1O0PA

Solution structure of the third rna recognition motif (rrm) of u2af65 in complex with an n-terminal sf1 peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
104
structure length
104
Chain Sequence
GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the molecular recognition between human splicing factors U2AF65 and SF1/mBBP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Splicing factor U2AF 65 kDa subunit
total genus 16
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1o0pA00
3ZZYA 2MY8A 2JRSA 2MKHA 2KN4A 2LKZA 1WG1A 3CXCR 2DO0A 4F02A 2MZSA 4YB1P 4F26A 1U1NA 3G9CA 1YJ9S 3CMES 2MQLA 2DGTA 3U1MA 2K8GA 3MUVP 4V19X 2LECA 2DHGA 4WFNQ 2KI2A 2ADBA 1S79A 2XSFA 2DGQA 3CCJS 3NNHA 2M8DB 1X0FA 3THTA 4FXWA 1VQ5S 3G71S 3VAHA 3UCZP 2XNQA 1QVFR 2DH8A 1XN9A 4Y00A 2MQMA 2DISA 1Q81T 2EK1A 4CQ1A 2CQ2A 1A9NB 4LMZA 1M5KC 2CPFA 1UAWA 4CIOA 4W90B 1WG5A 1FHTA 1UFWA 1Q82T 4TU8A 4A8XA 1HA1A 3US5A 1N52B 3NS6A 2ERRA 2CQIA 1U1OA 4QU6A 5IM0A 2DNYA 3SDEA 2DHXA 3K0JA 2OIHA 2GHPA 1KQSR 1UP1A 2E5JA 2M2BA 3J7YU 2YWKA 3ZZZA 1BY9A 2KVIA 2RT3A 2MHNA 5JVGQ 2D9OA 1CVJA 2D9PA 2M52A 1WI8A 2KXHA 1OWXA 2MXYA 1U1LA 3CC7S 2QEXS 3UD3P 2RRBA 1Q86T 2XB2D 1OPIA 5CYJA 2FC9A 3PIOQ 2JVRA 1U1QA 1WHVA 2CQPA 2I38A 2KM8B 3CMAS 2D3OR 2CPZA 2OTJS 2LA6A 2PEHA 3VAMA 2YKAA 5DDQC 2DGWA 1SJ4P 1VC0A 3PIPQ 1D9AA 4LJMA 2FPHX 1N54B 1IQTA 3CTRA 1DHMA 1X4DA 2CPIA 4CH1A 3MI7X 2M0GB 3VAJA 2RNEA 5LXYA 2KT5A 4BS2A 4Y0FA 2CPEA 1DBDA 3SXLA 2MZTA 1U1RA 2J76E 2MQQA 3Q2TC 1X5TA 1X4EA 2RUGA 3G8SA 1A7GE 3L3CA 3CCES 3JB9k 2MQNA 2CQHA 3B4DA 1RK8A 5LSLA 3CCSS 1W2BR 1KOOA 5GVQA 5LJ3Y 1PO6A 4IOAQ 2M4MA 5HO4A 3FEXB 4TU7A 2LQ5A 3VAGA 2CQ1A 1M1KT 3OW2R 2HGLA 1DZ5A 1SJRA 3MDFA 5DDOC 3BEGB 1WWHA 5FJ4A 2DNOA 1FXLA 2DNLA 1X5OA 1K73T 1P1TA 2V94A 1N8RT 1R8PA 1VQ4S 3NS5A 4IUFA 2SXLA 1FO1A 1YIJS 1X4HA 1U1PA 1D8ZA 1WEZA 2KFYA 2J0QD 2NLWA 2RS8A 4C7QA 1VQKS 2YH0A 2DGSA 3MUTP 1VBZA 3ULHA 3P3DA 4Z2XA 3UD4P 1ZZFA 3UWTA 1YJNS 1JMTA 4WCEQ 2L08A 2LEAA 1WG4A 2CQCA 2G1DA 2KG0A 1KOHA 3LPYA 3CULA 1N88A 3Q2SC 4ERDA 2AD9A 2RRAA 3VALA 1L3KA 1FJEB 2M8HA 1WHYA 1SXLA 5HL7Q 3S6EA 3DXBA 3G96A 3RW6A 3TP2A 3P49B 5GADU 3D2WA 3S8SA 3H2UB 3MD1A 5D77A 2DNMA 2N82B 2MKIA 2QA4S 2DNQA 2HYIB 2MSTA 4J5OA 5GMKa 4UQTA 1K8AT 2DH7A 2J0SD 2AYBA 4M5DB 2E5GA 1YWXA 4P6QA 2MYFA 2KU7A 2G4BA 1FT8A 2MKCA 2CPHA 1VQ8S 3G8TA 4PKDB 5H1SV 1SJ3P 2XS7A 2OJ3A 5MLCV 1YI2S 1O0PA 3VAFA 5DM7Q 2MQPA 2CPJA 5IM0B 5IFMA 3NNAA 3VF0B 4YOEA 1HD0A 3EX7B 1ZH5A 2M7SA 2MZQA 2JVOA 1P27B 4ED5A 2X1GA 2DNHA 2GO9A 2DNZA 4QPTA 1KD1T 2M88A 2LMIA 4CH0S 1X4AA 3FEYB 2G0CA 4PR6A 1VBYA 3MURP 3IRWP 1YITS 1S72S 1WEYA 2HGMA 2O3DA 2LXIA 2M70A 1M5PC 2DNKA 2Q79A 2DNGA 2F9DA 2DGXA 5DM6Q 2MKKA 2PE8A 2EVZA 1VC5A 1NU4A 5DDRC 2CQGA 4IO9Q 1U2FA 3G4SS 2B0GA 1B7FA 3G6ES 5LXRA 2OSQA 2JX2A 1FJ7A 1JJHA 2MY7A 5LJ5Y 1WHWA 1WF1A 2OTLS 5BJRA 1JJ4A 1H2UX 2DK2A 2LYVA 1R8HA 4PRFA 5DDPC 4WIIA 2N3OA 2L9WA 2KXFA 3UCGA 3CCQS 1DRZA 1VQ9S 1NO8A 2NZ4A 3H2VE 4UY8T 2UP1A 1X4CA 2YTCA 1OIAA 2KG1A 4IOCQ 4LIRA 5JVHQ 2E44A 2VONA 2MKSA 2VODA 1ZZNA 4QQBA 4OZ1A 4C0OC 3S7RA 2U2FA 3V4MA 4U67Q 2DGOA 2DITA 4RU2A 1U1KA 5LSOA 2N3LA 5DETA 1U6BA 3CD6S 2E5HA 3B4MA 2MZ1A 4WFBQ 2DNNA 2RQ4A 2KHCA 2MQOA 3VAIA 2X1AA 1JJ2R 1HD1A 4FXVA 2FY1A 2DHSA 1WF0A 5ITHA 1VQLS 2KRRA 3I55S 2XNRA 3R1HA 2LEBA 4WF9Q 5GAGU 3NNCA 1WF2A 3MUMP 3S01A 3CCLS 1VQPS 2ADCA 3EGNA 3J7ZT 2ZJPQ 4W92B 2VOOA 2KXNB 2RU3A 2CPYA 2CPDA 3SDEB 3CUNA 2HGNA 1PGZA 3VAKA 1H2TZ 2ZJRQ 3SMZA 2YH1A 2KM8C 1URNA 5GAEU 2DIVA 5CA5A 3BO3A 2XS2A 1VQNS 4QU7A 1X5PA 2WBRA 1FJCA 1WELA 1X5SA 2HZCA 2MJNA 2X1FA 2RVJA 1X4BA 2M9KA 2FHOB 3R1LA 3MOJB 3R27A 3CF5Q 1YTYA 1OO0B 1K9MT 2AYEA 1RKJA 3CCVS 2VOPA 4F25A 2DGUA 2DIUA 3UE2A 2XS5A 1M5OC 1U1MA 2EK6A 3CC4S 4TU9A 3TO8A 1UW4A 1VC6A 3DLLQ 1SJQA 4WFAQ 1WTBA 5GAHU 3EGZA 3MD3A 3U1LA 2CQ3A 1M5VC 1M90T 2I2YA 1X4FA 2MMYA 2KYXA 3BS9A 2CQBA 1NJIT 3P6YC 2MPUA 4ZKAA 4C4WA 2LA4A 2N7CA 1QVGR 3HI9A 2MSSA 1U6FA 3NMRA 2A3JA 1VBXA 2BOPA 2HVZA 3P5TL 2MJUA 3N9UC 2K3KA 2DGVA 1KC8T 1WI6A 1H2VZ 2JWNA 2RS2A 3CC2S 1YHQS 1G2EA 2L41A 5D78A 2CPXA 2MB0B 1F9FA 2MKJA 5IQQA 2CQ4A 2X1BA 2CJKA 2RQCA 3TYTA 2KRBA 2DH9A 2J8AA 2CQDA 3THPA 1VQMS 1VQ7S 1SJFA 3BO4A 1AUDA 2AYGA 4TLQA 3IWNC 3MXHP 5EN1A 2AYMA 4WKRA 3BO2A 2DNRA 2F9JA 2LXUA 4OZ0A 2MGZB 2DNPA 3UCUP 3CPWR 2MGZA 1X4GA 2F3JA 2ZJQQ 1WHXA 5CXTA 2DHAA 2DB1A 2MZRA 1YJWS 2KH9A 2E5IA 3CCRS 2BZ2A 3CCUS 2MZJA 4EGLA 1FNXH 1H6KX 1WEXA 2CQ0A 1VQOS 2LCWA 2U1AA 1HL6A 3HHNB 3CCMS 1QM9A 3I56S 3LQVA 3RW7A 1VQ6S 1Q7YT 2DO4A 2QFJA 4YUDA 2OSRA 2FC8A
chains in the Genus database with same CATH superfamily
