1O0PA

Solution structure of the third rna recognition motif (rrm) of u2af65 in complex with an n-terminal sf1 peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
104
structure length
104
Chain Sequence
b'GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Splicing factor U2AF 65 kDa subunit
publication title Structural Basis for the molecular recognition between human splicing factors U2AF65 and SF1/mBBP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 16
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1o0pA00
4V19X 4WF9Q 2L41A 2I38A 1S72S 3CUNA 3R27A 4WCEQ 2CPIA 2YWKA 2DNNA 2G1DA 2KT5A 3NMRA 2GHPA 1WEZA 1X4HA 2X1GA 1RKJA 1D9AA 2DNHA 2F3JA 1X5SA 2DIUA 4C7QA 2YKAA 3CCRS 1RK8A 2X1BA 1FJ7A 2MY8A 5HL7Q 2MKCA 2CQ0A 1UW4A 1X4CA 2KG0A 1YJ9S 2XS5A 2DITA 1VC6A 1KOHA 2DNLA 1N52B 2CPFA 5EN1A 3D2WA 1WHVA 1O0PA 2AYEA 2CPXA 3CULA 2HGMA 5LJ5Y 2VOPA 2DGUA 2AYBA 4WKRA 2J0SD 1U6FA 1YHQS 1FO1A 4Y0FA 1WEXA 3MD1A 4RU2A 2DNRA 3VAFA 3UD4P 2CQDA 2A3JA 5DETA 2CQ1A 1VQ8S 2QFJA 4UQTA 2M88A 1WF0A 2ZJQQ 1SJ4P 4P6QA 2JWNA 2MZRA 2CPDA 4UY8T 2MMYA 2MZQA 3FEYB 5DDQC 3UWTA 2KYXA 1FNXH 5FJ4A 1U1PA 1X4EA 2YTCA 1SJFA 2MB0B 1U1KA 2NLWA 2MQNA 2LEAA 1U1NA 1WTBA 2AYMA 2E5GA 2KN4A 4IOCQ 2OSQA 4CH0S 2D9PA 2M0GB 1KOOA 5IFMA 1AUDA 2UP1A 2MJNA 3CD6S 3BS9A 1VQMS 2VOOA 1X0FA 1PGZA 1K9MT 2CQPA 2LXIA 1KD1T 5CXTA 5H1SV 2CPJA 2MGZB 1ZZNA 1HA1A 3TYTA 1A9NB 1M1KT 1YJWS 3J7YU 1YWXA 1X5PA 3BEGB 2YH0A 2D9OA 3MURP 3G8SA 1VQ5S 3S8SA 2CJKA 3P49B 3G4SS 2KRBA 3CCMS 1SJ3P 2DHAA 1UP1A 4QPTA 2J76E 4Z2XA 3US5A 2V94A 2CPYA 4TU7A 2KG1A 2J0QD 2DIVA 2MPUA 1U1QA 2DGOA 1M5PC 4F25A 3V4MA 3SXLA 3H2UB 5JVHQ 1WI8A 2FC9A 1U1RA 2LA4A 5DDRC 2FC8A 3B4DA 2DISA 2U1AA 3ULHA 2O3DA 2ADBA 2MGZA 2HGLA 2E44A 3CCQS 2CQ4A 3R1LA 5LJ3Y 2OSRA 2LECA 5CA5A 2ZJPQ 3LQVA 2DNGA 3VALA 1L3KA 2DGQA 2LMIA 1Q86T 2DH7A 3OW2R 1CVJA 2DNPA 3U1MA 1B7FA 2D3OR 3EGZA 2MZSA 1FJEB 1K73T 2MQLA 2PE8A 2OTLS 1U1LA 3MUTP 3UD3P 3CPWR 3TO8A 1N8RT 3MD3A 4WFAQ 3J7ZT 2VONA 2X1FA 2GO9A 3P3DA 4OZ1A 1SXLA 5D78A 3VAIA 2KXHA 2FPHX 2L9WA 1FXLA 2HZCA 2EK6A 3CF5Q 3IRWP 3H2VE 3PIOQ 1M5OC 2JVRA 1UAWA 2MQPA 4TU8A 1P27B 2MZJA 3G6ES 3TP2A 3CCJS 2WBRA 1X4GA 1ZH5A 2MKIA 3S01A 1NU4A 1Q7YT 3BO2A 5LXRA 2KI2A 3EGNA 1WEYA 1F9FA 2XB2D 1VQPS 3CCES 2HYIB 2KHCA 2ADCA 3CCUS 1X4DA 2DGWA 5LXYA 1WG5A 1U1OA 3CMES 2FY1A 3MUVP 1QVFR 3EX7B 3HHNB 1A7GE 2CQBA 2DNKA 1DBDA 2MQOA 4LJMA 2XS7A 3CCLS 2RT3A 2M52A 4BS2A 3G8TA 1BY9A 2CQHA 1OIAA 5CYJA 1DZ5A 3P5TL 2LKZA 3LPYA 2DGSA 2CQGA 4CIOA 2CQIA 2JX2A 2KFYA 4ZKAA 1VQ6S 1HL6A 2E5JA 2AYGA 1VBXA 2MSSA 3I56S 3DXBA 2RRBA 2DH9A 1FT8A 1WHWA 3VAKA 1WF2A 1W2BR 4IOAQ 1WF1A 5D77A 1IQTA 2N3LA 3L3CA 2DNQA 2RS8A 2AD9A 3DLLQ 3B4MA 3G71S 5LSOA 3UCGA 1DHMA 2DGTA 5DDPC 2BZ2A 1QM9A 2KM8C 1SJQA 1DRZA 2M70A 2DNYA 5GMKa 1WHYA 2DO0A 3NNCA 3PIPQ 3UE2A 3CC4S 5JVGQ 4FXVA 1X4AA 1R8PA 4TLQA 2HGNA 5DDOC 5IQQA 2KM8B 2M8HA 2U2FA 1YJNS 2E5HA 4F02A 3SDEB 2LEBA 1YTYA 2B0GA 4PKDB 5HO4A 1U1MA 3MI7X 1VC5A 5GAHU 3NNAA 1K8AT 2MQQA 1YI2S 2M2BA 5GAGU 2G0CA 4YOEA 3CCSS 4M5DB 2F9JA 1ZZFA 2KXFA 3RW6A 1VQLS 4W90B 2KXNB 4C4WA 1PO6A 4W92B 2MKSA 1H2UX 3UCUP 5MLCV 3MOJB 2QA4S 2CQ3A 5BJRA 2SXLA 3CC7S 2EK1A 1OPIA 3SDEA 3CTRA 3CC2S 3UCZP 2DNMA 2CQCA 1VQOS 2DHXA 2EVZA 2LYVA 3JB9k 4TU9A 1WG4A 4OZ0A 4CQ1A 2MY7A 3CMAS 3FEXB 2XSFA 2CPHA 1HD1A 1P1TA 3S6EA 4IUFA 2G4BA 4EGLA 2YH1A 1OO0B 2HVZA 3VF0B 5GADU 4ERDA 3CXCR 1JJ4A 3VAMA 1U2FA 1KC8T 3I55S 2RQCA 2RQ4A 1VQ4S 1D8ZA 1NO8A 3ZZYA 2CPZA 2XS2A 4Y00A 1X4BA 1VBYA 2MQMA 3RW7A 3BO4A 3NNHA 2OTJS 2KH9A 2MKHA 2N3OA 1Q81T 1M90T 1OWXA 2XNQA 1Q82T 2JRSA 2K3KA 2DHGA 2MKJA 2DB1A 1HD0A 2MYFA 3THTA 2M7SA 2CQ2A 4QU7A 2MJUA 1U6BA 3N9UC 3IWNC 5LSLA 2OIHA 1QVGR 1VQ9S 1N88A 2F9DA 2M9KA 1H6KX 2MZTA 4QU6A 1KQSR 3VAJA 3HI9A 2NZ4A 1FJCA 1X4FA 2J8AA 1YIJS 5GAEU 1YITS 5IM0B 1SJRA 4WFNQ 2MSTA 1WI6A 2DNZA 5DM6Q 1VQKS 2XNRA 2FHOB 1WWHA 3CCVS 2LXUA 2RS2A 2DNOA 2JVOA 3Q2SC 1VC0A 2MZ1A 2PEHA 1H2VZ 4C0OC 4WFBQ 4YB1P 3NS6A 2LA6A 2DGXA 2MKKA 4YUDA 2ZJRQ 2LQ5A 2DHSA 1G2EA 2MXYA 3ZZZA 4J5OA 4LMZA 3THPA 2ERRA 2RUGA 2X1AA 1VQ7S 4U67Q 1M5KC 2DK2A 2KRRA 1WHXA 2BOPA 4LIRA 4PR6A 5IM0A 5DM7Q 3P6YC 2CPEA 2DH8A 3U1LA 3MDFA 4IO9Q 4PRFA 2DO4A 4A8XA 1NJIT 4QQBA 2VODA 1VQNS 1M5VC 2M4MA 2QEXS 3MUMP 2N7CA 1JJHA 1X5TA 2M8DB 2E5IA 1WELA 2Q79A 1XN9A 1WG1A 3G9CA 4CH1A 1N54B 1URNA 2MHNA 2RVJA 2KVIA 1FHTA 3VAHA 1R8HA 1S79A 2I2YA 3BO3A 1JMTA 5ITHA 3SMZA 1VBZA 3Q2TC 4ED5A 4FXWA 3R1HA 1X5OA 2N82B 3G96A 3S7RA 2L08A 1JJ2R 1UFWA 3NS5A 2OJ3A 3MXHP 4WIIA 2KU7A 2LCWA 2RRAA 4F26A 2K8GA 5GVQA 3K0JA 1H2TZ 2RNEA 2RU3A 3VAGA 2DGVA
chains in the Genus database with same CATH superfamily
