1O07A

Crystal structure of the complex between q120l/y150e mutant of ampc and a beta-lactam inhibitor (mxg)
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
358
structure length
355
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLLVPDEVKSSSDLLRFYQNWQPAWAPGTQRLEANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSISDNKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Aspects for Evolution of beta-Lactamases from Penicillin-Binding Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 114
structure length 355
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1o07A00
2A3UA 5CHJA 5G18A 3P09A 5HAIA 3UDFA 4QD4A 5E2GA 3W4OA 5CEBA 1YT4A 5M18A 5FDHA 1GA9A 2Y2NA 4KZ8A 5FI7A 3SS3A 1FCMA 3DWKA 4KENB 4RVAA 4H8RA 2OV5A 4KZ6A 3SS5A 2FFYA 5DF7A 5FATA 4IVKA 3W4PA 5CHUA 3RXXA 1DJBA 3WS0A 2HDSA 2HP5A 1RGYA 4B4ZA 2V20A 3G30A 3P98A 4M3KA 3VP1A 1K55C 3GQZA 1BLHA 3SH8A 4DF6A 1IYSA 4S2PA 3HVFA 1M6KA 3OPRA 1WYBA 4E3MA 1L0DA 4S2NC 5FI2A 5KSHA 1IEMA 5FAQA 3UPOA 3BFCA 4WZ5C 3MKEA 4JBFA 4KZ3A 1XX2A 4OP8A 2X01A 4FH2A 4OLDA 4E3LA 2H0TA 4DDYA 2OSUA 3IHAA 3SH9A 2HPBA 4WEJA 5GHZA 2QMIA 4JXGA 4DXBA 5DF8A 3HUMA 1EWZA 1FOFA 1W79A 4K0WA 1SDEA 3MXRA 4WYYA 5F1GA 5E2FA 4XUXA 3ZDJA 1O07A 1XA1A 2WKIA 3HLEA 1FR6A 4P87A 3MBZA 4OOLA 1JTDA 5DTSA 3VMAA 2G2UA 4LCMA 3PBOA 5E43A 5DF9A 1K4FA 1W8YA 1K38A 1KVLA 5DVAA 3MZDA 3Q7VB 1FSWA 4X55A 4FH4A 2J9PA 3ZFZA 2OLVA 3FKVA 2GDNA 3IXDA 1PWGA 5KZHA 2C5WB 1CEGA 4JXSA 5TFQA 1L0GA 2IWDA 3WWXA 2XK1A 2ZJ9A 3OZHA 4JXWA 4LENA 3BFFA 1U60A 5E2EA 3OPPA 4KQQA 1Y54A 4OQIA 3NDGA 5HAQA 1MKIA 5CEDA 2ZQCA 4EQIA 4Y7PA 4EBLA 3IF6C 4FD8A 3VSKA 3UPPA 1PIOA 1XGIA 3M6HA 1WYCA 3IT9A 1MPLA 4BD0A 1FSYA 4PMAA 4IBRA 5GLCA 4E3OA 4JF6A 2CC1A 3ZGAB 4OVDA 5CGSA 1L2SA 1K54C 1YLZA 3BLSA 4E3KA 3IH9A 1KGEA 4FCFA 2P9VB 2I72A 1KDWA 3M6BA 3ZHHA 4A5RA 1XGJA 2EXAA 4MBFA 3MXSA 1GHIA 4Y0OA 4LV3A 5GHXA 5HAPA 1ALQA 2Y2KA 3LY4A 1JVJA 4U0XA 1H8ZA 1G68A 4WM9A 5A92A 1PYYA 1CEFA 3A3FA 5EVIA 3UDIA 4KG2A 4EV4A 1Z6FA 4E3JA 2H0YA 5HFOA 2R9XA 3M2JA 1YLJA 3NY4A 3PAEA 4U3TA 5CHMA 2ZQAA 4JKTA 4OPZA 1FCOA 3WRTA 5A91A 5JYPA 1K57C 3DW0A 1GCEA 1BSGA 2ZM8A 1O7EA 3G2YA 3O88A 3NI9A 4B4XA 3S1YA 3OCNA 5CXWA 1PW1A 3G4PA 3WS2A 4PM5A 1NZUA 5FSRA 1ES4A 4DE1A 3W4QA 1YMXA 1ZG6A 1XPBA 4KG5A 3WS1A 5HL1A 4QU3A 1S6RA 2ZM0A 3QHYA 2HDQA 4IBXA 4CJNA 4X69A 1RGZA 3ZG0A 4OQ0A 3UN7A 2ZQ8A 4JF4A 2EX2A 2ZC4B 4GDBA 3VOYA 4X6TA 3C5AA 3IH8A 3FZCA 3UO9A 5TGFA 4OPQA 4MLLA 2EFXA 1K56A 1PWCA 1DY6A 3ZCZA 4Q8IA 1IYPA 4UAAA 3EQVA 3MZFA 1BT5A 3EQUA 3LO7A 4QY6A 1LI0A 4R0QA 4ZTKA 3BFDA 2H10A 1K57A 4X68A 4U0TA 4KQRA 3MKFA 3CJMA 2Z2MB 4Z9QA 5F83A 3ZG7B 2WGWB 3HLDA 1DJCA 4KZ5A 3TG9A 3UNWA 4LV0A 4OQGA 5M19A 3ISGA 2ZM2A 1J9MA 1L0FA 1G6AA 5FI6A 3UE0A 3I7JA 2RCXA 4JXVA 5GHYA 3PBSA 1VQQA 2ZC5B 5FASA 2JCHA 3Q7ZA 1Q2QA 3IXBA 4RX2A 1DJAA 5CRFA 3NCKA 2XQZA 1IYOA 3IHBA 3ZG8B 1E3UA 2Y2OA 3IQAA 4ZJ1A 4WZ4A 3HUNA 4P85A 4WMCD 1GHPA 5EPHA 2WGVA 2ZC3B 1WE4A 2WADA 1NYYA 2XH9A 4L0LA 3O3VA 5EE8A 5FQMA 1LL5A 2EX8A 4QY5A 3BLMA 2P74A 1HD8A 4S2JA 2XR0A 3G32A 5GLBA 4DE2A 2DRWA 1YLWA 2XEPA 2Y91A 1M40A 4C75A 1K6SA 2WYXA 3NIAA 4KZBA 5CERA 4PM8A 4EUZA 5KMWA 1YLTA 2PU2A 4YFMA 5FA7A 2VGJA 1MWTA 2J7VA 3MFDA 3GVBA 1BLCA 1YLYA 1ZC2A 5F1FA 4S2NA 2X71A 1SHVA 3GV9A 3A3DA 1K55A 3OC2A 3ZG5A 4DE0A 1BTLA 4Y0UA 2ZQ9A 3G34A 4GOGA 3HLWA 4E6WA 1GHMA 1TEMA 5AQBA 3HREA 3LY3A 4OKPA 4DXCA 1IKIA 3Q1FA 1KE0A 3PBRA 2HP9A 3N8RA 2WK0A 4OOMA 3V5MA 2PU4A 3FYZA 4HBUA 1TDGA 2QPNA 3PBTA 3OPHA 1HTZA 1MWUA 4QHCA 4MNRA 1NJ4A 1KGFA 4N9KA 1KDSA 2XD1A 3GR2A 5HARA 2ZC7A 3LEZA 4EWFA 3FV7A 4UHUA 2ZQ7A 1ERMA 4XXRA 5A90A 3AGDA 4P0MA 4JF5A 5EOOA 2WKEA 1BLSA 2Q9MA 2EFUA 1NRFA 4P6BA 1K6RA 2Y2IA 3ITBA 1K56D 1SDNA 3PAGA 1IELA 4S2MA 5IHVA 2ZQDA 3GSGA 3C7VA 4KZAA 3UPNA 4KZ7A 1ESUA 2R9WA 4R4SA 3FKWA 3QNCA 1NZOA 4C6YA 3O87A 5A93A 3AGFA 3ITAA 4IVIA 3ZNYA 3IWIA 1ZG4A 2EX9A 5GLDA 4BQMA 3BFGA 2ZMAA 3A3IA 4N1XA 4S2KA 5HW3A 1PZPA 1JTGA 4E3NA 2QZ6A 5EVID 4UA9A 3WS4A 1RP5A 1BUEA 1VM1A 1YQSA 3LCEA 4ZJ2A 3S4XA 2V2FF 4GZBA 3DWZA 1PZOA 2Y2HA 2HDUA 1EI5A 2A49A 2XFSA 3G31A 3GRJA 2Y2QA 2IWBA 3GMWA 1W8QA 4O7DA 4E3IA 3A3JA 4JPMA 4YINA 4ZBEA 3VFFA 1IYQA 4S2IA 4DRTA 1KE3A 4DKIA 1YMSA 1NY0A 2Z2LB 2Y4AA 3HBRA 1W5DA 4RX3A 5TR7A 5U47A 3SS4A 3Q7VA 4GD6A 4QB8A 1XA7A 4WZ5A 5AQ9A 4GNUA 1N4OA 3N6IA 1K4EA 4PM6A 5L2FA 3UE1A 3IF6A 1YLPA 3VOZA 2XLNA 1HVBA 1XXMA 3A3EA 1FR1A 1MWRA 1TVFA 3SH7A 2Y2LA 4KZ4A 5BOHA 5D3OA 4R1GA 3AGEA 3N8SA 5CGWA 3VSLA 1E3UD 5I94A 1K54A 1I2WA 1TDLA 3C4PA 4B88A 4QJGA 3UY6A 1E25A 3Q81A 1C3BA 3UE3A 4GN2A 5KSCA 3BECA 4GDNA 4WEKA 4X56A 1MBLA 1OMEA 2OLUA 4OPYA 2ZLYA 3CZDA 4R23A 2V1ZA 4OP5A 3Q82A 3VP4A 2PBYA 3C4OA 2BLSA 2WUQA 3UDXA 4Y0TA 4IEDA 1ES5A 3W8KA 3VFHA 3DTMA 2WAFA 1E4DA 3ZVWA 1MWSA 3PBQA 3PTEA 2X02A 3D4FA 3G2ZA 1KVMA 3NC8A 4DE3A 3S22A 2BG1A 3SOIA 4N1HA 2WZZA 3C7UA 5FQIA 3V39A 2ZD8A 5CECA 2DCFA 5EECA 3IXGA 4S2OA 1SCWA 4ZDXA 2Y2MA 4HBTA 4CPKA 4KG6A 5EVIB 1H5XA 1QMFA 1ERQA 1PWDA 4KZ9A 1S0WA 1ESIA 4DDSA 1I5QA 5J8XA 4KQOA 3WS5A 4R3BA 5HX9A 1IKGA 5F82A 2WGIA 2VGKA 1N9BA 3N8LA 1MY8A 4MBKA 2C6WB 1LLBA 2WZXA 3TOIA 4D2OA 1GA0A 2HDRA 3M2KA 5DTKA 4HEFA 1JWZA 5FAOA 1LHYA 2XDMA 1QMEA 3RJUA 2IWCA 2Y59A 3HLBA 4ID4A 2XD5A 3CG5A 4GB7A 1KE4A 4BENA 4OPRA 4C3QA 3V50A 2JBFA 2XF3A 2Y2GA 3OPLA 3NDEA 4ZJ3A 3G35A 1BLPA 3BFEA 4MEZA 4BJPA 3RXWA 3ZG9B 4UA6A 4HESA 3V3SA 1XP4A 4XUZA 5E2HA 4BLMA 1W7FA 5EVLA 1JWVA 2B5RA 1MXOA 5EOEA 4PM7A 5GL9A 2DNSA 4WMCA 1NXYA 1CI9A 1PI4A 4JLFA 4GD8A 3HLGA 4FSFA 2UWXA 4N92A 5EUAA 3ZNTA 3Q07A 1BULA 4LCLA 2WAEA 5FQJA 4EBPA 2WKHA 1FQGA 5CTMA 4OQHA 4RA7A 5AQAA 5DTTA 3TSGA 4OONA 1HZOA 4OLGA 3V3RA 4R3JA 2WGWA 4EBNA 4OH0A 5EVIC 1ZKJA 3BEBA 2Q9NA 2J8YA 4R4RA 2E8IA 1H8YA 1NYMA 1PW8A 3HLFA 2H5SA 1ONHA 2J9OA 3N7WA 2EX6A 3IF6B 3QNBA 3N4IA 1EROA 3BM6A 4PPRA 3VP3A 1ES2A 1PI5A 3E2KA 5AQ7A 4NK3A 1ONGA 3MZEA 4ZAMA 3VP2A 1L0EA 2JC7A 4E6XA 2ZC6B 2EXBA 2Y55A 4UA7A 3VP0A 3BYDA 1Q2PA 2XGNA 4GKUA 1AXBA 4RYEA 4BD1A 1SKFA 4NETA 1LL9A 2FFFB 4S2LA 4X53A 5CGXA 3IWQA 4LV1A 4BL3A 1BZAA 5GLAA 1XKZA 3PBNA 5FAPA 1CI8A 3IXHA 3IWOA 3B3XA 3CMZA 5FQQA 3GTCA 3FWLA 3ZVTA 1FCNA 3E2LA 1ES3A 3NBLA 1LI9A 1JWPA 2Y2JA 3HLCA 4K91A 4N9LA 2P9VA 3BRMA 1K25A 5CTNA 4WBGA 3O86A 5FQ9A 2G2WA 2JE5A 1CK3A 2Y2PA 3JYIA 1RCJA 4WELA 1I2SA 4OOYA 5FQKA 3WRZA 2HP6A 4K0XA 5M1AA 1KGGA 4BL2A 4MBHA 3OCLA 2XFTA 3HUOA 4F94A 3IF5A 4LV2A 4PM9A 3HL9A 1YM1A 2RL3A 5JYOA
chains in the Genus database with same CATH superfamily