1JB0C 3ZZYA 2MY8A 1U0SA 3ILOA 1IKYA 1QUVA 2MKHA 2C2ZB 4ZOSA 5J2PA 3PY8A 4XDDA 1QSLA 1SUQA 3GG1A 3HO1A 4F02A 1PYTA 2MZSA 4MJKA 4ANDA 4CLPA 3G9CA 4PG8A 4Y2IA 3BGLA 3CMES 2DT9A 2FTRA 2HFZA 2MQLA 1VQYA 3I96A 4OYXA 3OL6A 2ZM6J 2FJXA 3CDBA 3MUVP 4LF8F 4V19X 1HBUA 2GCFA 1Q4RA 1RT6A 3HSJA 1IR2A 2NSCA 3I5AA 4WFNQ 3PW2A 2ADBA 1RWUA 4OMFG 1YGYA 2B6AA 4DL2A 8ATCB 2M8DB 3WIUA 4ZPCA 4Q8FA 1ITPA 3DN9A 5F0UA 1VQ5S 4FPRA 2WVFA 1NSQA 3GONA 3EM1A 4ELUA 4ICLB 4KO0B 1T9TA 5D3GA 5L8RC 1R8BA 1KS2A 4DUYJ 1KDNA 3IS9A 4Y00A 3PW7A 2R8JA 4RW8B 4RWWA 3RJMB 1Q81T 2A10A 1CJVB 3QLHB 2KJWA 2EC2A 4LR7A 1NHUA 2EK1A 3ILJA 1NPPA 3I9V9 1OMSA 4S0MA 4CQ1A 2ZEJA 5K14B 4LMZA 1TFWA 1A9NB 2CPFA 1UAWA 5KFGA 3HXMA 2V67A 3LP2A 3V6KA 2C2RA 2KT3A 3H59A 3R5JB 4I7FA 5F9NA 3PACA 4RZRA 1MW7A 2G9OA 1MWYA 4P7TA 1RABB 2D74B 5G4DA 2VDIA 2CJQA 1CQNA 1RAFB 5KT4A 4A8XA 4TU8A 3UVJB 2QFIA 1E6VB 3DCAA 1NB2A 5A8WB 3NGSA 1O6XA 2BJEA 4K2JA 1FERA 2OI2A 3M2RB 1N0VC 3DU5A 4Y28C 4OHWA 4EUVA 2ERRA 3NMAA 4PYAA 2WW8A 3D9BA 3PX6A 5IM0A 5HMZA 2CRLA 4PQUB 3SDEA 4P72A 4FDFA 4DUZF 2C3PA 1RAHB 4ES2A 2XCPA 2PIIA 5ADZA 2JEJA 1H3DA 4IH7A 3TJAA 2OIHA 4N76A 1KQSR 4F7VA 4NL5A 3DNCA 4NYZA 1UJ4A 2M2BA 2F8HA 4OI4A 3ZZPA 3ZZZA 3OTDA 1GXTA 1HHTP 3EWGA 3L7PA 2GZOA 5DZ7A 4DG1B 1DFDA 3KUGA 4I2QA 1TVRA 2D9OA 1YRXA 3D66A 3R2CJ 3THVA 1T9WA 4U7UD 2W7AA 2IVYA 5D0RA 3P96A 1IBLF 1PYSB 4J9OA 5FDLB 1MMLA 2PFFB 1IVZA 1MU2A 3R2DJ 4IG3A 5BYRA 3GB0A 3FQKA 2W9BA 2JZ5A 2P6TA 1NJXA 1XEZA 2OAUA 4C8MA 1OPIA 1DLOB 5CYJA 4X4SA 3D6HB 4NLYA 3OUYB 1FNMA 4JP8A 5C5JA 1NPKA 4RL1A 1WHVA 3KHGA 2KM8B 3O5TB 3ET6A 4CI0B 2XY6A 1S6QB 1GMVA 1NDCA 2BJ9A 1RU2A 2RRNA 5C24B 4YS2A 1IKYB 2LA6A 3KK1A 2VKRA 1VDHA 2ASYA 3M8SA 2CNKB 1HQ2A 3M7VA 3ETOA 1N32J 3TX0A 4MIAA 3SCJE 3BGRB 4HI2A 5KFYA 3KLEB 4M95A 5DDQC 4XPEA 1F9EB 2YWGA 4RU9A 1Q78A 4LF4F 1VC0A 2RQKA 2XMMA 3PIPQ 2F8EX 2RKIA 3CTRA 1NK8A 1LWEA 1AZSA 3W2VB 4CH1A 2GVZB 4M5DA 3SBMA 4DF8A 2M0GB 1KBRA 2HFVA 1PSDA 1TUGB 1V3SA 2GNKA 2HAIA 3DM2A 5GMEA 3VAJA 2PI5A 4DI6A 5ETPA 1U7LA 4ZLPA 3IGNA 5K8NA 1U1RA 3MEGB 4FYVB 4UOCA 4X65J 1IBMF 1H98A 4HKQA 1X31C 2APOA 2KKHA 1TELA 4Y2KA 1X4EA 4X4TA 3T3FA 3G8SA 1A7GE 4HHUA 1S1TA 3NRBA 1OQ3A 3OR2B 2DBBA 2K1RA 4WE1A 5HVGA 2LU2A 2XI3A 1D9FA 3HSDA 4OX9J 4PWDA 1JLAB 2FJVA 1GTHA 5BXIA 2QX0A 2H4WB 1RK8A 4F3OA 1W2BR 1SC6A 2Z57B 3U7JA 5HMYA 3M9NB 4WIQA 4WXOA 2VG6A 1EP4B 3WZ0A 1N48A 1JXLA 2DR5A 3WDOA 4O3SA 4WU2A 1G2EA 2FHJA 1JLFB 1R6VA 1OYEA 3PEJA 3PDNA 3BJYA 4DV5J 3J80Y 1CLFA 4ZCLA 4ES1A 3OW2R 2F1FA 3H90A 5F41A 3N28A 3VV2B 1DJ0A 1E6VA 5GMDA 3AAWB 3QZ7A 2FVQA 4LF4J 4JYAJ 3BEGB 1BGXT 3D6MB 4PXBA 5CABA 1LFWA 1W25A 3TZYA 4J37A 2A2DA 2R2RA 3AOBA 4YMEA 3OL8A 3D54A 4IFYB 5KT6A 3SCIE 2W8KA 2EFQA 2ZHBA 1PYOB 1RTHB 2V94A 4RW6A 1R8PA 3C66A 1FK9B 1VJWA 3DRYA 4MMOA 1VQ4S 2BJDA 1JKHB 4ZVHA 4DU7A 1N5VA 4K4SA 1FO1A 1F2HA 1FCAA 1G4CA 1YIJS 1U1PA 3EUNA 3W7BA 4GVBA 1UVNA 1TL1B 3KKFA 1WDTA 3L7UA 3OFFA 5DG9A 1T9UA 2KFYA 2JFKA 3QZ8A 3MEDB 2NLWA 2ZH1A 3V4IB 1VGYA 1TVRB 4HACA 4WU3A 4OX9F 2CZVC 5J1EA 4X62F 1AB8A 2DGSA 1M5HA 2KB2A 3MUTP 2CWKA 1VBZA 3ULHA 5KG1A 2Z2YB 4Z2XA 1IN0A 5DLFA 3UPFA 3UWTA 4WCEQ 1TK0A 2LEAA 4MKAA 1IKXA 2CQCA 3QMQA 4TY8B 1WTFA 1KOHA 4NLOA 2EXUA 2QMUB 3DGPA 1KEKA 3CULA 1I51B 1N88A 1U49A 3Q2SC 1UPMB 2KT2A 2BX6A 4LSLB 4DSLA 3ENQA 5E33A 3TVYA 4EI2A 4NXNJ 3ZZRA 1HMVA 3MFIA 4A8YA 4ED1A 1WHYA 2XY7A 5M2PA 5KFXA 2ZZNA 3TP2A 1U09A 5A8KB 1F60B 4FF3A 3P49B 1NSPA 2LQBA 2XCAA 2UXCF 3NBPA 3K5PA 2CVEA 1GX6A 5H9FJ 3RRHA 1D9DA 1N36F 5F0WA 4IFVB 1R89A 1JXEA 2QL5B 2YNHA 3N6MA 3M30B 3QNWB 2JSXA 4X65F 1IBMJ 2MKIA 7AT1B 2RU9A 3M9OB 2GQ2A 3R8YA 2DNQA 3L7OA 1MMNA 1OY6A 4J5OA 1SL2A 1K8AT 1BWEA 4ZPBA 1G6BA 2R7VA 2AYBA 3W65A 2GVZA 2VG7B 2E5GA 3JS9A 4M5DB 4NRTA 2W9CB 2MYFA 3IO1A 4FKYA 1VHIA 1I5OB 1ZM9A 7FDRA 2YKNB 2GJIA 1S4FA 3DM2B 2XHCA 3MPVA 4DV3J 1A0OB 2XI2A 4KSEB 3MEGA 1S7IA 5D4OA 2BE9B 4O4RA 1EQMA 4USJC 3G8TA 4PKDB 1RHQB 4P74A 4HH1A 4YB5A 2GMLA 5AJ3J 4DFKA 5JXSA 4MKVA 2K1RB 3TANA 3M2RA 1GXUA 3KDOA 2RE1A 4AL6A 5MLCV 1YI2S 5BR8J 4Q0BB 5F8JA 2CPJA 2V68A 4RBUA 5IM0B 4QWEA 2W2MP 1U2CA 2FGCA 2ZBQA 3OBIA 2XTJP 1YJUA 5KG0A 3GFZA 2ATCB 1IXKA 2ZVIA 1HD0A 4Z7YA 1FRMA 4LVOP 2M7SA 3IMQJ 1NKCA 3M6VA 3KJQB 1WC1A 4DU8A 4KB7A 2OPRB 1BUXA 2BE7D 2DNHA 1REVB 3IC1A 3N4WA 2WW4A 4QPTA 3HSGA 3QT8A 4ZCIA 4I2QB 2I5JB 4ECTA 4PUOB 1TL7B 1QE1B 5DLGA 2D1CA 4NEYA 3SSQA 3AD8C 3NCPA 2HGMA 2D7SA 4DV7F 3G86A 2D3O1 3VGVA 2R7QA 4QW8A 3ZC4A 4KPYA 2CJXB 1KLMA 5C25B 2R8HA 2DY9A 3PXGa 4A8KA 3RB6A 2F9DA 4JV2A 3GV5B 5DM6Q 4AL5A 1UWBB 2CDRB 5LMNF 1GH8A 3HVTA 4W4MA 3DI6A 4R8UB 2C42A 1F6TA 1NSKL 1RAOA 1SV5B 2JJ4D 2OPQB 4LSNB 4BWMA 3CDUA 1N0UA 4Z7CA 5DDRC 3NGDA 4PYDA 3U02A 3KLHA 3G6XA 1U2FA 3TNVA 3TARA 3ET6B 4QBUA 5KFCA 2F63A 2LDYA 1T94A 3LF0A 4ECQA 4CO0A 1U2RA 1C0UB 5C24A 1RTZA 2QIFA 4TLRA 4QWCA 4ZVTB 3PFOA 5B08A 1EARA 4TY8A 5D8HB 4AL7A 1S1VB 1SL1A 4M5LA 4UF4A 2BYCA 1K1QA 4ZA1A 1H2UX 3BB5A 3MPUB 3SEOA 2ZNZA 4F4XA 4JI7F 4C8YA 2HVIA 1RT7A 4X4RA 2ACMA 3OHBA 1HNIA 1TZ0A 3ILLA 4WWSA 3GU0A 2N3OA 3JQJA 4WBFA 3BQ2A 3CCQS 2GW8A 2C2OB 4FNHA 2PDAA 2YWEA 1DRZA 4ILLA 1NO8A 2NZ4A 3H2VE 3CNQP 3ITHB 2BJ7A 4KGZB 5KFWA 2UVUA 3Q89A 4LIRA 1FDAA 5JVHQ 2E44A 4DMZA 2V2KA 2YNIA 2XLJA 2X7IA 4OYIA 4QQBA 2H3EB 3C15B 1G7CB 4PWUA 1VJQA 4F4YA 3KNAA 4K0KF 1XNQJ 4EBCA 2DITA 1ROFA 3PRVA 1FTRA 4KGKA 2VQEJ 3T6JA 5LSOA 2N3LA 2HVEA 2OO4A 3MWBA 2WVEA 5BR8F 1B0VA 2CYYA 4WFBQ 3RRGA 4USIA 3CDAA 3FSXA 3VAIA 2W24A 2YKNA 3E51A 4DR3J 4I6WA 1KFSA 1WC5A 2VU5A 3TAMA 3HHLA 4L3NA 3OTEA 2BJ1A 2B5JA 4CLLA 2V50A 4RWXA 2I6WA 1RT6B 4M8LA 4Z37A 5ITHA 3W8PA 3I0RA 1LQ9A 1HNXF 4ELTA 4WZMA 