4YB5A 3CUNA 1WD6A 1EETA 3R3TA 2GHPA 4DV5J 3PR5B 1RKJA 4C7QA 3NP5A 4YMEA 3DNCA 2X1BA 1FJ7A 5HL7Q 3T1HF 2BBEA 4JBCA 3NMAA 1RAEB 2DITA 2QYGA 3DFEA 1G4CA 1NDPA 1KNZA 2DNRA 3T1YF 4K4VA 4ZVUB 1KBRA 3TI0A 1FDDA 1ZA2B 3IO1A 4IOCQ 1IBMF 4DL7A 2IRYA 4WYLA 2PGCA 3FRZA 4KHMA 4USJC 4LVNP 4JI2F 1RKIA 4QWDA 4CCHA 2VU5A 5B0EA 1KONA 3DLGA 3P49B 3SSRA 3CCMS 2E9ZA 2ZVIA 4DUYF 2V4QA 3D7SB 2LQ9A 4I6AA 2C3UA 3MMBB 3B82A 3UDEA 4U6PA 4FF2A 4JI8F 3H0PA 2ZOGA 5KFCA 2ADBA 1CBKA 5CD4H 1R8AA 3DLKB 3QNWB 4Q2MA 1CVJA 3U1MA 1N33F 1B7FA 3EGZA 2R7TA 5ETVA 3CPWR 2CYYA 4DR5J 5FLXU 2VONA 4OMFG 2XLKA 4F0HA 1FE0A 2FPHX 4DR7J 1FTCA 1JLQB 3OJSA 4RW4B 2JVRA 4FBUA 4OLOA 1E6VA 2E9RX 1UPPA 4WP9A 1IWAA 1NU4A 2J9EA 4B9LA 4IG3A 3FBCA 2XB2D 3V5RA 4DPWA 1R27B 4AUKA 1EARA 1WG5A 1P6TA 4WE1A 2FY1A 2AJ2A 1PILA 4J9OA 4ZPTR 1DARA 4DS4A 4FN5A 2FHJD 3AA8A 4E0DA 3AD7C 2X3DA 4PAAA 3H42A 5J2MB 1HL6A 1BWEA 2IDEA 3HF5A 4DS5A 5CD4A 5C24B 3O44A 4DX6A 2UUBJ 4GKKJ 3B4MA 1OSDA 4DPTA 2HNZA 1T0TV 2A2CA 5DQIA 1VK3A 1S12A 4HEA9 1LKZA 3BGUA 3C3LA 4DG1B 2HMIA 2ATLA 2FUG9 3ZTPA 1K8AT 5KFLA 3OL7A 4WFYA 4EYHB 3FQLA 4OZ5A 1HNXJ 3QRPA 5A8KA 2EBEA 4TQRA 4HTJA 1TL5A 2YKMA 1RAIB 3KK2A 3EDRB 3TZZA 3JB9k 4TU9A 2HS3A 4ES2A 3QIPA 4NLDA 1HNVA 2WVBA 4DPOA 4OYBA 1HNWF 2G4BA 1N0UA 1NM2A 1J5EF 3M8QA 4M5GA 2BW2A 5F41A 2RKIA 2XHWA 4KSEB 2OTJS 4O23A 2PFFB 3CJSA 2K3IA 1N6QB 1CS4B 1KVIA 3CJKB 2CNOB 2O67A 5L1KA 3W2VA 2HHHJ 1XQIA 3N9UC 5C2CA 1SL1A 1QVGR 1N88A 3V6DA 5HLFB 1NKCA 2NZ4A 1X4FA 1FEHA 4USIA 4DWIA 5C42B 5IM0B 2VC0A 3PYDA 2MSTA 2C3OA 3QAUA 1VC0A 4ZCLA 4LUBA 3IS9B 4OLPA 1H2VZ 1S1TA 4UY85 3MGJA 5J2NB 4UF4A 4UZBA 3DLHA 1AW0A 4ZPBA 3T41A 2ERRA 5LMUF 4U67Q 3LP1B 4C97A 3T3FA 1FESA 1IM6A 2HBYB 3NGKA 5ETPA 2YNFB 4MJKA 4A8XA 2I1RA 4JI7F 3CB4A 2RQKA 1N36J 2XMJA 2ZITA 3V6JA 3LF0A 3GJRB 2OEJA 2G2ZA 3LP0A 3PVXA 2IM3A 4ED5A 3CCTA 6FDRA 4ZHRB 3M8PA 2W2QP 2YVSA 4QWAA 4F26A 4TLRA 1JLFB 1H2TZ 1RHMB 1MWYA 1LV5A 2E9TA 2H48B 4DSIA 2QMWA 5DGBA 1UJ6A 4DL3A 2F3JA 3HHKA 2MY8A 4ETXA 2UV8G 1L3UA 1RWKB 2YX7A 1WC0A 1NK0A 4DV7F 5E0OA 4NZ0A 4CLSA 3CULA 4CLLA 1FX2A 4RW6B 3D54A 4N8OA 4KGVB 3KLFB 1W25A 4RU2A 2RHQB 1EP4B 2EI5A 7FDRA 4HHUA 3CGIA 4ECTA 5DDQC 4OI4A 4IOBA 1UVJA 4DPYA 2NLWA 2F8HA 4MKAA 2MQNA 3DXSX 2OSQA 4CH0S 2RH3A 2A6MA 4LFCF 2A6OA 1HHTP 3OL8A 1UA1A 4K4XA 4NI2A 4B3RF 1HWKA 3M8RA 3JYTA 1A9NB 1TELA 4ANCA 2UVRA 2YH0A 2CJKA 3US5A 2QTWA 3CD0A 5JVHQ 4DZDA 4KKOB 1RTDA 2FJEB 4NYPA 3ULHA 1HR0J 1WACA 2VIHA 3BKFA 3CDUA 2QYCA 4NASA 1GAOA 2QL9B 2HNYB 1ACMB 4GVBA 2D3OR 1AZSA 3ITHB 4U7CA 1MROA 3BKTA 2R7WA 3MD3A 4K0KJ 3BBFA 5CH7B 4ED6A 4M8LA 1WSRA 1F60B 3BGRB 1SXLA 5D78A 1QUPA 5B08A 5DJBA 3RR8A 3CCJS 2UXBJ 3AH6A 1Q79A 4CO0A 5L9NA 1ZH5A 4ID5B 5ETTA 1HWIA 2X51A 2IBOA 2NCKL 3RBEA 3R7SB 4DQSA 2FJDB 1A7GE 3CNQP 3VQTA 4E8UA 4LJMA 2RT3A 3R5AA 1IR1A 1RT7A 4F2SA 1F3VA 1VQ6S 4UUWA 3NOGA 4BWMA 3PJWA 4OI3A 3M05A 1PJ6A 2KM8C 2BZ2A 2KYZA 2YKNA 2HNDB 1B0TA 4ED1A 1FWLA 4P2XA 5KFPA 5HROB 2CJAA 3G82A 4PKDB 4NA2A 2KO1A 5GAHU 2CJ9A 3LH2S 5ETSA 3UVJB 1JLAB 4TY9A 1H2UX 4M95A 3MOJB 3CJ8A 4FVCA 5B0CA 3MM6B 1U26A 5H9EJ 1KDNA 5K14A 1S9EA 4AQYF 1NJWA 4DL6A 2BKNA 2RB7A 1YRTA 3Q83A 8ATCB 2CPHA 1HD1A 2O66A 3D68A 1KFDA 4OJGA 2HVZA 5KAKA 5KT7A 1JJ4A 2VQEJ 1VI7A 5J2PA 4IH6A 1T3NA 5AT1B 1VQ4S 2P9EA 1S5ZA 3ZZYA 4ELUA 2OHDA 3J80U 3MMAB 1U4BA 2FVCA 3DDKA 3NNHA 1REVB 1SBRA 4DCPB 4OJHA 3PCOB 2DHGA 2MKJA 1SKUB 4KYZA 2IC3B 3H8YA 3EGWB 3VZIA 4O3QA 2J9DA 3E51A 2JEFA 4MIBA 1ULRA 2WOMB 3QT7A 1S1VA 2D74B 4CM2A 4P7TA 4JV1A 3NL0A 5DM6Q 2B51A 2JC1A 1I1GA 3H5SA 2AJFE 2PEHA 1N32F 4DLGA 3PKMA 4DL4A 3KG4A 3M8ZA 2RUGA 1FDBA 4E98A 1Y5LB 3VR1A 4IH7A 4EZ9A 1NJIT 4USUA 4X4RA 4YHHF 2W7OA 2MLZA 1N54B 2VZ9A 1U48A 1YQHA 1P9QC 2I2YA 2J6TA 3W61A 2W4DA 4AE5A 2RRAA 2YY3A 4MKYA 3IAS9 2K8GA 4ZP7A 3O5TB 3KK1B 3K8VA 2RU3A 3WQPA 2ZBPA 3D66A 5HSPA 2GIFA 3AD8C 3R97A 1HQ2A 3UDLA 1S0VA 4Q0BA 1K0VA 2DR9A 1HWLA 2RAQA 5B0BA 4WIQA 2B6AA 4CO3A 2DNHA 2OFGX 1X5SA 2YKAA 4J7CA 4FDFA 4GKJJ 2YPYA 3DRPB 2ZM6J 1IKYB 4ED2A 3J7AN 2AYBA 1RT2B 2EFVA 4LIWA 2PFDA 5HVGA 2PA3A 2F5GA 5DETA 1RWOB 2L9DA 4PXCA 2ZJQQ 2Y8YA 2XQCA 4TYBA 2MMYA 2KYXA 1VRUB 4RBVA 5KFEA 4LF2A 2V4RA 3G86A 2IY5B 4CP5A 4X66J 4ZPVR 1N34F 3CJ3A 2D9PA 1RLDA 1PKUA 1FERA 2VOOA 5EWFA 5CZVA 5KG6A 3OHAA 2J0XA 2ZBIA 2RD5C 1L3SA 5A8KB 5L38A 2K7JA 4P72A 2VPWB 4WTOB 1U2RA 5CQGA 3EWGA 3KK3B 3M2RA 3LGMA 3IR6B 1U47A 2OMLA 3BR8A 1C2PA 1EQMA 2ZUAA 3HVTA 3LUYA 4C3LA 2R2UA 4I67A 2GS8A 5T7LB 2DNGA 3R5JB 1KHWA 2VL1A 2FVSA 2CNKB 2GV1A 2WCXA 3OR2A 3U27A 3TZXA 2BM1A 2H5JB 3C14A 4R8UA 2L9WA 1FXLA 3ZXWA 2YQ0A 3SCKE 1OY9A 1K0TA 1RQ0A 4JOUA 1D1UA 4DXLA 4M5HA 1WOPA 1WEYA 4DV6F 1F1BB 4IG0A 3FFIB 1S6UA 3H20A 1BQMA 3FBBA 3TANA 2CQBA 3DGPA 2ROPA 1GNKA 1RAOA 1T94A 2FHKA 4J37A 1HYSB 2RDDA 4K4SA 5HBMB 5DO2A 4LF8J 4YR2A 1EQ0A 4CIOA 3MM7A 3H90A 4EK2A 2OD4A 2DH9A 2VKRA 1FRIA 1W2BR 3TEHB 2RS8A 3GCWP 2EFPA 3PHEA 4ATNA 3UCGA 1S1XA 2OPPA 1U2CA 4WZQA 1WHYA 3GONA 1RSCA 2XY7A 3LP0B 1HW9A 1UZDA 3U1NA 4L76A 3OUYA 1UL3A 4KY3A 1YI2S 5FIIA 4YS2A 1RAHB 3SSSA 4USHA 3RW6A 1FKOB 3WHIA 4O0NA 2HW3A 3WIUA 4F04B 4BC7A 3ZTQA 4G65A 1EHWA 1TL7B 5BJRA 2QMUB 4LF7F 2HVEA 2PEBA 1OPIA 1ZM3A 3GE9A 4JI6J 4ZVEA 2DNMA 1T8EA 4CQ1A 1BLUA 4C48A 2HWHA 3S6EA 2BW7A 4A8FA 5D4OA 4GO5X 1UZHA 1JNZB 2E1RA 2RQCA 4IFVA 3UDVA 2XS2A 5H9FJ 3IAM9 1I6JA 1ZBTA 2MQMA 2MKHA 2W9CA 1FXRA 1YSJA 2EWHA 3K57A 3ZTSA 1TKZA 3N01A 3ISZA 2XWXA 4WP8A 4IYQA 4V19J 3BSOA 2RDIA 2HAFA 2W9BA 3FC9A 1YITS 4QW8A 1U8SA 1QTMA 2JEJA 1UEKA 1DLOA 3G6YA 5KFVA 4ITSA 3M6VA 2BE9B 2LA6A 2ZJRQ 2V8HA 5B0GA 1NEEA 4HDGA 2ZEJA 2F4VJ 1W26A 4ZVHA 1XC9A 