1T1BA 5G18A 1T18A 5HAIA 5E2GA 3W4OA 4BBTA 5HDSA 2Y2NA 5FI7A 4KENB 3DWKA 2FFYA 5DF7A 4RQ9A 4IVKA 3RXXA 3WS0A 3T4KA 4M3KA 3GQZA 3F1NA 1M6KA 1L0DA 5FI2A 3UPOA 4KZ3A 3MFXA 4JGRA 4M4XA 4MDZA 1W79A 5CX7A 5F1GA 5E2FA 5MC7A 2JKFA 4P87A 5DTSA 2Z6CA 2D02A 3MZDA 4X55A 4FH4A 2OLVA 2GDNA 2C5WB 5EV0A 3OZHA 1Y54A 1DRMA 3KYEA 3IF6C 1PIOA 1XGIA 4OVDA 3H7WB 2B95A 3K3CA 5F5YA 1ACFA 3IH9A 4R6LA 1N9NA 1KGEA 2P9VB 2I72A 1KDWA 1SKOA 3ZHHA 2W3HA 4MBFA 1V9ZA 3JPUA 4Y3IA 1CJFA 1ALQA 2PAVP 1DP9A 5A92A 5EVIA 5EFWA 3LIFA 3UDIA 2H0YA 1NWZA 3PAEA 5CHMA 4UQIM 4OPZA 3QP8A 4WUJA 1GCEA 1BSGA 2ZM8A 1O7EA 2D01A 3S1YA 1OTIA 4I3IA 5L8MA 1PW1A 3G4PA 2LB9A 3WS2A 4PM5A 5FSRA 3W4QA 4EERA 2V9AA 4KG5A 3WS1A 1S6RA 2HDQA 4X69A 2HJEA 3ZG0A 1P9RA 3FZCA 3UO9A 4Q8IA 3NOTC 3SW1A 3BFDA 3CJMA 2Z2MB 3ZG7B 2WGWB 1DJCA 3NJAA 3TG9A 1P97A 3C2WA 4GLQA 5M19A 1L0FA 5FI6A 5GHYA 3PBSA 1TS7A 3IXBA 3KYQA 2AVXA 1DJAA 2V0UA 5CRFA 1F2KA 3IQAA 4ZJ1A 3HUNA 4P85A 1GHPA 1WE4A 2WADA 4G3WA 2XH9A 5EE8A 5FQMA 1HD8A 4HH3A 4S2JA 3ULFA 2DRWA 1M40A 3DBAA 2WYXA 3NIAA 4JGPA 5CERA 1FIKA 2PU2A 2J7VA 1BLCA 1YLYA 4QWOA 1K55A 3OC2A 3T12B 2MJ6A 3PBRA 3N8RA 4L9EA 2PT7A 2J3WA 4HBUA 2W1TB 3IBRA 1HTZA 1NJ4A 4N9KA 3EEHA 1ERMA 2HF6A 3AGDA 3RTYA 2EFUA 3ITBA 1K56D 1SDNA 3MMHA 1IELA 3C7VA 3FKWA 1NZOA 3O87A 3IX8A 3G6OA 4IUHA 3LUQA 3BFGA 4AFIA 2V8FA 3JVVA 5HD3A 5HW3A 1JTGA 4R38A 3HJIA 4UA9A 5I5LA 4ETZA 3LEQA 3T4LA 3UE6A 2Y2HA 2A49A 2XFSA 3G31A 4D60A 3GRJA 2Y2QA 4E3IA 1W8QA 4O7DA 4JPMA 4DKIA 1NY0A 2Z2LB 2Y4AA 4QB8A 4PM6A 5L2FA 5HPIA 3H9WA 1MWRA 4HOIA 1P9WA 3AGEA 1K54A 3KO6A 2ZOIA 1T1CA 2NUTC 4WEKA 1F98A 2ZLYA 3CZDA 3Q82A 3VP4A 2KLIA 1PFLA 4IEDA 4Y0TA 3C38A 2WAFA 1E4DA 2ZL1A 3PTEA 4DE3A 2WZZA 5CECA 5EECA 4ZDXA 1V9YA 4HBTA 5EVIB 1QMFA 2PBDP 1ESIA 4HP9A 4HJ4A 4R3BA 5HX9A 5F82A 1MY8A 2C6WB 3LICA 3BY9A 2HDRA 4FTXA 4HEFA 1LHYA 2XDMA 3W2ZA 3HLBA 3KSIA 2XD5A 2KDKA 2PHYA 1OJ5A 4ZJ3A 3G35A 4BJPA 4PHTA 2YKFA 5L09A 2WKRA 4HESA 5EVLA 1YSPA 5EOEA 1TD5A 4WMCA 2VA0A 1D7EA 4KUKA 3BW6A 2QJ7A 4GD8A 4N92A 4FSFA 5HWVA 4LCLA 5CTMA 1UWPX 5DTTA 4OLGA 3BQAA 3V3RA 5EVIC 3D3OA 2J8YA 1OTAA 1W63M 5EM0A 2XSSA 3HLFA 3VE3A 2L0WA 4O01A 3E2KA 5AQ7A 2I9VA 4ZAMA 3UB8A 4E6XA 3L7HA 2ZC6B 3HJKA 2Y55A 4UA7A 3VP0A 4NETA 4X53A 5TBMA 3FG8A 2W0NA 1XKZA 1CI8A 3B3XA 3CMZA 1ES3A 1JWPA 2JKGA 3HLCA 1LSWA 1S1YA 1STZA 2ZL1B 3B42A 2JKRI 3LR0A 3JYIA 1RCJA 4OOYA 4I38A 1YSQA 1KGGA 3IS2A 3A0VA 4K08A 4F94A 4PM9A 1OTDA 5CHJA 5CEBA 1FCMA 5DKKA 3MXQA 4RVAA 4H8RA 4KZ6A 3SS5A 3NULA 3LIDA 4EEUA 1RGYA 1S4RA 3VP1A 1K55C 1F5MA 4S2PA 3HVFA 1WYBA 1IEMA 2M7VA 4HP4A 3MKEA 4JBFA 4OP8A 3QP4A 4NXEA 3T50A 2OSUA 3IHAA 3SH9A 1K0KA 2QMIA 4DJ3A 2A2LA 1EWZA 1FOFA 3LFVA 4K0WA 3MXRA 3R4KA 2GX5A 4HIAA 1FR6A 3T1QB 2G2UA 4LCMA 3PBOA 4NXFA 1S67L 2JHEA 5DF9A 1K4FA 1W8YA 5C5KA 1GSWA 1S66L 1FSWA 3ZFZA 1NLYA 1PWGA 3IXDA 2VV8A 2VGLS 4JXSA 5TFQA 4B9OA 2ZJ9A 3MQ0A 2K31A 5E2EA 4KQQA 4OQIA 5HAQA 2WKPA 2ZQCA 5TBMB 3LR3A 3FPVA 1MPLA 4IBRA 3IBJA 4JF6A 2CC1A 1GSVA 3VV4A 1L2SA 1K54C 3T4JA 3PR6A 4FCFA 3CLOA 3M6BA 2J3TD 1KOUA 1GHIA 4MCWA 4Y0OA 2OAP1 2BTFP 2FH5A 1H8ZA 4U0XA 4WM9A 1CEFA 1Z6FA 2R9XA 3NY4A 4U3TA 5F6AA 1ODVA 5J3WA 3F1PB 1FCOA 5A91A 5JYPA 1P0ZA 3OCNA 4DE1A 3KYZA 4UEYA 1ZG6A 5HL1A 4QU3A 1YKDA 3QHYA 1J3WA 4EUVA 2ZQ8A 2K7SA 4JF4A 1LSVA 2ZC4B 4X6TA 2O9CA 2PYPA 3E4OA 5TGFA 4MLLA 3ZCZA 1NRJA 2P08A 1S4SA 3CI6A 3EQVA 4ME4A 2HJ9C 4X68A 2HZ5A 4CLCB 4LRYC 1AWIA 1J9MA 1IOUA 2RCXA 4LFUA 1VQQA 4RX2A 4EQ1A 1IYOA 3CAXA 3QP5A 4WZ4A 5EPHA 2ZC3B 3O3VA 2P74A 5HL6A 2HV1A 2XR0A 5GLBA 2XEPA 4C75A 3GDIA 5KMWA 4YFMA 3MFDA 3GVBA 4S2NA 1SHVA 4CLCE 3R7WB 4Y0UA 3G34A 1GHMA 1TEMA 3A0SA 2HP9A 3IS2B 1TS6A 1A0KA 3FYZA 3OPHA 4YWZA 4MNRA 3GR2A 5HARA 3LEZA 1OT6A 5LBRA 4WF0A 5A90A 4P0MA 2OWHA 5EOOA 2K2NA 1K6RA 5DFYA 3KSGA 3UPNA 3GSGA 4KZAA 4Y13A 1ESUA 4X1LA 4R4SA 4C6YA 3AGFA 2OOLA 3ITAA 4IVIA 2EX9A 2O0YA 5GLDA 3F1NB 4BQMA 4NG2A 3A3IA 1PZPA 2A24A 3C30A 4BWIA 3WS4A 1RP5A 4MMNA 3LCEA 4MN6A 4NEED 4Q0IA 4GZBA 4H6JA 1EI5A 4X1MA 2IWBA 3A3JA 4YINA 4S2IA 4DRTA 1KE3A 1EW0A 3QP2A 1YMSA 5U47A 1XA7A 4GNUA 3UMEA 1N4OA 1K4EA 1YLPA 1XXMA 2W3EA 5AVEA 1FR1A 4CLCC 1CF0A 3UB7A 4KZ4A 2VLGA 4R1GA 5CGWA 2PDRA 3N8SA 4HH2A 4DN0A 4B88A 3CPTB 4QJGA 1E25A 1C3BA 5KSCA 1MBLA 4JGQA 4O0PA 3EOIA 3C4OA 2BLSA 2WUQA 2QHKA 3W8KA 3VFHA 3FPWA 2R78A 3H7WA 5L10A 3PBQA 2QWSA 2VJWA 2X02A 2QJ5A 3G2ZA 1SKOB 3T1RA 3LR4A 4N1HA 5FQIA 4FOFA 3MS6A 4HQAA 4S2OA 1SCWA 4KG6A 1ERQA 1LL8A 4KZ9A 5J8XA 3WS5A 3F1PA 1IKGA 3N8LA 1MKMA 1LLBA 2WZXA 3U2AA 5FAOA 4UQIS 3CG5A 4BENA 3UB9A 4OPRA 1JNUA 3NDEA 4MEZA 3RXWA 4PAUA 4BLMA 2YKHA 2B5RA 4Y5FA 1ZTUA 2DNSA 2PR5A 1UGUA 5IU1A 3B47A 1CI9A 3MQQA 2PR6A 1LSXA 3ZNTA 2EA9A 4H6JB 4EBPA 2WKHA 2BASA 4RA7A 3TSGA 4R3JA 4OH0A 4L9GA 2E8IA 1H8YA 2L4RA 1LT0A 1ONHA 2EX6A 1OTBA 1XJ3A 4LRXC 1UWNX 4PPRA 3VP3A 1PI5A 1ONGA 3MZEA 4Q0JA 2UV0E 3U4LP 2XROA 4BD1A 1AXBA 3CITA 5TJJA 5K5BA 1BZAA 3PBNA 3IXHA 3GTCA 3FWLA 3ZVTA 3K3DA 4Y17A 1K25A 5FDSA 5CTNA 4WBGA 2W1TA 3O86A 3ICYA 5HPFA 3CUEC 5M1AA 3KSHA 4NXGA 3HCYA 2IA2A 1D06A 2XFTA 2EWWA 3KX0X 4ETXA 1YM1A 2A3UA 1VETB 2KOIA 3UDFA 1YT4A 5M18A 5FEFA 4GHIA 3W4PA 5CHUA 1DJBA 2VV7A 3DTEA 1VEUB 2V0WA 3QP6A 2V20A 4II7A 1BLHA 3SH8A 4DF6A 3OPRA 4E3MA 5EVEA 4S2NC 5KSHA 3BFCA 4WZ5C 1XFQA 4E3LA 4DDYA 2HPBA 4WEJA 5GHZA 2Y79A 4JXGA 4EESA 2O99A 5DF8A 3HUMA 4DXBA 4WYYA 1SDEA 4XUXA 3ZDJA 1O07A 2HGVA 3HLEA 3MBZA 4OOLA 1JTDA 3VMAA 5E43A 3T1SA 1K38A 4IJGA 5DVAA 4P6ZM 3FKVA 1GSXA 5KZHA 2JKRM 1L0GA 3WWXA 2XK1A 3CPTA 1SZVA 3DTIA 4JXWA 4LENA 3BFFA 5DFXA 2M7UA 2V1AA 4Y2FA 3NDGA 2VX8A 4EQIA 4FD8A 3VSKA 3UPPA 3S7QA 2ZBBA 1FSYA 4PMAA 4E3OA 3ZGAB 4WN5A 3TW8A 3CUEA 4E3KA 1S1ZA 2EXAA 4IHQA 4ZRRA 5GHXA 1PNEA 2Y2KA 1G28A 3LY4A 4YOFA 2W27A 4E3JA 3M2JA 2ZQAA 3CWFA 4JKTA 3WRTA 3RFBA 3G2YA 3O88A 3NI9A 5CXWA 4GHIB 1ES4A 3P7NA 4HNBA 1XPBA 2ZM0A 1VEUA 1OTEA 4IBXA 4CJNA 2XA7M 1RGZA 3UN7A 3VOYA 1OT9A 3T4TA 1K56A 1PWCA 1DY6A 4WLAA 3MZFA 1BT5A 3EQUA 3LO7A 1LI0A 4R0QA 3S7PA 1K57A 4U0TA 2CMNA 4YNRA 4Z9QA 4BMWA 3HLDA 3UNWA 4LV0A 3NECA 4OQGA 2ZM2A 1G6AA 3I7JA 4JXVA 2ZC5B 2JCHA 3Q7ZA 1Q2QA 3DAVA 2XQZA 3ZG8B 3EGDC 1E3UA 4WL9A 3LI8A 3E4QA 2WGVA 5IS1A 1NYYA 4L0LA 1LL5A 2EX8A 4QY5A 5FL3A 3BLMA 4DE2A 1YLWA 2Y91A 2H28A 5DKLA 4PM8A 3OOVA 1MWTA 3LI9A 1ZC2A 3GV9A 4DE0A 2PD7A 1BTLA 3BQ8A 4GOGA 3HLWA 4E6WA 4OKPA 4DXCA 5HWTA 4BBUA 4OOMA 3V5MA 1TDGA 2QPNA 2J80A 3PBTA 1MWUA 4HI4A 4QHCA 1KDSA 2XD1A 4G3KA 2ZC7A 3FV7A 4UHUA 1FILA 3TRCA 4CQHA 3E98A 2PD8A 2Q9MA 1NRFA 4R70A 2EWVA 2Y2IA 4P6BA 3D9YA 4HHDA 2ACGA 3PAGA 4S2MA 4DMZA 2R9WA 3QNCA 4G3VA 5A93A 4QPRA 2G7UA 3IWIA 3NOPC 3QP1A 5HSQA 4N1XA 4S2KA 3T4OA 4F3LA 1BUEA 2LB5A 1VM1A 3MSHA 3ZYTA 3DWZA 1PZOA 4ARZB 3PHYA 2HDUA 4PKYG 4ZBEA 4JGOA 2W1RA 4RX3A 1W5DA 3SS4A 5FEGA 5AQ9A 2DMWA 4WZ5A 3N6IA 3UE1A 3VOZA 2XLNA 1HVBA 3A3EA 3IX3A 1TVFA 3SH7A 5BOHA 5D3OA 3RH8B 1E3UD 2VK3A 3MJQA 5I94A 3EGXC 2GZAA 3UY6A 5J4EA 3Q81A 1T19A 4GDNA 4BBVA 4X56A 2OLUA 2PBYA 4NKPA 3UDXA 1N9OA 3DTMA 1MWSA 2XRNA 3D4FA 2JKTM 1KVMA 3NC8A 4EEPA 4FUWA 1G6OA 4GS9B 3V39A 3IXGA 1Y28A 4CPKA 2WKQA 3TJZC 1PWDA 1S0WA 4DDSA 1I5QA 1H3QA 4KQOA 2WGIA 2VGKA 1N9BA 1DP6A 4D2OA 2M1CA 2P7JA 1GA0A 3VOLA 1JWZA 1QMEA 2IWCA 3OBFA 4C3QA 2Y2GA 3BFEA 3ZG9B 4UA6A 3V3SA 1Z09A 1W7FA 1JWVA 4F3LB 4PM7A 1H8MA 2XA7S 1TS8A 1NXYA 4JLFA 3HLGA 2UWXA 3Q07A 3L9KA 3D72A 