3LTOA 5I3PA 4KPCA 5GAGU 4XPCA 1WF2A 3QQCD 2RJZA 1KFDA 4TY9A 2W4PA 2E1MC 4LF2A 3S01A 1VQPS 2FIUA 1HR0F 2EFGA 2R7OA 5KG7A 4B3OB 3PCOB 2IAJA 2JEFA 2VDHA 2BDPA 1H72C 2CPYA 4FBUA 5HI7A 4B3SF 4NZ7A 4ANCA 1J5OA 1HNVB 4KFBA 3VTIA 5CYMB 1S1UA 1RISA 3KWMA 1CJVA 2CKWA 2Z0GA 3FCHA 4EK2A 3MEEB 2VBXA 4UOGA 2HZAA 3PYGA 5KFPA 2ZJRQ 2XLIA 2ASJA 4M5MA 1FEEA 1RBAA 3MMBA 2KM8C 2JFDA 3LP2B 4CLUA 4OHYA 2V4QA 2PSZA 2F4FA 3HFVA 3PTWA 3HKWA 3BO3A 1Q79A 1S49A 3JQMA 3OTBA 1X5PA 4J91A 3ZTPA 3GV8B 3OR1B 3C6UB 4ANEA 1VYAA 4DJBA 4FYWB 1XR5A 3GFXA 4KHRA 3FMBA 2MJNA 3BKTA 4ZP7A 5KFMA 4ECWA 2RVJA 4JBCA 1X4BA 2YX1A 3MOZA 4OX7A 4BDPA 2FHOB 1FKPB 4HT7A 4KAIA 5K9FA 3BGOP 2DRAA 2BM1A 1NPRA 1N33F 4TYAA 5D0GA 1U4BA 3F0NA 4ZVEA 1SH3A 3CO9A 3CCVS 1K0VA 1UJ5A 2BA9A 3AJDA 4QIVA 5LOQA 3D6FB 3PX0A 5T7LB 4F25A 3MAQA 4DR7J 3Q24A 3OLBA 1UCNA 2RAQA 4J7CA 5DZ6A 4KHPJ 3UE2A 2V9WA 2J9EA 3HHKA 3DRSB 2ZDOA 4F3QA 4ALZA 3K17A 4PPZA 5EWFA 3OJSA 4NXMJ 1UW4A 3DLLQ 1VIOA 4WFAQ 5HMXA 1KHVA 2GJ2A 1F0XA 3H7HB 1CULB 1JXVA 2GIFA 5KFIA 2QYCA 3EVWA 4ECRA 1QSSA 2CQ3A 3G6VA 4N56A 4B3RF 4OQJA 1SPBP 1NJIT 2ZE2A 1BE4A 3HVAA 3M1VB 3KLIB 3TW0A 2HVDA 4ZKAA 3QAUA 4H54A 2N7CA 1U6FA 3AOAA 4LF1A 2A3JA 3TZWA 5T41A 1BQNB 1LK5A 2VQEF 1VBXA 2QLWA 3N5FA 3HT0A 1RCXB 8AT1B 1RT4A 3KUEA 4Q8EA 1T7PA 2FVCA 1KHWA 3TA2A 4IYQA 4CO5A 2JWNA 2PN6A 1U02A 4FS1A 3KTQA 3J80U 5D78A 4N7TA 1S6QA 2MB0B 2GQCA 5IQQA 2YKMA 2AX1A 3LO3A 4FZVA 1U45A 1ZM3A 2EBGA 5SUHA 3Q23A 2HQCA 2CJKA 3EXCX 1HI8A 4GO5X 4BCAA 1WORA 2RQCA 2J8AA 3EE3A 4JOUA 4CO3A 1S6PA 3DFEA 1R0AA 1VQ7S 4HYKA 3VGSA 1VOMA 3KK3A 2QSFA 2AYGA 2HHSA 1S57A 2HZVA 3BGRA 1NJYA 2FHKA 5EN1A 2V2QA 1HBNB 2J7KA 5HLFA 1VRTB 5B0FA 3HHLB 3LOUA 1XNRJ 1DY3A 4L74A 3ZTQA 1DTTB 1T9YA 3P45B 4RW7A 3SFUA 2MGZA 4DFPA 1X4GA 1EETA 3ZNUA 2ZJQQ 2YPYA 4D3GA 5CXTA 5AXNA 4PUOA 2PMWA 1SVDA 3P5BP 5HROA 3RZAA 4CT8A 3W66A 2KH9A 4LF6J 2N4DA 3N5BA 2BZ2A 2ZOFA 5KG2A 3BR8A 4EGLA 1H6KX 4UQGA 1NMEB 1VQOS 3DU6A 2LCWA 2EEYA 1RT2A 2W2QP 1UWBA 4ZK7M 1VQSA 1QM9A 2CADA 2Q6BA 3KJVB 3CCMS 4JI6J 3EVOA 3I0SB 2OPPA 4OV1A 4PXCA 2HS4A 3ZO7A 3OLAA 3I56S 4OLPA 5KFQA 3SI8A 3RW7A 1VQ6S 1Q7YT 2DO4A 2DYAA 3RYLA 4BLGA 1EP4A 3K8WA 2RH3A 4LFAJ 4KJIA 4F3MA 4USTA 3R7BB 3TQ1A 1WD6A 3FDSA 3MR2A 2H5EA 3DRPB 5IT0A 2LKZA 2HFSA 2OEMA 4DPUA 4ZJQA 1QSYA 5IV4A 4M63A 2OFGX 4O4GB 4ZVRB 3DLEB 1XNRF 3Q8QB 3DLKA 5E41A 2DGTA 3U1MA 4HDHA 1S1XB 1S5ZA 2CJAA 1E6YA 2FGOA 3FSYA 2WSFC 3PRDA 3PZPA 2VH7A 3VR1A 3P8BB 2NXCA 2DCLA 4PPDA 1X0FA 3THTA 1JK9B 4FXWA 4MKBA 4ENOA 1FKOA 3QFWA 5AXMA 1IKWA 1F5CA 3UI3A 1Y9OA 4NXMF 4PWWA 4C2MA 1S4EA 4FS2A 2XNQA 2HVHA 1S9GA 1JLGB 1OQ6A 1EB0A 1XN9A 3M8PA 3QGGA 4O3PA 1CULA 3V4IA 5H9FK 4ICLA 4KO0A 3KLGA 2MQMA 1N5SA 3CW2C 3HPOA 1XMQJ 4DX5A 1IBKJ 3RU0A 3KG1A 1FJGJ 4FBTA 3QIPA 1X60A 3C3LA 5KFLA 4EBDA 3TJ8A 2CJYB 1JNRB 2EFOA 1ZPVA 2IPOB 2BVZA 2XZWA 1WG5A 3D68A 3H42A 3QGIA 4ZPDA 5FIIA 3VZHA 3KMQA 4X4VA 3HP6A 3TAMB 3IA0A 3HVRA 4IDKA 5CQGA 4DX7A 4DLGA 4TN2A 3NCRA 3OT9A 1VI7A 2V69A 2ZOMA 3UVJA 3OSPA 4LF5J 1HW8A 3I4PA 3QRRA 2CQIA 2AJ0A 5A6PA 1WOPA 3FRYA 2XGQA 3K0JA 2LXFA 1IM4A 2IAJB 2KFNA 3IWXA 3IAM9 2R7TA 3CJKB 4CNYA 3I87A 1RBOB 3I4HX 4F4ZA 4LF9F 1J5OB 2ZBPA 1CJUB 2KVIA 1VRTA 5B0CA 3MM6A 5D4NA 2RT3A 5JVGQ 3R5GA 1YKWA 1DTTA 4DG1A 4J9UE 3BZQA 4WP8A 2VG5A 2XYHB 3IR5B 2M52A 3UN3A 2UXCJ 1LWFB 3R97A 1AXQA 2B51A 1UZDA 4NOHA 2MXYA 3MAAB 1BQMB 4ZVPB 1FRKA 1U1LA 3WQPA 3DLBA 1QLNA 3C6UA 3BKUA 3LP1A 1ZAXA 3L9ZA 3IGVA 4RO0A 4WK3A 3UD3P 2A6OA 4RW4B 3ZTRA 2XB2D 1Q86T 4DXLA 4HLBA 3BV8A 3AA8A 2Z8QA 4I1TA 3RRKA 4C3LA 3K5MA 1U48A 2WOMB 4LF5F 3PYFA 2ZC4A 4UZBA 3OUYA 4NASA 2XZDB 2YX4A 2D3OR 2GAGC 2Z56B 3BR9A 1N34J 5FD1A 1SB6A 2DRDA 2PEHA 3LUYA 4PG5A 3VZIA 4QPXA 3TUPA 4FVCA 4K4VA 1WUUA 2OPRA 4PZVA 2RB7A 4V1Ak 4CNZA 1HYSB 1FWPA 4DV1F 4Q5VA 1DTQB 3C6TA 3RBXA 4Q7AA 2LEPA 3V6DB 5E2QA 2CJBA 1QE1A 2GVDA 4NMXA 3SFGA 2ZZMA 3H8YA 1D9AA 5HVFA 3HZEA 1K0TA 1XR6A 3D0GE 2B4UA 3ZZ0A 1DHMA 3NWGA 1H73A 1Y5NB 3GILA 1UJ6A 4R5PA 2HQ3A 3TEHB 2IA6A 1YK9A 3M2UB 4P7VA 5B0BA 2RNEA 2AZ1A 3GJRB 5LXYA 3H4BA 3AY0A 3BGFA 2V4RA 1DBDA 4OYBA 2MZTA 2FLOA 5ETQA 3Q2TC 4K5SA 3M8RA 4H4MB 2COLA 3GIIA 2V8GA 4Q43A 4P2FA 2V34A 1EX8A 1FTCA 3B8HA 3PR4A 1GEHA 4PG6A 3N01A 3OL9A 1R0CB 2IDLA 2MQNA 1LFPA 2QLFB 3OR2A 5C2GA 1C0UA 5LSLA 3D1QA 2CDQA 4IG0A 5GVQA 1P9YA 1IBCB 5J2PB 2HNDA 1S6PB 4WYWA 4IOAQ 3DYAA 3IRXB 2M4MA 2P9EA 2WVDA 3C16A 4G1PA 5E5NA 1S0VA 2DPJA 2JL9A 1HI0P 1H7WA 2K7KA 3HDSA 3QSYB 2CQ1A 1M1KT 2ZKTA 1SJRA 1V5IB 3MDFA 4KH0B 1NSAA 3ISZA 1S97A 1MLAA 1WWHA 5IT9Y 1B70B 2O1PA 5L1JA 1Z2ZA 4L72B 1TP7A 2DNLA 3AOCA 4USKA 1A6LA 2DPIA 4WFYA 1FXLA 3HZGA 1V3ZA 5J2QA 1K73T 2OFHX 4E0DA 1SQGA 4URQU 2GA7A 2HHHF 5DO2A 2NYIA 3K5OA 2NPIA 1RAAB 3A3NB 3LALA 3NS5A 3TUJC 3Q8RB 3OSNA 1EIYB 4JI7J 1VRUA 3JYTA 4KE5A 2XWYA 4OHVA 3FFIB 3OV7A 1S6UA 1NK5A 4YY3J 2IRUA 1VISA 3CIMA 1WEZA 2IBOA 4GVBB 2XQCA 3R6GB 2C1EB 5KT7A 4DWIA 2RS8A 1UA0A 4NI2B 4CLWA 2HRUA 2POKA 2A18A 1PCAA 3IP0A 4C9DA 3Q8PB 3UD4P 3M6XA 3D0IE 2GQQA 2UUAF 4WP9A 3J81j 2L08A 3LW5C 3VWSA 2UUBJ 2BKNA 1NK4A 4AD6A 2XMVA 3GPAA 4EFAC 1I94F 2B3TB 4DCPB 2KG0A 3A4TA 1YJRA 3LPYA 2UZAA 4IRKA 5HP1B 