4B3SF 3E2EA 5DM7Q 3P6YC 3UR0A 4AD6A 1VQNS 3OXLA 4DR4F 4GVBB 1JJHA 3BR9A 2V5HG 3IBWA 1WELA 4LSLA 3OD2A 3FJ2A 4X64J 4A8KA 4YEAA 2P2CB 3Q22A 4R5PA 5K8OA 4QJVA 3GJSB 3MXHP 1T03A 4AT1B 3PYEA 2I9SA 2LDYA 2RNEA 5ADZA 2DGVA 4WF9Q 3BJYA 1S72S 3T1AA 3R27A 2VFUA 2PMHA 2XGQA 2ZOMA 1WEZA 4QIFA 3W5ZA 1RK8A 1C0TA 4QYZJ 1XBWA 1X4CA 2VBYA 1ELOA 4JYAF 1KOHA 4Q44A 2GHWA 4B3MJ 2PD1A 3C6TB 3PX6A 4GC6A 1HBMB 3WZ0A 2UVVA 3JS9A 1OY8A 4DV1J 4L75A 3PRDA 2H54B 5KFZA 2L9NA 5AE2A 3K17A 1FE4A 1N36F 1S6QA 3POTB 3I5BA 4OYZA 1RAJA 4ZVSB 3DC2A 2XY6A 3TAQA 1U1PA 4ENOA 2KJWA 2BJEA 4ZMMA 1V9OA 4I56A 3NBPB 4NRUA 3HX9A 2YNGA 4NYZA 3G82B 2WSEC 3MZIA 5KTQA 2AJ1A 5LL6d 5CYMB 4N8NA 2IDLA 1RTJB 2CQPA 2CVEA 2QA2A 4JI3F 1HA1A 1V3RA 2LLZA 2H9ZA 1YWXA 1X5PA 2W7PA 2KRBA 3QJJA 4K5SA 4I7FA 2J0QD 3DLBA 4XDDA 1M5PC 2ILZA 4ZLJA 1UJ4A 1NK4A 2W1BA 3B4DA 3DOKA 1IBLJ 1XIQA 1ZTTA 3JQMA 3ZZTA 3VALA 3QLHA 2UUWA 3BQ1A 3BH6B 1FJEB 3TR5A 3IM8A 3MAQA 1G3OA 3VAIA 2OUGA 5KFOA 3K89A 4HDHA 4OI6A 2E7WA 2E5LF 1QD1A 2MKIA 3BO2A 5LXRA 2C28A 4ILLA 2CZ9A 1S1VB 4A4JA 1JK9B 4B02A 4V1Ak 1TU0B 1VQYA 5HQLA 5E3QA 4CO2A 3OTOJ 2VJVA 3J81Y 3UD5A 2KDOA 1IJFB 3T9ZA 4CLPA 5KFWA 3MR7A 2CZ4A 3P5TL 4DUZJ 2R3VA 4LFBF 4ILRA 4DFMA 4YR3A 4P52A 2BJ9A 5LMNJ 5K5MA 4IO1A 2DGTA 3M7VA 2QMXA 1F9EB 3J7YI 3NNCA 1T3OA 1D3WA 2U2FA 2E5HA 1R8CA 3MCMA 3SIPB 4NX9A 3LWLA 4B9VA 5F8MA 2G0CA 4YOEA 4W90B 3JSMA 1Q0NA 4WXOA 1LWEB 4NLYA 3TA1A 3SFUA 3H59A 3T6JA 3W65A 1ZA1B 1S76D 5T14A 3WBZA 3KLIA 2B4PA 4OZ0A 2MY7A 3K59A 4EZ6A 1IJEB 3FEXB 2CIMA 4OHZA 3GFZA 4O0IA 2FZGB 2AJ4A 2WAQD 2HFSA 2OELA 3THVA 2N4DA 4FF4A 2R7VA 1RISA 1X4BA 1Q81T 3MR6A 1RE1B 5F8HA 1ZM2A 2XMWA 3IG1B 2CDQA 2W8LA 2JJ4D 3NGUA 3R5DA 1IKWA 4HYKA 4PABA 1P9YA 3EXYA 4C8MA 4LRDA 2WBMA 1U6BA 3MECA 1EIYB 3GYXB 3HFKA 4H4OB 5EX0A 3KJFB 3VAJA 1XR5A 3I32A 1X9SA 2MTLA 4RLEA 1VQKS 2FHOB 5D0HA 4ZOSA 2JVOA 3J81U 3M2RB 4PZVA 3DLJA 1FDAA 4WPAA 2VICA 3HVTB 4PG4A 1KWMA 1T9VA 1R43A 2HS0A 4I0WA 3P8BB 1VRQC 4CLZA 1RXOB 4I2PA 3MPVA 4PRFA 3ZO7A 1H98A 2B9EA 4FP9A 4LF6F 4ZPCA 3H7HB 3RB0A 3BZQA 1TUGB 4RBTA 3KKFA 3A12A 3C14B 1FXDA 1X5OA 1S0MA 3NS5A 4PUOA 3CWJA 4NEYA 3GFYA 1RWPB 4O44B 4XDCA 1FD8A 2YQ3A 4IG0B 1D9AA 3R5BA 2OMOA 1BQMB 4MK7A 1S59A 3DGPB 2V34A 3CJRA 5A2QY 4WU3A 2NXNA 1NCLA 4KIAA 3PW5A 4Y0FA 4X62F 2YNIA 4ECQA 3CVKA 3L4BC 2F7VA 2AX0A 5D3GA 5E33A 2MHEA 1REGX 3KG1A 4KO0A 2IA0A 4QWBA 4ZCIA 3A3NB 1S1XB 1DQAA 2OPPB 2CJXB 2ZWOA 2VPZB 3F56A 3V6HA 1QSSA 2HG4A 2LEAA 1OY6A 3M6UA 1Z2ZA 3EMTA 2YKQA 1RDRA 2J5AA 1KD1T 4Q8FA 1M1KT 1RADB 3VHQA 3LO3A 2NUHA 3MEGB 4NXMF 3EM1A 5CABA 1B7YB 1T9YA 2V94A 3FSXA 3SXLA 4KC5A 4RNHA 1F9HA 1Y5IB 1XNRF 1UVMA 5A8WB 2ZC4A 2NS1B 1IBKF 4X4TA 1K47A 2ZJPQ 1HMVB 3HD1A 3HHLB 2DH7A 1S6PA 4Y2CA 1EKRA 1FRLA 5AXKA 4G1QA 1OJ4A 1K73T 2MQLA 2OTLS 3GLJA 2AGQA 1WDTA 4OZ1A 4B9UA 1R31A 3FGVA 1PCAA 3IRWP 2QL7B 1QTNB 4DL5A 3HFVA 1RHQB 4TU8A 4C0BA 4NLRA 1FRKA 2DYAA 4DV3F 1YBUA 4MMOA 4RZRA 2V9WA 1FWPA 1BHNA 4YQWA 2W9BB 2KFNA 3QPIA 2FIUA 3CCUS 2DGWA 1SQGA 4K59A 2BJ3A 1U1OA 5KFGA 1RWWB 1DBDA 2G2YA 1OYEA 4IRKA 1VCTA 2Q6BA 2F1FA 5A2QU 3MEEA 4MFBA 2QL5B 1NAQA 5L1JA 1UWBA 4RO0A 1Y11A 3DM2A 1WTFA 3OTEA 2HRTA 2ZC3A 5D77A 4B08A 4RNFA 2QFIA 3HD2A 5EGYA 4KPYA 3EICA 4ZP8A 3RYLA 5GMKa 3MM9A 2YWFA 4LRCA 3KLVA 3PIPQ 4QR2A 4LSLB 3FCHA 4TLQA 2WVDA 1RT5B 3NCQA 1NH7A 3BYRA 3T1HJ 3LPEA 3MI7X 3NNAA 1KLMB 4CLTA 4N76A 1GX6A 4UTGA 4IDKA 5DLGA 3RR7A 3TX0A 2CQ3A 3EVWA 3T1YJ 2M3DA 5KT2A 1GXUA 3LA0A 1TFWA 1JWWA 2CQCA 4QZVB 3RB4A 2AKWB 4YB7A 1FDNA 5B0FA 3H2LA 4X4NA 1KSPA 3BH7B 4IUFA 1NSKL 2NSCA 2OI2A 5DZ6A 3GJTB 4DZ6A 4CO5A 4NCGB 5FDLB 3I31A 1DURA 4O4GB 1F3FA 1S6QB 5F0WA 2EXUA 4ICLB 2CPZA 3RUBL 2RF2B 1VBYA 2BUNA 2CKWA 4F4AA 1KEKA 1NPPA 5A0YB 4M63A 3IGNA 4DUYJ 2OLWA 3W64A 4Q45A 1S9FA 3FZ2A 2OPSA 4QOTA 3A3OB 2YNGB 2MJUA 1SQEA 5GMDA 4JI8J 3DYAB 3AY0A 2DRBA 3FRYA 2QSFA 3JSRA 1UMJA 3GG0A 2B9WA 4CO4A 3FCVA 1N33J 1BQNA 2B8PA 4TN2A 3PHTA 4U8VA 1MW7A 4I7FB 4FNHA 4CLFA 3SZ2A 4YUDA 4N77A 3C15B 2XMKA 2E1CA 2B56A 1WKKA 3MMCA 4X4SA 3DOKB 4KV8A 3Q8YA 4LF1A 1NSAA 3EZUA 5J1PA 4LIRA 4HACA 5GAGI 3NGTA 3U1LA 4RX6A 2ZHAA 3KMQA 1YK9A 5M2PA 3ZZOA 2QEXS 4J9LA 2E7VA 3TVYA 2R7QA 2DY1A 3PYGA 1S48A 1URRA 2W8KA 3KJVA 2XZTB 4QYRA 2PC6A 1CJVB 4DFJA 4ECRA 2DVIA 2E7XA 4LR9A 1GH8A 3EUNA 3TVKA 2XMTA 3VAGA 3E01A 4M5LA 4FYDA 3DHWC 3PRVA 4WCEQ 2CPIA 4NZ7A 1VJWA 2DNNA 4NRTA 2KT5A 5KFDA 2B5JA 3IBCB 3OXFA 2JFDA 2CPFA 1VOMA 3TAPA 1Y4ZB 2V8GA 3OXGA 4H4KC 2NSBA 2HFOA 2ZD1A 2DGUA 1FO1A 2QLWA 1FKPA 5DRKA 4OZJA 3D6TB 1F6TA 4J9PA 5KT6A 2XZWA 4UY8T 3KUGA 5KFAA 3FEYB 1IKXB 5FJ4A 3R6GB 2XBPA 3O8WA 4P73A 2FVPA 4EFAC 3WX4A 4QWCA 3DU6A 5EDWA 1HNWJ 4G1IA 5CXTA 3QSIA 5U47A 3J7YU 4L6V3 3G8SA 2BEFA 3N6MA 4J90A 4QPTA 4WYWA 2J6UA 1UJ5A 4YN3B 1CEZA 1RYRA 1KQGB 3FZBA 2QSWA 2FC9A 3TQEA 2LP4A 1LNQA 2CADA 2CA9A 2ZNZA 2CJYB 3H5UA 3LQVA 4QIGA 1TK8A 1LWCB 4ID8A 2VFVA 4KHPF 2BANA 1HI1A 3C6UA 4ZVOB 5GADI 3CIMA 3I9V9 3U7JA 4L3NA 1AA1B 1RACB 3MMBA 4OX9F 1S1UB 5CAAA 1UVKA 2O01C 2XWYA 5IQ6A 2CNNB 5IWAF 2J9DE 2WBRA 3MOZA 2DCLA 4HH1A 4WZMA 2KI2A 2Z2MA 5LMUJ 1VQPS 1S1WB 3CDAA 2HYIB 4NLQA 1BMQB 3TUPA 3GMGA 4ZPDA 2ZFHA 4DOZA 