4OQHA 3GECA 1G5UA 4EXOA 1HZOA 2OWJA 3BEBA 2Q9NA 2W3DA 2J9OA 3QNBA 4HY8A 1EROA 3NOUC 3BM6A 1ES2A 4X25A 2EXBA 3BYDA 1SKFA 1LL9A 4S2LA 3IWQA 4LV1A 3IX4A 5FQQA 1FCNA 3NBLA 1LI9A 4XT2B 3EEAA 3KSFA 3EWKA 4K91A 3BRMA 4GCZA 3V67A 1ZHHB 1YAXA 2Y2PA 2JE5A 4WELA 5FQKA 4K0XA 1IFQA 4L9FA 4BL2A 3IF5A 3HL9A 3A0RA 2X01A 5JYOA 3P09A 4QD4A 5FDHA 1GA9A 4KZ8A 3SS3A 2OV5A 5FATA 5HZHA 2HDSA 2HP5A 2V8CA 4B4ZA 3G30A 1WA9A 3P98A 2A24B 1IYSA 5KIZA 5EM1A 5FAQA 3BWLA 1XX2A 1N9LA 4I3JA 4Q0HA 3VE4A 3UMDA 4FH2A 4EETB 4OLDA 2H0TA 3C8CA 3PYPA 3BJNA 1D1JA 1XA1A 2WKIA 5F68A 3JVUA 1KVLA 3Q7VB 2J9PA 1CEGA 2IWDA 1H0MA 2OAQ1 3K2NA 2L1MA 1U60A 3OPPA 4NXBA 1MKIA 3T4QA 2NUPC 5CEDA 4Z1WA 4Y7PA 4EBLA 4CLCD 3M6HA 1WYCA 3IT9A 2VV6A 4BD0A 5GLCA 5CGSA 2J3TC 1YLZA 3BLSA 5DJUA 4XT2A 4A5RA 1XGJA 5IT5A 3MXSA 4LV3A 5HAPA 2W3GA 4KUOA 1JVJA 1G68A 1PYYA 3A3FA 4KG2A 4EV4A 4EW7A 5HFOA 3H82A 1MC0A 1YLJA 2W3FA 2ZOHA 4DJ2A 1K57C 3DW0A 1OPXA 3MR0A 4B4XA 2Q0OA 1L3LA 1NZUA 4HJ6A 1YMXA 4EU0A 5J7EA 4MN5A 4OQ0A 2EX2A 4GDBA 3FC7A 3C5AA 3IH8A 4OPQA 4ARZA 3T1XA 2EFXA 1IYPA 4UAAA 2VKSA 4QY6A 4GJ4A 4ZTKA 2H10A 1PRQA 3LR5A 5A8BA 4KQRA 3MKFA 4ESPA 5F83A 4KZ5A 3BY8A 3ISGA 5G4ZA 3UE0A 5FASA 3UB6A 4KQDA 2GJ3A 5DJTA 3NCKA 3IHBA 2Y2OA 4WMCD 2QYBA 4IUKA 1W63Q 3PXPA 3G32A 3OLOA 1K6SA 4GW9A 4KZBA 1VHMA 4EUZA 1YLTA 5FA7A 2VGJA 5F1FA 1OJGA 3LGOA 3E4PA 2X71A 2VZWA 3A3DA 3ZG5A 2ZQ9A 4GS9A 5AQBA 3ZQ5A 1HLUP 3HREA 3LY3A 4I39A 1IKIA 3Q1FA 1KE0A 3S7OA 2WK0A 2PU4A 5HD5A 1KGFA 1MZUA 4EWFA 1VETA 1NLZA 2ZQ7A 3DTKA 1DP8A 1YPRA 4XXRA 4JF5A 2WKEA 1BLSA 3H82B 3T4SA 5IHVA 2ZQDA 4KZ7A 1CQAA 3ZNYA 4LRZE 1ZG4A 5L07A 4HJ3A 2JKTI 2ZMAA 4E3NA 2QZ6A 5EVID 3LIAA 3UB5P 2O9BA 1YQSA 4ZJ2A 3S4XA 2KX6A 2V2FF 3GMWA 3MF0A 3VFFA 1IYQA 4LLOB 5TR7A 3HBRA 4Y15A 1F9IA 3LIBA 3Q7VA 4GD6A 4I5SA 1TS0A 3IF6A 5HDCA 5AJGA 3SZTA 1XJ4A 3CHWP 2Y2LA 2PYRA 3VSLA 1I2WA 1TDLA 2P04A 3C4PA 5AVFA 3UE3A 4GN2A 4MN7A 4B93A 3BECA 1Y4OA 1OMEA 4OPYA 4R23A 2V1ZA 4OP5A 3LYXA 1ES5A 3ZVWA 5HDDA 2INWA 2FZ0A 3S22A 2BG1A 3SOIA 2ZMVA 3C7UA 3F1OB 2ZD8A 2DCFA 2Y2MA 2QKPA 1H5XA 3TE8A 2Z6DA 1TF1A 5HWWA 4MBKA 3TOIA 2ZMFA 3M2KA 5DTKA 3RJUA 2Y59A 4ID4A 4GB7A 1KE4A 4I3AA 3V50A 2JBFA 2XF3A 3OPLA 2JN7A 1BLPA 1T1AA 2B02A 4O8GA 1X0OA 2E8JA 1XP4A 4XUZA 2B18A 5E2HA 4LPZA 4E04A 1XFNA 1MXOA 5F69A 5GL9A 1PI4A 1XJ6A 5EUAA 1BULA 5FQJA 2WAEA 4R3AA 1FQGA 5AQAA 2VEAA 3P01A 4OONA 4CLCA 2WGWA 3O5YA 4EBNA 1ZKJA 4R4RA 3NHQA 1NYMA 1PW8A 3MQOA 2H5SA 4PKYA 3N7WA 3IF6B 1VB6A 3N4IA 3VP2A 4NK3A 1BYWA 1L0EA 2JC7A 4P6ZS 1Q2PA 4LGWA 2XGNA 2Y8HA 4GKUA 4RYEA 2GNXA 2FFFB 5CGXA 3B33A 4BL3A 5GLAA 1XJ2A 2O9AA 3S7NA 5FAPA 3IWOA 3E0YA 3E2LA 2V1BA 2Y2JA 4N9LA 2P9VA 3R7WA 2PRFA 5FQ9A 2G2WA 1CK3A 1I2SA 3WRZA 2HP6A 5G4YA 3F1OA 4MBHA 3OCLA 3HUOA 3LIEA 2VGLM 4LV2A 2RL3A
chains in the Genus database with same CATH topology
2A3UA 5CHJA 5G18A 3P09A 5HAIA 3UDFA 4QD4A 5E2GA 3W4OA 5CEBA 1YT4A 5M18A 5FDHA 1GA9A 2Y2NA 4KZ8A 5FI7A 3SS3A 1FCMA 3DWKA 4KENB 4RVAA 4H8RA 2OV5A 4KZ6A 3SS5A 2FFYA 5DF7A 5FATA 4IVKA 3W4PA 5CHUA 3RXXA 1DJBA 3WS0A 2HDSA 2HP5A 1RGYA 4B4ZA 2V20A 3G30A 3P98A 4M3KA 3VP1A 1K55C 3GQZA 1BLHA 3SH8A 4DF6A 1IYSA 4S2PA 3HVFA 1M6KA 3OPRA 1WYBA 4E3MA 1L0DA 4S2NC 5FI2A 5KSHA 1IEMA 5FAQA 3UPOA 3BFCA 4WZ5C 3MKEA 4JBFA 4KZ3A 1XX2A 4OP8A 2X01A 4FH2A 4OLDA 4E3LA 2H0TA 4DDYA 2OSUA 3IHAA 3SH9A 2HPBA 4WEJA 5GHZA 2QMIA 4JXGA 4DXBA 5DF8A 3HUMA 1EWZA 1FOFA 1W79A 4K0WA 1SDEA 3MXRA 4WYYA 5F1GA 5E2FA 4XUXA 3ZDJA 1O07A 1XA1A 2WKIA 3HLEA 1FR6A 4P87A 3MBZA 4OOLA 1JTDA 5DTSA 3VMAA 2G2UA 4LCMA 3PBOA 5E43A 5DF9A 1K4FA 1W8YA 1K38A 1KVLA 5DVAA 3MZDA 3Q7VB 1FSWA 4X55A 4FH4A 2J9PA 3ZFZA 2OLVA 3FKVA 2GDNA 3IXDA 1PWGA 5KZHA 2C5WB 1CEGA 4JXSA 5TFQA 1L0GA 2IWDA 3WWXA 2XK1A 2ZJ9A 3OZHA 4JXWA 4LENA 3BFFA 1U60A 5E2EA 3OPPA 4KQQA 1Y54A 4OQIA 3NDGA 5HAQA 1MKIA 5CEDA 2ZQCA 4EQIA 4Y7PA 4EBLA 3IF6C 4FD8A 3VSKA 3UPPA 1PIOA 1XGIA 3M6HA 1WYCA 3IT9A 1MPLA 4BD0A 1FSYA 4PMAA 4IBRA 5GLCA 4E3OA 4JF6A 2CC1A 3ZGAB 4OVDA 5CGSA 1L2SA 1K54C 1YLZA 3BLSA 4E3KA 3IH9A 1KGEA 4FCFA 2P9VB 2I72A 1KDWA 3M6BA 3ZHHA 4A5RA 1XGJA 2EXAA 4MBFA 3MXSA 1GHIA 4Y0OA 4LV3A 5GHXA 5HAPA 1ALQA 2Y2KA 3LY4A 1JVJA 4U0XA 1H8ZA 1G68A 4WM9A 5A92A 1PYYA 1CEFA 3A3FA 5EVIA 3UDIA 4KG2A 4EV4A 1Z6FA 4E3JA 2H0YA 5HFOA 2R9XA 3M2JA 1YLJA 3NY4A 3PAEA 4U3TA 5CHMA 2ZQAA 4JKTA 4OPZA 1FCOA 3WRTA 5A91A 5JYPA 1K57C 3DW0A 1GCEA 1BSGA 2ZM8A 1O7EA 3G2YA 3O88A 3NI9A 4B4XA 3S1YA 3OCNA 5CXWA 1PW1A 3G4PA 3WS2A 4PM5A 1NZUA 5FSRA 1ES4A 4DE1A 3W4QA 1YMXA 1ZG6A 1XPBA 4KG5A 3WS1A 5HL1A 4QU3A 1S6RA 2ZM0A 3QHYA 2HDQA 4IBXA 4CJNA 4X69A 1RGZA 3ZG0A 4OQ0A 3UN7A 2ZQ8A 4JF4A 2EX2A 2ZC4B 4GDBA 3VOYA 4X6TA 3C5AA 3IH8A 3FZCA 3UO9A 5TGFA 4OPQA 4MLLA 2EFXA 1K56A 1PWCA 1DY6A 3ZCZA 4Q8IA 1IYPA 4UAAA 3EQVA 3MZFA 1BT5A 3EQUA 3LO7A 4QY6A 1LI0A 4R0QA 4ZTKA 3BFDA 2H10A 1K57A 4X68A 4U0TA 4KQRA 3MKFA 3CJMA 2Z2MB 4Z9QA 5F83A 3ZG7B 2WGWB 3HLDA 1DJCA 4KZ5A 3TG9A 3UNWA 4LV0A 4OQGA 5M19A 3ISGA 2ZM2A 1J9MA 1L0FA 1G6AA 5FI6A 3UE0A 3I7JA 2RCXA 4JXVA 5GHYA 3PBSA 1VQQA 2ZC5B 5FASA 2JCHA 3Q7ZA 1Q2QA 3IXBA 4RX2A 1DJAA 5CRFA 3NCKA 2XQZA 1IYOA 3IHBA 3ZG8B 1E3UA 2Y2OA 3IQAA 4ZJ1A 4WZ4A 3HUNA 4P85A 4WMCD 1GHPA 5EPHA 2WGVA 2ZC3B 1WE4A 2WADA 1NYYA 2XH9A 4L0LA 3O3VA 5EE8A 5FQMA 1LL5A 2EX8A 4QY5A 3BLMA 2P74A 1HD8A 4S2JA 2XR0A 3G32A 5GLBA 4DE2A 2DRWA 1YLWA 2XEPA 2Y91A 1M40A 4C75A 1K6SA 2WYXA 3NIAA 4KZBA 5CERA 4PM8A 4EUZA 5KMWA 1YLTA 2PU2A 4YFMA 5FA7A 2VGJA 1MWTA 2J7VA 3MFDA 3GVBA 1BLCA 1YLYA 1ZC2A 5F1FA 4S2NA 2X71A 1SHVA 3GV9A 3A3DA 1K55A 3OC2A 3ZG5A 4DE0A 1BTLA 4Y0UA 2ZQ9A 3G34A 4GOGA 3HLWA 4E6WA 1GHMA 1TEMA 5AQBA 3HREA 3LY3A 4OKPA 4DXCA 1IKIA 3Q1FA 1KE0A 3PBRA 2HP9A 3N8RA 2WK0A 4OOMA 3V5MA 2PU4A 3FYZA 4HBUA 1TDGA 2QPNA 3PBTA 3OPHA 1HTZA 1MWUA 4QHCA 4MNRA 1NJ4A 1KGFA 4N9KA 1KDSA 2XD1A 3GR2A 5HARA 2ZC7A 3LEZA 4EWFA 3FV7A 4UHUA 2ZQ7A 1ERMA 4XXRA 5A90A 3AGDA 4P0MA 4JF5A 5EOOA 2WKEA 1BLSA 2Q9MA 2EFUA 1NRFA 4P6BA 1K6RA 2Y2IA 3ITBA 1K56D 1SDNA 3PAGA 1IELA 4S2MA 5IHVA 2ZQDA 3GSGA 3C7VA 4KZAA 3UPNA 4KZ7A 1ESUA 2R9WA 4R4SA 3FKWA 3QNCA 1NZOA 4C6YA 3O87A 5A93A 3AGFA 3ITAA 4IVIA 3ZNYA 3IWIA 1ZG4A 2EX9A 5GLDA 4BQMA 3BFGA 2ZMAA 3A3IA 4N1XA 4S2KA 5HW3A 1PZPA 1JTGA 4E3NA 2QZ6A 5EVID 4UA9A 3WS4A 1RP5A 1BUEA 1VM1A 1YQSA 3LCEA 4ZJ2A 3S4XA 2V2FF 4GZBA 3DWZA 1PZOA 2Y2HA 2HDUA 1EI5A 2A49A 2XFSA 3G31A 3GRJA 2Y2QA 2IWBA 3GMWA 1W8QA 4O7DA 4E3IA 3A3JA 4JPMA 4YINA 4ZBEA 3VFFA 1IYQA 4S2IA 4DRTA 1KE3A 4DKIA 1YMSA 1NY0A 2Z2LB 2Y4AA 3HBRA 1W5DA 4RX3A 5TR7A 5U47A 3SS4A 3Q7VA 4GD6A 4QB8A 1XA7A 4WZ5A 5AQ9A 4GNUA 1N4OA 3N6IA 1K4EA 4PM6A 5L2FA 3UE1A 3IF6A 1YLPA 3VOZA 2XLNA 1HVBA 1XXMA 3A3EA 1FR1A 1MWRA 1TVFA 3SH7A 2Y2LA 4KZ4A 5BOHA 5D3OA 4R1GA 3AGEA 3N8SA 5CGWA 3VSLA 1E3UD 5I94A 1K54A 1I2WA 1TDLA 3C4PA 4B88A 4QJGA 3UY6A 1E25A 3Q81A 1C3BA 3UE3A 4GN2A 5KSCA 3BECA 4GDNA 4WEKA 4X56A 1MBLA 1OMEA 2OLUA 4OPYA 2ZLYA 3CZDA 4R23A 2V1ZA 4OP5A 3Q82A 3VP4A 