1PC5A 1SQEA 2HS3A 4J9SA 1RHUB 2VJUA 1Q8IA 2O01C 5F8NA 4LSLA 1Q95G 5A0YA 1L3KA 4I68A 2C3MA 2VA3A 1SXLA 3S6EA 1HIYA 2CJ9A 2ZUGA 4UOHA 3G96A 3K58A 1NK9A 3KUHA 1TL4A 6FDRA 1KKHA 4J9MA 4DR2F 4KRWA 4JUZA 1NAQA 1SC1B 3VCDA 5CAAA 3ZTSA 2QT7A 1NH8A 2XYPB 1RTIB 1T05B 2HW3A 1W7WA 1SI9A 1KQFB 4O0IA 2AJ4A 1TMJA 4I6YA 3DLJA 5D77A 3LANA 4OYAA 1HQUB 2NS1B 1RTDB 2HIYA 2W25A 3RW6A 2QA1A 3DLHA 5HJYA 4UQTA 2FLPA 4XIUA 3BSCA 3M6UA 4CO4A 2R7WA 2DD8S 1YWXA 1OY8A 2UUBF 2UUAJ 3H5XA 2JOQA 4WPAA 2KU7A 1YDLA 3AQPA 2YXLA 4IG3B 4DPTA 3GIKA 3SIPB 3EDQB 3UR0A 3GSIA 4F4KA 2MKCA 3T41A 2C28A 3RB4A 2DVIA 3SSRA 4DUZJ 1PBUA 2CPHA 4HTJA 4KBIA 1S76D 4ZLLA 1HBUB 2CG8A 5H1SV 2YPZA 2M3DA 1U47A 3GJQB 2XS7A 4ZLJA 2OJ3A 2BEFA 4DR4F 4NZ0A 3UD5A 2KVQE 4CRJA 5GAHI 2J0WA 2AJFE 1LK7A 1YQHA 4WYLA 4DSFA 1M0SA 3NNAA 3NEKA 4M5JA 4YOEA 3S1TA 3CJKA 3K5NA 1RAEB 3R7SB 2YNFB 1WSVA 2RMLA 2GO9A 3M8ZA 3QT6A 4DPXA 2ZWOA 4KTQA 2HFNA 3KLIA 4CLZA 1X4AA 4DV6F 1NDKA 5KFHA 4PR6A 1RSCA 4XK8C 4DQRA 3DOMB 3DDIA 2QG9B 4OZJA 3IRWP 1Q0NA 2VG5B 2I5JA 4ELVA 1YITS 1UMJA 1WEYA 2FZKB 2HQDA 2O3DA 3DLGB 4ETXA 1TV6A 1VMBA 4QW9A 1BQMA 3MM5A 4L6V3 3SCKE 1M5PC 1U24A 4B3RJ 4WP3A 2DGXA 3E8OA 3ENVA 1FX4A 3N6NA 2XHWA 4O3RA 1VC5A 3TI0A 1CJKA 1NU4A 2H48B 1XMBA 4R8UA 2FLNA 2CQGA 3D67A 4NA1A 2ZH7A 3R5BA 1PBAA 2B0GA 2VG6B 4J9RA 4GC6A 1AT1B 1S59A 1RWXB 1VRQC 4KGVB 2AT1B 3BYPA 5ETOA 3CJ3A 3MCSA 3CSKA 1FJ7A 1CC7A 1JJHA 2MY7A 3M2VA 1HBMB 5K8PA 1Q53A 1WHWA 4K50A 4JI0F 3QT7A 1WF1A 5A8RA 3KOAA 3HSZA 2BQUA 1RHJB 5ETSA 2ZZTA 2IJFA 2FDNA 3NLCA 4I69A 3H0PA 1WKLA 3MR7A 4DR7F 5DDPC 3MTJA 5E7OB 5KFKA 2ZH4A 2JHEA 4JI2J 2L9WA 3UCGA 1GK8A 1MWZA 2F40A 2X51A 2XG8A 3M32A 4DCJB 3OHAA 1FK9A 1UVIA 3UR3C 4ZLNA 3CMQA 4UY8T 2CAJA 4OI2A 2YTCA 5U47A 1OIAA 4PG7A 2KG1A 1S10A 4TYBA 3H40A 2EBEA 4ZDNA 3HVWA 3T1YJ 3FZBA 5LMUF 5F3ZA 2KYZA 3NWRA 1K1SA 1ZZNA 3MEDA 2MTLA 3F56A 4DSEA 2AEJA 3V4MA 1OY9A 2DY1A 1HQUA 1IWGA 4LRCA 3V81B 3M8QB 3GZ7A 3EXYA 1CQMA 1Q16B 5DETA 5FLXU 2HBZB 3B4MA 4JV1A 4O3OA 2QLBB 4JYAF 3Q8UA 1IKXB 1X8DA 3RAMA 5A76A 5AXLA 4CLYA 1BMQB 1QUPA 4JI8J 2KHCA 2QL7B 1HI1A 2UVWA 4YDXA 5L1LA 3W5XA 4FYDA 4I7FB 1YSJA 1EHWA 2RF2A 4FVMA 2HFUA 3DOLA 2XEXA 2XO7A 5SZTA 2XMKA 1WF0A 2XM3A 4DPYA 1VLYA 1E6YB 2EKNA 2V6AA 2XMAA 4DV2F 1VQLS 1RADB 3DGVA 2XNRA 1RT3B 2Z4PA 4M5GA 2LEBA 4OJHA 4TKTA 4WF9Q 2XLKA 4JI2F 3MUMP 2IM1A 3CDWA 1UVJA 1U0HB 3MM8A 4LRAA 4NLVA 2ADCA 3EGNA 1NKEA 4A8SA 2R8IA 2UUCJ 4C97A 3A8IA 1TFYA 3LWLA 1LW2B 2KXNB 2W9CA 1HWUA 4X62J 2CPDA 2FZCB 3TZXA 3SDEB 1FRIA 2LVWA 3HCXA 3M8PB 4F4AA 5MAOA 5KFJA 1FE4A 2P6SA 2YNHB 3AD7C 3NAIA 3QO9A 1RYRA 3CUNA 1REGX 3VAKA 2AZ3A 1GAOA 4OZ5A 1S1TB 2FJEB 4B3TF 4ECSA 1XR7A 4RPFA 3WIVA 3QIPB 4E8UA 3PV8A 4UOFA 2IRYA 2ASDA 1XNQF 2HNZB 3UW1A 5B0AA 4GO7X 4YHHF 2YH1A 2V0NA 3LH2S 2DIVA 3Q0AA 2HBQB 3L95X 4NPOA 1TK5A 2UVVA 2R7SA 4QYZJ 4LF6F 2HEKA 2F4VF 1VQNS 2LQJA 3DLGA 3NGUA 1LV5A 2VQFF 1C1BA 2WBRA 3I6PA 1FJCA 4DN0A 2BM0A 1WELA 4DR3F 2QLXA 1X5SA 2HZCA 2L9DA 4U96A 4X64J 1ZYQA 3HJFA 2YWHA 3R1LA 3MOJB 2ILYA 1O51A 3BBFA 4YR0A 2YVSA 2C3OA 1K9MT 4C8KA 2KO1A 5FLXY 4DR5J 4H4KC 3CVKA 4RJVA 1RKJA 4DUTA 1NLKL 4IFYA 1EKSA 2VZ9A 5ETKA 3LWMA 3TRGA 1FFWB 4USHA 5GAEI 3FBCA 1YZ6A 3T5JA 3CIZA 3RG6A 2WK4A 5HN0A 1G1XA 2CNOB 3K89A 2XS5A 2Z2MA 1M5OC 3DMJB 2EK6A 3W63A 3CC4S 4H4OB 4E2FB 3PKYA 3NS7B 5KFEA 1SJQA 5F8GA 1F3FA 3R5DA 1JLBB 2DR8A 3NGRA 1C1CA 3KK1B 1C0TB 1FRXA 3EGZA 3UQSA 5I3QA 3NKYA 3TUIC 1RT5B 1M5VC 2ZHAA 1RYSA 3JSMB 2DR9A 2LDIA 2I2YA 2WVCA 1GNKA 2MMYA 1RLDA 4NLRA 4P9SA 1DARA 3KLVA 3TJ9A 1X9SA 3ZZTA 2UV8G 4EBEA 4P71A 2LA4A 2E7VA 3A13A 3GP9A 1OYDA 3MAHA 4K4WA 1N32F 3DRRA 4OLOA 1MG7A 2ZD1B 1LWEB 1CJTB 1M1HA 2HVZA 4NA2A 2BOPA 1J5EJ 2MJUA 3KK2A 4PXDA 3AQOA 4IR9A 2DGVA 2XZTB 2NPFA 2PEBA 3Q22A 1YX2A 4LBPA 3PEHA 2EKYA 1YRTA 3BDEA 1TKDA 2RS2A 2OUGA 3CC2S 1YHQS 1KVJA 4NLPA 3FKBA 2CNNB 2CPXA 3GR1A 3TX8A 4OYOA 1HPZA 1YZ7A 2MLXA 3BQ0A 3PYDA 4F36A 1AYEA 3KLHB 2X1BA 4OZ3A 2XBPA 4NLDA 3W9JA 5DG7A 2LQ8A 2WONA 3EGVA 4ZPVR 5DG8A 4ED4A 2Y0SD 1JLCB 1VQMS 3J7YI 3F73A 4ZPAA 2IIHA 2Y3YA 3N6LA 2P9GA 4DV4J 2ALYB 2VJVA 2DEJA 2UU9F 4AXJA 3MXHP 1NUEA 3CJSA 4IFVA 2VBYA 3VVUA 1RT1A 4HVZA 1YVFA 2YX7A 4WKRA 4QYRA 2DNRA 2F9JA 3MCMA 4Y2MA 2W01A 4LBHA 5B0EA 4XO0A 1WOOA 3C14A 5L9NA 5KFDA 1XC9A 4DSJA 2W7PA 4B3TJ 3SCLE 1WC6A 5C42B 3SYZA 1N6QB 1PG5B 1T0TV 2DHAA 5KFNA 5A2QY 3IBWA 8RUCA 5KOWA 1EETB 4B3MJ 3C46A 2R7XA 4EWTA 1YJWS 3CCRS 2MHEA 2AKWB 4GC7A 1FDDA 1KP6A 1LW2A 2DTJA 2MZJA 4J9VA 3QRQA 1WEXA 2BR0A 2FJAB 2CQ0A 1UPPA 2ZDPA 4NLUA 3CJTA 2R9LA 3FUYA 3MR5A 1SIZA 1CS4A 2YQ3A 3EDRB 1CPZA 2AGPA 4Y65A 1NEEA 5DJBA 4ED3A 2BANB 2IYGA 3G82A 4ETZA 2NZCA 3BH6B 2N4CA 3AT1B 3IG1B 4OHZA 2YQ1A 5DQHA 3I0SA 3W1YC 4C11B 4YUDA 3CD5A 2FC8A 1H7XA 1SQFA 5B0GA 3UNGC 3H2LA 5CZXA 4QIGA 4FYXB 1UL3A 1WC3A 4WFXA 3U1NA 3KLFB 4EYHB 1JNZB 1UWAA 1Z4UA 3PYEA 2KN4A 3GIMA 1S7HA 1WG1A 1RUSA 2DO0A 3CXCR 4J9KA 2PFDA 3JQKA 4YB1P 4Y34A 2AJ1A 1U1NA 1XMOJ 4F04B 3HLUA 4Y6IA 4ES3A 2ZNYA 1Y3KA 2YBVA 3D3BJ 3DRXA 1C4CA 3LAMA 1M5SA 2DHGA 2IMOA 3H5YA 4DL7A 2LP4A 2KI2A 2OMOA 3AHPA 2FUG9 1S79A 3W3SA 2DGQA 1KSPA 3NNHA 1NXIA 4NLWA 3OTOJ 2BRLA 