4EWTA 2IFXA 2J7UA 4DDFA 2W25A 4JI7J 4WJBA 1JLQA 4RW4A 5ETQA 2M52A 2HQDA 1BY9A 3KWMA 5DZ7A 1G1XA 3KLGB 3PYFA 5IOLA 4AXJA 2GAHC 2ZDPA 3TAMB 1RTIB 5IC4B 5CHCB 4DU7A 4NL5A 2AD9A 2NREA 3HJVA 4P10A 2YX1A 4GMKA 2DO0A 5ETOA 4F2RA 4FXVA 4ZA1A 2AWZA 3UPFA 2OPQB 2EG2A 4DV7J 5J2MA 4PUOB 4ELTA 4I2QB 1WUUA 5C24A 1KS2A 4C4WA 3GV8B 4NLOA 1LWXA 4EBCA 1LW0B 4F7VA 4ED8A 5HMZA 1S7IA 1FVQA 1X7VA 2J9CA 1Y5NB 1RCXB 3BN7A 4DG1A 1RT6B 5KFYA 1CJUA 1PBUA 4EBEA 1HW8A 4F36A 2VPYB 1NK5A 3LOUA 1PC4A 2WB4A 4LFCJ 5JXSA 2BQUA 3HKZD 4B3RJ 5HJXA 3BO4A 2KH9A 4NLWA 4OJ1A 3QFWA 5A76A 2XNQA 1F5BA 4RBUA 2VJUA 4ED0A 2DB1A 2W2MP 1X31C 3ONQA 1JKHB 2CQ2A 1TKDA 4CT9A 3AQPA 3QGHA 1RBLA 1UTAA 3ZNUA 1OYDA 1TUVA 2HVIA 3PFEA 1VQSA 4L73A 1YLXA 3T6BA 2KJVA 1N6QA 2CAJA 4LFAF 3DRRA 3CJKA 3I4HX 8AT1B 5HP1B 5E7OB 4RW8A 2HHPA 3NS6A 1V5IB 2DGXA 2JFKA 1XJWB 2V4JB 5LOQA 4OQJA 5HLFA 1FWKA 4JB8B 1M5KC 4TNOA 2KZMA 5IM0A 4OYWA 2Y1LB 4QQBA 1S6PB 5A8RB 2VFRA 2PI5A 2CG4A 2M8DB 3IS9A 3SQGB 4ZDNA 5J2NA 3P5BP 3M9OB 5HMXA 3IMQJ 2RVJA 3JQKA 2VASA 1L3TA 3SMZA 4WXWA 3R1HA 3LP1A 1IKVA 2NYIA 5KG0A 4ZP9A 2DXDA 2YNFA 2GX8A 1OMSA 2R2SA 1TL3B 2G1HA 4F4WA 2GW8A 3BV8A 5KT4A 1DTQB 4ZIWA 3T19A 2W2NP 1DQ8A 5KG1A 2G9OA 4ZJOA 3IM9A 2H4YB 2C3YA 3HZEA 3QWUA 1VC6A 2LU2A 4A8WA 1JLFA 2HQGA 1GX5A 1U24A 2G0IA 2EG1A 1S6OA 4ZPWR 2FVRA 3UDCA 1HHSA 3VGVA 1UWBB 3DM2B 1VGYA 2G13A 4NLPA 2VQFF 4NLGA 5GAEI 2YQ1A 2BQRA 1S77D 5E3CA 3MM9B 4CM0A 4RW6A 4AQYJ 2HRUA 5EHHA 3KLFA 2B4VA 2JHEA 4ALZA 1JLGB 2UXDF 1TK0A 2VFSA 2Y8WA 3M2VB 1X0FA 3HULA 1EP4A 5BXIA 2IMWP 1FJGF 3DMJB 1ZZNA 1UFLA 3LGNA 4DF8A 3V2UC 1ZAVA 2D9OA 2G2OA 4DN0A 3G4SS 1SJ3P 1VIOA 2CRLA 2WVCA 2ZH4A 1V6HA 3CCWA 2DIVA 1WI8A 5HMYA 2ZH5A 2GQCA 5KFXA 1PJ5A 3HHLC 2XYHB 1L3KA 1DY3A 3I0RA 1RAGB 2XCPA 1M1GA 1KTVA 3MEDB 2R2TA 4CTAB 4EU0A 3WIVA 4KKOA 3CE8A 4J9NA 4X4VA 5KG5A 2QA1A 1N32J 4TQSA 4OZ2A 4K7QA 4PCQA 3TX8A 4C3KA 2CFXA 1GQEA 2HNYA 5JMNA 1S4FA 2IJFA 2MLYA 2WONB 1EJ7L 2HSEB 4ZN3A 3G6XA 3QGPA 2VG7A 1Q7LB 3IA0A 3AB4B 5LXYA 3N6NA 3OT9A 2C2OB 2CDRB 4RW9B 4YHHJ 3V6KA 3K5MA 1QAIA 2OKQA 1TAQA 3W8PA 4PWDB 1C1CB 1GT8A 4ID5A 3PX4A 1DZ5A 2H5IB 3AOBA 4TVAB 3DN9A 3PEHA 3GQCA 4X4PA 2IRXA 1KVKA 2CZVC 3FBFA 5KFSA 2KFYA 1T9TA 2K1RB 3FUYA 1YBAA 2J0WA 2J6SA 3V4IA 3W5YA 2HFVA 2DR6A 3C16B 3G71S 4JI0F 2LDIA 3UE2A 1JLEB 3CC4S 4WBFA 1SC3B 1WORA 1X4AA 1DTTA 3Q8SB 2BE2B 1WKJA 2HQIA 2PMWA 3SDEB 2RMLA 2CVIA 5EUHA 3GIRA 1VC5A 3ICLA 2QLXA 1TVRA 5GAGU 4RW7A 4C9DA 2B4UA 3AXKA 3R2DJ 3OFFA 3C2PA 3DLEB 5F8JA 1PO6A 4W92B 3K5LA 2CNLB 4B17A 1AT1B 1FF2A 1U0HB 3FBEA 3DOLB 5HROA 3CC2S 3X3UA 4X65F 4LR8A 4NMXA 4K4WA 3UVJA 3SCIE 1JLAA 2UXCF 1SCJB 1TKTA 4EGLA 1N34J 1OO0B 2UV8A 4QCLA 1FKPB 4O3PA 4NLUA 1U2FA 4I68A 2DPJA 3MM6A 1NO8A 5B7WA 3PJ9A 1LFPA 4DCOB 1YBTA 1YJTA 2HIYA 3MAHA 4U95A 2XGPA 2GA7A 1PYSB 2BVZA 2V0NA 1Q95G 2IVYA 5HI7A 4JV0A 5DG7A 3MCOA 4ZVGA 2R7UA 3IWNC 5LSLA 3ILOA 2M9KA 3MMAA 4NXNF 2ROEA 1REVA 3FDSA 2ALYB 4QIVA 1U09A 3DGVA 3H5YA 1UCNA 4Y2MA 4CH7A 4OI0A 3BM7A 1TFYA 4DV0F 4HVZA 2IC3A 2V2VA 1HQUA 1IUJA 4PWWA 4F8RA 4WFBQ 2MKKA 2EEYA 3HKWA 1N5QA 1FFSB 1NH8A 5C7PA 2GVDB 4MAKA 3KDNA 2WOMA 2E66A 4IR9A 2K7KA 3QGGA 3M30B 3W1YC 2VFTA 4IO9Q 1D0EA 3W9JA 3IRXB 3F73A 2YWGA 4M1KA 4DV6J 5AE3A 2QC3A 2BANB 4A8MP 3W5XA 3C6UB 4MIWA 1URNA 1FHTA 3HT3A 1SV5B 3WC2A 1W7WA 1JJ2R 4P9SA 3OHBA 3ZFVA 4PXBA 5I3PA 2NPFA 1JXEA 1Q16B 2IAJA 3OSNA 4QWEA 4LSNB 3VGSA 1MMNA 4J9RA 4LQ3A 5F9LA 3LGHA 3NOCA 3GP9A 4B9TA 5E3PA 1MG7A 1S97A 5EN1A 3D2WA 2AYEA 4LT6A 3KK1A 5DG8A 1SL0A 4BHQA 1YHQS 1P1LA 3RGIA 2GO8A 3VAFA 1EKSA 2B7BB 1YDLA 2AIRB 5F9NA 4BC9A 2MZQA 3UWTA 1GMUA 2RHSB 1X4EA 2COLA 3DRPA 2BRLA 3EPGA 1IKYA 4LF7J 1BXNA 1RT2A 3FSYA 3C8YA 1F5CA 3VVUA 2CWXA 4CYUA 1YJWS 1VRUA 2A0FB 3G8QA 1RAAB 3A8EA 3QQCD 2HFUA 4KRWA 4P71A 1RLCL 5DLFA 1GTEA 2LA4A 3BKUA 1CJUB 2HGLA 2ALZA 4WU2A 2R8HA 4Y2AA 3SYZA 4DX5A 2LECA 4O3OA 2AZ3A 4Q43A 5K8PA 1LWFB 4K5RA 3KK3A 4NMLA 2HAIA 4OYPA 5E41A 3UD3P 4HLBA 3NWRA 4U96A 4WFAQ 2X1FA 2R4FA 2KXHA 5IZHA 1NHVA 1M5OC 2YX4A 4FYXB 1SKSA 5T7LA 2YNHB 1SIZA 4CLYA 3SQOP 4J9KA 2R42A 5HATA 4B3SJ 3ENAA 3SSQA 2K06A 4NLVA 1NLKL 1HNZF 3QRQA 4DLEA 3CMES 3MUVP 4DR4J 5M2UA 3DRRB 3UR3C 4AL6A 4RW8B 9RUBA 3UN3A 4L72B 1C0UB 1HQEB 2JLFA 3N4WA 4PYDA 3K5PA 2V8VA 5KFBA 3A4TA 2CWKA 3EZ5A 3FFIA 1JB0C 4DR1J 1MSWD 2ZKTA 1FT8A 1BD6A 4JI1J 3W60A 1R8BA 5F8LA 2C1EB 1C1BB 2Y1RI 4LRFA 3EE3A 1HYSA 4GVLA 1IR2A 2M8HA 4E2FB 5HBMA 4JYAJ 1YTYA 4HHHA 1SJ1A 2UUAF 4HI2A 2EC2A 1IKVB 3BN4A 3W2WA 2XY5A 4KPCA 3GIKA 1C4AA 1CQNA 3QGIA 4ZPAA 2H51B 2LQBA 3D1HA 1SL2A 5AJ3F 4FF1A 2ASYA 1FKOA 4B3OB 2CG8A 1FK9B 4M5MA 2C2MB 2C22A 4BWJA 3H5XA 4RUHA 1DJ0A 1TL7A 3ZZ0A 5BR8F 3HVAA 2DR7A 3BGLA 3M1VB 3NAIA 3DDNA 5KFIA 1QSLA 3CO9A 1NUEA 4JI3J 2VDIA 5CCLA 3V81B 3RJMB 3ENQA 2VF3A 2HQCA 2K3KA 2WTFA 4BBYA 1R6VA 2C3PA 1PYTA 4DR2F 4QU7A 4JI5J 3ADAC 4C0HA 2ZZNA 1X60A 3M8SA 1H6KX 3GFXA 1F5AA 2LFVA 3VGUA 3AOCA 3LAKA 3CDBA 4F3QA 3B78A 1U7LA 5GAEU 1IN0A 4JV5J 1Y7PA 3PW0A 3HHDA 2VPXB 3RTVA 2V2ZA 3DI6B 3ZTOA 2FB0A 1K1QA 3AD9C 3DRSB 3HT0A 1ZM9A 3N79A 5M2RA 2BA9A 1TZ0A 2ZNYA 1Q8IA 4OZ3A 4USMA 4UT4A 2QV6A 2DK2A 1WHXA 2BOPA 2E5LJ 3K5NA 