;  2O9A A;  2HF6 A;  1FQG A;  1LT0 A;  4A5R A;  3OZH A;  2ZL1 B;  1VHM A;  3WS1 A;  2BG1 A;  2V1B A;  3GR2 A;  1WE4 A;  1BT5 A;  1XJ6 A;  1JNU A;  3ZG5 A;  3DBA A;  2NUT C;  4KQD A;  5GLB A;  3IWQ A;  3LGO A;  4RX3 A;  5TBM B;  3Q1F A;  3UPN A;  1ZG4 A;  4CQH A;  3D4F A;  1UWP X;  4OPZ A;  1H8Z A;  1YLW A;  4YOF A;  3VMA A;  2WUQ A;  1IEL A;  5DF8 A;  2AVX A;  3GEC A;  3C8C A;  3SS4 A;  3D72 A;  3N7W A;  3ZVT A;  2Y2J A;  3OPR A;  1YQS A;  2RL3 A;  3RH8 B;  1T1C A;  3B47 A;  2Y59 A;  1MWS A;  1FIK A;  3O3V A;  2QWS A;  4DKI A;  1DJA A;  3M6B A;  4WLA A;  4D2O A;  3BQA A;  3ZNT A;  2HJE A;  5L2F A;  2JKG A;  3ZVW A;  2ZM2 A;  4L9F A;  4F3L A;  3G35 A;  5I94 A;  5HFO A;  2B95 A;  2QPN A;  1W5D A;  1YT4 A;  1PRQ A;  3HUM A;  1YLZ A;  4RA7 A;  1ERM A;  4CLC E;  2WKH A;  3HJI A;  1C3B A;  3LUQ A;  4IVK A;  5IU1 A;  1K4F A;  5CGW A;  1W63 M;  3SS5 A;  2JKF A;  1MKM A;  4UA6 A;  2OOL A;  2UV0 E;  2KX6 A;  1PW1 A;  3LCE A;  1TDL A;  1KGF A;  4EWF A;  2V8C A;  1YM1 A;  3DTM A;  1K55 A;  4IUK A;  4R0Q A;  5DJT A;  4MEZ A;  3Q81 A;  4R70 A;  4MDZ A;  2VKS A;  2PYP A;  3N8S A;  3T4L A;  1HZO A;  4Q0I A;  4JXS A;  3BLM A;  5FQJ A;  4RQ9 A;  3UPO A;  4Y5F A;  4BL3 A;  1CK3 A;  3UB8 A;  4FOF A;  3MXR A;  3CPT A;  5GLD A;  2JC7 A;  4DE1 A;  2J3W A;  3LY3 A;  3LFV A;  1W79 A;  2J9O A;  2KDK A;  3NOT C;  4I3A A;  3IX3 A;  3A3E A;  4WYY A;  3LID A;  5HW3 A;  3GQZ A;  1XJ4 A;  1GSX A;  2ZC3 B;  3NBL A;  3IT9 A;  2QMI A;  4X69 A;  4R4S A;  3KSF A;  4Y0O A;  4OPQ A;  2XFS A;  5A90 A;  5KMW A;  1XFQ A;  4X68 A;  3VSL A;  3P98 A;  1MWT A;  1PZO A;  5GHX A;  3A0S A;  1S1Y A;  2JN7 A;  2J3T C;  2VJW A;  3M2K A;  1P9W A;  2Y2G A;  2Z2L B;  1BLC A;  4KG2 A;  3Q82 A;  2VX8 A;  2JKT I;  5FAP A;  4EEU A;  3MJQ A;  1EW0 A;  3W4Q A;  5HSQ A;  4KG6 A;  3W4P A;  5FI2 A;  3QNB A;  4E3M A;  3BFC A;  4FUW A;  3CMZ A;  3IWO A;  2HP6 A;  1S1Z A;  2Z2M B;  2ZC5 B;  5DTK A;  1HLU P;  2CC1 A;  5HZH A;  3MSH A;  5FAO A;  4X53 A;  3VE4 A;  2ZMF A;  1XJ2 A;  4XXR A;  1G68 A;  2WAE A;  3ICY A;  1CI9 A;  4HBT A;  1SKF A;  5DKK A;  4O01 A;  4KUO A;  1P0Z A;  4GJ4 A;  3LR5 A;  4DE3 A;  4HY8 A;  3NDG A;  4AFI A;  5FAS A;  2EXA A;  3RTY A;  3NY4 A;  4P87 A;  2ZQC A;  1OME A;  1DJC A;  1OTD A;  3HLD A;  1KE4 A;  2D02 A;  4Y7P A;  3IX4 A;  4MN5 A;  1E3U D;  3BFF A;  3RXX A;  1MZU A;  3BEC A;  1EI5 A;  3EWK A;  2H28 A;  4OQI A;  2XD5 A;  1ES3 A;  4ID4 A;  2EX6 A;  4OON A;  2ZC7 A;  4WL9 A;  2MJ6 A;  2A49 A;  4LRY C;  3T4K A;  4QPR A;  4JPM A;  4HHD A;  3GTC A;  2WK0 A;  3FG8 A;  4L0L A;  3A0R A;  3G31 A;  1L0D A;  1PI5 A;  3DTK A;  3B33 A;  3MR0 A;  2J9P A;  1K55 C;  1PW8 A;  1YLT A;  4MBH A;  3C30 A;  5DJU A;  1GA0 A;  5EPH A;  1TS8 A;  4GZB A;  2OWH A;  5FDS A;  