2GIQA 3FFIA 1Z2LA 3TOQA 2JLGA 1RXOB 3MHYA 2AU0A 3GV7B 3UCZP 4TQRA 1BD6A 4WK1A 4URGA 2QGFB 3T9ZA 1QVFR 2DEIA 5ETLA 3PW0A 3MCNA 4ID5A 4C6AA 3JTOA 1YBTA 3PO4A 3I82A 1WSRA 2RD5C 3JSMA 3FBEA 2GMHA 4I0WA 4OHXA 4NZ6A 3R7NB 4RUHA 1R6YA 1Y5IB 2FJDB 1NK6A 2P5VA 3OTCA 4I64A 3TVZA 1JJCB 2OPSA 4LFAF 4FF1A 1M5KC 2LQ9A 1DQ9A 3DRRB 4CIOA 4HHJA 3DDKA 4FYYB 3CO0P 3BSOA 2J6UA 1FHTA 3DHXA 4UTGA 1JLQA 4C3KA 3PVXA 4NCAA 5AT1B 3QATA 3US5A 4MAKA 4CT9A 1N52B 4IO1A 7FD1A 2BACA 4FKXA 2AJ2A 3JTPA 3VGUA 1P9QC 4NYPA 4K4XA 3HULA 4QU6A 1FRLA 2I9SA 2VPZB 4ZPWR 3ITHA 2DHXA 2Q43A 2R7UA 1S9EA 1FKAF 5E3PA 5D4LA 5IOLA 1RTIA 6AT1B 4QWAA 5EGYA 2NSBA 5IS2A 1TKZA 4B9NA 2VV5A 2E1AA 2E5JA 4B9MA 5F8LA 4DQPA 1HD1A 4U8YA 5CYQB 2A1BA 2B4VA 4NYOA 3J7Z5 1FEHA 2ZWPA 1H38A 2MHNA 1VFJA 2E5LF 2PA3A 2ZE2B 3M1VA 2BJ8A 1CVJA 2BOAA 3W8GA 5H9EK 5B7WA 3CWJA 2D9PA 3MM9A 5H9EJ 1WI8A 1QTNB 3GFYA 3MMCB 1MN7A 2JEGA 3NGTA 4GRSA 1EAYC 4USMA 1Q1KA 2YNGA 2AJQA 1NHVA 4C8NA 5M2RA 2RQMA 1WC0A 2QEXS 3A8KA 3MMAA 2IJNA 3JSBA 3PNIA 2LU1A 1GQEA 5L46A 5KFOA 2FJWA 2V2VA 1S9FA 1UEVA 4LR9A 4DV7J 1FX2A 1T03A 4F2SA 2WVBA 2FJBB 5EHHA 4QWDA 2EFVA 4HI1A 1YBUA 2JVRA 2RHSB 3PHEA 1T3OA 4PWDB 2XSJB 2I38A 3DDNA 3DI6B 4QWBA 3CMAS 3DOKA 4C3MA 3OFEA 4YB6A 4IRDA 2CPZA 5B0DA 2OTJS 2P9CA 4EO8A 2HFOA 4UUWA 3KLFA 1FWLA 2HAFA 3KFWX 1B0PA 3CD0A 1RU1A 4H4OA 1S1UB 4LRBA 1JLFA 2HHPA 1ZAVA 1TQLA 1ZAWA 4KY3A 5EDWA 4ECZA 1Y7PA 2J5AA 2YKAA 3CE8A 2AP6A 3QGHA 4CLKA 4ED2A 2XMWA 4DR4J 4ZIWA 5J2NB 4DV0F 3HF5A 1YJVA 1SC4B 1N54B 2HSEB 2M5YA 4LJMA 4PABA 1K47A 4ZMMA 1FFGB 3H25A 4GKKJ 2IY5B 3MM5B 3GTYX 2R2SA 4P2MA 2D69A 2QZ8A 3G6YA 3K5LA 4Y0FA 2CPEA 1H0HB 3ONQA 4K7QA 1MU2B 1HHSA 2B7CB 2MQQA 1FDNA 1RCOB 2KL8A 4JI3J 1X5TA 1T95A 2EC0A 1RI7A 5KG5A 4NCBA 5IXUA 2R42A 2YNIB 3AXMA 1WJ9A 3TR5A 2G0IA 3OFHA 3OPKA 4X66J 3SQGA 2VHGA 4DL6A 4G3IA 5KTQA 4FF2A 2CQHA 3QJJA 4L76A 3CJQA 3IFEA 2ROEA 4BC9A 3CCSS 2Y0BB 1HBMA 4X4QA 2BW2A 2W7OA 2B43A 3C2PA 5KFUA 2V8DA 5A8RB 1U6ZA 3I5BA 3FEXB 2YWFA 3A12A 3DYAB 3DGPB 3W9IA 4M5IA 1RT1B 3MCOA 4LFCF 5KT3A 1SKUB 3KLEA 2HGLA 1IKVB 2XYGB 1N4LA 1DZ5A 3W2WB 3C14B 5HATA 5DDOC 2DR7A 5FJ4A 1UFLA 2DNOA 2G2OA 3R9LA 2FD2A 1KN6A 1N6QA 1X5OA 3I0RB 3KJFB 5A6WA 3HM9A 3T9NA 4GKKF 3KJNB 1P1TA 3UDCA 3PJWA 1NZAA 5M2UA 5KFBA 4OX6A 1UW9A 4IUFA 1EQ0A 4RBVA 3BPSP 2VFRA 1MN9A 1TKTB 2ZH3A 4B3OA 1JLGA 2EW9A 1X4HA 4Q2MA 4TVAB 3D3CJ 3FJ2A 3LP0A 1UEKA 3UO0A 1SCJB 2WHOA 1HWLA 4PCQA 3RB3A 2J0QD 1HNVA 4KFBB 1MWQA 5J1NA 3MEKA 4X84A 2MKYA 4YR3A 2GMJA 4J9PA 1RQ0A 3A3PB 4ZVOB 2AQ4A 2IYIA 2YH0A 1KWMA 3D0HE 1UVKA 3NOCA 4C0HA 5D0HA 4F0KA 4C11A 2HK2A 4U7CA 3P3DA 3T5LA 1H74A 1R0AB 4B9TA 1ZZFA 4QZVB 3MMCA 3Q8YA 3O2IA 1JMTA 4I6AA 1OJ4A 3DOLB 1WG4A 4ZN1A 1JJ2R 3VHQA 4O3QA 4LFCJ 4ERDA 3PRBA 1DQAA 5D0EA 4ED0A 2HNYB 4QIWD 5IV3A 2AD9A 2DRBA 3J7AN 3NG8A 3VALA 1FKPA 1RWPB 2EFPA 4AT1B 4K8RA 4F0MA 1FJEB 4N41A 4CO1A 3DXBA 1R7IA 1LEOA 2MLZA 1M1GA 4KV8B 4IH5A 3DOKB 4O23A 4CLTA 5J2MB 4B02A 2C2DA 1S0OA 4F0HA 3VQTA 3G2XA 5GADU 3S8SA 1IBKF 4MYTA 5G0RA 1Q7LB 1UEUA 2VBWA 1PC4A 4WJBA 1W26A 3ELHA 4RW8A 1IBLJ 1Y10A 3MECA 1HWJA 4RUCA 4ID5B 2Y8YA 4JI3F 4U7UK 2WBMA 1HQEB 1WNEA 3K59A 2FVRA 2QLJB 4XDCA 2ASLA 2MSTA 1PKUA 1V3RA 3IXQA 3MPYA 2VUGA 5GMKa 2DH7A 1RTDA 2J0SD 4OI1A 4P6QA 1L3UA 2MQ8A 3VGTA 3T1YF 1J5EF 2AGOA 1FT8A 5A8WA 4QCLA 1BQNA 2DJWA 1GMWA 3W61A 3MMJA 1R8CA 3DLKB 2W9AA 1JX4A 2HHWA 2XGPA 4DL5A 1VQ8S 1SV5A 2AV5A 3POTA 5CD4H 2ACYA 3RBEA 1SJ3P 1HNZF 2F4VJ 4CTAB 2QMWA 2R8GA 1O0PA 3VAFA 5DM7Q 2F65A 2I0XA 2MQPA 1CBKA 5IFMA 4Y2AA 4JI8F 3IN5A 4DQQA 4F67A 3M9MB 2DR6A 4A4JA 3VF0B 3EX7B 4JI1J 1ACMB 1S12A 3C6TB 5ETNA 2UXDF 1SH2A 4R25A 4YR2A 1ICEB 3QSIA 3KLGB 3HFKA 3I32A 2Y1JA 2V5HG 4CYUA 2LMIA 2VL1A 1QAJA 4CH0S 2AEMA 2B4PA 1VBYA 1RB0A 3MURP 4R5PB 3H20A 4BC7A 3WC2A 3RUBL 1S72S 5BYSA 4C0BA 1ZS6A 4DFJA 3NL0A 3RBZA 5HROB 1HBOA 1YLXA 3X3UA 4B17A 1ULRA 5LSRA 4JI4J 3NOGA 2DNKA 2J7UA 1SJ1A 1TKTA 2Q79A 4H4MA 3MMAB 1S0NA 1QJHA 2GAHC 2K3IA 2MKKA 4KR0B 4WFZA 2ZH6A 2EVZA 1T03B 5JMNA 1AROP 4YHHJ 4G1IA 1Y0HA 3IS9B 1NJWA 4JI5F 4CWBA 4UT4A 4LFBJ 1RWVB 5ETMA 4LR8A 4CDIA 1YJ7A 3QLHA 3EPIA 3GYGA 3KHRA 3G4SS 5E3QA 1V6HA 2BXJA 4G6VB 3G6ES 5K14A 1B7FA 5LXRA 3TUZC 2GIRA 1L3SA 1RJJA 2JX2A 2VD3A 5F9LA 4LRDA 3BREA 4ZVQB 5LJ5Y 2HRYA 1KTVA 4LFBF 2B8QA 1LNQA 1CJUA 1PIEA 2L9NA 3FK4A 4DPWA 3RAXA 4ILMA 5BJRA 4J90A 5HQMA 3B78A 3MFHA 2UUWA 4MT1A 4J9QA 1QAXA 1CEZA 4ECVA 1RGVA 3W9HA 4DCOB 1O5JA 4NMLA 2ZHOA 5KFAA 3GCWP 4M94A 3NY0A 4LQ3A 1BC6A 3DHWC 3TZZA 2KXFA 5ETTA 4DV4F 2AHOB 3PX4A 1VR6A 1Z1ZA 4OJGA 1VK3A 1VQ9S 4N47A 5HMWA 1VK8A 2ILZA 5L9XA 4L73A 1Q8KA 2NXJA 3IR7B 2B9WA 3UDLA 4JV0A 2HK3A 1ZOTA 2HWHA 3I5CA 1RP5A 4EZ6A 4WE1B 1I94J 2VONA 3K57A 1MROA 1IKWB 1Q5YA 3CCTA 3BSNA 2VODA 2WOMA 4OZ1A 4ED6A 3RR8A 3GYNA 3T19A 1YBAA 3SV3A 1HQEA 2C3YA 4N8NA 4U67Q 3MMBB 4YB7A 1SKRA 1B3TA 1ZA2B 3N0VA 2V8PA 4OYZA 3CD6S 4PQAA 1U6BA 2E5HA 2KDOA 1BHNA 4RNNA 1L5UA 5D15A 2C2MB 2NCKL 1GMWD 4ITSA 5CH7B 3FSIA 4IH6A 1KQKA 3OXGA 2MQOA 2OELA 3E3XA 2FY8A 3ETMA 2X1AA 2FY1A 2GFFA 4JI1F 1RHMB 1F9HA 2NUUG 1SUQB 2DHSA 4DZ6A 2JH3A 3J81U 2UXDJ 4NE9C 4DZDA 3AFGA 1RBLA 4RKUC 2R2UA 