4XO0A 3LALA 3I0RB 2NUUG 2V8DA 3D3CJ 1JIHA 3BDEA 3G2XA 4HH0A 2PSZA 4ES3A 4DL2A 3TA2A 1FTRA 1X8DA 2LXFA 3OLAA 4FXWA 2L08A 2GGPA 4Y2KA 4R0EA 4B9NA 4LFBJ 4OYMA 3DOMB 9ATCB 2G1DA 3GR0A 2YBVA 2KB2A 3Q24A 2VG7B 5SZTA 2LQ8A 2V6AA 1YJ9S 1RWVB 3ELHA 3NWGA 1R3NA 4KHRA 5I3QA 4L3KA 2HGMA 3BSCA 3J7Z5 3RG6A 2AF6A 1MU2B 2J0SD 1CJKA 2BJ1A 3T5LA 2GC8A 2FLNA 1WEXA 4C11A 2XO7A 3BREA 1I3OB 4ER8A 3RAMA 1SH3A 1ZOTA 3V4IB 2L3MA 3PTWA 3C6TA 5AXMA 2ACYA 1HBMA 1ZM4A 1DTTB 1N56A 2YPZA 1U1NA 2DJWA 4H4KA 1RABB 3OJUA 1KOOA 3POTA 1WKLA 1HI0P 4FVMA 5I3UA 1TVRB 4RW7B 3A3PB 1VS3A 5F3ZA 2DEJA 4F4YA 3NBPA 5I42B 3SFGA 4F25A 3BB5A 1NJXA 5CYMA 5DDRC 1RTJA 2XLIA 3CCQS 1TKTB 3R1LA 1JXVA 3JQJA 3CJ4A 2BJ8A 3D67A 1TV6A 2DNPA 3GYGA 2MZSA 4DFPA 1WDDA 3TO8A 2Z30B 3M8WA 1RGVA 1YJVA 4KQZA 1SIWB 4URSA 2DTJA 4OHWA 2WRMA 4I6WA 2FHMA 3EGNA 3Q23A 2F40A 4F0KA 1NXIA 1KLNA 2KVQE 1QVFR 2GFFA 4JI4F 4DV4F 3OQ2A 1HQUB 4AYBD 2IVMA 1U49A 1PSDA 4LF6J 3GIJA 3G8TA 7FD1A 4HTIA 1WOSA 4FYVB 2DGSA 3ZNJ1 2W2OP 2MSSA 1VBXA 2OFHX 2MEWA 4FNIA 1C4CA 3MPDA 5DDPC 1DRZA 3AJDA 2M70A 3L7OA 3FMWA 2OEKA 3QYYA 1Q5YA 4DV2F 3TWZA 3D6HB 1Z1ZA 4OHYA 2YWWA 3H98A 2RSQA 4KH0B 1VQLS 4X62J 2IAJB 3GPAA 4BCAA 1FRHA 3OV7A 2R2RA 5MLCV 5F8NA 1VISA 2I6WA 2V2QA 2UUTA 4MIAA 3BSAA 2VC1A 2EK1A 5L46A 3UCZP 1CULB 3VCDA 2XEXA 1N48A 3KYLA 5LT5A 1B64A 1I5OB 1Y3JA 2RE1A 1Y9OA 5L8RC 1LWEA 2IRUA 4ERDA 3NS7B 2JDJA 3I55S 1S99A 4OYAA 1H7XA 1O6XA 2GQQA 1CLFA 2N3OA 4OX6A 2F65A 3K7RA 5C2GA 5HQMA 3QFHA 1RTHB 4NXMJ 2NXJA 4F4KA 4WP3A 3VV2B 2W9AA 2NPIA 3ILIA 1XNRJ 3SCLE 3PZPA 4EO6A 1FJCA 2VB6A 4CYUB 4OJ3A 1IBKJ 3QATA 1H7WA 2KHDA 2XNRA 3IG1A 3HMJG 3R2CJ 1IR0A 3GZ7A 4CLKA 2M5YA 1B3TA 4DQPA 1TL1B 4H4OA 4KGMA 2FTRA 4J5OA 3THPA 4X4OA 2NQPA 4DX8H 5CZXA 2UU9F 2XTJP 4KJIA 4DV3J 2DD8S 1AYEA 3VVTA 3KOAA 4ZVFA 2E5IA 1G6BA 2IPOB 3CW2C 4RNMA 2JH3A 4P7VA 3BO3A 1M0SA 1JMTA 5ITHA 1XR6A 2BACA 3OVBA 2N82B 3UN2A 2KU7A 2XMUA 3LP2B 3C66A 4OL8A 2PA8D 1L3VA 4PQUA 2HHSA 1NB2A 3HVRA 4DR3F 2IYGA 4AL7A 3QT5A 5KFJA 1WC1A 1PYOB 5KT3A 2CQ0A 1NZAA 6AT1B 2ZH1A 2DNLA 1N52B 1H0HB 1WHVA 3I82A 4DSEA 4O44A 1U6FA 1RA7A 3GG1A 1NPKA 3GJQB 2AHOB 1TTHB 2AEMA 2RQMA 3TJ9A 1KQFB 1P8GA 5KG3A 2W4PA 4ECYA 1SJ4P 4XIUA 4P6QA 4FYYB 4F3OA 2MB0B 2OEMA 4FPIA 2XYGB 3OPKA 2MQ8A 3CD6S 2D69A 3W2WB 1GXTA 3CCZA 5GAHI 1VLOA 2MGZB 1HPZB 2EBGA 1B99A 3TYTA 5GMEA 2LQJA 2B9YA 3BEGB 1CJTB 1XK8A 2ABYA 3CIZA 4RKUC 2DGOA 3M6XA 1XMOF 4P2SA 2R8IA 2VH7A 3EGVA 4KTQA 2Z57B 4U9RA 3I0SB 4IQMA 4ED4A 8RUCA 2VG6B 1HBUB 4KB7A 2LMIA 3MEGA 4URGA 1FNOA 1PG5B 5J1NA 1XR7A 4MKVA 4XTTA 1A0OB 3GCXP 2PE8A 1RHUB 1Q8KA 4USKA 3EJMA 2GMHA 3FCWA 2P8IA 2ACMA 2WVFA 5A8WA 3CF5Q 1M5SA 5D0RA 3NGDA 5DQGA 1P27B 3M9MB 1VYAA 3NAHA 2F4FA 1HMVA 3HHLA 5ETKA 3CD7A 2ZKUA 2HVDA 1XEZA 4DN9A 3OTBA 1QE1B 1D8YA 3VWSA 3A8IA 1YJRA 5C5JA 3CJ5A 4A8YA 2CQHA 4G3IA 1OIAA 1N5TA 2PMZD 1NKEA 2LKZA 2I5JB 5IC6B 4ZLLA 1RZMA 3M8YA 3DXBA 4K4TA 2WSFC 1LXNA 3DLLQ 3HP6A 2ZZMA 1FFWB 3W9HA 2ZWPA 2H5EA 3HHEA 3MCNA 3PACA 2ZE2B 4KFBB 4J9UE 1Q78A 3AB2B 1FI4A 1VHFA 2GGPB 1HIYA 3GWCA 1H38A 4LVOP 4K8RA 3QO9B 1JQGA 2BMBA 1RT5A 3CC7S 5D6GA 2GMLA 3KLEB 2DEIA 3RU0A 3W8GA 3NLCA 4ETZA 3HCXA 1KLMA 4DHVA 5MAOA 3L7UA 3JTPA 3GSIA 4DR1F 5IT9Y 1WNEA 4HT7A 1RA6A 4JI1F 1CJKB 1J5OA 1XMQF 1T9XA 3VF0B 3IFEA 5G0RB 4C11B 4PQAA 2ASDA 3MFHA 2FJAB 2HK3A 2BKPA 4DI6A 2BDPA 2CUYA 3KLHB 2EKYA 4UZCA 2Z2ZA 1QDUB 1JLBA 3THTA 1H74A 3Q8VA 4NCGA 5FDLA 4H4MB 4O4GA 2XI2A 3T9NA 3PFOA 4RWXA 4ICLA 5I3UB 2RF2A 1KQSR 1YIJS 1XTZA 1ZETA 2EC0A 5KFRA 2PIIA 3SEOA 5A0YA 1HKAA 2OPRB 4KAIA 4KHPJ 1B4SA 3ENVA 1UVNA 2MZ1A 4C0OC 4YB1P 2FGCA 4Y34A 1VFJA 4OX9J 4NLTA 3DYAA 1KRPA 3ZZZA 4LMZA 3KXDA 2HZVA 1WC4A 4U7UD 1XERA 5IWAJ 4DU8A 1N5YB 2ZH2A 3SI8A 4YR0A 1TV6B 3M2UB 3LW5C 5H9FK 4JI5F 4IRCA 3C15A 4EMDA 2DXEA 3K58A 4EEYA 3H25A 1GMWD 2HHQA 4ES1A 4J9QA 3OTCA 3K0JA 1YKWA 4JV5F 2KT3A 2IM2A 1NBEB 4IFYB 4F4XA 2DBBA 4KGKA 1VLYA 3R8YA 3OLBA 1NK8A 2MKCA 1CJVA 1UW4A 4EUVA 3M6WA 2KG0A 1HARA 1NKBA 2FD2A 4AXIA 3CMQA 3N0VA 1BQXA 2XCAA 2VOPA 4WKRA 5IT9U 3BGFA 4DSKA 1Y0HA 1RHJB 2M88A 2RRNA 4ZVTB 1I94F 2FY8A 1OS5A 2Z2YB 2XI3A 3B6BA 4RUAA 2YTCA 3U02A 1E6YB 3BQ0A 4MT1A 2ZH3A 3MPWA 3MHYA 3O3LA 4UUXA 2KN4A 2UP1A 1VQMS 5F8GA 3WX8A 2CPJA 1BWVA 3W9IA 5T41A 1HBOB 1IKXA 4MTPA 3JXOA 4NA1A 2J76E 1U8WA 1SC4B 2CPYA 2Z2LA 4QYZK 2MPUA 2ATCB 4XPCA 4XK8C 2DRAA 5CYQB 4C8KA 3RBDA 2U1AA 3EVMA 3P4UB 1AROP 2ZH8A 3SCJE 1ZYQA 5EX3A 4GRSA 3VQSA 1FRXA 1UETA 2HPUA 1RT4B 4N41A 3KUHA 2FHJA 4D3HA 5HQ8A 5SUHA 2GO9A 4WK1A 4J9MA 2B3TB 3PXGa 4ZK7M 2HWIA 4LFAJ 2ZH9A 2GVZA 5KG7A 3ZZRA 3FQKA 4DSLA 2UUCF 2MZJA 1SUQA 2Y3YA 4I4BA 1RT1A 3O6QA 1LWCA 5K8MA 4OYOA 2EW9A 2V2KA 1F9FA 3K8WA 2F8MA 3MPYA 2KHCA 2ADCA 3HM9A 2AU0A 4B3TF 4KH1B 3EYZA 1S1UA 3DCAA 3EX7B 3R9LA 4ZITA 4ECXA 4TY8B 1GFWB 1XWLA 5CYJA 4RUBA 3MTJA 3O2IA 4ZVQB 4YP3A 2ZVSA 5KFUA 3MMJA 1S1WA 1SI9A 2C2KB 5ETRA 2AYGA 4JUZA 1LW2B 1QM9A 1GMVA 1SJQA 1XNQF 4DX7A 4EBDA 1R8PA 5JJBA 3KLGA 4OYXA 2WHOA 2ZHBA 1NJZA 3ET6A 4KBIA 1S9GB 1HBNB 5KFNA 2DR5A 3TAMA 4PG7A 1RTIA 1T9UA 4PQUB 2KXNB 3I6PA 4K4YA 2RJZA 1K44A 1CSJA 3J80Y 2VQFJ 1MLAA 2JEIA 3B8HA 1IQZA 1ITPA 2OPQA 1RBOB 