2PBYA 3C4OA 2BLSA 2WUQA 3UDXA 4Y0TA 4IEDA 1ES5A 3W8KA 3VFHA 3DTMA 2WAFA 1E4DA 3ZVWA 1MWSA 3PBQA 3PTEA 2X02A 3D4FA 3G2ZA 1KVMA 3NC8A 4DE3A 3S22A 2BG1A 3SOIA 4N1HA 2WZZA 3C7UA 5FQIA 3V39A 2ZD8A 5CECA 2DCFA 5EECA 3IXGA 4S2OA 1SCWA 4ZDXA 2Y2MA 4HBTA 4CPKA 4KG6A 5EVIB 1H5XA 1QMFA 1ERQA 1PWDA 4KZ9A 1S0WA 1ESIA 4DDSA 1I5QA 5J8XA 4KQOA 3WS5A 4R3BA 5HX9A 1IKGA 5F82A 2WGIA 2VGKA 1N9BA 3N8LA 1MY8A 4MBKA 2C6WB 1LLBA 2WZXA 3TOIA 4D2OA 1GA0A 2HDRA 3M2KA 5DTKA 4HEFA 1JWZA 5FAOA 1LHYA 2XDMA 1QMEA 3RJUA 2IWCA 2Y59A 3HLBA 4ID4A 2XD5A 3CG5A 4GB7A 1KE4A 4BENA 4OPRA 4C3QA 3V50A 2JBFA 2XF3A 2Y2GA 3OPLA 3NDEA 4ZJ3A 3G35A 1BLPA 3BFEA 4MEZA 4BJPA 3RXWA 3ZG9B 4UA6A 4HESA 3V3SA 1XP4A 4XUZA 5E2HA 4BLMA 1W7FA 5EVLA 1JWVA 2B5RA 1MXOA 5EOEA 4PM7A 5GL9A 2DNSA 4WMCA 1NXYA 1CI9A 1PI4A 4JLFA 4GD8A 3HLGA 4FSFA 2UWXA 4N92A 5EUAA 3ZNTA 3Q07A 1BULA 4LCLA 2WAEA 5FQJA 4EBPA 2WKHA 1FQGA 5CTMA 4OQHA 4RA7A 5AQAA 5DTTA 3TSGA 4OONA 1HZOA 4OLGA 3V3RA 4R3JA 2WGWA 4EBNA 4OH0A 5EVIC 1ZKJA 3BEBA 2Q9NA 2J8YA 4R4RA 2E8IA 1H8YA 1NYMA 1PW8A 3HLFA 2H5SA 1ONHA 2J9OA 3N7WA 2EX6A 3IF6B 3QNBA 3N4IA 1EROA 3BM6A 4PPRA 3VP3A 1ES2A 1PI5A 3E2KA 5AQ7A 4NK3A 1ONGA 3MZEA 4ZAMA 3VP2A 1L0EA 2JC7A 4E6XA 2ZC6B 2EXBA 2Y55A 4UA7A 3VP0A 3BYDA 1Q2PA 2XGNA 4GKUA 1AXBA 4RYEA 4BD1A 1SKFA 4NETA 1LL9A 2FFFB 4S2LA 4X53A 5CGXA 3IWQA 4LV1A 4BL3A 1BZAA 5GLAA 1XKZA 3PBNA 5FAPA 1CI8A 3IXHA 3IWOA 3B3XA 3CMZA 5FQQA 3GTCA 3FWLA 3ZVTA 1FCNA 3E2LA 1ES3A 3NBLA 1LI9A 1JWPA 2Y2JA 3HLCA 4K91A 4N9LA 2P9VA 3BRMA 1K25A 5CTNA 4WBGA 3O86A 5FQ9A 2G2WA 2JE5A 1CK3A 2Y2PA 3JYIA 1RCJA 4WELA 1I2SA 4OOYA 5FQKA 3WRZA 2HP6A 4K0XA 5M1AA 1KGGA 4BL2A 4MBHA 3OCLA 2XFTA 3HUOA 4F94A 3IF5A 4LV2A 4PM9A 3HL9A 1YM1A 2RL3A 5JYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3U A;  5CHJ A;  5G18 A;  3P09 A;  5HAI A;  3UDF A;  4QD4 A;  5E2G A;  3W4O A;  5CEB A;  1YT4 A;  5M18 A;  5FDH A;  1GA9 A;  2Y2N A;  4KZ8 A;  5FI7 A;  3SS3 A;  1FCM A;  3DWK A;  4KEN B;  4RVA A;  4H8R A;  2OV5 A;  4KZ6 A;  3SS5 A;  2FFY A;  5DF7 A;  5FAT A;  4IVK A;  3W4P A;  5CHU A;  3RXX A;  1DJB A;  3WS0 A;  2HDS A;  2HP5 A;  1RGY A;  4B4Z A;  2V20 A;  3G30 A;  3P98 A;  4M3K A;  3VP1 A;  1K55 C;  3GQZ A;  1BLH A;  3SH8 A;  4DF6 A;  1IYS A;  4S2P A;  3HVF A;  1M6K A;  3OPR A;  1WYB A;  4E3M A;  1L0D A;  4S2N C;  5FI2 A;  5KSH A;  1IEM A;  5FAQ A;  3UPO A;  3BFC A;  4WZ5 C;  3MKE A;  4JBF A;  4KZ3 A;  1XX2 A;  4OP8 A;  2X01 A;  4FH2 A;  4OLD A;  4E3L A;  2H0T A;  4DDY A;  2OSU A;  3IHA A;  3SH9 A;  2HPB A;  4WEJ A;  5GHZ A;  2QMI A;  4JXG A;  4DXB A;  5DF8 A;  3HUM A;  1EWZ A;  1FOF A;  1W79 A;  4K0W A;  1SDE A;  3MXR A;  4WYY A;  5F1G A;  5E2F A;  4XUX A;  3ZDJ A;  1O07 A;  1XA1 A;  2WKI A;  3HLE A;  1FR6 A;  4P87 A;  3MBZ A;  4OOL A;  1JTD A;  5DTS A;  3VMA A;  2G2U A;  4LCM A;  3PBO A;  5E43 A;  5DF9 A;  1K4F A;  1W8Y A;  1K38 A;  1KVL A;  5DVA A;  3MZD A;  3Q7V B;  1FSW A;  4X55 A;  4FH4 A;  2J9P A;  3ZFZ A;  2OLV A;  3FKV A;  2GDN A;  3IXD A;  1PWG A;  5KZH A;  2C5W B;  1CEG A;  4JXS A;  5TFQ A;  1L0G A;  2IWD A;  3WWX A;  2XK1 A;  2ZJ9 A;  3OZH A;  4JXW A;  4LEN A;  3BFF A;  1U60 A;  5E2E A;  3OPP A;  4KQQ A;  1Y54 A;  4OQI A;  3NDG A;  5HAQ A;  1MKI A;  5CED A;  2ZQC A;  4EQI A;  4Y7P A;  4EBL A;  3IF6 C;  4FD8 A;  3VSK A;  3UPP A;  1PIO A;  1XGI A;  3M6H A;  1WYC A;  3IT9 A;  1MPL A;  4BD0 A;  1FSY A;  4PMA A;  4IBR A;  5GLC A;  4E3O A;  4JF6 A;  2CC1 A;  3ZGA B;  4OVD A;  5CGS A;  1L2S A;  1K54 C;  1YLZ A;  3BLS A;  4E3K A;  3IH9 A;  1KGE A;  4FCF A;  2P9V B;  2I72 A;  1KDW A;  3M6B A;  3ZHH A;  4A5R A;  1XGJ A;  2EXA A;  4MBF A;  3MXS A;  1GHI A;  4Y0O A;  4LV3 A;  5GHX A;  5HAP A;  1ALQ A;  2Y2K A;  3LY4 A;  1JVJ A;  4U0X A;  1H8Z A;  1G68 A;  4WM9 A;  5A92 A;  1PYY A;  1CEF A;  3A3F A;  5EVI A;  3UDI A;  4KG2 A;  4EV4 A;  1Z6F A;  4E3J A;  2H0Y A;  5HFO A;  2R9X A;  3M2J A;  1YLJ A;  3NY4 A;  3PAE A;  4U3T A;  5CHM A;  2ZQA A;  4JKT A;  4OPZ A;  1FCO A;  3WRT A;  5A91 A;  5JYP A;  1K57 C;  3DW0 A;  1GCE A;  1BSG A;  2ZM8 A;  1O7E A;  3G2Y A;  3O88 A;  3NI9 A;  4B4X A;  3S1Y A;  3OCN A;  5CXW A;  1PW1 A;  3G4P A;  3WS2 A;  4PM5 A;  1NZU A;  5FSR A;  1ES4 A;  4DE1 A;  3W4Q A;  1YMX A;  1ZG6 A;  1XPB A;  4KG5 A;  3WS1 A;  5HL1 A;  4QU3 A;  1S6R A;  2ZM0 A;  3QHY A;  2HDQ A;  4IBX A;  4CJN A;  4X69 A;  1RGZ A;  3ZG0 A;  4OQ0 A;  3UN7 A;  2ZQ8 A;  4JF4 A;  2EX2 A;  2ZC4 B;  4GDB A;  3VOY A;  4X6T A;  3C5A A;  3IH8 A;  3FZC A;  3UO9 A;  5TGF A;  4OPQ A;  4MLL A;  2EFX A;  1K56 A;  1PWC A;  1DY6 A;  3ZCZ A;  4Q8I A;  1IYP A;  4UAA A;  3EQV A;  3MZF A;  1BT5 A;  3EQU A;  3LO7 A;  4QY6 A;  1LI0 A;  4R0Q A;  4ZTK A;  3BFD A;  2H10 A;  1K57 A;  4X68 A;  4U0T A;  4KQR A;  3MKF A;  3CJM A;  2Z2M B;  4Z9Q A;  5F83 A;  3ZG7 B;  2WGW B;  3HLD A;  1DJC A;  4KZ5 A;  3TG9 A;  3UNW A;  4LV0 A;  4OQG A;  5M19 A;  3ISG A;  2ZM2 A;  1J9M A;  1L0F A;  1G6A A;  5FI6 A;  3UE0 A;  3I7J A;  2RCX A;  4JXV A;  5GHY A;  3PBS A;  1VQQ A;  2ZC5 B;  5FAS A;  2JCH A;  3Q7Z A;  1Q2Q A;  3IXB A;  4RX2 A;  1DJA A;  5CRF A;  3NCK A;  2XQZ A;  1IYO A;  3IHB A;  3ZG8 B;  1E3U A;  2Y2O A;  3IQA A;  4ZJ1 A;  4WZ4 A;  3HUN A;  4P85 A;  4WMC D;  1GHP A;  5EPH A;  2WGV A;  2ZC3 B;  1WE4 A;  2WAD A;  1NYY A;  2XH9 A;  4L0L A;  3O3V A;  5EE8 A;  5FQM A;  1LL5 A;  2EX8 A;  4QY5 A;  3BLM A;  2P74 A;  1HD8 A;  4S2J A;  2XR0 A;  3G32 A;  5GLB A;  4DE2 A;  2DRW A;  1YLW A;  2XEP A;  2Y91 A;  1M40 A;  4C75 A;  1K6S A;  2WYX A;  3NIA A;  4KZB A;  5CER A;  4PM8 A;  4EUZ A;  5KMW A;  1YLT A;  2PU2 A;  4YFM A;  5FA7 A;  2VGJ A;  1MWT A;  2J7V A;  3MFD A;  3GVB A;  1BLC A;  1YLY A;  1ZC2 A;  5F1F A;  4S2N A;  2X71 A;  1SHV A;  3GV9 A;  3A3D A;  1K55 A;  3OC2 A;  3ZG5 A;  4DE0 A;  1BTL A;  4Y0U A;  2ZQ9 A;  3G34 A;  4GOG A;  3HLW A;  4E6W A;  1GHM A;  1TEM A;  5AQB A;  3HRE A;  3LY3 A;  4OKP A;  4DXC A;  1IKI A;  3Q1F A;  1KE0 A;  3PBR A;  2HP9 A;  3N8R A;  2WK0 A;  4OOM A;  3V5M A;  2PU4 A;  3FYZ A;  4HBU A;  1TDG A;  2QPN A;  3PBT A;  3OPH A;  1HTZ A;  1MWU A;  4QHC A;  4MNR A;  1NJ4 A;  1KGF A;  4N9K A;  1KDS A;  2XD1 A;  3GR2 A;  5HAR A;  2ZC7 A;  3LEZ A;  4EWF A;  3FV7 A;  4UHU A;  2ZQ7 A;  1ERM A;  4XXR A;  5A90 A;  3AGD A;  4P0M A;  4JF5 A;  5EOO A;  2WKE A;  1BLS A;  2Q9M A;  2EFU A;  1NRF A;  4P6B A;  1K6R A;  2Y2I A;  3ITB A;  1K56 D;  1SDN A;  3PAG A;  1IEL A;  4S2M A;  5IHV A;  2ZQD A;  3GSG A;  3C7V A;  4KZA A;  3UPN A;  4KZ7 A;  1ESU A;  2R9W A;  4R4S A;  3FKW A;  3QNC A;  1NZO A;  4C6Y A;  3O87 A;  5A93 A;  3AGF A;  3ITA A;  4IVI A;  3ZNY A;  3IWI A;  1ZG4 A;  2EX9 A;  5GLD A;  4BQM A;  3BFG A;  2ZMA A;  3A3I A;  4N1X A;  4S2K A;  5HW3 A;  1PZP A;  1JTG A;  4E3N A;  2QZ6 A;  5EVI D;  4UA9 A;  3WS4 A;  1RP5 A;  1BUE A;  1VM1 A;  1YQS A;  3LCE A;  4ZJ2 