3M8YA 5A0YB 1RHRB 1HHQA 2KRRA 3I55S 2GGPA 2PA8D 4IDKB 3R1HA 2J9DE 4DL4A 3JXOA 4HL9A 3CCLS 1YRUA 4G1QB 4G65A 3FEZA 4ECUA 1U0HA 3MM8B 3NGKA 4W92B 2VOOA 1XMOF 4H4KA 1ZPWX 1TL1A 1DAXA 3WX4A 2WSCC 2R8KA 4QJVA 1NK7A 4C48A 3G87A 4K4YA 3OD2A 1NBEB 5HAOA 4A48A 2ZOGA 4CLSA 1SKSA 1GT8A 2AEFA 4A8OA 2QL9B 3Q8SB 1G3OA 3BGUA 5E3RA 1BWVA 3BDPA 2BKOA 2GC8A 4ECYA 2AIRB 5EWEA 4LF9J 5GAEU 2VFVA 3SZ2A 3AA9A 5CA5A 2HNZA 2UV8A 1N5YB 4K4UA 3UDEA 1IUJA 2Q6CA 1S77D 5IT9U 2XMJA 2A0FB 1C2PA 3ILIA 2H9ZA 1HBOB 1JLQB 5F8IA 1C1BB 3B82A 1VBKA 2IC3A 2X1FA 2XMTA 2M9KA 1FVQA 3AJ2A 1R43A 2VF3A 3P4UB 4A46A 1YTYA 1OO0B 1XTZA 4K59A 1KC8T 2AYEA 2Z2LA 4RW4A 2V8VA 1JLEB 1AFIA 4ZVGA 5J2QB 2HRTA 3HHLD 1MSWD 3HD1A 1DQ8A 5EUHA 2J9CA 2DGUA 1R27B 2IVMA 2QRRA 2AWZA 3PFEA 1NCLA 2X3DA 1Q8LA 4DS4A 1NB7A 1U1MA 3A8EA 3WBZA 4ILRA 3EZ5A 1Y11A 5CYQA 3T5HA 2VFTA 2ZH9A 2VPXB 1WTBA 1HBNA 5CYMA 2VB6A 2RDJA 5GAHU 1K44A 3MECB 3MD3A 1JLBA 3MEEA 3U1LA 4NCGA 1HYSA 2VKZG 5LM7E 3MM9B 4B9LA 1X4FA 2W4CA 3DOMA 4NI2A 3BS9A 4MK7A 2E1CA 2E5LJ 2CQBA 4LBIA 5I3UB 3P6YC 5LMNJ 2MPUA 3PG9A 5KT2A 3RB0A 2E9RX 4ED8A 4C4WA 1APSA 3HI9A 2MSSA 4JB8B 1RA6A 1QAIA 3NMRA 2X3GA 3AB2B 4QR1A 4NLQA 4L75A 2AGQA 1IM6A 1PILA 3V6HA 1TKXA 3O3LA 4MFBA 3D6TB 1VLOA 2IVFB 2ZD1A 2IJRA 1JKHA 2D41A 1F5AA 2K3KA 2CVIA 3N9UC 3NXZA 4ZVUB 3BN7A 3OL7A 3GSDA 2JEIA 1RAIB 1HNWF 4Q44A 4AQYJ 4A47A 1H2VZ 3FCVA 1CJKB 1TL3B 4OI6A 4ZP6A 2J6SA 4Q0BA 1LKZA 1T9XA 2C2KB 2ZBRA 3M6WA 5CCLA 2BBEA 1DLOA 2Z58B 4AE5A 1XWLA 4DPOA 2OP5A 4WTOB 2C22A 1MNEA 2CQ4A 2H1YA 2PD1A 2G2ZA 4P2SA 3LA0A 5J1EB 4KKOA 1D8YA 4LF7F 4MIWA 4YP3A 1QDUB 3ISND 1WOSA 3JTNA 2DH9A 3SSSA 3THPA 4ECXA 1X9MA 2B9EA 1NDPA 3M2VB 1AUDA 3FVYA 2BUNA 1JLCA 2BQRA 5KFTA 2ZITA 3EVMA 1N5TA 4QYZK 3BPDA 3PW4A 2W8LA 3IWNC 3T1AA 5K8OA 2NXEA 2W2PP 2HNDB 2P2CB 1X9WA 2PO4A 2RDIA 3E01B 2AYMA 5KFVA 3BO2A 1OPZA 2XMUA 4BHQA 5L38A 2BABA 4X4UA 2DNPA 4OFZA 3UCUP 1P8GA 4LVNP 3CPWR 3TWZA 4LF8J 2Y1IA 4UY85 1WHXA 4EO6A 2WSEC 3M32B 2HQGA 4JV5F 2CIMA 2O5DA 1SKWA 2MZRA 1AZSB 3W64A 3W2VA 2DXDA 3ZFVA 2FHMA 1KLMB 2E5IA 2RUSA 2UUTA 3MF5A 5C25A 5A8KA 3HFZB 1FESA 2VPWB 3SQOP 1FNXH 2CA9A 3UNYA 1L3TA 5DQGA 2HMIB 4LSNA 3UFCX 5JJBA 1HL6A 3CEDA 2NR0A 2ZH8A 3DKDA 1KNZA 3MPWA 4DUYF 1JQGA 4N8OA 5L1IA 2BKPA 5HBMA 2WAQD 3M8QA 1TU0B 5AE3A 1NDLA 2KFZA 4ZHRA 1YJTA 2OSRA 4RNHA 2C2EA 4C8ZA 1HNXJ 4YY3F 4RNFA 3CJRA 2JRSA 2QN6B 5KFFA 4OZNA 4QR2A 3KK3B 3OVSA 2QYGA 5HQ8A 2UU9J 1I3OB 1P6TA 2YNFA 1RT7B 3IM8A 4RLEA 4F26A 4DX8H 2H54B 2YKOA 2ALZA 1YJ9S 2FQQB 4ZP8A 1HFEL 4N77A 1FVSA 1XQIA 4MIBA 2GX8A 4NWBA 3ZTOA 4FF4A 3F41A 4RX6A 3ENWA 2K8GA 2RIJA 3HKZD 2G0JA 1SIWB 2LECA 2I8EA 4DR6F 1AW0A 2FLLA 1IJFB 2FVSA 4IOBA 4HTIA 2ATLA 2XSFA 3BKFA 1X0PA 3VQSA 3CCJS 2Y8WA 1TV6B 3FZ2A 2JLFA 5BYQA 3EMTA 2B8PA 4TNOA 5IC6B 3B54A 4RW6B 3G71S 5D3GB 2G2YA 3VAHA 2HIQA 4NXNF 1YG0A 4DFMA 3C15A 1QAYA 2F7VA 2CG4A 3GYXB 2DH8A 4DS5A 1MROB 4AQYF 2DISA 4O3NA 3OQ2A 2IM3A 2W4DA 3GJTB 4BS2A 2KZMA 2CQ2A 2J7WA 3T1HJ 2B9YA 9RUBA 2CXEA 1B7YB 1LWFA 3AB4B 3PKMA 4WKYA 3GR0A 1FWKA 4RNOA 1HARA 1FXRA 3GLJA 2OPSB 5KG6A 3PR5B 3MAAA 1FRJA 4W90B 1RA7A 1X7VA 2EI5A 4P2XA 3OXLA 4UZCA 1KVIA 1UFWA 1B4SA 1S0MA 4UW2A 1S1WA 2VFUA 3SV4A 1Q82T 5AE1A 3M05A 2NREA 3DLEA 1R31A 1XIQA 1HA1A 2WZ1A 5I4MA 3NS6A 5IQ6A 1B0TA 3CDEA 4DR6J 2OLWA 4DV3F 3CJ0A 4NX9A 1HMVB 3TQEA 1U1OA 2UXBF 2V4JB 4ID8A 4G1QA 2DNYA 5D6GA 1BXNA 1U8SA 1AFJA 2BE2A 3PM9A 4U9RA 3EPGA 3TA0A 3NCQA 3QYYA 3BBBA 3EZUA 1PJ5A 4CM2A 4CZCA 1S6OA 2GHPA 3HHLC 2GO8A 4MK8A 1T9VA 5EWGA 4R0JA 4ER8A 1UP1A 2QO3A 1S1VA 3J7YU 2YWKA 1BY9A 3TVKA 3HK2A 4ZCMA 4QIFA 2IBKA 2E9TA 2EWHA 3L4BC 3M30A 2E7XA 2A2CA 1FNOA 1WDDA 1HNIB 1GTEA 3M4XA 2H5JB 2Q3PA 3ZZUA 1I6JA 3MGJA 3OR1A 2KXHA 1OWXA 4ZVSB 1HLWA 3FGVA 4A8MP 5CD4A 4O0NA 4K4TA 1SL0A 4DSIA 3CC7S 1GX5A 5KFRA 2VICA 3PJ9A 1ZBTA 3QIDA 2CNLB 3BQ1A 2IC3B 3EZOA 1NRKA 2RRBA 3GMGA 3CGIA 1NH7A 4YEAA 4CTAA 1LXNA 5T7LA 2FC9A 5HSPA 4U6PA 4RUAA 3PIOQ 1EZZB 2J9DA 3LPEA 4DL0C 5HBMB 4OYMA 3W60A 1JLEA 5K20B 1U1QA 2CQPA 3V5RA 5KFZA 4ZHRB 2FHJD 5KG4A 4IG0B 4CO2A 3FMWA 4DL3A 3AXKA 2HLUA 2LFVA 3EYZA 4KGXB 3C16B 4E98A 4EU0A 3VAMA 5B09A 2OHDA 2YQ0A 4RW9B 2PC6A 2Y9HA 3WHIA 4OJ1A 4K4ZA 4DLEA 2H4YB 3ICLA 2MLYA 1LOUA 4DQSA 3MM6B 2B5JB 3JSRA 1UZHA 2OD4A 2DGWA 5C42A 1SJ4P 4ATNA 4HEA9 2FPHX 4FNIA 3IAS9 3CJ8A 2GHVC 3KXDA 3V6JA 1X4DA 2CPIA 4DR1F 5J2NA 1IQTA 2QC3A 2L48A 5L1KA 2YWWA 5IZHA 3MI7X 2LLZA 4USVA 2IMWP 4URSA 1FRHA 1LWCA 1RZMA 2KT5A 3ENAA 2F8MA 1TKXB 1TAQA 1FI4A 1VRUB 2P8IA 3PJXA 3JYTB 3SXLA 4HH0A 1RDRA 3IBCB 4LUBA 3QJPA 2PGCA 2J76E 4DV6J 2AW0A 4J9NA 2HHQA 1FA0A 2G1HA 1V9OA 2D3UA 2RUGA 2V8HA 3FQLA 3IG1A 3L3CA 1JLAA 3HVTB 3CCES 1LW0B 2FZGB 4NLSA 5DGAA 3JB9k 2QE5A 4RBTA 1NKBA 4WZQA 2ZM6F 4GVLA 3B4DA 4KKOB 4A8WA 5LMUJ 3SQGB 2MEWA 1U8WA 2HQFA 1KOOA 3QPIA 5LJ3Y 4C8LA 1PO6A 1Y00A 1RAJA 1SC3B 1V5VA 3KDNA 3R5CA 4O44B 3JSYA 2H65B 5HO4A 1LXJA 2LQ5A 2EG2A 1C0TA 2OKQA 4TU7A 4J9LA 5ETVA 2ZH5A 3VAGA 4M5HA 4C8OA 4ZPTR 4LSZB 3AD9C 4OJ3A 4JI5J 3BM7A 1OSDA 3CJ4A 2E1PA 1QD1A 2CFXA 3IM9A 4M5NA 1IKVA 2IHR1 1RACB 4FP9A 2VA2A 2DXFA 5C7PA 3O1LA 5KT5A 1RTHA 4AUKA 3N79A 3A1YG 5K5MA 1TK8A 