4LF4J 2EVZA 2LYVA 1T7PA 1Y3KA 3D1OA 5B09A 4I2QA 1ZPVA 2XSFA 1P1TA 1X0PA 1GTHA 3MR3A 3BF4A 5E5NA 1LW0A 3RAXA 2UXDJ 4UOFA 4Y00A 1FJGJ 2HIQA 2HEKA 1RT6A 1OPZA 2NYHA 3DHXA 2MLXA 4KT0C 2J7KA 3EDQB 2XG8A 4Q7AA 2D7SA 4FKXA 1LK7A 5D15A 3D6FB 1O8BA 2F9DA 3KMSA 4QPXA 1FA0A 1VRTB 5J1EA 4X4UA 2NXEA 1SJRA 3NGSA 2C42A 5AXNA 4C8ZA 4KGXB 2B7CB 3GV7B 1M5HA 3D0HE 3TA0A 1JKHA 2JLGA 4A48A 2X7IA 2DHSA 5ETLA 2GHVC 4QW9A 5IXUA 2JZ5A 1EB0A 2WVEA 2AMCB 2R8JA 2CPEA 2PDAA 2QJ3A 1FFGB 3DRYA 1NJYA 2DO4A 1NZ8A 2A2DA 1MMLA 3MUMP 5HP1A 1X5TA 2JC0A 4RNNA 4ANDA 1EETB 1CG2A 1WG1A 2XM3A 3Q8RB 3CT9A 3QT6A 3UNYA 2V4JA 3DDIA 3CJ2A 1TAUA 1S79A 3PG9A 4N47A 3TQ1A 2HBQB 4LBHA 4M5IA 4R25A 3Q2TC 2W01A 1FNMA 1UFWA 2OJ3A 4QR1A 3RZAA 3MAAA 1PC5A 4F67A 1RBAA 4HT5A 4WFXA 2ILYA 2D3O1 5A8RA 4Q2LA 1S49A 3SQGA 3NMRA 1GXLA 2X1GA 1NMEB 3OL9A 1B70B 3UN5A 2HHUA 1G7CB 4O3NA 4UOCA 4JI0J 2VD3A 2BXJA 3N28A 1TL3A 4A8QA 1LEOA 3RRKA 1DTQA 2GIRA 2CQDA 4G1PA 3TNVA 1VQ8S 2QFJA 1CC8A 1JJCB 1RT3A 1H3DA 4G6VB 4DR6F 1SH0A 3AOAA 1VIXA 3DLGB 2FJXA 5I4MA 3P96A 4X65J 4FF3A 3CDWA 3PM9A 2ROGA 3BS9A 3I5CA 4O3RA 1PGZA 3AQOA 3W66A 4MYTA 2UXCJ 3TVZA 5IV3A 3O1LA 2PI4A 3S8SA 2LVWA 1Q8LA 3Q86A 4DQQA 4LF5F 4DBQA 5KT5A 1R0AA 2XYPB 3PW2A 3E3XA 1JLGA 3M2VA 2BJDA 2E1MC 3DMJA 1J5OB 1E6VB 3PNIA 1H73A 2BV3A 2DGQA 3OBIA 3AXMA 3OW2R 3RRHA 4NXNJ 4IG3B 2H4WB 3IBFB 4ZJLA 1N8RT 2DRDA 3Q89A 4WE1B 4D3GA 4DV0J 1JLBB 4GC7A 2MQPA 4FBTA 2VBWA 2O5DA 3NG8A 3OL6A 1ZTWA 4HI1A 1I51B 3MEDA 4CTAA 1L5UA 2HFNA 5K20B 4WWSA 3CSKA 3SBMA 3GFHA 4LREA 4BS2A 2HNZB 4LF9F 3MR5A 1MN7A 2XMAA 2C2RA 2Y1JA 2WONA 1NDKA 3RRGA 2CQGA 2HMIB 2PO4A 3HJFA 3TZYA 2Q6CA 4DV5F 1JX4A 1Y10A 3VAKA 1WSVA 1RYSA 4RW9A 3MPUB 3NCRA 3HXMA 4J91A 5IT4A 2YKMB 4PWDA 3KK2B 1C1CA 2J7WA 3UNGC 5J2QA 3RBXA 2HHXA 1DAXA 1U1MA 2K1RA 1FKAF 2Y1IA 3QIPB 2VA2A 1HNVB 3D3BJ 3QBCA 2V69A 5KFTA 3C16A 2CJQA 5AXLA 4EO8A 3M8QB 1JLEA 2QA4S 3OSPA 3R5CA 4EI2A 1S0NA 4F0MA 2RKIB 2BE2A 3SDEA 1RHKB 4UQGA 4PG5A 1VQOS 2QX0A 5BYQA 3CMAS 2QLFB 2HQFA 3GILA 2HHWA 5HJYA 4A8OA 3DLEA 2IYIA 2XMVA 3W2VB 2JLEA 2HVHA 1YRUA 3P45B 4PPZA 3V6DB 1Q8BA 1U0HA 3DOLA 1A6LA 2XZDB 1OWXA 2JRSA 3AA9A 1UWAA 4HKQA 5LSRA 2N7YA 4Y65A 1S1TB 3Q8PB 3FVYA 1LQ9A 5THWA 2X3GA 3GTYX 1VQ9S 2IIHA 1RB0A 1IXKA 1X9MA 5G4DA 3HVWA 1NSPA 4DR5F 3ILLA 2GJ2A 1S7HA 2Z8QA 1SPBP 2DNOA 3KG0A 4DR7F 4BLGA 5RUBA 2LQ5A 3GB0A 4ELVA 1G2EA 3MEKA 2P6SA 3M8PB 2VUGA 4TYAA 3AAWB 1N5VA 3QWPA 1BC6A 1KP6A 3SV4A 5L1IA 3VTIA 1O5JA 1HNZJ 3HSDA 2Q1LA 1MWZA 2MDAA 2GVDA 1NB7A 2ZBCA 1KR4A 3BYPA 2GVZB 4WIIA 2D1CA 3PR4A 4PXDA 1VK8A 1MNEA 3M30A 2VG5A 1SUQB 5E3AA 1RT1B 5JUMA 3IRXA 3DRXA 1WOOA 4MK9A 2UUBF 4GKKF 2N4CA 1UVLA 3PRBA 2YXLA 4IRDA 3Q8QB 5A6PA 3J81j 1SV5A 2QLJB 1X9WA 5IS2A 3PX0A 3PO5A 4WTYA 3MTKA 1O0PA 1AFJA 1RWUA 4B9MA 3HSGA 5LJ5Y 4N7TA 1WC3A 1HNXF 2UUAJ 1KN6A 1KHVA 4LSNA 3HPOA 2R8KA 2A3JA 1MMDA 2JL9A 2OO4A 3BSNA 2V68A 3IWLA 1DFDA 2QRRA 2V8PA 5KFKA 1HWJA 4NI2B 3JYTB 1TK5A 4DQIA 1U1KA 3NXZA 4PWUA 5DQHA 1Q5VA 2I0XA 2AYMA 2E5GA 1D09B 3ET6B 5AJ3J 2Y0BB 1RTDB 3QMQA 1K9MT 1APSA 1PIEA 2KZZA 3MM8A 3KHHA 5BR8J 4M5NA 2PT0A 2C2EA 2DHAA 1UP1A 2KG1A 4TU7A 2ZDOA 2C2DA 1U1QA 1AZSB 3V4MA 2HHHF 1MROB 4ZVPB 3TW0A 5AE1A 1SC1B 4Y28C 1U1RA 1ZPWX 3J7A1 4W98A 4IKAA 4LBPA 4DR2J 5DG9A 3FSIA 5LJ3Y 2OSRA 1QJHA 1D9DA 2XHCA 4QBUA 3MFIA 3D1QA 1RU2A 1B0PA 3J7ZT 3IR7B 2AP6A 2OH2A 2EK6A 3IGVA 4OZLA 3G6ES 4ZJQA 3MM5A 3S01A 1RT7B 1LWFA 1RUSA 4PEOA 1UFKA 3JSBA 1U45A 3BGOP 5J1EB 2OAUA 4H54A 2DNKA 2HBRB 1W2IA 5BYRA 2YKNB 3PW7A 4RJVA 2RU9A 2DCUB 2HZAA 1U0SA 1YJ7A 2YNHA 2BE7D 4CDIA 2JX2A 2E5JA 3IN5A 3I56S 3PW4A 2Y0SD 1YGYA 2ZZTA 4FPRA 4BDPA 3E8OA 1FD2A 2LU1A 2N3LA 1TL4A 4ZVRB 5LSOA 3S1TA 4YY3J 4OIXA 4HR2A 1C0UA 4CO1A 1HQEA 1CQMA 5K14B 1YJNS 1S9EB 4DF4A 2JSXA 3FMBA 2MQQA 3MAAB 3HFZB 1RP5A 2ZH7A 4X84A 3CCSS 2KXFA 3H4BA 2B8QA 1NHUA 3H40A 2MKSA 1C1BA 4FZVA 5J2PB 3QJPA 4A46A 3D0IE 2SXLA 4K4ZA 1KQKA 3CTRA 4R0JA 4PPDA 5KOXA 2DHXA 2F8EX 3CJ0A 2FZKB 3T5JA 2GJIA 2KFZA 1V3SA 3ISNC 3CXCR 2P9GA 3N5BA 2Q66A 1RT3B 3RW7A 4P2FA 2W2PP 1XMBA 2J8SA 3CJQA 1HD0A 4B3OA 1WC5A 1HR0F 2FYXA 1OQ6A 1FK9A 4J9VA 1KFSA 3WDOA 2OIHA 2QG9B 3M1VA 2FLPA 2YWEA 1ROFA 1T05A 3HI9A 2AEFA 3V81A 2QN6B 4LF4F 4ZN1A 4WFNQ 4K0KF 3GR1A 3OFEA 2AV5A 5ETNA 1R0AB 4OV6A 3AJ1A 2UXBF 4OYIA 4LQ9A 1HI8A 2MXYA 1QAYA 4ECZA 3CO0P 3W7BA 3AODA 4MK8A 3QZ7A 2DXFA 2KRRA 2DR8A 2Q3PA 2IVFB 2KTQA 1UKUA 3DI6A 3BBBA 3DRSA 1OQ3A 4Q0BB 1XN9A 2GMJA 2EKNA 4CH1A 1PAUB 4KGZB 2VA3A 2B6AB 2OP5A 3EVOA 3VZHA 1R8HA 4JI4J 4DV4J 1AUSL 5EWEA 4MKBA 1HLWA 3S7RA 3L7PA 5HANA 2DY9A 2QE5A 5D0GA 5GVQA 5HN0A 2B4OA 3UO0A 4HL9A 4M5DA 3OVSA 2HKEA 2L41A 2FGOA 2HK2A 2YWKA 3OVAA 2R7OA 4ECWA 3BPDA 2FDNA 2BM0A 1X4HA 2VHGA 2QGFB 4I64A 3KHGA 3DKDA 2AT1B 3HDSA 5A6WA 4C8OA 4WFZA 4ED7A 3N6LA 3F41A 4YFUA 1MWQA 2QO3A 2YKOA 4Q8EA 5B0AA 4DV2J 3HK2A 4N5SA 1RWNB 2AJ0A 3DOMA 4JV2A 2XSJA 2Q43A 1EX8A 2FQQB 3GSDA 3AFGA 1JLCA 3BDPA 4UQTA 3LWMA 3G87A 1U02A 3KUEA 2CPDA 3IC1A 4AL5A 1FNXH 2YKPA 3L9ZA 1GMWA 2HHVA 3GIMA 3TUZC 2IBKA 1MU2A 1HNIA 5J2QB 3Q8UA 2MJNA 2VQEF 4IQXA 2D3UA 4I1TA 2OD6A 4USTA 2K2PA 1YX2A 1S4EA 3KJQB 4ZP6A 3MCSA 3RB6A 2FVQA 