2WZZ A;  1SDN A;  3MXS A;  4EER A;  4RYE A;  1BZA A;  5EV0 A;  2P9V B;  1FCM A;  4LCM A;  4BWI A;  2PD7 A;  3BFG A;  3PBT A;  3BW6 A;  3QP4 A;  1YSP A;  3E4O A;  1I2W A;  4EET B;  3UB6 A;  3BM6 A;  3F1P A;  3UE0 A;  2GNX A;  3HJK A;  4DDY A;  2XQZ A;  1IEM A;  2E8I A;  3GDI A;  3PTE A;  2A24 B;  2UWX A;  4IJG A;  5L09 A;  3ZHH A;  1N9O A;  5FEG A;  3FZC A;  1XGI A;  4JXG A;  2QJ7 A;  4DXC A;  3WS0 A;  3BJN A;  4MMN A;  5E2H A;  1OJ5 A;  3C4O A;  1KE0 A;  2XSS A;  1VEU A;  4NK3 A;  2Y2Q A;  3R7W A;  4P6B A;  4O8G A;  4QD4 A;  3HLB A;  4N1H A;  4R23 A;  2FH5 A;  2Q9N A;  4HQA A;  3WS2 A;  1O07 A;  3CHW P;  4KZ4 A;  2XA7 M;  1TVF A;  1NLY A;  2J80 A;  3NOU C;  2R78 A;  1CQA A;  3HUN A;  4B88 A;  2VV8 A;  4WZ5 A;  3ZG7 B;  4R1G A;  3S1Y A;  4H6J A;  1S66 L;  2HDQ A;  3Q7V A;  3BRM A;  5CGX A;  4I39 A;  3E2K A;  2G2U A;  4CJN A;  5K5B A;  3FWL A;  2M1C A;  1P9R A;  1M6K A;  5A92 A;  4G3V A;  1K57 A;  5KIZ A;  4E6X A;  5GHZ A;  3UDF A;  4NXF A;  4WUJ A;  2WAF A;  1CF0 A;  1WA9 A;  2HJ9 C;  3ZCZ A;  4K0X A;  4GS9 B;  2PRF A;  2ZBB A;  3WRZ A;  4BBU A;  3LR3 A;  5AVE A;  5HAP A;  4M4X A;  4OOL A;  3DAV A;  4EBP A;  1VEU B;  1VB6 A;  5G4Y A;  2K31 A;  2IA2 A;  1IYP A;  1K56 D;  2O9C A;  3QP8 A;  4S2L A;  1ESI A;  2I72 A;  4NEE D;  4RX2 A;  2JKR M;  5GL9 A;  5E2F A;  1NXY A;  1X0O A;  3FPW A;  4ZAM A;  3SH9 A;  4HBU A;  3UE1 A;  5CHJ A;  3LR0 A;  4HES A;  3IWI A;  4D60 A;  4X1L A;  4ARZ B;  3E4P A;  3VE3 A;  3H9W A;  4BD1 A;  1H5X A;  2JE5 A;  2P74 A;  1K54 A;  2O99 A;  3IQA A;  3CI6 A;  4KUK A;  3DTI A;  1NYY A;  3E98 A;  2V8F A;  5EVI C;  4PKY G;  3MQ0 A;  4PM7 A;  3G2Z A;  3WS4 A;  3UY6 A;  4BEN A;  3CIT A;  1KVL A;  4GD6 A;  2DCF A;  2W3H A;  5FQM A;  4CLC C;  4ZDX A;  2P04 A;  2EFX A;  3KYQ A;  2Y2N A;  3CLO A;  1LSX A;  1LL9 A;  4BMW A;  4LV2 A;  3VP0 A;  3ZDJ A;  2VLG A;  2DNS A;  4X55 A;  4BQM A;  1N9B A;  2ZQ7 A;  3OOV A;  2L0W A;  3A0V A;  5F1F A;  3LY4 A;  4OQH A;  3NIA A;  1FOF A;  1F9I A;  4QHC A;  5IS1 A;  1LSW A;  3IS2 B;  5FAT A;  4DDS A;  4FCF A;  1SHV A;  4GW9 A;  4U3T A;  3VSK A;  1TS7 A;  2IWD A;  3HLG A;  1BLP A;  3EEH A;  4EBN A;  3UB5 P;  2L4R A;  1VM1 A;  2WGW A;  4S2N A;  3KSH A;  5HX9 A;  1GHM A;  4WM9 A;  1G6O A;  3EOI A;  3QHY A;  4LFU A;  4E3K A;  1T1B A;  5FL3 A;  4WMC A;  3ZG0 A;  4GDN A;  3F1N B;  4QB8 A;  3OPP A;  3L7H A;  2B5R A;  2M7U A;  1MY8 A;  2IWB A;  3EQU A;  4PHT A;  4R3A A;  3FYZ A;  3TG9 A;  1L0F A;  3LIF A;  3BQ8 A;  2A3U A;  3T4O A;  1BUE A;  3G32 A;  1L2S A;  2VV6 A;  3HL9 A;  1CEF A;  2KOI A;  1STZ A;  3UE3 A;  4OLG A;  4JF4 A;  4GD8 A;  4JKT A;  1BLS A;  1BLH A;  1ZHH B;  3PBS A;  3JVU A;  4HP4 A;  3GSG A;  3NCK A;  4EXO A;  3S7P A;  5HWV A;  1A0K A;  3UPP A;  4GB7 A;  3BFD