A;  3S4X A;  2V2F F;  4GZB A;  3DWZ A;  1PZO A;  2Y2H A;  2HDU A;  1EI5 A;  2A49 A;  2XFS A;  3G31 A;  3GRJ A;  2Y2Q A;  2IWB A;  3GMW A;  1W8Q A;  4O7D A;  4E3I A;  3A3J A;  4JPM A;  4YIN A;  4ZBE A;  3VFF A;  1IYQ A;  4S2I A;  4DRT A;  1KE3 A;  4DKI A;  1YMS A;  1NY0 A;  2Z2L B;  2Y4A A;  3HBR A;  1W5D A;  4RX3 A;  5TR7 A;  5U47 A;  3SS4 A;  3Q7V A;  4GD6 A;  4QB8 A;  1XA7 A;  4WZ5 A;  5AQ9 A;  4GNU A;  1N4O A;  3N6I A;  1K4E A;  4PM6 A;  5L2F A;  3UE1 A;  3IF6 A;  1YLP A;  3VOZ A;  2XLN A;  1HVB A;  1XXM A;  3A3E A;  1FR1 A;  1MWR A;  1TVF A;  3SH7 A;  2Y2L A;  4KZ4 A;  5BOH A;  5D3O A;  4R1G A;  3AGE A;  3N8S A;  5CGW A;  3VSL A;  1E3U D;  5I94 A;  1K54 A;  1I2W A;  1TDL A;  3C4P A;  4B88 A;  4QJG A;  3UY6 A;  1E25 A;  3Q81 A;  1C3B A;  3UE3 A;  4GN2 A;  5KSC A;  3BEC A;  4GDN A;  4WEK A;  4X56 A;  1MBL A;  1OME A;  2OLU A;  4OPY A;  2ZLY A;  3CZD A;  4R23 A;  2V1Z A;  4OP5 A;  3Q82 A;  3VP4 A;  2PBY A;  3C4O A;  2BLS A;  2WUQ A;  3UDX A;  4Y0T A;  4IED A;  1ES5 A;  3W8K A;  3VFH A;  3DTM A;  2WAF A;  1E4D A;  3ZVW A;  1MWS A;  3PBQ A;  3PTE A;  2X02 A;  3D4F A;  3G2Z A;  1KVM A;  3NC8 A;  4DE3 A;  3S22 A;  2BG1 A;  3SOI A;  4N1H A;  2WZZ A;  3C7U A;  5FQI A;  3V39 A;  2ZD8 A;  5CEC A;  2DCF A;  5EEC A;  3IXG A;  4S2O A;  1SCW A;  4ZDX A;  2Y2M A;  4HBT A;  4CPK A;  4KG6 A;  5EVI B;  1H5X A;  1QMF A;  1ERQ A;  1PWD A;  4KZ9 A;  1S0W A;  1ESI A;  4DDS A;  1I5Q A;  5J8X A;  4KQO A;  3WS5 A;  4R3B A;  5HX9 A;  1IKG A;  5F82 A;  2WGI A;  2VGK A;  1N9B A;  3N8L A;  1MY8 A;  4MBK A;  2C6W B;  1LLB A;  2WZX A;  3TOI A;  4D2O A;  1GA0 A;  2HDR A;  3M2K A;  5DTK A;  4HEF A;  1JWZ A;  5FAO A;  1LHY A;  2XDM A;  1QME A;  3RJU A;  2IWC A;  2Y59 A;  3HLB A;  4ID4 A;  2XD5 A;  3CG5 A;  4GB7 A;  1KE4 A;  4BEN A;  4OPR A;  4C3Q A;  3V50 A;  2JBF A;  2XF3 A;  2Y2G A;  3OPL A;  3NDE A;  4ZJ3 A;  3G35 A;  1BLP A;  3BFE A;  4MEZ A;  4BJP A;  3RXW A;  3ZG9 B;  4UA6 A;  4HES A;  3V3S A;  1XP4 A;  4XUZ A;  5E2H A;  4BLM A;  1W7F A;  5EVL A;  1JWV A;  2B5R A;  1MXO A;  5EOE A;  4PM7 A;  5GL9 A;  2DNS A;  4WMC A;  1NXY A;  1CI9 A;  1PI4 A;  4JLF A;  4GD8 A;  3HLG A;  4FSF A;  2UWX A;  4N92 A;  5EUA A;  3ZNT A;  3Q07 A;  1BUL A;  4LCL A;  2WAE A;  5FQJ A;  4EBP A;  2WKH A;  1FQG A;  5CTM A;  4OQH A;  4RA7 A;  5AQA A;  5DTT A;  3TSG A;  4OON A;  1HZO A;  4OLG A;  3V3R A;  4R3J A;  2WGW A;  4EBN A;  4OH0 A;  5EVI C;  1ZKJ A;  3BEB A;  2Q9N A;  2J8Y A;  4R4R A;  2E8I A;  1H8Y A;  1NYM A;  1PW8 A;  3HLF A;  2H5S A;  1ONH A;  2J9O A;  3N7W A;  2EX6 A;  3IF6 B;  3QNB A;  3N4I A;  1ERO A;  3BM6 A;  4PPR A;  3VP3 A;  1ES2 A;  1PI5 A;  3E2K A;  5AQ7 A;  4NK3 A;  1ONG A;  3MZE A;  4ZAM A;  3VP2 A;  1L0E A;  2JC7 A;  4E6X A;  2ZC6 B;  2EXB A;  2Y55 A;  4UA7 A;  3VP0 A;  3BYD A;  1Q2P A;  2XGN A;  4GKU A;  1AXB A;  4RYE A;  4BD1 A;  1SKF A;  4NET A;  1LL9 A;  2FFF B;  4S2L A;  4X53 A;  5CGX A;  3IWQ A;  4LV1 A;  4BL3 A;  1BZA A;  5GLA A;  1XKZ A;  3PBN A;  5FAP A;  1CI8 A;  3IXH A;  3IWO A;  3B3X A;  3CMZ A;  5FQQ A;  3GTC A;  3FWL A;  3ZVT A;  1FCN A;  3E2L A;  1ES3 A;  3NBL A;  1LI9 A;  1JWP A;  2Y2J A;  3HLC A;  4K91 A;  4N9L A;  2P9V A;  3BRM A;  1K25 A;  5CTN A;  4WBG A;  3O86 A;  5FQ9 A;  2G2W A;  2JE5 A;  1CK3 A;  2Y2P A;  3JYI A;  1RCJ A;  4WEL A;  1I2S A;  4OOY A;  5FQK A;  3WRZ A;  2HP6 A;  4K0X A;  5M1A A;  1KGG A;  4BL2 A;  4MBH A;  3OCL A;  2XFT A;  3HUO A;  4F94 A;  3IF5 A;  4LV2 A;  4PM9 A;  3HL9 A;  1YM1 A;  2RL3 A;  5JYO A; 
#chains in the Genus database with same CATH topology
 1T1B A;  5G18 A;  1T18 A;  5HAI A;  5E2G A;  3W4O A;  4BBT A;  5HDS A;  2Y2N A;  5FI7 A;  4KEN B;  3DWK A;  2FFY A;  5DF7 A;  4RQ9 A;  4IVK A;  3RXX A;  3WS0 A;  3T4K A;  4M3K A;  3GQZ A;  3F1N A;  1M6K A;  1L0D A;  5FI2 A;  3UPO A;  4KZ3 A;  3MFX A;  4JGR A;  4M4X A;  4MDZ A;  1W79 A;  5CX7 A;  5F1G A;  5E2F A;  5MC7 A;  2JKF A;  4P87 A;  5DTS A;  2Z6C A;  2D02 A;  3MZD A;  4X55 A;  4FH4 A;  2OLV A;  2GDN A;  2C5W B;  5EV0 A;  3OZH A;  1Y54 A;  1DRM A;  3KYE A;  3IF6 C;  1PIO A;  1XGI A;  4OVD A;  3H7W B;  2B95 A;  3K3C A;  5F5Y A;  1ACF A;  3IH9 A;  4R6L A;  1N9N A;  1KGE A;  2P9V B;  2I72 A;  1KDW A;  1SKO A;  3ZHH A;  2W3H A;  4MBF A;  1V9Z A;  3JPU A;  4Y3I A;  1CJF A;  1ALQ A;  2PAV P;  1DP9 A;  5A92 A;  5EVI A;  5EFW A;  3LIF A;  3UDI A;  2H0Y A;  1NWZ A;  3PAE A;  5CHM A;  4UQI M;  4OPZ A;  3QP8 A;  4WUJ A;  1GCE A;  1BSG A;  2ZM8 A;  1O7E A;  2D01 A;  3S1Y A;  1OTI A;  4I3I A;  5L8M A;  1PW1 A;  3G4P A;  2LB9 A;  3WS2 A;  4PM5 A;  5FSR A;  3W4Q A;  4EER A;  2V9A A;  4KG5 A;  3WS1 A;  1S6R A;  2HDQ A;  4X69 A;  2HJE A;  3ZG0 A;  1P9R A;  3FZC A;  3UO9 A;  4Q8I A;  3NOT C;  3SW1 A;  3BFD A;  3CJM A;  2Z2M B;  3ZG7 B;  2WGW B;  1DJC A;  3NJA A;  3TG9 A;  1P97 A;  3C2W A;  4GLQ A;  5M19 A;  1L0F A;  5FI6 A;  5GHY A;  3PBS A;  1TS7 A;  3IXB A;  3KYQ A;  2AVX A;  1DJA A;  2V0U A;  5CRF A;  1F2K A;  3IQA A;  4ZJ1 A;  3HUN A;  4P85 A;  1GHP A;  1WE4 A;  2WAD A;  4G3W A;  2XH9 A;  5EE8 A;  5FQM A;  1HD8 A;  4HH3 A;  4S2J A;  3ULF A;  2DRW A;  1M40 A;  3DBA A;  2WYX A;  3NIA A;  4JGP A;  5CER A;  1FIK A;  2PU2 A;  2J7V A;  1BLC A;  1YLY A;  4QWO A;  1K55 A;  3OC2 A;  3T12 B;  2MJ6 A;  3PBR A;  3N8R A;  4L9E A;  2PT7 A;  2J3W A;  4HBU A;  2W1T B;  3IBR A;  1HTZ A;  1NJ4 A;  4N9K A;  3EEH A;  1ERM A;  2HF6 A;  3AGD A;  3RTY A;  2EFU A;  3ITB A;  1K56 D;  1SDN A;  3MMH A;  1IEL A;  3C7V A;  3FKW A;  1NZO A;  3O87 A;  3IX8 A;  3G6O A;  4IUH A;  3LUQ A;  3BFG A;  4AFI A;  2V8F A;  3JVV A;  5HD3 A;  5HW3 A;  1JTG A;  4R38 A;  3HJI A;  4UA9 A;  5I5L A;  4ETZ A;  3LEQ A;  3T4L A;  3UE6 A;  2Y2H A;  2A49 A;  2XFS A;  3G31 A;  4D60 A;  3GRJ A;  2Y2Q A;  4E3I A;  1W8Q A;  4O7D A;  4JPM A;  4DKI A;  1NY0 A;  2Z2L B;  2Y4A A;  4QB8 A;  4PM6 A;  5L2F A;  5HPI A;  3H9W A;  1MWR A;  4HOI A;  1P9W A;  3AGE A;  1K54 A;  3KO6 A;  2ZOI A;  1T1C A;  2NUT C;  4WEK A;  1F98 A;  2ZLY A;  3CZD A;  3Q82 A;  3VP4 A;  2KLI A;  1PFL A;  4IED A;  4Y0T A;  3C38 A;  2WAF A;  1E4D A;  2ZL1 A;  3PTE A;  4DE3 A;  2WZZ A;  5CEC A;  5EEC A;  4ZDX A;  1V9Y A;  4HBT A;  5EVI B;  1QMF A;  2PBD P;  1ESI A;  4HP9 A;  4HJ4 A;  4R3B A;  5HX9 A;  5F82 A;  1MY8 A;  2C6W B;  3LIC A;  3BY9 A;  2HDR A;  4FTX A;  4HEF A;  1LHY A;  2XDM A;  3W2Z A;  3HLB A;  3KSI A;  2XD5 A;  2KDK A;  2PHY A;  1OJ5 A;  4ZJ3 A;  3G35 A;  4BJP A;  4PHT A;  2YKF A;  5L09 A;  2WKR A;  4HES A;  5EVL A;  1YSP A;  5EOE A;  1TD5 A;  4WMC A;  2VA0 A;  1D7E A;  4KUK A;  3BW6 A;  2QJ7 A;  4GD8 A;  4N92 A;  4FSF A;  5HWV A;  4LCL A;  5CTM A;  1UWP X;  5DTT A;  4OLG A;  3BQA A;  3V3R A;  5EVI C;  3D3O A;  2J8Y A;  1OTA A;  1W63 M;  5EM0 A;  2XSS A;  3HLF A;  3VE3 A;  2L0W A;  4O01 A;  3E2K A;  