4DMZA 3OR2B 3H2UB 1NK7A 1RWXB 2DISA 2EFOA 4R8UB 2E44A 2MKYA 2CQ4A 4HHJA 4MYUA 2DT9A 4MH8A 5CA5A 1UW9A 2W24A 1Q86T 3PY8A 2EFGA 4C2MA 5ETMA 2RUSA 5I42A 2NXCA 3VGTA 3KFWX 4NCBA 3QT8A 5LM7E 1UPMB 4ANEA 2BR0A 1TKXA 2HZCA 3H2VE 1UAWA 1LXJA 3QSYB 2NZCA 4JP8A 3TP2A 3JAMY 3KNGA 2PN6A 1X4GA 2HWTA 1RAFB 3BPSP 4O4RA 4M94A 3MM7B 2UU9J 2RDJA 2IA6A 1O51A 3FK4A 2MQOA 2XS7A 4C6AA 3F0NA 3M32A 2WZ1A 1F2GA 1RU1A 2BQ3A 1S10A 5HMWA 3ZZPA 5L1LA 3OR1A 2RIJA 3D28A 3RAQA 3OUYB 5KFHA 2DKOB 4Y2IA 5D4NA 1TQLA 1IQTA 2CXEA 4DR3J 4GKJF 4OX7A 3W62A 1BUXA 2FJBB 2HRYA 4DFKA 2EFNA 2O1PA 4LSZB 2ZM6F 3R7BB 3ZZUA 1RHRB 2AGPA 1IM4A 4C8LA 2VG5B 2GNKA 4CLWA 1ZZFA 1YZ7A 1RI7A 1ZAXA 2V67A 3R5GA 1VBKA 4ZS6A 4LR7A 3T5KA 2I8EA 2V50A 2BX6A 4IFVB 2QLBB 2VDHA 4X66F 2WSCC 5KFFA 1YJUA 2W9CB 1HHQA 1FRJA 3IXQA 5B0DA 2ASJA 1TKZB 4NWBA 4ECVA 5GADU 3VAMA 5IT0A 4I69A 1KC8T 4O3SA 2FLLA 1D8ZA 4PYAA 2HLUA 1CULA 1KKHA 4OFZA 4ZCKA 4DPUA 1M90T 2APOA 1ICEB 2Z56B 1Q82T 2XLJA 2NXUA 1DLOB 2QA4G 4F50A 3B54A 2KKHA 3HLUA 2E1AA 1WJ9A 3TOQA 2XC9A 1XMOJ 4DJBA 1F2HA 1T11A 5HVHA 4NE9C 4X2BA 3I96A 3JAMU 4QU6A 4Z7YA 2J8AA 1NNDA 3ZC4A 3MM8B 4CZCA 1DQ9A 2DNZA 1RTHA 1SKWA 4DL0C 4C3MA 3R7NB 2UZAA 4R5PB 3TARA 2X1AA 1VQ7S 3RB3A 1T03B 5D8HB 1SVDA 3L95X 7AT1B 3TUJC 4X4QA 4FXDA 2VODA 2UVUA 2BABA 4NLXA 1IVZA 1TP7A 1TL1A 3VAHA 5KFQA 1C0TB 1LK5A 1Q53A 1SH2A 1VBZA 2L48A 4LF8F 1NPRA 2OGUA 4NPOA 4ED3A 3HSZA 5KFMA 3CEDA 2R7SA 3MM5B 1Z2LA 4NEZA 2Z58B 4V19X 2I38A 1IBMJ 2BYCA 4N56A 2BRKA 1H72C 3ETOA 5E2QA 2LEPA 1AXQA 3CCRS 4JI2J 4CT8A 1AFIA 1TUWA 1TMJA 2CPXA 3LP2A 1UEVA 1N5SA 3N5FA 1HWUA 1SC6A 2R7XA 4PG6A 4FS2A 3UD4P 2FLOA 2CQ1A 1RWMB 3CDEA 2JWNA 3EXCX 2MZRA 2V9KA 2WW4A 4JI6F 1PJ7A 2AEJA 5KG2A 3MF5A 3TEGA 3MR2A 4NYOA 1SJFA 3KDOA 2GIQA 3KJNB 3K5OA 4B9SA 3IWXA 1WTBA 3JTOA 1VHIA 3WC0A 5IFMA 2GJFA 4TKTA 1AB8A 3TJ8A 2BKOA 2GQ2A 4DQRA 2DPIA 1NHKL 2LXIA 1UVIA 3BQ2A 1TR0A 1XMQJ 2V63A 2KT2A 1YZ6A 3MURP 3T5HA 3DU5A 3QLHB 4ZLNA 4CNZA 5C25A 3D6MB 4Z2XA 1NRKA 2P9CA 1SQFA 1R6YA 4QR0A 3AHPA 4ECUA 4RWWA 2ZBRA 4QIEA 2O3DA 3A13A 2MGZA 1HPZA 1M1HA 2ASLA 3OTDA 1D9FA 4FS1A 3UFCX 3I87A 3KNAA 3ILJA 1CJTA 4NZ6A 2QIFA 1FX4A 2JNJA 5HAOA 1U1LA 3MUTP 4OHXA 1U25A 4EYIB 2JEGA 1LOUA 4M5KA 4YB6A 2VV5A 5KOWA 1S0OA 3P3DA 2F4VF 4KR0B 4IR1A 3I0SA 1F0XA 1NK9A 1UEUA 4XAKA 4PXEA 4GO7X 3A1YG 1YRXA 1VR6A 3NGRA 1JNRB 2VG6A 1HBUA 3NRBA 4K4UA 1T05B 2C2NA 3CCES 1IWGA 4X64F 3HHNB 3QRRA 3CCLS 3KTQA 3GV5B 3X1LB 3UW1A 4ZCMA 2R8GA 4OX8A 4RUCA 1FCAA 3KHLA 3QAEA 3CD5A 2BOAA 4ZKAA 4Z7CA 1QE1A 4IOAQ 1WF1A 2IHR1 4CWBA 1J5EJ 3NKYA 3W3SA 1DHMA 3JSMB 4B3MF 4DUTA 2IMOA 2NR0A 2HGNA 4YDXA 4CI0B 5DDOC 5IQQA 2I5JA 1S57A 4DV1F 2P5VA 2B0GA 5HO4A 2FJWA 3KLIB 1YG0A 2POKA 2AJQA 2IM1A 2M2BA 4M5DB 3NY0A 4TXSA 2H3EB 3M4XA 4C8YA 4P75A 3UCUP 1QY7A 2AQ4A 3FKBA 4S0MA 1RCOB 2QT7A 4NA3A 2ZE2A 4KFBA 1I94J 2AW0A 4ZIVA 1PBAA 2YH1A 4C8NA 3QO9A 1RJJA 1IKWB 2AGOA 2XSJB 4CRJA 2EPIA 1YVFA 4OHVA 5KG4A 4YY3F 1PAEX 2FZCB 3MECB 3DLKA 2RQ4A 1JLCB 3KLEA 3TUIC 3F44A 3L09A 3D5MA 3CJTA 3OFHA 4KE5A 4P74A 2MYFA 4LRBA 2HHTA 1HNIB 2M7SA 3FEZA 1IBLF 1SB6A 2E29A 5G0RA 1QAXA 1Q1KA 3IP0A 2CJBA 3KLHA 2IJRA 1RTZA 3TZWA 4I2PB 5F0UA 2AX1A 2LXUA 2RS2A 3TRGA 4QIWD 3Q2SC 2G0JA 3GU0A 4FYWB 4DCJB 4NOHA 3H4DA 4H4MA 1J2VA 4ZLPA 4ECSA 2ZBQA 4RR5A 4RL1A 1EAYC 2P6TA 2UUCJ 4OI1A 1IBCB 3ETMA 2B43A 4NLSA 2DH8A 1NDLA 3MDFA 3OTOF 2OPRA 1Z4UA 2GAGC 2N7CA 2GZOA 1QUVA 3G9CA 3HO1A 3UI3A 4B3TJ 4AFFA 1J27A 1MN9A 4DUZF 4ILMA 1FEEA 1TKXB 4XPEA 2HFZA 2LCWA 1TMMA 3W63A 1N5YA 5LMNF 4U8YA 1CC7A 3EZOA 2HLTA 1ZS6A 3M2UA 2YNIB 3AJ2A 5D3GB 1FVSA 2DIUA 2AZ1A 3QZ8A 4KO0B 2QZ8A 2XS5A 1XNQJ 3M32B 5BYSA 1K1SA 4L74A 4IFYA 3SV3A 3OR1B 3MD1A 4Q5VA 1T9WA 4YDDB 2A1BA 4RPFA 3QJLA 1HFEL 2B9XA 2C2ZB 1WF0A 4NCAA 3I9ZA 3LTOA 1JXLA 2RILA 1R0CB 4URQU 4CLUA 3QIDA 1CS4A 3ENWA 1GEHA 4Y6IA 3HZGA 2M0GB 1AUDA 1KVJA 2VBXA 1FRMA 3FNNA 3PV8A 1NDCA 3BBCA 1NSQA 3C46A 5H1SV 2F63A 4LRAA 5C42A 1R7IA 4DPXA 1VQ5S 1E6YA 3A8JA 1U6ZA 2DHHA 2D3ZA 4K50A 4G1QB 2E1PA 3ISND 2FC8A 2HQ3A 5K9FA 4Y3CA 1HBOA 4UOHA 3MWBA 1WC6A 5FD1A 2HURA 3I5AA 2WK4A 2H1YA 2WW8A 3ZTRA 3LANA 5E3RA 3RBZA 1LFWA 3EPIA 3KHRA 5D4LA 4W4MA 3D0GE 4F4ZA 1BGXT 4M5JA 5CYQA 5L39A 3PO4A 4U7UK 1QLNA 5D0EA 4ZHRA 3JTNA 3PIOQ 2XO6A 4A8SA 1Q7YT 2HBZB 3MEEB 1B0VA 4MFBB 1RT4A 1CPZA 4IH5A 1X4DA 5D4PA 2XMMA 2VBZA 1VMBA 2W4CA 4OV1A 4K2JA 3NCPA 2EFQA 2WB1D 3C19A 3PJXA 3LPYA 1R0BG 4RU9A 4Z37A 2CQIA 5K8NA 5DGAA 4J9SA 2D41A 5CCMA 2RRBA 1BE4A 1WHWA 1WF2A 2C3MA 3L3CA 2DNQA 2ZHOA 4IDKB 4TY8A 2DNYA 1KTQA 5H9EK 3HHLD 5JVGQ 1N0VC 4F3MA 2R9LA 4C98A 2KM8B 3GYNA 2ZUGA 4F02A 3M9NB 5HK4A 2LEBA 3PEJA 3HSJA 2Z4PA 2JOQA 2F9JA 3AT1B 1QSYA 2VKZG 1V3ZA 5L9XA 1LW2A 3K2YA 5F8IA 2IJNA 3LAMA 4UOGA 1QAJA 3GIIA 3D4JA 4K2XA 3Q0AA 1S9GA 1HBNA 4DR6J 1WG4A 2W7AA 3TJAA 2Y9HA 4DSJA 4P2MA 2GCFA 5HVFA 3R6LB 2OPSB 4USWA 4OZNA 3D9BA 4WK3A 1NK6A 1OSCA 4I6YA 3I4PA 1GK8A 1V5VA 3ITHA 2FJVA 5F3TA 1Y00A 1N4LA 3BGRA 5IV4A 1ZAWA 4LF5J 4UW2A 5DS7A 4LBIA 4FKYA 4USVA 1BQNB 4OI2A 1UA0A 3G6VA 4DSFA 4CNYA 4WKYA 2MZTA 3MMCB 4KV8B 6FD1A 2BJ7A 2A18A 1VJQA 4HACB 1WI6A 1WWHA 2KL8A 2XULA 2IM0A 3CCVS 2ZH6A 5C25B 2H65B 3PKYA 1EZZB 4RNOA 2UVWA 1R89A 3KJVB 3JSYA 2HS4A 2YWHA 3NEKA 1VRTA 4PR6A 1Q4RA 3E01B 3A8KA 1M5VC 2M4MA 3OFGA 2Q79A 1VDHA 4A47A 5FLXY 2HNDA 3UQSA 2ZOFA 2MHNA 2KVIA 2B5JB 1SKRA 2A10A 4PG8A 1T95A 2R7RA 2Z0GA 3G96A 3PDNA 4LF9J 5EWGA 3IR5B 1T02A 4DEZA 2ZD1B