A;  2PBD P;  2GX5 A;  1XP4 A;  4OLD A;  4KZ9 A;  1J9M A;  3MKE A;  4WEK A;  5FQQ A;  5EVI D;  3V5M A;  1L3L A;  4P6Z S;  4U0T A;  3AGE A;  2OSU A;  3PBR A;  2Z6D A;  5F6A A;  4K08 A;  5F68 A;  4KQO A;  5A91 A;  1N4O A;  2LB9 A;  1XA1 A;  3L9K A;  3G30 A;  2XA7 S;  3OCN A;  3S7O A;  2OAQ 1;  4EU0 A;  2X01 A;  3G6O A;  1G28 A;  4FSF A;  2FZ0 A;  1IKG A;  3HLW A;  4GHI B;  5FDH A;  3C7V A;  5F83 A;  5L07 A;  3K2N A;  3BWL A;  3MMH A;  2WKQ A;  5EVI A;  2WAD A;  1Z6F A;  4UQI S;  4EUZ A;  3BY8 A;  2ZC4 B;  5CED A;  2XRO A;  3EQV A;  4JGR A;  5EVI B;  4S2M A;  1FCN A;  2HP5 A;  1ERQ A;  3E2L A;  4GCZ A;  4IBR A;  2GZA A;  2VA0 A;  2PHY A;  3K3C A;  2EX8 A;  2BTF P;  4CLC A;  4KQQ A;  1NRJ A;  2G7U A;  1V9Y A;  5L8M A;  3Q7V B;  2V0U A;  3BY9 A;  4IED A;  3UDX A;  3F1P B;  2X02 A;  3MF0 A;  1F5M A;  4OOY A;  4FD8 A;  4UQI M;  5GLC A;  5FEF A;  2EFU A;  3IXD A;  1ES5 A;  4QY6 A;  3UB9 A;  2V20 A;  4R3J A;  3I7J A;  3MZE A;  2EA9 A;  3QP1 A;  4WEL A;  4KQR A;  2XGN A;  1W8Q A;  4DRT A;  2OV5 A;  5CXW A;  1W63 Q;  1QMF A;  5TFQ A;  3IHA A;  3V67 A;  3ZG8 B;  1CI8 A;  4EW7 A;  4JGP A;  4FH4 A;  1D1J A;  2W3E A;  4OOM A;  2WGI A;  4E3L A;  3UO9 A;  3EEA A;  4IVI A;  1DP8 A;  1V9Z A;  3T1Q B;  4UA7 A;  1Y54 A;  4Y0U A;  3M6H A;  4P85 A;  4KZ8 A;  1OT9 A;  2XF3 A;  3VP2 A;  2VK3 A;  3IH9 A;  2QHK A;  1T1A A;  2W3G A;  5AJG A;  4UA9 A;  3IBR A;  1ZKJ A;  1K6R A;  4MNR A;  3U2A A;  2PU2 A;  4FH2 A;  4QJG A;  3LYX A;  4ETZ A;  4WBG A;  5JYO A;  2B02 A;  1W7F A;  4N9L A;  1S67 L;  4NXB A;  4HI4 A;  1PWD A;  2YKH A;  3FKW A;  4S2J A;  3IXG A;  1NY0 A;  4KZA A;  2HZ5 A;  4Z9Q A;  3SH7 A;  3KX0 X;  4R3B A;  5EVE A;  4YNR A;  5F82 A;  4ZTK A;  4WN5 A;  2ZQD A;  4GNU A;  4LGW A;  3C38 A;  4I38 A;  3UNW A;  2WKE A;  2O9B A;  5G4Z A;  3S4X A;  4PAU A;  2ZM8 A;  1I2S A;  4S2O A;  1YPR A;  3PAE A;  4Y0T A;  3P7N A;  4KZ7 A;  5HDC A;  1OTI A;  5CX7 A;  1VQQ A;  2ZQ9 A;  4CLC D;  2K2N A;  1E3U A;  1ALQ A;  1LSV A;  2HP9 A;  1H8Y A;  2V1Z A;  4ZBE A;  2XFT A;  2GDN A;  5TJJ A;  1TS6 A;  3O88 A;  4ESP A;  2H0T A;  1K6S A;  5HDD A;  3HRE A;  4EQI A;  5KSC A;  2QZ6 A;  5M18 A;  3OPL A;  5TGF A;  3HCY A;  1I5Q A;  2JKR I;  4R6L A;  3GRJ A;  3HLE A;  4EUV A;  2J8Y A;  2JBF A;  1JTD A;  5DF9 A;  3D3O A;  3MQQ A;  4N92 A;  3GMW A;  1DY6 A;  4HH3 A;  1K56 A;  5DTT A;  1PFL A;  3ISG A;  3NHQ A;  2I9V A;  4E6W A;  5FQ9 A;  1Y4O A;  5U47 A;  2H5S A;  4LV3 A;  2XR0 A;  1BUL A;  2ZLY A;  3HLC A;  4ZJ3 A;  4PKY A;  1DP9 A;  1S4R A;  3CUE C;  3NI9 A;  2A24 A;  1YMX A;  2KLI A;  3T1R A;  1LI9 A;  3LIE A;  4DJ2 A;  4JXV A;  1KOU A;  2WKP A;  2Y2P A;  5EUA A;  3HLF A;  4KZ5 A;  1JWP A;  3KO6 A;  4F94 A;  3UMD A;  4DXB A;  4XT2 B;  3V50 A;  3WRT A;  2Y2H A;  