5AQ7 A;  2I9V A;  4ZAM A;  3UB8 A;  4E6X A;  3L7H A;  2ZC6 B;  3HJK A;  2Y55 A;  4UA7 A;  3VP0 A;  4NET A;  4X53 A;  5TBM A;  3FG8 A;  2W0N A;  1XKZ A;  1CI8 A;  3B3X A;  3CMZ A;  1ES3 A;  1JWP A;  2JKG A;  3HLC A;  1LSW A;  1S1Y A;  1STZ A;  2ZL1 B;  3B42 A;  2JKR I;  3LR0 A;  3JYI A;  1RCJ A;  4OOY A;  4I38 A;  1YSQ A;  1KGG A;  3IS2 A;  3A0V A;  4K08 A;  4F94 A;  4PM9 A;  1OTD A;  5CHJ A;  5CEB A;  1FCM A;  5DKK A;  3MXQ A;  4RVA A;  4H8R A;  4KZ6 A;  3SS5 A;  3NUL A;  3LID A;  4EEU A;  1RGY A;  1S4R A;  3VP1 A;  1K55 C;  1F5M A;  4S2P A;  3HVF A;  1WYB A;  1IEM A;  2M7V A;  4HP4 A;  3MKE A;  4JBF A;  4OP8 A;  3QP4 A;  4NXE A;  3T50 A;  2OSU A;  3IHA A;  3SH9 A;  1K0K A;  2QMI A;  4DJ3 A;  2A2L A;  1EWZ A;  1FOF A;  3LFV A;  4K0W A;  3MXR A;  3R4K A;  2GX5 A;  4HIA A;  1FR6 A;  3T1Q B;  2G2U A;  4LCM A;  3PBO A;  4NXF A;  1S67 L;  2JHE A;  5DF9 A;  1K4F A;  1W8Y A;  5C5K A;  1GSW A;  1S66 L;  1FSW A;  3ZFZ A;  1NLY A;  1PWG A;  3IXD A;  2VV8 A;  2VGL S;  4JXS A;  5TFQ A;  4B9O A;  2ZJ9 A;  3MQ0 A;  2K31 A;  5E2E A;  4KQQ A;  4OQI A;  5HAQ A;  2WKP A;  2ZQC A;  5TBM B;  3LR3 A;  3FPV A;  1MPL A;  4IBR A;  3IBJ A;  4JF6 A;  2CC1 A;  1GSV A;  3VV4 A;  1L2S A;  1K54 C;  3T4J A;  3PR6 A;  4FCF A;  3CLO A;  3M6B A;  2J3T D;  1KOU A;  1GHI A;  4MCW A;  4Y0O A;  2OAP 1;  2BTF P;  2FH5 A;  1H8Z A;  4U0X A;  4WM9 A;  1CEF A;  1Z6F A;  2R9X A;  3NY4 A;  4U3T A;  5F6A A;  1ODV A;  5J3W A;  3F1P B;  1FCO A;  5A91 A;  5JYP A;  1P0Z A;  3OCN A;  4DE1 A;  3KYZ A;  4UEY A;  1ZG6 A;  5HL1 A;  4QU3 A;  1YKD A;  3QHY A;  1J3W A;  4EUV A;  2ZQ8 A;  2K7S A;  4JF4 A;  1LSV A;  2ZC4 B;  4X6T A;  2O9C A;  2PYP A;  3E4O A;  5TGF A;  4MLL A;  3ZCZ A;  1NRJ A;  2P08 A;  1S4S A;  3CI6 A;  3EQV A;  4ME4 A;  2HJ9 C;  4X68 A;  2HZ5 A;  4CLC B;  4LRY C;  1AWI A;  1J9M A;  1IOU A;  2RCX A;  4LFU A;  1VQQ A;  4RX2 A;  4EQ1 A;  1IYO A;  3CAX A;  3QP5 A;  4WZ4 A;  5EPH A;  2ZC3 B;  3O3V A;  2P74 A;  5HL6 A;  2HV1 A;  2XR0 A;  5GLB A;  2XEP A;  4C75 A;  3GDI A;  5KMW A;  4YFM A;  3MFD A;  3GVB A;  4S2N A;  1SHV A;  4CLC E;  3R7W B;  4Y0U A;  3G34 A;  1GHM A;  1TEM A;  3A0S A;  2HP9 A;  3IS2 B;  1TS6 A;  1A0K A;  3FYZ A;  3OPH A;  4YWZ A;  4MNR A;  3GR2 A;  5HAR A;  3LEZ A;  1OT6 A;  5LBR A;  4WF0 A;  5A90 A;  4P0M A;  2OWH A;  5EOO A;  2K2N A;  1K6R A;  5DFY A;  3KSG A;  3UPN A;  3GSG A;  4KZA A;  4Y13 A;  1ESU A;  4X1L A;  4R4S A;  4C6Y A;  3AGF A;  2OOL A;  3ITA A;  4IVI A;  2EX9 A;  2O0Y A;  5GLD A;  3F1N B;  4BQM A;  4NG2 A;  3A3I A;  1PZP A;  2A24 A;  3C30 A;  4BWI A;  3WS4 A;  1RP5 A;  4MMN A;  3LCE A;  4MN6 A;  4NEE D;  4Q0I A;  4GZB A;  4H6J A;  1EI5 A;  4X1M A;  2IWB A;  3A3J A;  4YIN A;  4S2I A;  4DRT A;  1KE3 A;  1EW0 A;  3QP2 A;  1YMS A;  5U47 A;  1XA7 A;  4GNU A;  3UME A;  1N4O A;  1K4E A;  1YLP A;  1XXM A;  2W3E A;  5AVE A;  1FR1 A;  4CLC C;  1CF0 A;  3UB7 A;  4KZ4 A;  2VLG A;  4R1G A;  5CGW A;  2PDR A;  3N8S A;  4HH2 A;  4DN0 A;  4B88 A;  3CPT B;  4QJG A;  1E25 A;  1C3B A;  5KSC A;  1MBL A;  4JGQ A;  4O0P A;  3EOI A;  3C4O A;  2BLS A;  2WUQ A;  2QHK A;  3W8K A;  3VFH A;  3FPW A;  2R78 A;  3H7W A;  5L10 A;  3PBQ A;  2QWS A;  2VJW A;  2X02 A;  2QJ5 A;  3G2Z A;  1SKO B;  3T1R A;  3LR4 A;  4N1H A;  5FQI A;  4FOF A;  3MS6 A;  4HQA A;  4S2O A;  1SCW A;  4KG6 A;  1ERQ A;  1LL8 A;  4KZ9 A;  5J8X A;  3WS5 A;  3F1P A;  1IKG A;  3N8L A;  1MKM A;  1LLB A;  2WZX A;  3U2A A;  5FAO A;  4UQI S;  3CG5 A;  4BEN A;  3UB9 A;  4OPR A;  1JNU A;  3NDE A;  4MEZ A;  3RXW A;  4PAU A;  4BLM A;  2YKH A;  2B5R A;  4Y5F A;  1ZTU A;  2DNS A;  2PR5 A;  1UGU A;  5IU1 A;  3B47 A;  1CI9 A;  3MQQ A;  2PR6 A;  1LSX A;  3ZNT A;  2EA9 A;  4H6J B;  4EBP A;  2WKH A;  2BAS A;  4RA7 A;  3TSG A;  4R3J A;  4OH0 A;  4L9G A;  2E8I A;  1H8Y A;  2L4R A;  1LT0 A;  1ONH A;  2EX6 A;  1OTB A;  1XJ3 A;  4LRX C;  1UWN X;  4PPR A;  3VP3 A;  1PI5 A;  1ONG A;  3MZE A;  4Q0J A;  2UV0 E;  3U4L P;  2XRO A;  4BD1 A;  1AXB A;  3CIT A;  5TJJ A;  5K5B A;  1BZA A;  3PBN A;  3IXH A;  3GTC A;  3FWL A;  3ZVT A;  3K3D A;  4Y17 A;  1K25 A;  5FDS A;  5CTN A;  4WBG A;  2W1T A;  3O86 A;  3ICY A;  5HPF A;  3CUE C;  5M1A A;  3KSH A;  4NXG A;  3HCY A;  2IA2 A;  1D06 A;  2XFT A;  2EWW A;  3KX0 X;  4ETX A;  1YM1 A;  2A3U A;  1VET B;  2KOI A;  3UDF A;  1YT4 A;  5M18 A;  5FEF A;  4GHI A;  3W4P A;  5CHU A;  1DJB A;  2VV7 A;  3DTE A;  1VEU B;  2V0W A;  3QP6 A;  2V20 A;  4II7 A;  1BLH A;  3SH8 A;  4DF6 A;  3OPR A;  4E3M A;  5EVE A;  4S2N C;  5KSH A;  3BFC A;  4WZ5 C;  1XFQ A;  4E3L A;  4DDY A;  2HPB A;  4WEJ A;  5GHZ A;  2Y79 A;  4JXG A;  4EES A;  2O99 A;  5DF8 A;  3HUM A;  4DXB A;  4WYY A;  1SDE A;  4XUX A;  3ZDJ A;  1O07 A;  2HGV A;  3HLE A;  3MBZ A;  4OOL A;  1JTD A;  3VMA A;  5E43 A;  3T1S A;  1K38 A;  4IJG A;  5DVA A;  4P6Z M;  3FKV A;  1GSX A;  5KZH A;  2JKR M;  1L0G A;  3WWX A;  2XK1 A;  3CPT A;  1SZV A;  3DTI A;  4JXW A;  4LEN A;  3BFF A;  5DFX A;  2M7U A;  2V1A A;  4Y2F A;  3NDG A;  2VX8 A;  4EQI A;  4FD8 A;  3VSK A;  3UPP A;  3S7Q A;  2ZBB A;  1FSY A;  4PMA A;  4E3O A;  3ZGA B;  4WN5 A;  3TW8 A;  3CUE A;  4E3K A;  1S1Z A;  2EXA A;  4IHQ A;  4ZRR A;  5GHX A;  1PNE A;  2Y2K A;  1G28 A;  3LY4 A;  4YOF A;  2W27 A;  4E3J A;  3M2J A;  2ZQA A;  3CWF A;  4JKT A;  3WRT A;  3RFB A;  3G2Y A;  3O88 A;  3NI9 A;  5CXW A;  4GHI B;  1ES4 A;  3P7N A;  4HNB A;  1XPB A;  2ZM0 A;  1VEU A;  1OTE A;  4IBX A;  4CJN A;  2XA7 M;  1RGZ A;  3UN7 A;  3VOY A;  1OT9 A;  3T4T A;  1K56 A;  1PWC A;  1DY6 A;  4WLA A;  3MZF A;  1BT5 A;  3EQU A;  3LO7 A;  1LI0 A;  4R0Q A;  3S7P A;  1K57 A;  4U0T A;  2CMN A;  4YNR A;  4Z9Q A;  4BMW A;  3HLD A;  3UNW A;  4LV0 A;  3NEC A;  4OQG A;  2ZM2 A;  1G6A A;  3I7J A;  4JXV A;  2ZC5 B;  2JCH A;  3Q7Z A;  1Q2Q A;  3DAV A;  2XQZ A;  3ZG8 B;  3EGD C;  1E3U A;  4WL9 A;  3LI8 A;  3E4Q A;  2WGV A;  5IS1 A;  1NYY A;  4L0L A;  1LL5 A;  2EX8 A;  4QY5 A;  5FL3 A;  3BLM A;  4DE2 A;  1YLW A;  2Y91 A;  2H28 A;  5DKL A;  4PM8 A;  3OOV A;  1MWT A;  3LI9 A;  1ZC2 A;  3GV9 A;  4DE0 A;  2PD7 A;  1BTL A;  3BQ8 A;  4GOG A;  3HLW A;  4E6W A;  4OKP A;  4DXC A;  5HWT A;  4BBU A;  4OOM A;  3V5M A;  1TDG A;  2QPN A;  2J80 A;  3PBT A;  1MWU A;  4HI4 A;  4QHC A;  1KDS A;  2XD1 A;  4G3K A;  2ZC7 A;  3FV7 A;  4UHU A;  1FIL A;  3TRC A;  4CQH A;  3E98 A;  2PD8 A;  2Q9M A;  1NRF A;  4R70 A;  2EWV A;  2Y2I A;  4P6B A;  3D9Y A;  4HHD A;  2ACG A;  3PAG A;  4S2M A;  4DMZ A;  2R9W A;  3QNC A;  4G3V A;  5A93 A;  4QPR A;  2G7U A;  3IWI A;  3NOP C;  3QP1 A;  5HSQ A;  4N1X A;  4S2K A;  3T4O A;  4F3L A;  1BUE A;  2LB5 A;  1VM1 A;  3MSH A;  3ZYT A;  3DWZ A;  1PZO A;  4ARZ B;  3PHY A;  2HDU A;  4PKY G;  4ZBE A;  4JGO A;  2W1R A;  4RX3 A;  1W5D A;  3SS4 A;  5FEG A;  5AQ9 A;  2DMW A;  4WZ5 A;  3N6I A;  3UE1 