1O0PA

Solution structure of the third rna recognition motif (rrm) of u2af65 in complex with an n-terminal sf1 peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
104
structure length
104
Chain Sequence
GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Splicing factor U2AF 65 kDa subunit
publication title Structural Basis for the molecular recognition between human splicing factors U2AF65 and SF1/mBBP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 16
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1o0pA00
1X5PA 2KVIA 4UY8T 1VQ9S 2MY7A 3B4DA 4C7QA 2M2BA 1WI6A 3CC7S 2DISA 3UCUP 1VQLS 2CQ4A 1O0PA 3UCGA 2LECA 3RW6A 1UFWA 1WHVA 2DHGA 1R8PA 3MD3A 2YKAA 1ZZFA 3Q2SC 4PKDB 1L3KA 2KN4A 2BZ2A 2MJNA 2MZSA 1HD1A 2J0QD 1VQNS 1WHWA 2MKKA 3CMAS 3S6EA 2U2FA 2DITA 1Q86T 4LJMA 4UQTA 3NS5A 4OZ1A 4CH1A 2OIHA 1YIJS 3THTA 1H6KX 1U1KA 3G4SS 1PO6A 1VQOS 1AUDA 1DRZA 4BS2A 3ULHA 2RU3A 2G0CA 1SJRA 1SJFA 2DNHA 3CXCR 2LMIA 1KOHA 2I2YA 3RW7A 1X0FA 3CC4S 5IFMA 2CQ1A 2DNKA 1X4EA 1WI8A 2CQ2A 2DH8A 1UAWA 1X4FA 1FT8A 2XB2D 1OIAA 4PR6A 1OPIA 5DM6Q 1KOOA 3R27A 2KH9A 1VQ8S 3G8TA 2QFJA 4QU6A 1VQPS 5LXRA 3MUVP 2NLWA 4EGLA 2GHPA 2J8AA 2LCWA 1M5PC 2DNPA 4LMZA 4C0OC 3H2UB 4TLQA 1WWHA 2DO4A 3EGNA 1M90T 1JJ4A 2XNRA 2DH7A 4M5DB 2CPFA 2RQ4A 2V94A 2MKIA 3BO2A 2DIVA 2E5IA 2CQBA 1Q82T 3S01A 2L9WA 1VQ5S 2VOOA 4IOCQ 2GO9A 5EN1A 3CPWR 2Q79A 2MQOA 4TU7A 2RRAA 2FY1A 2KXHA 1HA1A 1VQ7S 1VBXA 4F26A 5GVQA 2CQGA 1RKJA 1P1TA 1FNXH 1KQSR 2U1AA 1N54B 3CCES 1JMTA 1A9NB 2KFYA 3CCMS 5ITHA 1YI2S 4RU2A 2KG0A 2DNMA 1VBZA 1FXLA 4F25A 2MGZB 2XS5A 1QM9A 1YTYA 2MKCA 5GAGU 5DDOC 3NNCA 5DETA 1X4HA 2CPXA 2O3DA 5H1SV 2DGSA 2MQQA 3CCRS 1UP1A 5IQQA 1WHXA 1X4CA 2CPZA 3PIPQ 2JVOA 5DDPC 2MZRA 3CC2S 1VQKS 2CQCA 3CTRA 2XSFA 