4P6Z M;  1LLB A;  1FIL A;  4OP5 A;  4DE0 A;  3UME A;  4S2K A;  2Y2O A;  3HVF A;  5EM0 A;  1MKI A;  5IHV A;  4K91 A;  5J7E A;  2WKI A;  3VOZ A;  3GV9 A;  5FQK A;  4XT2 A;  2V1A A;  2V9A A;  4EES A;  2R9W A;  1AWI A;  2PAV P;  3Q7Z A;  3PBQ A;  3IXH A;  2HDU A;  1YSQ A;  1XFN A;  3D9Y A;  2XD1 A;  1XXM A;  1MC0 A;  2Y2I A;  1SKO B;  3ZQ5 A;  5CGS A;  3ULF A;  4OPR A;  3NUL A;  2P7J A;  3ZNY A;  1YKD A;  5J4E A;  3T4S A;  4HJ4 A;  4IHQ A;  3AGF A;  1ES4 A;  1PWC A;  5HL1 A;  2ZOH A;  3QNC A;  1XX2 A;  3RXW A;  1MBL A;  1TEM A;  4BD0 A;  2QKP A;  1GHI A;  1E4D A;  2R9X A;  1LI0 A;  3IH8 A;  2W27 A;  3CPT B;  1GSV A;  3KYE A;  1K57 C;  4EV4 A;  1K25 A;  3GVB A;  3LEZ A;  3UN7 A;  2EWV A;  3PAG A;  3T4T A;  1SZV A;  1CEG A;  5HD3 A;  3LR4 A;  2VEA A;  4ZJ1 A;  4MBK A;  4L9E A;  5FI7 A;  5M1A A;  5E2E A;  1GA9 A;  5CTN A;  2Q9M A;  4JLF A;  5HD5 A;  4WEJ A;  3IXB A;  4BL2 A;  4IUH A;  5IT5 A;  1S0W A;  3SZT A;  4S2I A;  4NKP A;  1K54 C;  3MS6 A;  1LL5 A;  4N9K A;  1F98 A;  4H6J B;  1Q2P A;  2PDR A;  5EM1 A;  4CPK A;  1F2K A;  3IF5 A;  2L1M A;  3NOP C;  4Q0J A;  5EOE A;  1JTG A;  4XUX A;  5FQI A;  3G2Y A;  3NJA A;  5HWW A;  2ZJ9 A;  4LRZ E;  3W4O A;  3N8L A;  1OJG A;  2W1R A;  1RP5 A;  3ZG9 B;  1K38 A;  3RFB A;  3CAX A;  4BBT A;  1N9N A;  2EX2 A;  4B9O A;  5CER A;  3H82 A;  3V3S A;  1XA7 A;  3LI9 A;  1OTA A;  3KSG A;  5A93 A;  1MXO A;  2ZD8 A;  4O7D A;  4LRX C;  1HVB A;  4MBF A;  5TBM A;  4DN0 A;  3A3I A;  3VP4 A;  1YMS A;  3C2W A;  3OC2 A;  2EXB A;  2WYX A;  4Y2F A;  4H8R A;  4HIA A;  3UB7 A;  1YLP A;  1NYM A;  5BOH A;  4NG2 A;  1FSY A;  2EWW A;  5DTS A;  1LL8 A;  5C5K A;  5A8B A;  1UGU A;  5HL6 A;  3NEC A;  4X25 A;  2VV7 A;  1RGY A;  5EE8 A;  4GKU A;  1T18 A;  1YAX A;  4QWO A;  1Y28 A;  2XH9 A;  4LCL A;  2M7V A;  4EEP A;  4E04 A;  2E8J A;  4GN2 A;  3UDI A;  1S6R A;  1IKI A;  5CHU A;  4DMZ A;  1IFQ A;  1KE3 A;  3O5Y A;  3W2Z A;  1ZC2 A;  2P9V A;  3FC7 A;  4OVD A;  5FSR A;  3QP6 A;  4DE2 A;  1PZP A;  1NLZ A;  4PMA A;  3O87 A;  3CJM A;  3T1X A;  3PHY A;  3AGD A;  2ZC6 B;  3DW0 A;  4JGO A;  3T1S A;  4ARZ A;  2ZQ8 A;  1ESU A;  4WF0 A;  2EX9 A;  4HJ6 A;  3LEQ A;  1BSG A;  1ONG A;  2VGJ A;  5G18 A;  4OKP A;  3E0Y A;  5J8X A;  2FFF B;  2H10 A;  4NXE A;  1GHP A;  3M2J A;  3CZD A;  4E3N A;  1XPB A;  4HOI A;  4C75 A;  3P09 A;  1VET A;  3N8R A;  3V3R A;  3LIA A;  3FKV A;  4BJP A;  4DF6 A;  5F5Y A;  5E43 A;  3HBR A;  4Q0H A;  1JWZ A;  1H8M A;  2J7V A;  1KDW A;  1N9L A;  4PM6 A;  2DMW A;  3IF6 A;  5HPI A;  1KDS A;  4KG5 A;  2QJ5 A;  2XK1 A;  3FV7 A;  4HEF A;  4MN7 A;  1DP6 A;  4P0M A;  4JBF A;  2Y55 A;  2ACG A;  2W1T A;  3PYP A;  3PXP A;  1IOU A;  1IYS A;  1JVJ A;  2ZMA A;  4QU3 A;  2Y79 A;  1HTZ A;  1TF1 A;  4X6T A;  3OPH A;  