chains in the Genus database with same CATH topology
4O44B 3DRXA 4XDCA 4MK9A 4YB5A 3CUNA 2UUBF 4GKKF 2N4CA 1FD8A 1WD6A 2G1DA 1EETA 2YQ3A 3R3TA 1UVLA 3PRBA 2GHPA 4IRDA 3GR0A 3Q8QB 3Q24A 2KB2A 3PR5B 4IG0B 1RKJA 2VG7B 5A6PA 1D9AA 4C7QA 3R5BA 2OMOA 3NP5A 4YMEA 1SV5A 3DNCA 2X1BA 5SZTA 1FJ7A 1X9WA 5IS2A 1BQMB 4MK7A 5HL7Q 3T1HF 2BBEA 3PX0A 4JBCA 5D4OA 3NMAA 1YJ9S 3PO5A 2DITA 3NWGA 4WTYA 3MTKA 1R3NA 4KHRA 5I3QA 5A2QY 1O0PA 1AFJA 4WU3A 1RWUA 3DFEA 4B9MA 4KIAA 2HGMA 3BSCA 5LJ5Y 3J7Z5 3PW5A 2AF6A 1MU2B 2J0SD 3T5LA 4Y0FA 2GC8A 4X62F 2YNIA 2FLNA 1KNZA 1HNXF 4ECQA 1WEXA 3CVKA 4C11A 1KN6A 2F7VA 1KHVA 2XO7A 2DNRA 4LSNA 2AX0A 5D3GA 5E33A 3HPOA 3BREA 2R8KA 2A3JA 2MHEA 3T1YF 3RAMA 1MMDA 2JL9A 1SH3A 2OO4A 3KG1A 4KO0A 3BSNA 4K4VA 2IA0A 1ZOTA 3IWLA 3V4IB 2QRRA 1DFDA 4QWBA 4ZCIA 2L3MA 5KFKA 1HWJA 3JYTB 1S1XB 1TK5A 1DQAA 2OPPB 4DQIA 1U1KA 3C6TA 2VPZB 3F56A 4PWUA 5AXMA 2ACYA 3V6HA 1QSSA 3TI0A 1HBMA 1ZM4A 5DQHA 1DTTB 2HG4A 2LEAA 1FDDA 1N56A 3IO1A 2I0XA 1U1NA 3M6UA 2AYMA 2E5GA 4IOCQ 1Z2ZA 2DJWA 1IBMF 4H4KA 4DL7A 3OJUA 1KOOA 2IRYA 4WYLA 3POTA 2YKQA 2PGCA 1RDRA 1HI0P 4FVMA 3FRZA 5I3UA 1TVRB 3QMQA 1RTDB 2J5AA 4KHMA 4RW7B 1K9MT 4USJC 4LVNP 4JI2F 1KD1T 1APSA 1RKIA 2KZZA 3MM8A 1VS3A 4QWDA 3KHHA 5F3ZA 4CCHA 4Q8FA 1M1KT 5B0EA 1KONA 3LO3A 2PT0A 3DLGA 3P49B 3SSRA 2C2EA 2NUHA 3MEGB 3CCMS 2E9ZA 4NXMF 2DHAA 4DUYF 1UP1A 4F4YA 3NBPA 2KG1A 2V94A 5I42B 4TU7A 2V4QA 2ZDOA 2C2DA 1U1QA 3FSXA 3SFGA 4F25A 3BB5A 3V4MA 2LQ9A 3SXLA 1NJXA 2HHHF 1MROB 4I6AA 3TW0A 4KC5A 5AE1A 2C3UA 3MMBB 3B82A 4Y28C 4RNHA 4U6PA 1U1RA 4FF2A 5CYMA 5DDRC 4JI8F 1ZPWX 2ZOGA 5KFCA 1RTJA 1Y5IB 3J7A1 1XNRF 4IKAA 5A8WB 2ZC4A 1UVMA 2ADBA 2XLIA 2NS1B 3CCQS 1TKTB 5DG9A 5CD4H 3R1LA 1R8AA 1IBKF 3FSIA 5LJ3Y 4X4TA 2OSRA 2ZJPQ 3CJ4A 1QJHA 1HMVB 3DLKB 3HHLB 2DH7A 4Q2MA 1S6PA 4Y2CA 1FRLA 1TV6A 5AXKA 1D9DA 1CVJA 2DNPA 3U1MA 4G1QA 1N33F 1B7FA 3EGZA 2R7TA 4QBUA 2MZSA 1K73T 2MQLA 2OTLS 4DFPA 3MFIA 3CPWR 2CYYA 3D1QA 3TO8A 2AGQA 1B0PA 3J7ZT 1RGVA 1YJVA 3IR7B 2VONA 2AP6A 2OH2A 4KQZA 4OMFG 4OZ1A 4B9UA 2XLKA 1R31A 3FGVA 1FE0A 2FPHX 1SIWB 2EK6A 3IRWP 1FTCA 4URSA 3IGVA 1JLQB 3OJSA 4DL5A 2DTJA 4OHWA 4OZLA 4RW4B 2JVRA 4FBUA 4OLOA 4TU8A 1E6VA 4C0BA 2E9RX 3G6ES 4NLRA 3MM5A 1FRKA 2WRMA 4DV3F 4MMOA 1NU4A 2J9EA 3S01A 4B9LA 4RZRA 4I6WA 2V9WA 4IG3A 2FHMA 1RT7B 1LWFA 3EGNA 2XB2D 3V5RA 4YQWA 2W9BB 2KFNA 3JSBA 1U45A 1R27B 4AUKA 3QPIA 2FIUA 2F40A 3Q23A 3CCUS 2DGWA 5J1EB 4K59A 1WG5A 2OAUA 1KLNA 1P6TA 4WE1A 5KFGA 1U1OA 2FY1A 1QVFR 2GFFA 4H54A 4JI4F 2DNKA 4DV4F 1DBDA 1PILA 3OQ2A 1HQUB 4AYBD 2IVMA 1W2IA 5BYRA 4J9OA 1PSDA 1DARA 4ZPTR 1U49A 2YKNB 3PW7A 3GIJA 2RU9A 3G8TA 7FD1A 4IRKA 2Q6BA 4HTIA 4DS4A 2DCUB 2F1FA 2YNHA 4FN5A 2FHJD 3AA8A 3MEEA 4E0DA 4MFBA 2DGSA 2JX2A 1NAQA 5J2MB 5L1JA 1HL6A 2E5JA 3IN5A 1UWBA 1BWEA 3DM2A 1VBXA 2MSSA 3I56S 3PW4A 1WTFA 2OFHX 3OTEA 4FNIA 2ZC3A 2Y0SD 1YGYA 3HF5A 4FPRA 4DS5A 4BDPA 5C24B 3E8OA 1FD2A 2LU1A 5D77A 4B08A 4RNFA 2N3LA 1TL4A 3O44A 1C4CA 3B4MA 1OSDA 5LSOA 5EGYA 5DDPC 1DRZA 4KPYA 3S1TA 2M70A 4ZP8A 3RYLA 5GMKa 3L7OA 2YWFA 3MM9A 4OIXA 2HNZA 3KLVA 3PIPQ 2A2CA 4LSLB 3FCHA 3FMWA 4QR2A 5DQIA 1VK3A 4TLQA 1C0UA 1RT5B 3NCQA 3QYYA 1HQEA 1NH7A 4HEA9 1LKZA 1CQMA 4CO1A 4DV2F 3BGUA 5K14B 3C3LA 1YJNS 1S9EB 4DF4A 4DG1B 1Z1ZA 2JSXA 2HMIA 2ATLA 3MI7X 3FMBA 2FUG9 3NNAA 4OHYA 1K8AT 2MQQA 5KFLA 1KLMB 3OL7A 3H98A 1RP5A 4WFYA 2RSQA 2ZH7A 4X84A 3CCSS 4N76A 2KXFA 4EYHB 3FQLA 1GX6A 4OZ5A 3H4BA 1VQLS 2IAJB 4BCAA 4IDKA 1NHUA 5A8KA 1FRHA 3H40A 2EBEA 2MKSA 5DLGA 3RR7A 4TQRA 4HTJA 3OV7A 1C1BA 1TL5A 5MLCV 4FZVA 2YKMA 2R2RA 5F8NA 2CQ3A 5J2PB 2UUTA 3QJPA 4MIAA 4A46A 3D0IE 2SXLA 3KK2A 2M3DA 3BSAA 4K4ZA 2VC1A 5KT2A 1GXUA 2EK1A 1TFWA 1KQKA 3CTRA 4R0JA 1JWWA 3UCZP 4PPDA 5KOXA 2CQCA 2DHXA 4QZVB 3VCDA 3RB4A 3JB9k 4TU9A 4YB7A 1FDNA 2XEXA 1N48A 2HS3A 5B0FA 2F8EX 3KYLA 3H2LA 4ES2A 3QIPA 3CJ0A 4NLDA 1HNVA 5LT5A 1B64A 1Y3JA 4X4NA 4DPOA 3T5JA 1KSPA 4IUFA 2GJIA 2NSCA 2RE1A 2KFZA 1HNWF 2G4BA 1N0UA 4CO5A 1Y9OA 5L8RC 1J5EF 1V3SA 3M8QA 4NCGB 5FDLB 1LWEA 2IRUA 3I31A 4ERDA 1DURA 3ISNC 3CXCR 4O4GB 1S6QB 2JDJA 3I55S 1S99A 2BW2A 5F0WA 2P9GA 3N5BA 4ICLB 2CPZA 5F41A 2RKIA 2Q66A 2XHWA 1H7XA 2RF2B 4KSEB 1VBYA 2GQQA 1CLFA 1RT3B 3RW7A 2OTJS 2BUNA 2CKWA 2N3OA 4O23A 4OX6A 2PFFB 3K7RA 1KEKA 2K3IA 1XMBA 5A0YB 1RTHB 4M63A 3IGNA 1HD0A 2OLWA 1N6QB 4Q45A 1S9FA 4B3OA 1HR0F 1KVIA 4F4KA 3CJKB 1OQ6A 1FK9A 3FZ2A 2O67A 2OPSA 5L1KA 3W2VA 1KFSA 4QOTA 2YNGB 3WDOA 2MJUA 2W9AA 2NPIA 3N9UC 1SQEA 1SL1A 2OIHA 1QVGR 3M1VA 1N88A 3DYAB 3AY0A 3V6DA 5HLFB 2FLPA 2YWEA 2DRBA 1ROFA 2QSFA 3FRYA 3JSRA 3SCLE 1UMJA 3HI9A 4EO6A 3PZPA 1T05A 3GG0A 1NKCA 2NZ4A 1FJCA 1X4FA 1FEHA 2VB6A 4USIA 3V81A 4OJ3A 2B9WA 4LF4F 4DWIA 1H7WA 5C42B 5IM0B 2VC0A 4WFNQ 2MSTA 2KHDA 4CO4A 4K0KF 2XNRA 3GR1A 3IG1A 3OFEA 2C3OA 2AV5A 3HMJG 3QAUA 1VC0A 1IR0A 1BQNA 4ZCLA 4TN2A 4LUBA 3IS9B 3GZ7A 4OLPA 1H2VZ 1S1TA