2AYEA 4P6QA 1SXLA 1H2UX 2MSSA 2KRBA 3P49B 3J7ZT 2NZ4A 2DGVA 1S79A 2J76E 4LIRA 2DGXA 2LA4A 3LPYA 2SXLA 1U1RA 2ZJRQ 1WEYA 1S72S 2DNRA 2X1GA 2MPUA 2YWKA 3R1LA 3NS6A 1U1QA 2DH9A 3S7RA 3MOJB 5CXTA 1K9MT 1Q7YT 1WF1A 2G4BA 2MY8A 2CQHA 1X4GA 3S8SA 1KC8T 1U1LA 4TU9A 1N52B 3VAGA 5DDRC 1YITS 1VC6A 4Y00A 4YUDA 2F9JA 3I56S 1U1NA 2QEXS 3VAJA 1M5OC 2AYBA 1WEXA 1U1MA 4CQ1A 4Z2XA 5LJ3Y 4QQBA 2VONA 1K8AT 1U6BA 1WEZA 1U1OA 2RQCA 1IQTA 3OW2R 2FHOB 3SMZA 4WKRA 2LXIA 2HZCA 4ED5A 2DNYA 1BY9A 5LSOA 2DNOA 2RVJA 5GMKa 2FPHX 1X4DA 2AYMA 2HYIB 2MKSA 2KYXA 2CQIA 2E5JA 2MKJA 3SDEA 5CA5A 4FXVA 2MMYA 1R8HA 2CPDA 3TYTA 5LSLA 1VQMS 2G1DA 5CYJA 1ZZNA 2L08A 2BOPA 1B7FA 2D9PA 2KM8C 2DGUA 5D78A 1K73T 3U1LA 3EX7B 2LA6A 3P3DA 2DB1A 2K3KA 3Q2TC 2DGTA 2DHSA 2DHXA 1U6FA 2RNEA 2A3JA 2ADCA 3DLLQ 2M8HA 3HI9A 1WF0A 2N7CA 1HD0A 4PRFA 2LYVA 1P27B 2PEHA 3EGZA 2M4MA 3G71S 5IM0B 1Q81T 2CPHA 4C4WA 3HHNB 2CQ3A 2DIUA 4FXWA 4WF9Q 2YTCA 5MLCV 2MZQA 1N8RT 1VC5A 3VAKA 3J7YU 3ZZYA 2FC9A 1X5OA 1U1PA 3UD3P 5JVGQ 3P6YC 1W2BR 3CULA 1UW4A 1X4BA 2MXYA 2MZTA 4A8XA 2M0GB 3I55S 2MKHA 2UP1A 2HGLA 3V4MA 1JJ2R 5BJRA 3VAMA 4CIOA 2M70A 4WCEQ 5HO4A 2DGQA 1OWXA 3MURP 2RS8A 3VAIA 2XS7A 1WG1A 4IO9Q 2CPEA 1SJ4P 3VAFA 1WELA 2M7SA 2OTLS 4OZ0A 2MQPA 3FEXB 2OTJS 3U1MA 3CD6S 3CCSS 1G2EA 2JWNA 2MQMA 1WG5A 3UWTA 1YHQS 2HVZA 1QVFR 2B0GA 3K0JA 2OSRA 1SJ3P 2DNGA 2DNZA 3NMRA 2J0SD 2HGNA 2L41A 1JJHA 1YJNS 1X4AA 2KXNB 2CQDA 1DBDA 4WIIA 3UCZP 3NNAA 2F9DA 2CPJA 3BEGB 2MZ1A 3B4MA 2VODA 4IUFA 2YH1A 2RT3A 3ZZZA 3L3CA 2DNQA 5LXYA 1YJ9S 2KI2A 3MUMP 3MI7X 4YB1P 5LJ5Y 3N9UC 3VALA 2MHNA 2DHAA 3G96A 3BO3A 5DM7Q 3US5A 1M5KC 4YOEA 1OO0B 2AYGA 4W90B 3VF0B 1N88A 4WFBQ 1FHTA 2JX2A 1VQ4S 3UE2A 2PE8A 2QA4S 2N82B 2CPYA 2LEBA 3NNHA 3MDFA 2CJKA 2MQNA 2E5HA 2X1FA 1FO1A 3IRWP 