3A3D A;  5GHY A;  1MWR A;  5L10 A;  3KSI A;  3NC8 A;  1FSW A;  4OQG A;  5HAQ A;  5KSH A;  1BTL A;  3Q07 A;  1J3W A;  1XGJ A;  4QY5 A;  1L0E A;  4OP8 A;  1OTB A;  1PIO A;  4DJ3 A;  4LPZ A;  5I5L A;  4OH0 A;  2V2F F;  2J3T D;  1TD5 A;  1DJB A;  4Z1W A;  3B3X A;  3JYI A;  1HD8 A;  1BYW A;  5EVL A;  1WYC A;  2ZQA A;  2VGK A;  3NDE A;  2WZX A;  1ES2 A;  2PYR A;  2W0N A;  4K0W A;  3RJU A;  3C5A A;  4UHU A;  5DVA A;  3MXQ A;  1VET B;  5TR7 A;  5AQ9 A;  4S2P A;  4E3I A;  4YIN A;  4PM8 A;  4KEN B;  2W1T B;  3A3F A;  2WGV A;  2FFY A;  4E3O A;  3VFH A;  3BYD A;  3F1O B;  4I5S A;  3F1N A;  5LBR A;  3BEB A;  2P08 A;  1SCW A;  4JF5 A;  2ZMV A;  2JKT M;  2B18 A;  4C3Q A;  3DWZ A;  2DRW A;  4HJ3 A;  4JGQ A;  4YFM A;  3LO7 A;  4GS9 A;  3S7Q A;  1AXB A;  3SS3 A;  5HDS A;  2XDM A;  2Y91 A;  3OCL A;  1CJF A;  4NXG A;  1FCO A;  2IWC A;  4Y3I A;  1PYY A;  1JWV A;  2XRN A;  4JXW A;  2OWJ A;  3G34 A;  5HAI A;  4BLM A;  5DKL A;  1NJ4 A;  3IBJ A;  2ZM0 A;  1PWG A;  1XKZ A;  3H7W A;  3N6I A;  4ME4 A;  1FR1 A;  4MCW A;  2XEP A;  3A3J A;  4RVA A;  2WGW B;  3S22 A;  3VV4 A;  4L9G A;  2C5W B;  2BAS A;  3IF6 C;  5EFW A;  3T4Q A;  4FTX A;  3PBO A;  2PT7 A;  2X71 A;  5DFX A;  2OLU A;  1NRF A;  3KYZ A;  1T19 A;  1M40 A;  4WZ4 A;  4BBV A;  3EGD C;  1XJ3 A;  1KGE A;  4S2N C;  5DF7 A;  4GLQ A;  3SH8 A;  3DTE A;  3PR6 A;  3VOY A;  1W8Y A;  2A2L A;  2HV1 A;  5D3O A;  5FA7 A;  2O0Y A;  4UEY A;  3MFX A;  2HGV A;  3TSG A;  4R4R A;  2OLV A;  2HDR A;  3BFE A;  3MZF A;  4PPR A;  1TDG A;  2HDS A;  1IYQ A;  4HNB A;  2Y2M A;  1K0K A;  4NET A;  3TOI A;  4O0P A;  3OBF A;  5DFY A;  3T50 A;  2Y4A A;  2Y8H A;  3ITB A;  4EQ1 A;  3IHB A;  5M19 A;  3H7W B;  5EEC A;  3SOI A;  4LV1 A;  2K7S A;  4OPY A;  5FI6 A;  3SW1 A;  1D06 A;  5AQB A;  1L0G A;  4ETX A;  2PBY A;  3HUO A;  5CEB A;  3VFF A;  3N4I A;  4ZJ2 A;  4HP9 A;  4GOG A;  4KZB A;  1WYB A;  2VGL S;  2RCX A;  2VGL M;  2G2W A;  1FR6 A;  1KGG A;  3CG5 A;  4MLL A;  1UWN X;  1U60 A;  3K3D A;  3CUE A;  3ZYT A;  2XLN A;  1YLJ A;  3VP3 A;  3ITA A;  3QP2 A;  4I3J A;  1GSW A;  4Y15 A;  5JYP A;  5KZH A;  3O86 A;  4KZ3 A;  4PM9 A;  5HWT A;  3PBN A;  3BLS A;  2OAP 1;  1RGZ A;  2BLS A;  4JF6 A;  4XUZ A;  4LLO B;  3MFD A;  3TW8 A;  3MZD A;  3F1O A;  4IBX A;  4F3L B;  3E4Q A;  4WMC D;  3LI8 A;  2WKR A;  5AVF A;  1NZU A;  3TE8 A;  1D7E A;  3OLO A;  1LHY A;  3R7W B;  3IF6 B;  4II7 A;  1DRM A;  4M3K A;  4LEN A;  2NUP C;  3P01 A; 
#chains in the Genus database with same CATH homology