1D3WA 3BBCA 1Q5VA 1TTHB 2J8SA 3M2UA 2R7RA 1N8RT 4JI0J 1Q8BA 4P52A 2YKPA 1C4AA 2B6AB 4RNMA 1DURA 1RT2B 2NXUA 2QA2A 2SXLA 3DRSA 1RHKB 2GHWA 3HMJG 2VIHA 2HMIA 2OPPB 4OI3A 5I42B 1S99A 1ZETA 2E9ZA 1D8ZA 1R8AA 1IWAA 3MTKA 4DQIA 1RLCL 1HPZB 3RTVA 2HWIA 1RWOB 4ZS6A 2HHVA 3OVAA 4PG4A 1TUWA 4C7QA 1VQKS 3FC9A 4ED7A 4B3SJ 5DRKA 2OEKA 2RDDA 1VHFA 3BN4A 4N5SA 4B9SA 1IR1A 5E3AA 1YJNS 3IRXA 9ATCB 5F3TA 1UFKA 2HBRB 2G1DA 3EJMA 3NAHA 4IKAA 4C98A 4DDFA 1RT4B 4DEZA 1S1XA 3ADAC 3FCWA 2L3MA 3HHEA 1UVLA 2G13A 1CC8A 1RKIA 2RHQB 3BSAA 4MH8A 4Y3CA 4V19J 2VQFJ 2RRAA 5LT5A 5DGBA 4XAKA 4LQ9A 2K2PA 3GE9A 2J0XA 4KGMA 4MYUA 2M8HA 4OZ2A 4RUBA 3V2UC 5HL7Q 1T3NA 4F4WA 4R0EA 1R3NA 1S9EB 2OGUA 3IBFB 3UDVA 3NBPB 2ZUAA 1XMQF 2WRMA 4OYWA 3WC0A 3D2WA 2IM0A 3GQCA 2OH2A 1S9GB 5KG3A 1B64A 3PO5A 3Q83A 1WKJA 5G0RB 3H2UB 4I56A 3DMJA 3AH6A 4ZJLA 1IQZA 3MD1A 1J2VA 4MKYA 1KRPA 2DNMA 2MDAA 1VIXA 1JIHA 2QSWA 2E7WA 2VPYB 4NLTA 4AXIA 3D1OA 4X4OA 2BQ3A 2UUCF 4B9UA 4CCHA 3BH7B 3CB4A 5IC4B 2QA4S 3MZIA 2HYIB 4JI4F 1F2GA 5IWAJ 4KC5A 5KAKA 4KT0C 1VCTA 1URRA 3QFHA 4WTYA 3CD7A 1MMDA 4EZ9A 2Q66A 4AFFA 2HBYB 5KFSA 2B7BB 4I67A 4I2PA 4KYZA 1LWCB 4HDGA 3ZZOA 2G4BA 2NUHA 4A8FA 5FDLA 1NM2A 4DOZA 2HG4A 1S1WB 3FBBA 3KNGA 5HP1A 3TEGA 3K8VA 3OXFA 3UN5A 2ZBCA 3GFHA 2W2NP 3W5ZA 4B08A 3H4DA 4DV5F 4DV1J 4Q2LA 3WX8A 2FB0A 4P75A 3KMSA 1RTJB 1LW0A 3KJVA 2H5IB 4IQXA 1NHKL 2EFNA 3FNNA 4IRCA 3QWUA 2HHXA 1TL5A 3CCWA 1OSCA 1D0EA 1UVMA 1FF2A 1ZM2A 1HKAA 4DN9A 2OMLA 4X64F 3TA1A 2BE2B 2HURA 2JC1A 2WONB 2BMBA 1NZ8A 5HLFB 2A6MA 2VASA 2Q1LA 5K8MA 1ZH5A 4HR2A 4X4NA 1T05A 2MZQA 2JVOA 1REVA 2ZKUA 1I1GA 1P27B 2GV1A 2H51B 3CCZA 3HD2A 2WTFA 4LREA 2X1GA 2GS8A 4NRUA 3BF4A 2DNZA 5HK4A 1WACA 2AMCB 4BWJA 2JDJA 4DV2J 2M88A 1KQGB 1KD1T 2B9XA 3M8WA 3HHDA 4YDDB 3FEYB 2XO6A 4CYUB 2G0CA 3C8YA 6FD1A 2W2OP 2XWXA 4TQSA 1TR0A 4OZLA 5E0OA 2ZH2A 1GMUA 4MFBB 1J27A 2RKIB 3D1HA 4XTTA 2Z2ZA 4IR1A 4OYPA 2LXIA 2M70A 4CM0A 2C2NA 2FVPA 2HS0A 1FKOB 2EG1A 4NLGA 1D1UA 2AF6A 1TL3A 2DCUB 2DNGA 3F44A 3GIJA 1S48A 2RSQA 1N34F 2OD6A 2PE8A 2YY3A 3D28A 3H5SA 3QBCA 1B99A 3LGHA 2C3UA 3OJUA 1N56A 2IA0A 1HNZJ 2J6TA 3BYRA 4ZN3A 1NK0A 4IO9Q 2IM2A 5HJXA 2HHUA 2V9KA 3CJ5A 2Y1RI 1QTMA 2WCXA 1PAUB 1T11A 1L3VA 4MTPA 2OSQA 2HQIA 3LGNA 5EX3A 1DTQA 1RWNB 3HT3A 1HNWJ 2QA4G 3E01A 5T14A 1GFWB 4KQZA 4LT6A 1N5YA 2HHHJ 2RF2B 4HT5A 2DHHA 4IQMA 4DR2J 4ZIVA 1JJ4A 4P73A 2OTLS 2DK2A 2ROPA 2DXEA 3O6QA 1AA1B 3LAKA 4NLXA 2LYVA 3W2WA 1TAUA 1U25A 2VFSA 1R8HA 4PRFA 4WXWA 3I9ZA 4WIIA 2N7YA 4ZP9A 1T02A 4OX8A 2BJ3A 1N33J 4K2XA 3OVBA 1HR0J 2ZVSA 5CZVA 2YNGB 2UP1A 4OL8A 1RWMB 1X4CA 3GWCA 3O8WA 3MR3A 4IOCQ 4ZVFA 3H98A 2E29A 2IDEA 3FBFA 3QO9B 2Z30B 2MKSA 4QR0A 3QAEA 4W98A 3Q8VA 3QJLA 3D4JA 5GADI 5F8MA 4B9VA 4PXEA 5IT4A 5AXKA 4JV5J 5THWA 4C0OC 3OTOF 4B3MF 3EGWB 3W62A 3S7RA 2U2FA 2JC0A 1XJWB 2V2ZA 2VBZA 4EMDA 4DR5F 2JNJA 4A8QA 2DGOA 4KIAA 4RU2A 3OFGA 5AJ3F 4ZJOA 1U1KA 2UVRA 3R6LB 1PJ6A 1UTAA 2ZFHA 4F2RA 2KZZA 2MZ1A 1W2IA 5CHCB 2DNNA 2F5GA 2K06A 2RQ4A 3DXSX 2NQPA 2EPIA 4I2PB 5I42A 3A3OB 1UKUA 4X4PA 4O44A 4FXVA 3CJ2A 5ETRA 4U95A 3J81Y 1UA1A 2JLEA 2O67A 3LP1B 2HHTA 4NEZA 2AX0A 2HNYA 5LL6d 3Q86A 3W5YA 2R2TA 1XERA 1BQXA 1FE0A 4O4GA 1N36J 3R3TA 3DC2A 4X2BA 5L39A 1LWXA 4LF7J 3NNCA 2CWXA 3T6BA 2GGPB 1HWKA 3AJ1A 3MM7A 1KONA 3J7ZT 2ZJPQ 1KR4A 4OIXA 3JAMY 4KHPF 2QTWA 2HKEA 1WKKA 3GJSB 3NP5A 2RU3A 1JWWA 2CUYA 4KHMA 4OV6A 1Y5LB 3X1LB 1VS3A 3GCXP 5RUBA 3H5UA 1Y4ZB 1P1LA 3AODA 1C1CB 3D5MA 3MPDA 4LIWA 2HGNA 5AE2A 1PGZA 4RR5A 3UN2A 1H2TZ 2R3VA 1KVKA 2RILA 3V6DA 4GMKA 3SMZA 1TKZB 1T8EA 3A8JA 1UETA 3QT5A 3RAQA 1SH0A 3V81A 1URNA 1FXDA 5GAGI 5E3CA 2B56A 2VC0A 2CZ4A 5J1PA 2XS2A 4QU7A 2HWTA 4QOTA 3JAMU 2E1RA 1CJTA 1HW9A 1F5BA 4CP5A 4PAAA 3KHHA 3IWLA 2XULA 2DKOB 2VG7A 4AYBD 4DF4A 4U8VA 1RWWB 1CG2A 2BW7A 2QMXA 1BLUA 4ZCKA 3ISNC 3K7RA 4DBQA 3R27A 3CF5Q 3TAQA 3E2EA 3ZNJ1 2PMHA 3POTB 2WB1D 1OS5A 3KG4A 3PHTA 1RT3A 2GJFA 2V4JA 5HANA 2XC9A 2OEJA 4USUA 1KTQA 3ZXWA 2E66A 2VOPA 4L3KA 2K7JA 3KG0A 1QY7A 5F8HA 1XK8A 2DIUA 4KH1B 4Q45A 1O8BA 2XSJA 3T5KA 2BV3A 3RR7A 3MR6A 2QJ3A 5CCMA 4UUXA 2D3ZA 3GIRA 4TU9A 3TO8A 1VC6A 1EJ7L 1SBRA 3LP0B 2NYHA 3IR6B 3VVTA 1N5QA 2V63A 3LGMA 4Y2CA 1PJ7A 1FD8A 3D7SB 5KOXA 2UXBJ 4M1KA 2IRXA 1M90T 3K2YA 5C2CA 4DSKA 2KYXA 1GXLA 3C19A 3EICA 1F1BB 4NCGB 3PW5A 4FXDA 2VC1A 4PEOA 3CT9A 4FN5A 5D4PA 5HVHA 1NJZA 1TMMA 1QVGR 5I3UA 4D3HA 2W1BA 1IR0A 1TL7A 4HHHA 4USWA 4F8RA 1R0BG 3B6BA 1FDBA 2HLTA 2KTQA 3P5TL 2IFXA 4LRFA 3KYLA 3TAPA 1KLNA 1RWKB 2XY5A 5A2QU 4CLFA 1XBWA 4YQWA 1CS4B 1RAGB 1EKRA 1WI6A 3FRZA 1U26A 2KJVA 4FPIA 4I4BA 4TXSA 3QRPA 2ROGA 2BANA 3G82B 2YKMB 2L41A 4M5KA 3T1HF 4EYIB 1F9FA 1RTJA 2MKJA 4KV8A 5J2MA 1ZTWA 1ZA1B 2OPQA 4YN3B 3RBDA 1CSJA 1ZM4A 2WB4A 4PQUA 3TYTA 2KRBA 3J7A1 2CQDA 1RE1B 2N82B 4RW9A 1SJFA 3BO4A 2PT0A 2PMZD 3HJVA 3L09A 3U27A 1HWIA 1Y3JA 4CH7A 4TLQA 4DX6A 4EEYA 2BRKA 1TUVA 5HQLA 4X66F 1D09B 2LXUA 4OZ0A 4RW7B 3HX9A 2ABYA 1RT5A 2MGZB 1AUSL 4ZITA 2B4OA 4ED5A 2FYXA 3KHLA 1F3VA 2F3JA 2GVDB 2PI4A 5EX0A 2DB1A 4MK9A 4YFUA 1ZTTA 3MM7B 4NA3A 5JUMA 2ZBIA 4BBYA 3QWPA 4K0KJ 2O66A 3O44A 3CCUS 3R5AA 2YKQA 3KK2B 2I1RA 4JI6F 4OI0A 1ELOA 2W9BB 4F50A 4DV0J 1WC4A 1FD2A 2U1AA 2KHDA 5IWAF 3HHNB 2CZ9A 3G8QA 2NXNA 4DR1J 1IJEB 1NNDA 5DQIA 1PAEX 4HACB 4P10A 4QIEA 3QGPA 3GG0A 3RGIA 4GKJF 4GKJJ 4K5RA 3LQVA 2QFJA 2HPUA 1FFSB 3I31A 2QV6A 4DHVA 2ZC3A 2Y1LB 1FJGF 3DRPA 2R4FA 5DS7A