2RUGA 2XNQA 4WFAQ 2X1BA 1CVJA 1PGZA 2DNNA 2D3OR 4F02A 2AD9A 3TO8A 1VC0A 2VOPA 2M88A 1KD1T 3DXBA 3CCJS 2DGWA 2ERRA 1F9FA 1X5TA 2FC8A 4J5OA 3CCUS 4V19X 2LEAA 2LXUA 3G8SA 2CQPA 2M52A 2D9OA 2X1AA 4W92B 2ZJPQ 4WFNQ 2JVRA 5DDQC 5FJ4A 3VAHA 3SDEB 2MQLA 5IM0A 3D2WA 1VBYA 2N3LA 2RS2A 5JVHQ 2MSTA 1NJIT 1VQ6S 4TU8A 3PIOQ 1NO8A 3MUTP 1WTBA 3CMES 1FJCA 1DZ5A 5GADU 2EK6A 5GAHU 2CQ0A 2KHCA 2E44A 2KM8B 4Y0FA 5HL7Q 2KG1A 3SXLA 2MGZA 2OSQA 3BO4A 1WHYA 2M8DB 4U67Q 1SJQA 3G6ES 2K8GA 3JB9k 4CH0S 1DHMA 4ZKAA 1D9AA 3CCQS 1QVGR 3TP2A 2HGMA 2KT5A 3CUNA 2MJUA 2DK2A 2M9KA 4ERDA 1D8ZA 1U2FA 3FEYB 1HL6A 3UD4P 1M1KT 2YH0A 1URNA 3H2VE 4QPTA 3MXHP 2DO0A 2CPIA 1WG4A 2E5GA 3BS9A 5D77A 2ZJQQ 3CF5Q 2KRRA 3G9CA 2EK1A 1X5SA 4IOAQ 1M5VC 1H2TZ 2DGOA 2ADBA 5GAEU 3LQVA 2LKZA 1YWXA 2OJ3A 1WF2A 3CCLS 1ZH5A 2N3OA 2EVZA 4QU7A 1XN9A 2LQ5A 1FJEB 1NU4A 1YJWS 2I38A 2WBRA 2MZJA 2JRSA 3R1HA 3MD1A 2MB0B 1RK8A 2RRBA 1H2VZ 1A7GE 2KXFA 3P5TL 2F3JA 2XS2A 3THPA 3CCVS 2DNLA 2MYFA 3IWNC 2KU7A 1FJ7A
chains in the Genus database with same CATH superfamily
1Q8LA 4F3MA 1S1XA 2DCUB 4O44A 9RUBA 1ZZFA 4CLFA 4AE5A 3BKUA 2QJ3A 4C0HA 2MZSA 1NK5A 2MKKA 1X31C 5D0HA 3ISZA 2V8GA 2HS0A 2EKNA 2FVPA 4PEOA 4RNNA 3WC0A 1DTQA 2XYGB 1PO6A 4IR1A 2C2ZB 2J7KA 3I87A 5BYQA 2I2YA 2B4UA 2VQFF 3ZZ0A 4ES3A 4P2XA 2R7VA 4DBQA 4M5HA 4MIAA 5A2QY 1X4EA 2BKPA 3NEKA 2DH8A 1FT8A 1VR6A 4Z7CA 4N56A 2QFJA 4DV2J 4QBUA 2ZZMA 4NXMJ 3LWMA 2KTQA 2LCWA 3KOAA 4CLZA 3PNIA 3C6UB 3H2UB 3FJ2A 2F4VF 2W9AA 1LOUA 4Y2AA 4ZPCA 1BQMA 4OYWA 2KXHA 2MEWA 2YWEA 2KFYA 1J2VA 4H4OB 2XS5A 1IR2A 3HSZA 4OZJA 1Y0HA 1RWPB 4HHHA 4ZVPB 1BMQB 2MZRA 1S0OA 3JSMB 4DPYA 1TK5A 1SXLA 1SKSA 2HVIA 1HR0J 4OMFG 1C1CB 4A8MP 3EDRB 1XNQF 1EETB 3PKYA 4XIUA 4DV1F 2Q43A 2YWKA 1S10A 3EPGA 2VFSA 2MY8A 1PJ7A 