 3A3I A;  3VP4 A;  3EQV A;  1YMS A;  3OC2 A;  5EVI B;  2EXB A;  2Y2K A;  2WYX A;  4S2M A;  4H8R A;  1FCN A;  2HP5 A;  1ERQ A;  3E2L A;  2J9P A;  4IBR A;  3W8K A;  1YLP A;  1NYM A;  5BOH A;  2EX8 A;  1K55 C;  1PW8 A;  1YLT A;  4KQQ A;  4MBH A;  4EBL A;  1FSY A;  3DWK A;  5DTS A;  3Q7V B;  4LV0 A;  1GA0 A;  3ZGA B;  4IED A;  5EPH A;  4GZB A;  3UDX A;  5EE8 A;  1RGY A;  1MWU A;  4GKU A;  5FAQ A;  2X02 A;  4OOY A;  2XH9 A;  4FD8 A;  2WZZ A;  1SDN A;  3MXS A;  4KZ6 A;  4LCL A;  5GLA A;  4RYE A;  1BZA A;  3WWX A;  4X56 A;  3V39 A;  2P9V B;  1ERO A;  1FCM A;  5GLC A;  4UAA A;  2EFU A;  3IXD A;  1ES5 A;  4LCM A;  4QY6 A;  4GN2 A;  4S2J A;  3UDI A;  1S6R A;  2V20 A;  1IKI A;  4R3J A;  5CHU A;  4Q8I A;  3BFG A;  3PBT A;  3I7J A;  4N1X A;  1ONH A;  5AQA A;  1KE3 A;  3MZE A;  1ZC2 A;  1I2W A;  2P9V A;  4B4Z A;  1EWZ A;  4OVD A;  5FSR A;  4DE2 A;  2PU4 A;  3BM6 A;  1PZP A;  4WEL A;  4KQR A;  3UE0 A;  2XGN A;  1W8Q A;  1PI4 A;  4PMA A;  1QME A;  3MKF A;  2OV5 A;  4DRT A;  2JCH A;  3O87 A;  2Y2L A;  5CXW A;  3CJM A;  5HAR A;  1K4E A;  4DDY A;  5EOO A;  1Q2Q A;  1QMF A;  2XQZ A;  5TFQ A;  3VP1 A;  3AGD A;  1IEM A;  5CTM A;  4PM5 A;  2ZC6 B;  3DW0 A;  3IHA A;  5CEC A;  2E8I A;  3PTE A;  3ZG8 B;  1CI8 A;  2UWX A;  2ZQ8 A;  3G4P A;  1ESU A;  1IYO A;  4C6Y A;  2EX9 A;  4FH4 A;  3ZHH A;  4OOM A;  2WGI A;  1BSG A;  5F1G A;  4E3L A;  3UO9 A;  3FZC A;  4IVI A;  1ONG A;  2VGJ A;  5G18 A;  4OKP A;  1KVM A;  1XGI A;  4UA7 A;  1Y54 A;  4JXG A;  5J8X A;  2FFF B;  2H10 A;  3M6H A;  4P85 A;  4KZ8 A;  1E25 A;  1YLY A;  4Y0U A;  1GHP A;  4DXC A;  3M2J A;  3WS0 A;  2XF3 A;  1O7E A;  3IH9 A;  4OQ0 A;  3VP2 A;  3CZD A;  4B4X A;  4E3N A;  3ZFZ A;  1GCE A;  1XPB A;  4GDB A;  4UA9 A;  4E3J A;  4C75 A;  3P09 A;  1ZKJ A;  1SDE A;  5E2H A;  4U0X A;  3N8R A;  3V3R A;  4WZ5 C;  1K6R A;  4MNR A;  3C4O A;  1KE0 A;  2PU2 A;  1MPL A;  3FKV A;  4BJP A;  4DF6 A;  4FH2 A;  5E43 A;  3HBR A;  4NK3 A;  1JWZ A;  4QJG A;  2Y2Q A;  5E2G A;  2J7V A;  1KDW A;  4PM6 A;  1RCJ A;  3IF6 A;  4WBG A;  5JYO A;  1W7F A;  2C6W B;  1KDS A;  4N9L A;  4KG5 A;  4P6B A;  5AQ7 A;  3MBZ A;  4QD4 A;  2XK1 A;  3FV7 A;  4HEF A;  3WS5 A;  1PWD A;  4P0M A;  2HPB A;  4JBF A;  3HLB A;  1NZO A;  3FKW A;  3IXG A;  4N1H A;  1NY0 A;  4KZA A;  2Y55 A;  4R23 A;  2Q9N A;  1ZG6 A;  1G6A A;  5CRF A;  4Z9Q A;  3SH7 A;  5F82 A;  4R3B A;  2H0Y A;  4ZTK A;  3WS2 A;  1O07 A;  3C4P A;  2ZQD A;  1IYS A;  4GNU A;  4KZ4 A;  1JVJ A;  3C7U A;  1TVF A;  2ZMA A;  4QU3 A;  1HTZ A;  3UNW A;  2WKE A;  4X6T A;  3OPH A;  3A3D A;  3HUN A;  4B88 A;  3S4X A;  5CHM A;  2ZM8 A;  5GHY A;  4WZ5 A;  1I2S A;  1MWR A;  4S2O A;  3ZG7 B;  3PAE A;  1FQG A;  4A5R A;  4Y0T A;  4R1G A;  3NC8 A;  1FSW A;  3S1Y A;  3OZH A;  4OQG A;  4KZ7 A;  5HAQ A;  5KSH A;  1BTL A;  2HDQ A;  3Q7V A;  3BRM A;  3Q07 A;  3WS1 A;  1XGJ A;  4QY5 A;  1L0E A;  2BG1 A;  5CGX A;  4OP8 A;  3E2K A;  2G2U A;  3GR2 A;  1WE4 A;  4CJN A;  3FWL A;  1BT5 A;  1PIO A;  3ZG5 A;  1M6K A;  5GLB A;  1VQQ A;  5A92 A;  2ZQ9 A;  