A;  3VOZ A;  2XLN A;  1HVB A;  3A3E A;  3IX3 A;  1TVF A;  3SH7 A;  5BOH A;  5D3O A;  3RH8 B;  1E3U D;  2VK3 A;  3MJQ A;  5I94 A;  3EGX C;  2GZA A;  3UY6 A;  5J4E A;  3Q81 A;  1T19 A;  4GDN A;  4BBV A;  4X56 A;  2OLU A;  2PBY A;  4NKP A;  3UDX A;  1N9O A;  3DTM A;  1MWS A;  2XRN A;  3D4F A;  2JKT M;  1KVM A;  3NC8 A;  4EEP A;  4FUW A;  1G6O A;  4GS9 B;  3V39 A;  3IXG A;  1Y28 A;  4CPK A;  2WKQ A;  3TJZ C;  1PWD A;  1S0W A;  4DDS A;  1I5Q A;  1H3Q A;  4KQO A;  2WGI A;  2VGK A;  1N9B A;  1DP6 A;  4D2O A;  2M1C A;  2P7J A;  1GA0 A;  3VOL A;  1JWZ A;  1QME A;  2IWC A;  3OBF A;  4C3Q A;  2Y2G A;  3BFE A;  3ZG9 B;  4UA6 A;  3V3S A;  1Z09 A;  1W7F A;  1JWV A;  4F3L B;  4PM7 A;  1H8M A;  2XA7 S;  1TS8 A;  1NXY A;  4JLF A;  3HLG A;  2UWX A;  3Q07 A;  3L9K A;  3D72 A;  4OQH A;  3GEC A;  1G5U A;  4EXO A;  1HZO A;  2OWJ A;  3BEB A;  2Q9N A;  2W3D A;  2J9O A;  3QNB A;  4HY8 A;  1ERO A;  3NOU C;  3BM6 A;  1ES2 A;  4X25 A;  2EXB A;  3BYD A;  1SKF A;  1LL9 A;  4S2L A;  3IWQ A;  4LV1 A;  3IX4 A;  5FQQ A;  1FCN A;  3NBL A;  1LI9 A;  4XT2 B;  3EEA A;  3KSF A;  3EWK A;  4K91 A;  3BRM A;  4GCZ A;  3V67 A;  1ZHH B;  1YAX A;  2Y2P A;  2JE5 A;  4WEL A;  5FQK A;  4K0X A;  1IFQ A;  4L9F A;  4BL2 A;  3IF5 A;  3HL9 A;  3A0R A;  2X01 A;  5JYO A;  3P09 A;  4QD4 A;  5FDH A;  1GA9 A;  4KZ8 A;  3SS3 A;  2OV5 A;  5FAT A;  5HZH A;  2HDS A;  2HP5 A;  2V8C A;  4B4Z A;  3G30 A;  1WA9 A;  3P98 A;  2A24 B;  1IYS A;  5KIZ A;  5EM1 A;  5FAQ A;  3BWL A;  1XX2 A;  1N9L A;  4I3J A;  4Q0H A;  3VE4 A;  3UMD A;  4FH2 A;  4EET B;  4OLD A;  2H0T A;  3C8C A;  3PYP A;  3BJN A;  1D1J A;  1XA1 A;  2WKI A;  5F68 A;  3JVU A;  1KVL A;  3Q7V B;  2J9P A;  1CEG A;  2IWD A;  1H0M A;  2OAQ 1;  3K2N A;  2L1M A;  1U60 A;  3OPP A;  4NXB A;  1MKI A;  3T4Q A;  2NUP C;  5CED A;  4Z1W A;  4Y7P A;  4EBL A;  4CLC D;  3M6H A;  1WYC A;  3IT9 A;  2VV6 A;  4BD0 A;  5GLC A;  5CGS A;  2J3T C;  1YLZ A;  3BLS A;  5DJU A;  4XT2 A;  4A5R A;  1XGJ A;  5IT5 A;  3MXS A;  4LV3 A;  5HAP A;  2W3G A;  4KUO A;  1JVJ A;  1G68 A;  1PYY A;  3A3F A;  4KG2 A;  4EV4 A;  4EW7 A;  5HFO A;  3H82 A;  1MC0 A;  1YLJ A;  2W3F A;  2ZOH A;  4DJ2 A;  1K57 C;  3DW0 A;  1OPX A;  3MR0 A;  4B4X A;  2Q0O A;  1L3L A;  1NZU A;  4HJ6 A;  1YMX A;  4EU0 A;  5J7E A;  4MN5 A;  4OQ0 A;  2EX2 A;  4GDB A;  3FC7 A;  3C5A A;  3IH8 A;  4OPQ A;  4ARZ A;  3T1X A;  2EFX A;  1IYP A;  4UAA A;  2VKS A;  4QY6 A;  4GJ4 A;  4ZTK A;  2H10 A;  1PRQ A;  3LR5 A;  5A8B A;  4KQR A;  3MKF A;  4ESP A;  5F83 A;  4KZ5 A;  3BY8 A;  3ISG A;  5G4Z A;  3UE0 A;  5FAS A;  3UB6 A;  4KQD A;  2GJ3 A;  5DJT A;  3NCK A;  3IHB A;  2Y2O A;  4WMC D;  2QYB A;  4IUK A;  1W63 Q;  3PXP A;  3G32 A;  3OLO A;  1K6S A;  4GW9 A;  4KZB A;  1VHM A;  4EUZ A;  1YLT A;  5FA7 A;  2VGJ A;  5F1F A;  1OJG A;  3LGO A;  3E4P A;  2X71 A;  2VZW A;  3A3D A;  3ZG5 A;  2ZQ9 A;  4GS9 A;  5AQB A;  3ZQ5 A;  1HLU P;  3HRE A;  3LY3 A;  4I39 A;  1IKI A;  3Q1F A;  1KE0 A;  3S7O A;  2WK0 A;  2PU4 A;  5HD5 A;  1KGF A;  1MZU A;  4EWF A;  1VET A;  1NLZ A;  2ZQ7 A;  3DTK A;  1DP8 A;  1YPR A;  4XXR A;  4JF5 A;  2WKE A;  1BLS A;  3H82 B;  3T4S A;  5IHV A;  2ZQD A;  4KZ7 A;  1CQA A;  3ZNY A;  4LRZ E;  1ZG4 A;  5L07 A;  4HJ3 A;  2JKT I;  2ZMA A;  4E3N A;  2QZ6 A;  5EVI D;  3LIA A;  3UB5 P;  2O9B A;  1YQS A;  4ZJ2 A;  3S4X A;  2KX6 A;  2V2F F;  3GMW A;  3MF0 A;  3VFF A;  1IYQ A;  4LLO B;  5TR7 A;  3HBR A;  4Y15 A;  1F9I A;  3LIB A;  3Q7V A;  4GD6 A;  4I5S A;  1TS0 A;  3IF6 A;  5HDC A;  5AJG A;  3SZT A;  1XJ4 A;  3CHW P;  2Y2L A;  2PYR A;  3VSL A;  1I2W A;  1TDL A;  2P04 A;  3C4P A;  5AVF A;  3UE3 A;  4GN2 A;  4MN7 A;  4B93 A;  3BEC A;  1Y4O A;  1OME A;  4OPY A;  4R23 A;  2V1Z A;  4OP5 A;  3LYX A;  1ES5 A;  3ZVW A;  5HDD A;  2INW A;  2FZ0 A;  3S22 A;  2BG1 A;  3SOI A;  2ZMV A;  3C7U A;  3F1O B;  2ZD8 A;  2DCF A;  2Y2M A;  2QKP A;  1H5X A;  3TE8 A;  2Z6D A;  1TF1 A;  5HWW A;  4MBK A;  3TOI A;  2ZMF A;  3M2K A;  5DTK A;  3RJU A;  2Y59 A;  4ID4 A;  4GB7 A;  1KE4 A;  4I3A A;  3V50 A;  2JBF A;  2XF3 A;  3OPL A;  2JN7 A;  1BLP A;  1T1A A;  2B02 A;  4O8G A;  1X0O A;  2E8J A;  1XP4 A;  4XUZ A;  2B18 A;  5E2H A;  4LPZ A;  4E04 A;  1XFN A;  1MXO A;  5F69 A;  5GL9 A;  1PI4 A;  1XJ6 A;  5EUA A;  1BUL A;  5FQJ A;  2WAE A;  4R3A A;  1FQG A;  5AQA A;  2VEA A;  3P01 A;  4OON A;  4CLC A;  2WGW A;  3O5Y A;  4EBN A;  1ZKJ A;  4R4R A;  3NHQ A;  1NYM A;  1PW8 A;  3MQO A;  2H5S A;  4PKY A;  3N7W A;  3IF6 B;  1VB6 A;  3N4I A;  3VP2 A;  4NK3 A;  1BYW A;  1L0E A;  2JC7 A;  4P6Z S;  1Q2P A;  4LGW A;  2XGN A;  2Y8H A;  4GKU A;  4RYE A;  2GNX A;  2FFF B;  5CGX A;  3B33 A;  4BL3 A;  5GLA A;  1XJ2 A;  2O9A A;  3S7N A;  5FAP A;  3IWO A;  3E0Y A;  3E2L A;  2V1B A;  2Y2J A;  4N9L A;  2P9V A;  3R7W A;  2PRF A;  5FQ9 A;  2G2W A;  1CK3 A;  1I2S A;  3WRZ A;  2HP6 A;  5G4Y A;  3F1O A;  4MBH A;  3OCL A;  3HUO A;  3LIE A;  2VGL M;  4LV2 A;  2RL3 A; 
#chains in the Genus database with same CATH homology
 2A3U A;  5CHJ A;  5G18 A;  3P09 A;  5HAI A;  3UDF A;  4QD4 A;  5E2G A;  3W4O A;  5CEB A;  1YT4 A;  5M18 A;  5FDH A;  1GA9 A;  2Y2N A;  4KZ8 A;  5FI7 A;  3SS3 A;  1FCM A;  3DWK A;  4KEN B;  4RVA A;  4H8R A;  2OV5 A;  4KZ6 A;  3SS5 A;  2FFY A;  5DF7 A;  5FAT A;  4IVK A;  3W4P A;  5CHU A;  3RXX A;  1DJB A;  3WS0 A;  2HDS A;  2HP5 A;  1RGY A;  4B4Z A;  2V20 A;  3G30 A;  3P98 A;  4M3K A;  3VP1 A;  1K55 C;  3GQZ A;  1BLH A;  3SH8 A;  4DF6 A;  1IYS A;  4S2P A;  3HVF A;  1M6K A;  3OPR A;  1WYB A;  4E3M A;  1L0D A;  4S2N C;  5FI2 A;  5KSH A;  1IEM A;  5FAQ A;  3UPO A;  3BFC A;  4WZ5 C;  3MKE A;  4JBF A;  4KZ3 A;  1XX2 A;  4OP8 A;  2X01 A;  4FH2 A;  4OLD A;  4E3L A;  2H0T A;  4DDY A;  2OSU A;  3IHA A;  3SH9 A;  2HPB A;  4WEJ A;  5GHZ A;  2QMI A;  4JXG A;  4DXB A;  5DF8 A;  3HUM A;  1EWZ A;  1FOF A;  1W79 A;  4K0W A;  1SDE A;  3MXR A;  4WYY A;  5F1G A;  5E2F A;  4XUX A;  3ZDJ A;  1O07 A;  1XA1 A;  2WKI A;  3HLE A;  1FR6 A;  4P87 A;  3MBZ A;  4OOL A;  1JTD A;  5DTS A;  3VMA A;  2G2U A;  4LCM A;  3PBO A;  5E43 A;  5DF9 A;  1K4F A;  1W8Y A;  1K38 A;  1KVL A;  5DVA A;  3MZD A;  3Q7V B;  1FSW A;  4X55 A;  4FH4 A;  2J9P A;  3ZFZ A;  2OLV A;  3FKV A;  2GDN A;  3IXD A;  1PWG A;  5KZH A;  2C5W B;  1CEG A;  4JXS A;  5TFQ A;  1L0G A;  2IWD A;  3WWX A;  2XK1 A;  2ZJ9 A;  3OZH A;  4JXW A;  4LEN A;  3BFF A;  1U60 A;  5E2E A;  3OPP A;  4KQQ A;  1Y54 A;  4OQI A;  3NDG A;  5HAQ A;  1MKI A;  5CED A;  2ZQC A;  4EQI A;  4Y7P A;  4EBL A;  3IF6 C;  4FD8 A;  3VSK A;  3UPP A;  1PIO A;  1XGI A;  3M6H A;  1WYC A;  3IT9 A;  1MPL A;  4BD0 A;  1FSY A;  4PMA A;  4IBR A;  5GLC A;  4E3O A;  4JF6 A;  2CC1 A;  3ZGA B;  4OVD A;  5CGS A;  1L2S A;  1K54 C;  1YLZ A;  3BLS A;  4E3K A;  3IH9 A;  1KGE A;  4FCF A;  2P9V B;  2I72 A;  1KDW A;  3M6B A;  3ZHH A;  