chains in the Genus database with same CATH topology
1JB0C 3ZZYA 2MY8A 1IKYA 1QUVA 2MKHA 4ZOSA 5J2PA 3PY8A 4XDDA 1QSLA 1SUQA 3GG1A 3HO1A 4F02A 2MZSA 4MJKA 3G9CA 4PG8A 4Y2IA 3BGLA 3CMES 2DT9A 2FTRA 2HFZA 2MQLA 1VQYA 3I96A 3OL6A 2FJXA 3CDBA 3MUVP 4LF8F 4V19X 1HBUA 2GCFA 1Q4RA 1RT6A 3I5AA 4WFNQ 2NSCA 3PW2A 2ADBA 1RWUA 4OMFG 1YGYA 2B6AA 4DL2A 2M8DB 4ZPCA 4Q8FA 3DN9A 5F0UA 1VQ5S 4FPRA 5D3GA 4ELUA 4ICLB 4KO0B 5L8RC 1R8BA 1KS2A 3PW7A 2R8JA 3IS9A 4Y00A 4RW8B 4RWWA 1Q81T 4GKJF 2A10A 3QLHB 2KJWA 5CZXA 1NHUA 2EK1A 4CQ1A 3I9V9 5K14B 4LMZA 1TFWA 1A9NB 2CPFA 1UAWA 5KFGA 3HXMA 3LP2A 3V6KA 2C2RA 2KT3A 3H59A 4I7FA 5F9NA 3PACA 4RZRA 1MW7A 2G9OA 1MWYA 4P7TA 2D74B 5G4DA 2CJQA 1CQNA 4TU8A 5KT4A 4A8XA 5A8WB 1E6VB 3DCAA 2BJEA 1FERA 3M2RB 4EUVA 1N0VC 3DU5A 4Y28C 4OHWA 2ERRA 3NMAA 2WW8A 3PX6A 5IM0A 5HMZA 2CRLA 4PQUB 3SDEA 4DUZF 2C3PA 4ES2A 2XCPA 2PIIA 5ADZA 2JEJA 1H3DA 4IH7A 2OIHA 4N76A 1KQSR 4NL5A 3DNCA 4NYZA 1UJ4A 2M2BA 2F8HA 4OI4A 3ZZPA 3ZZZA 3OTDA 1GXTA 1HHTP 3L7PA 4DG1B 4I2QA 1TVRA 2D9OA 1YRXA 3THVA 2W7AA 2IVYA 3P96A 1IBLF 4J9OA 5FDLB 1MMLA 2PFFB 1MU2A 4IG3A 5BYRA 3GB0A 3FQKA 2W9BA 2JZ5A 2P6TA 1NJXA 1XEZA 2OAUA 4C8MA 1OPIA 1DLOB 5CYJA 4X4SA 4NLYA 3OUYB 1FNMA 5C5JA 1WHVA 3KHGA 2KM8B 3O5TB 4CI0B 2XY6A 1S6QB 2RRNA 5C24B 1IKYB 2LA6A 3KK1A 2VKRA 2ASYA 3M8SA 3ETOA 4MIAA 3SCJE 3BGRB 4HI2A 5KFYA 3KLEB 4M95A 5DDQC 4XPEA 2YWGA 4RU9A 1Q78A 4LF4F 1VC0A 2RQKA 2XMMA 3PIPQ 2F8EX 2RKIA 3CTRA 1NK8A 1LWEA 3W2VB 4CH1A 4M5DA 4DF8A 2M0GB 2HAIA 1PSDA 1V3SA 2GNKA 3VAJA 3DM2A 2PI5A 1U7LA 4ZLPA 3IGNA 5K8NA 1U1RA 3MEGB 4UOCA 1IBMF 1H98A 4HKQA 4X4TA 2APOA 2KKHA 4Y2KA 3T3FA 1X4EA 3G8SA 1A7GE 1S1TA 3NRBA 1OQ3A 3OR2B 2DBBA 2K1RA 4WE1A 1D9FA 2LU2A 2XI3A 4PWDA 1JLAB 2FJVA 1GTHA 1RK8A 4F3OA 1W2BR 1SC6A 5HMYA 3U7JA 1I94F 3M9NB 1N48A 4WXOA 2VG6A 1EP4B 3WZ0A 1JXLA 2DR5A 3WDOA 4O3SA 4WU2A 2FHJA 1JLFB 3PEJA 3PDNA 3BJYA 3J80Y 1CLFA 4ZCLA 4ES1A 3OW2R 2F1FA 5F41A 3N28A 1DJ0A 1E6VA 3AAWB 3QZ7A 2FVQA 3BEGB 1BGXT 4PXBA 1LFWA 1W25A 2R2RA 4J37A 2A2DA 4YMEA 3OL8A 3D54A 4IFYB 5KT6A 3SCIE 2W8KA 2EFQA 2ZHBA 4RW6A 1RTHB 2V94A 1R8PA 3C66A 1FK9B 1VJWA 3DRYA 4MMOA 1VQ4S 2BJDA 1JKHB 4ZVHA 1N5VA 4K4SA 1FO1A 1FCAA 1YIJS 1U1PA 3EUNA 3W7BA 1UVNA 1TL1B 3KKFA 5DG9A 3OFFA 2KFYA 2JFKA 3QZ8A 3MEDB 2NLWA 2ZH1A 3V4IB 1VGYA 1TVRB 4OX9F 4WU3A 4X62F 2CZVC 5J1EA 2DGSA 1M5HA 2KB2A 3MUTP 1VBZA 3ULHA 5KG1A 4Z2XA 1IN0A 5DLFA 3UPFA 3UWTA 4WCEQ 1TK0A 2LEAA 4MKAA 1IKXA 2CQCA 3QMQA 4TY8B 1WTFA 1KOHA 4NLOA 3DGPA 1KEKA 3CULA 1N88A 1U49A 3Q2SC 2KT2A 4LSLB 4DSLA 3ENQA 5E33A 3TVYA 3ZZRA 1HMVA 3MFIA 4A8YA 4ED1A 1WHYA 2XY7A 5M2PA 5KFXA 2ZZNA 3TP2A 1U09A 5A8KB 1F60B 4FF3A 3P49B 2XCAA 2LQBA 2UXCF 3NBPA 3K5PA 2CVEA 1GX6A 5H9FJ 3RRHA 1D9DA 1N36F 5F0WA 4IFVB 1R89A 1JXEA 2YNHA 3N6MA 3M30B 4X65F 2JSXA 2MKIA 2RU9A 3M9OB 2GQ2A 2DNQA 3L7OA 1MMNA 4J5OA 1SL2A 1K8AT 1BWEA 4ZPBA 1G6BA 2R7VA 2AYBA 4M5DB 2VG7B 2E5GA 4NRTA 4ED0A 4WZQA 2MYFA 3IO1A 1ZM9A 7FDRA 2YKNB 2GJIA 1S4FA 3DM2B 3MPVA 2XI2A 4KSEB 3MEGA 5D4OA 4O4RA 4USJC 3G8TA 4PKDB 4HH1A 4YB5A 2GMLA 4DFKA 5JXSA 3TANA 2K1RB 3M2RA 1GXUA 2RE1A 4AL6A 5MLCV 1YI2S 4Q0BB 5F8JA 2CPJA 5IM0B 4RBUA 4QWEA 2FGCA 3OBIA 1YJUA 5KG0A 3GFZA 1IXKA 1HD0A 1FRMA 4LVOP 2M7SA 1NKCA 3M6VA 4KB7A 2OPRB 2DNHA 1REVB 3IC1A 3N4WA 4QPTA 4ZCIA 4I2QB 2I5JB 4PUOB 1QE1B 5DLGA 2D1CA 3SSQA 3NCPA 2HGMA 2D7SA 4DV7F 3G86A 2R7QA 4QW8A 3ZC4A 4KPYA 1KLMA 5C25B 2R8HA 3PXGa 4A8KA 3RB6A 2F9DA 4JV2A 3GV5B 5DM6Q 4AL5A 1UWBB 5LMNF 1GH8A 3HVTA 3DI6A 4R8UB 2C42A 1SV5B 4LSNB 2OPQB 2JJ4D 3NGDA 4BWMA 3CDUA 1N0UA 5DDRC 3U02A 3KLHA 3G6XA 1U2FA 3TNVA 3TARA 4QBUA 5KFCA 2LDYA 1T94A 3LF0A 4ECQA 4CO0A 1U2RA 1C0UB 5C24A 2QIFA 4TLRA 4QWCA 5B08A 3PFOA 4TY8A 4AL7A 1S1VB 1SL1A 2BYCA 1K1QA 4ZA1A 1H2UX 3BB5A 3SEOA 4F4XA 2ZNZA 4JI7F 4C8YA 2HVIA 1RT7A 4X4RA 3OHBA 1HNIA 1TZ0A 2N3OA 3BQ2A 3CCQS 2GW8A 4FNHA 1DRZA 2PDAA 2YWEA 4ILLA 1NO8A 2NZ4A 3H2VE 3ITHB 5KFWA 2UVUA 4LIRA 1FDAA 5JVHQ 2E44A 4DMZA 2V2KA 2YNIA 2XLJA 4QQBA 1G7CB 4PWUA 4F4YA 3KNAA 4K0KF 4EBCA 2DITA 1ROFA 1FTRA 4KGKA 3T6JA 5LSOA 2N3LA 2OO4A 3MWBA 5BR8F 1B0VA 2CYYA 4WFBQ 3RRGA 4USIA 3CDAA 3FSXA 3VAIA 2W24A 2YKNA 3E51A 4I6WA 1KFSA 3TAMA 3HHLA 4L3NA 3OTEA 2B5JA 4RWXA 1RT6B 4M8LA 4Z37A 5ITHA 3I0RA 1LQ9A 1HNXF 4ELTA 4WZMA 5I3PA 5GAGU 4XPCA 1WF2A 2RJZA 1KFDA 4TY9A 2W4PA 2E1MC 3S01A 1VQPS 2FIUA 1HR0F 2EFGA 2R7OA 5KG7A 4B3OB 2IAJA 2JEFA 2BDPA 2CPYA 4FBUA 5HI7A 4B3SF 4NZ7A 1J5OA 1HNVB 4KFBA 3VTIA 5CYMB 1S1UA 1RISA 3KWMA 2CKWA 2Z0GA 3FCHA 3MEEB 2VBXA 2ZJRQ 5KFPA 2XLIA 2ASJA 1FEEA 3MMBA 2KM8C 2JFDA 3LP2B 4OHYA 2V4QA 2PSZA 3HKWA 3BO3A 1Q79A 1S49A 3OTBA 1X5PA 3GV8B 3OR1B 3C6UB 4DJBA 1J5EF 1XR5A 3GFXA 4KHRA 3FMBA 2MJNA 4ZP7A 5KFMA 4ECWA 2RVJA 4JBCA 1X4BA 2YX1A 3MOZA 4OX7A 4BDPA 2FHOB 1FKPB 4HT7A 4KAIA 5K9FA 2DRAA 2BM1A 1N33F 4TYAA 1U4BA 4ZVEA 1SH3A 3CO9A 3CCVS 1K0VA 1UJ5A 2BA9A 4QIVA 3PX0A 5T7L