3IWQ A;  1K57 A;  1E3U A;  4OH0 A;  4RX3 A;  1ALQ A;  3Q1F A;  2HP9 A;  1H8Y A;  4E6X A;  2V1Z A;  2V2F F;  3UPN A;  4ZBE A;  1ZG4 A;  2XFT A;  5GHZ A;  1DJB A;  3B3X A;  3JYI A;  2GDN A;  3UDF A;  2WAF A;  3D4F A;  4OPZ A;  1HD8 A;  1H8Z A;  3O88 A;  1YLW A;  2H0T A;  1K6S A;  4K0X A;  5EVL A;  3ZCZ A;  1WYC A;  3WRZ A;  3HRE A;  2ZQA A;  4EQI A;  3VMA A;  5KSC A;  2QZ6 A;  5M18 A;  2VGK A;  3OPL A;  4OOL A;  2WUQ A;  5TGF A;  1IEL A;  3NDE A;  2WZX A;  5HAP A;  1ES2 A;  5DF8 A;  4EBP A;  4K0W A;  3SS4 A;  3RJU A;  3C5A A;  1I5Q A;  4UHU A;  5DVA A;  3N7W A;  3GRJ A;  1IYP A;  1K56 D;  3HLE A;  5TR7 A;  5AQ9 A;  4S2P A;  3ZVT A;  4E3I A;  4S2L A;  4YIN A;  2Y2J A;  3OPR A;  1ESI A;  2J8Y A;  1YQS A;  2RL3 A;  2JBF A;  1JTD A;  2I72 A;  5DF9 A;  4PM8 A;  2Y59 A;  1MWS A;  4N92 A;  4RX2 A;  4KEN B;  3O3V A;  5GL9 A;  3A3F A;  3GMW A;  2WGV A;  2FFY A;  5E2F A;  1NXY A;  3VFH A;  3BYD A;  4DKI A;  4E3O A;  4ZAM A;  1DY6 A;  1DJA A;  3M6B A;  4HBU A;  3SH9 A;  1K56 A;  3UE1 A;  5CHJ A;  4HES A;  5DTT A;  3BEB A;  3IWI A;  3ISG A;  4D2O A;  1SCW A;  3ZNT A;  4E6W A;  4JF5 A;  5L2F A;  5FQ9 A;  5U47 A;  2H5S A;  4LV3 A;  3ZVW A;  3DWZ A;  2XR0 A;  4C3Q A;  2ZM2 A;  2DRW A;  4BD1 A;  1BUL A;  1H5X A;  2JE5 A;  2P74 A;  4YFM A;  1K54 A;  2ZLY A;  3IQA A;  3HLC A;  4ZJ3 A;  3G35 A;  5I94 A;  5HFO A;  3LO7 A;  2QPN A;  3NI9 A;  1W5D A;  1NYY A;  1YT4 A;  3SS3 A;  1AXB A;  3HUM A;  1YLZ A;  1YMX A;  4RA7 A;  1ERM A;  2XDM A;  5EVI C;  2WKH A;  2Y91 A;  1C3B A;  1LI9 A;  3OCL A;  4IVK A;  1K4F A;  4PM7 A;  5CGW A;  3G2Z A;  3SS5 A;  4UA6 A;  3WS4 A;  4JXV A;  1PW1 A;  3UY6 A;  1FCO A;  2IWC A;  3LCE A;  2Y2P A;  5EUA A;  4BEN A;  1PYY A;  1KGF A;  1TDL A;  3HLF A;  4KZ5 A;  4EWF A;  1KVL A;  1JWP A;  1YM1 A;  1JWV A;  2DCF A;  3DTM A;  4GD6 A;  5FQM A;  1K55 A;  4ZDX A;  4F94 A;  4JXW A;  4R0Q A;  3G34 A;  4DXB A;  2EFX A;  5HAI A;  4BLM A;  1NJ4 A;  2Y2N A;  4MEZ A;  1LL9 A;  3Q81 A;  3V50 A;  4LV2 A;  3WRT A;  2Y2H A;  1LLB A;  3N8S A;  3VP0 A;  1HZO A;  4OP5 A;  4DE0 A;  3ZDJ A;  4JXS A;  3BLM A;  4S2K A;  5FQJ A;  2ZM0 A;  1PWG A;  2DNS A;  2Y2O A;  4X55 A;  4BQM A;  1XKZ A;  1N9B A;  3HVF A;  1MKI A;  5IHV A;  4BL3 A;  3UPO A;  4K91 A;  1CK3 A;  2WKI A;  2ZQ7 A;  3VOZ A;  3GV9 A;  3N6I A;  5FQK A;  1FR1 A;  2XEP A;  3A3J A;  4RVA A;  2WGW B;  5F1F A;  3S22 A;  3LY4 A;  4OQH A;  2C5W B;  2R9W A;  3IF6 C;  3MXR A;  3NIA A;  1FOF A;  4QHC A;  5GLD A;  2JC7 A;  3PBO A;  3Q7Z A;  4DE1 A;  3PBQ A;  3LY3 A;  1W79 A;  3IXH A;  2HDU A;  2J9O A;  2X71 A;  5FAT A;  2OLU A;  4DDS A;  1NRF A;  3A3E A;  4WYY A;  2XD1 A;  1XXM A;  5HW3 A;  4FCF A;  3GQZ A;  1M40 A;  1SHV A;  4U3T A;  4WZ4 A;  4S2N C;  1KGE A;  3VSK A;  2Y2I A;  