4A5R A;  1XGJ A;  2EXA A;  4MBF A;  3MXS A;  1GHI A;  4Y0O A;  4LV3 A;  5GHX A;  5HAP A;  1ALQ A;  2Y2K A;  3LY4 A;  1JVJ A;  4U0X A;  1H8Z A;  1G68 A;  4WM9 A;  5A92 A;  1PYY A;  1CEF A;  3A3F A;  5EVI A;  3UDI A;  4KG2 A;  4EV4 A;  1Z6F A;  4E3J A;  2H0Y A;  5HFO A;  2R9X A;  3M2J A;  1YLJ A;  3NY4 A;  3PAE A;  4U3T A;  5CHM A;  2ZQA A;  4JKT A;  4OPZ A;  1FCO A;  3WRT A;  5A91 A;  5JYP A;  1K57 C;  3DW0 A;  1GCE A;  1BSG A;  2ZM8 A;  1O7E A;  3G2Y A;  3O88 A;  3NI9 A;  4B4X A;  3S1Y A;  3OCN A;  5CXW A;  1PW1 A;  3G4P A;  3WS2 A;  4PM5 A;  1NZU A;  5FSR A;  1ES4 A;  4DE1 A;  3W4Q A;  1YMX A;  1ZG6 A;  1XPB A;  4KG5 A;  3WS1 A;  5HL1 A;  4QU3 A;  1S6R A;  2ZM0 A;  3QHY A;  2HDQ A;  4IBX A;  4CJN A;  4X69 A;  1RGZ A;  3ZG0 A;  4OQ0 A;  3UN7 A;  2ZQ8 A;  4JF4 A;  2EX2 A;  2ZC4 B;  4GDB A;  3VOY A;  4X6T A;  3C5A A;  3IH8 A;  3FZC A;  3UO9 A;  5TGF A;  4OPQ A;  4MLL A;  2EFX A;  1K56 A;  1PWC A;  1DY6 A;  3ZCZ A;  4Q8I A;  1IYP A;  4UAA A;  3EQV A;  3MZF A;  1BT5 A;  3EQU A;  3LO7 A;  4QY6 A;  1LI0 A;  4R0Q A;  4ZTK A;  3BFD A;  2H10 A;  1K57 A;  4X68 A;  4U0T A;  4KQR A;  3MKF A;  3CJM A;  2Z2M B;  4Z9Q A;  5F83 A;  3ZG7 B;  2WGW B;  3HLD A;  1DJC A;  4KZ5 A;  3TG9 A;  3UNW A;  4LV0 A;  4OQG A;  5M19 A;  3ISG A;  2ZM2 A;  1J9M A;  1L0F A;  1G6A A;  5FI6 A;  3UE0 A;  3I7J A;  2RCX A;  4JXV A;  5GHY A;  3PBS A;  1VQQ A;  2ZC5 B;  5FAS A;  2JCH A;  3Q7Z A;  1Q2Q A;  3IXB A;  4RX2 A;  1DJA A;  5CRF A;  3NCK A;  2XQZ A;  1IYO A;  3IHB A;  3ZG8 B;  1E3U A;  2Y2O A;  3IQA A;  4ZJ1 A;  4WZ4 A;  3HUN A;  4P85 A;  4WMC D;  1GHP A;  5EPH A;  2WGV A;  2ZC3 B;  1WE4 A;  2WAD A;  1NYY A;  2XH9 A;  4L0L A;  3O3V A;  5EE8 A;  5FQM A;  1LL5 A;  2EX8 A;  4QY5 A;  3BLM A;  2P74 A;  1HD8 A;  4S2J A;  2XR0 A;  3G32 A;  5GLB A;  4DE2 A;  2DRW A;  1YLW A;  2XEP A;  2Y91 A;  1M40 A;  4C75 A;  1K6S A;  2WYX A;  3NIA A;  4KZB A;  5CER A;  4PM8 A;  4EUZ A;  5KMW A;  1YLT A;  2PU2 A;  4YFM A;  5FA7 A;  2VGJ A;  1MWT A;  2J7V A;  3MFD A;  3GVB A;  1BLC A;  1YLY A;  1ZC2 A;  5F1F A;  4S2N A;  2X71 A;  1SHV A;  3GV9 A;  3A3D A;  1K55 A;  3OC2 A;  3ZG5 A;  4DE0 A;  1BTL A;  4Y0U A;  2ZQ9 A;  3G34 A;  4GOG A;  3HLW A;  4E6W A;  1GHM A;  1TEM A;  5AQB A;  3HRE A;  3LY3 A;  4OKP A;  4DXC A;  1IKI A;  3Q1F A;  1KE0 A;  3PBR A;  2HP9 A;  3N8R A;  2WK0 A;  4OOM A;  3V5M A;  2PU4 A;  3FYZ A;  4HBU A;  1TDG A;  2QPN A;  3PBT A;  3OPH A;  1HTZ A;  1MWU A;  4QHC A;  4MNR A;  1NJ4 A;  1KGF A;  4N9K A;  1KDS A;  2XD1 A;  3GR2 A;  5HAR A;  2ZC7 A;  3LEZ A;  4EWF A;  3FV7 A;  4UHU A;  2ZQ7 A;  1ERM A;  4XXR A;  5A90 A;  3AGD A;  4P0M A;  4JF5 A;  5EOO A;  2WKE A;  1BLS A;  2Q9M A;  2EFU A;  1NRF A;  4P6B A;  1K6R A;  2Y2I A;  3ITB A;  1K56 D;  1SDN A;  3PAG A;  1IEL A;  4S2M A;  5IHV A;  2ZQD A;  3GSG A;  3C7V A;  4KZA A;  3UPN A;  4KZ7 A;  1ESU A;  2R9W A;  4R4S A;  3FKW A;  3QNC A;  1NZO A;  4C6Y A;  3O87 A;  5A93 A;  3AGF A;  3ITA A;  4IVI A;  3ZNY A;  3IWI A;  1ZG4 A;  2EX9 A;  5GLD A;  4BQM A;  3BFG A;  2ZMA A;  3A3I A;  4N1X A;  4S2K A;  5HW3 A;  1PZP A;  1JTG A;  4E3N A;  2QZ6 A;  5EVI D;  4UA9 A;  3WS4 A;  1RP5 A;  1BUE A;  1VM1 A;  1YQS A;  3LCE A;  4ZJ2 A;  3S4X A;  2V2F F;  4GZB A;  3DWZ A;  1PZO A;  2Y2H A;  2HDU A;  1EI5 A;  2A49 A;  2XFS A;  3G31 A;  3GRJ A;  2Y2Q A;  2IWB A;  3GMW A;  1W8Q A;  4O7D A;  4E3I A;  3A3J A;  4JPM A;  4YIN A;  4ZBE A;  3VFF A;  1IYQ A;  4S2I A;  4DRT A;  1KE3 A;  4DKI A;  1YMS A;  1NY0 A;  2Z2L B;  2Y4A A;  3HBR A;  1W5D A;  4RX3 A;  5TR7 A;  5U47 A;  3SS4 A;  3Q7V A;  4GD6 A;  4QB8 A;  1XA7 A;  4WZ5 A;  5AQ9 A;  4GNU A;  1N4O A;  3N6I A;  1K4E A;  4PM6 A;  5L2F A;  3UE1 A;  3IF6 A;  1YLP A;  3VOZ A;  2XLN A;  1HVB A;  1XXM A;  3A3E A;  1FR1 A;  1MWR A;  1TVF A;  3SH7 A;  2Y2L A;  4KZ4 A;  5BOH A;  5D3O A;  4R1G A;  3AGE A;  3N8S A;  5CGW A;  3VSL A;  1E3U D;  5I94 A;  1K54 A;  1I2W A;  1TDL A;  3C4P A;  4B88 A;  4QJG A;  3UY6 A;  1E25 A;  3Q81 A;  1C3B A;  3UE3 A;  4GN2 A;  5KSC A;  3BEC A;  4GDN A;  4WEK A;  4X56 A;  1MBL A;  1OME A;  2OLU A;  4OPY A;  2ZLY A;  3CZD A;  4R23 A;  2V1Z A;  4OP5 A;  3Q82 A;  3VP4 A;  2PBY A;  3C4O A;  2BLS A;  2WUQ A;  3UDX A;  4Y0T A;  4IED A;  1ES5 A;  3W8K A;  3VFH A;  3DTM A;  2WAF A;  1E4D A;  3ZVW A;  1MWS A;  3PBQ A;  3PTE A;  2X02 A;  3D4F A;  3G2Z A;  1KVM A;  3NC8 A;  4DE3 A;  3S22 A;  2BG1 A;  3SOI A;  4N1H A;  2WZZ A;  3C7U A;  5FQI A;  3V39 A;  2ZD8 A;  5CEC A;  2DCF A;  5EEC A;  3IXG A;  4S2O A;  1SCW A;  4ZDX A;  2Y2M A;  4HBT A;  4CPK A;  4KG6 A;  5EVI B;  1H5X A;  1QMF A;  1ERQ A;  1PWD A;  4KZ9 A;  1S0W A;  1ESI A;  4DDS A;  1I5Q A;  5J8X A;  4KQO A;  3WS5 A;  4R3B A;  5HX9 A;  1IKG A;  5F82 A;  2WGI A;  2VGK A;  1N9B A;  3N8L A;  1MY8 A;  4MBK A;  2C6W B;  1LLB A;  2WZX A;  3TOI A;  4D2O A;  1GA0 A;  2HDR A;  3M2K A;  5DTK A;  4HEF A;  1JWZ A;  5FAO A;  1LHY A;  2XDM A;  1QME A;  3RJU A;  2IWC A;  2Y59 A;  3HLB A;  4ID4 A;  2XD5 A;  3CG5 A;  4GB7 A;  1KE4 A;  4BEN A;  4OPR A;  4C3Q A;  3V50 A;  2JBF A;  2XF3 A;  2Y2G A;  3OPL A;  3NDE A;  4ZJ3 A;  3G35 A;  1BLP A;  3BFE A;  4MEZ A;  4BJP A;  3RXW A;  3ZG9 B;  4UA6 A;  4HES A;  3V3S A;  1XP4 A;  4XUZ A;  5E2H A;  4BLM A;  1W7F A;  5EVL A;  1JWV A;  2B5R A;  1MXO A;  5EOE A;  4PM7 A;  5GL9 A;  2DNS A;  4WMC A;  1NXY A;  1CI9 A;  1PI4 A;  4JLF A;  4GD8 A;  3HLG A;  4FSF A;  2UWX A;  4N92 A;  5EUA A;  3ZNT A;  3Q07 A;  1BUL A;  4LCL A;  2WAE A;  5FQJ A;  4EBP A;  2WKH A;  1FQG A;  5CTM A;  4OQH A;  4RA7 A;  5AQA A;  5DTT A;  3TSG A;  4OON A;  1HZO A;  4OLG A;  3V3R A;  4R3J A;  2WGW A;  4EBN A;  4OH0 A;  5EVI C;  1ZKJ A;  3BEB A;  2Q9N A;  2J8Y A;  4R4R A;  2E8I A;  1H8Y A;  1NYM A;  1PW8 A;  3HLF A;  2H5S A;  1ONH A;  2J9O A;  3N7W A;  2EX6 A;  3IF6 B;  3QNB A;  3N4I A;  1ERO A;  3BM6 A;  4PPR A;  3VP3 A;  1ES2 A;  1PI5 A;  3E2K A;  5AQ7 A;  4NK3 A;  1ONG A;  3MZE A;  4ZAM A;  3VP2 A;  1L0E A;  2JC7 A;  4E6X A;  2ZC6 B;  2EXB A;  2Y55 A;  4UA7 A;  3VP0 A;  3BYD A;  1Q2P A;  2XGN A;  4GKU A;  1AXB A;  4RYE A;  4BD1 A;  1SKF A;  4NET A;  1LL9 A;  2FFF B;  4S2L A;  4X53 A;  5CGX A;  3IWQ A;  4LV1 A;  4BL3 A;  1BZA A;  5GLA A;  1XKZ A;  3PBN A;  5FAP A;  1CI8 A;  3IXH A;  3IWO A;  3B3X A;  3CMZ A;  5FQQ A;  3GTC A;  3FWL A;  3ZVT A;  1FCN A;  3E2L A;  1ES3 A;  3NBL A;  1LI9 A;  1JWP A;  2Y2J A;  3HLC A;  4K91 A;  4N9L A;  2P9V A;  3BRM A;  1K25 A;  5CTN A;  4WBG A;  3O86 A;  5FQ9 A;  2G2W A;  2JE5 A;  1CK3 A;  2Y2P A;  3JYI A;  1RCJ A;  4WEL A;  1I2S A;  4OOY A;  5FQK A;  3WRZ A;  2HP6 A;  4K0X A;  5M1A A;  1KGG A;  4BL2 A;  4MBH A;  3OCL A;  2XFT A;  3HUO A;  4F94 A;  3IF5 A;  4LV2 A;  4PM9 A;  3HL9 A;  1YM1 A;  2RL3 A;  5JYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...