2IWD A;  5DF7 A;  3SH8 A;  5CGS A;  2ZC3 B;  3VOY A;  3NBL A;  4OPR A;  1W8Y A;  3IT9 A;  2QMI A;  3ZNY A;  5D3O A;  5FA7 A;  4X69 A;  4R4S A;  3AGF A;  4Y0O A;  3HLG A;  2XFS A;  4OPQ A;  5A90 A;  5KMW A;  4X68 A;  1BLP A;  3VSL A;  1ES4 A;  4EBN A;  3TSG A;  4R4R A;  2OLV A;  2HDR A;  2WGW A;  1VM1 A;  3BFE A;  3P98 A;  4S2N A;  1MWT A;  1PZO A;  1PWC A;  1TDG A;  3MZF A;  4PPR A;  1GHM A;  5HX9 A;  5HL1 A;  3QNC A;  5GHX A;  4WM9 A;  3QHY A;  2HDS A;  1IYQ A;  4E3K A;  1XX2 A;  4WMC A;  3RXW A;  1MBL A;  2Y2M A;  1TEM A;  3ZG0 A;  4GDN A;  4QB8 A;  4BD0 A;  4NET A;  1GHI A;  3M2K A;  3OPP A;  3TOI A;  1E4D A;  2R9X A;  2B5R A;  1LI0 A;  2Y2G A;  1MY8 A;  2Z2L B;  3IH8 A;  1BLC A;  4KG2 A;  3Q82 A;  2IWB A;  1K57 C;  2Y4A A;  3EQU A;  4EV4 A;  3FYZ A;  3ITB A;  5FAP A;  1K25 A;  3GVB A;  3W4Q A;  3TG9 A;  3LEZ A;  3UN7 A;  1L0F A;  4KG6 A;  3IHB A;  3W4P A;  5FI2 A;  5M19 A;  3QNB A;  4E3M A;  2A3U A;  3BFC A;  1BUE A;  3CMZ A;  3PAG A;  3IWO A;  5EEC A;  3SOI A;  4LV1 A;  2HP6 A;  3G32 A;  1L2S A;  1CEG A;  2Z2M B;  3HL9 A;  4OPY A;  1CEF A;  5FI6 A;  2ZC5 B;  1L0G A;  5AQB A;  4ZJ1 A;  5DTK A;  3UE3 A;  2PBY A;  3HUO A;  4MBK A;  5CEB A;  3VFF A;  3N4I A;  4OLG A;  4ZJ2 A;  2CC1 A;  4JF4 A;  4GOG A;  4KZB A;  4GD8 A;  5FAO A;  4X53 A;  5FI7 A;  5M1A A;  4XXR A;  1WYB A;  5E2E A;  1GA9 A;  5CTN A;  1G68 A;  2WAE A;  2Q9M A;  2RCX A;  1BLS A;  1BLH A;  1CI9 A;  4JLF A;  4JKT A;  4WEJ A;  4HBT A;  1SKF A;  3PBS A;  2G2W A;  1FR6 A;  3IXB A;  1KGG A;  4BL2 A;  3CG5 A;  4MLL A;  1S0W A;  1U60 A;  4S2I A;  1K54 C;  1LL5 A;  3GSG A;  3NCK A;  4N9K A;  1Q2P A;  4CPK A;  4DE3 A;  3IF5 A;  2XLN A;  1YLJ A;  3VP3 A;  3NDG A;  5FAS A;  5EOE A;  2EXA A;  3UPP A;  3NY4 A;  4GB7 A;  3BFD A;  1JTG A;  4XUX A;  3ITA A;  4P87 A;  5FQI A;  1XP4 A;  3G2Y A;  4OLD A;  4KZ9 A;  1J9M A;  2ZQC A;  1OME A;  2ZJ9 A;  1DJC A;  3W4O A;  3MKE A;  3N8L A;  4WEK A;  5EVI D;  3HLD A;  5FQQ A;  5JYP A;  1KE4 A;  3V5M A;  3O86 A;  4Y7P A;  5KZH A;  1RP5 A;  4KZ3 A;  4U0T A;  3AGE A;  1E3U D;  4PM9 A;  2OSU A;  3BFF A;  3PBR A;  1K38 A;  3RXX A;  3ZG9 B;  3PBN A;  3BLS A;  3BEC A;  1RGZ A;  4KQO A;  1EI5 A;  5A91 A;  2BLS A;  1N4O A;  4JF6 A;  1XA1 A;  4XUZ A;  4OQI A;  2XD5 A;  3G30 A;  3MFD A;  3OCN A;  3MZD A;  1ES3 A;  4ID4 A;  2X01 A;  4IBX A;  2EX6 A;  4FSF A;  4OON A;  1IKG A;  2ZC7 A;  2EX2 A;  3HLW A;  5FDH A;  5CER A;  3C7V A;  4WMC D;  3V3S A;  1NZU A;  1XA7 A;  5F83 A;  2A49 A;  5A93 A;  4JPM A;  1LHY A;  2ZD8 A;  1MXO A;  3GTC A;  2WK0 A;  4O7D A;  5EVI A;  2WAD A;  3IF6 B;  4L0L A;  4M3K A;  1Z6F A;  4LEN A;  1HVB A;  3G31 A;  4MBF A;  4EUZ A;  2ZC4 B;  5CED A;  1L0D A;  1PI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...