3H2LA 2BRLA 4A46A 1DQ8A 2UUTA 1HYSA 3I56S 2F9JA 5RUBA 3CJTA 5CAAA 4C8YA 1GEHA 1U6BA 3VZHA 1MROB 3DDNA 5B09A 1RCXB 3SQGA 3TUJC 3QAEA 3PX4A 1MMLA 3NY0A 3GFXA 2EFOA 4FYXB 4X62F 1BQNB 2VKRA 3TAPA 1XK8A 3PXGa 2H51B 2W9BB 1ZZNA 2D9PA 4MMOA 1RBLA 3H7HB 1P9YA 5B0AA 1FEEA 4GC6A 1A0OB 1QSSA 2XMAA 4DLGA 1NK9A 2RE1A 1FJGJ 3WDOA 2NCKL 1U02A 2RILA 1I94F 3GR0A 1M0SA 4B3TF 3KTQA 4J9MA 4ZPTR 3CDWA 4G65A 1NXIA 4DL0C 2XGQA 3MURP 4DPTA 2F8MA 1Y5LB 4ZPAA 4DL3A 3BDEA 4YR0A 3MM8B 3DHWC 3HHLC 1BGXT 1CJTB 1CJVA 2P5VA 2J0SD 1S6QA 2ZVSA 3P96A 2F9DA 2VU5A 2XM3A 2PMZD 5D4OA 5LXYA 3V6KA 1V6HA 3HHLD 4YHHJ 1AFIA 4ZPVR 3JSBA 4PYDA 2JX2A 1T02A 2QZ8A 2OO4A 4H4MA 5C5JA 3C14A 4G1QB 1ITPA 1N0VC 3LP1B 2D3OR 4F02A 4CWBA 4CO4A 3FCVA 4ITSA 4C6AA 1NH7A 3IO1A 4B3OB 4J5OA 4EYIB 1B0TA 4M5KA 2D9OA 2BV3A 1VRUB 3FQKA 1VRTB 6AT1B 1U0HB 2BE7D 1RISA 2N3LA 3RR7A 2BW7A 4DR1J 1HBUA 2BM0A 1FJCA 1DZ5A 1EKRA 4USHA 2FGOA 3RAXA 2CADA 2BUNA 2G2ZA 5HMZA 5HL7Q 2KG1A 5BXIA 4JI3F 3W3SA 4OHXA 3KUHA 4BWMA 1D9AA 4USKA 3Q8UA 2XG8A 4TY8B 1S97A 1URNA 1SJ1A 4YMEA 5EDWA 5G0RB 4IR9A 4LR7A 3UI3A 4PWDB 3WX8A 2EVZA 1YZ7A 2LQ5A 3V81B 1SV5B 1TVRA 1AA1B 3HMJG 3OSPA 5DG7A 5GAGI 3MEDA 2GV1A 4DUZJ 4ETXA 4EZ9A 4UZCA 2WSCC 2KU7A 5FIIA 1LWCB 1MG7A 3CC7S 2L3MA 3NWRA 3UCGA 3GIMA 3DLGA 4IRDA 3ITHA 4CO1A 2V69A 3L4BC 4IFVB 5C42A 3AQOA 4HI2A 1HMVA 1YIJS 1H6KX 4IOBA 4TYAA 1JJCB 3KG0A 1PYSB 1WD6A 4J9UE 4X4QA 4ALZA 1IWAA 2HRTA 5KG0A 4EWTA 1NK0A 2C2KB 3MUVP 5HSPA 1BE4A 2HHQA 2DNPA 5CABA 4KGXB 3ZZPA 3SIPB 1JJ4A 2I0XA 2DH7A 2CPFA 2DIVA 1NJXA 2L9WA 1B0VA 2Q79A 2MQOA 4TU7A 5HJXA 2M3DA 1B0PA 1PBUA 2LXFA 5AXMA 4F26A 2C42A 1MWQA 3HVRA 1UA1A 2VPZB 1IWGA 1N5VA 4CLSA 4O3OA 2OHDA 2VICA 2BACA 2NR0A 4DV5J 1T9YA 1ZM9A 2LP4A 2VJVA 1RT3A 3EPIA 1HBMA 3QIDA 5IV3A 1FFGB 3DRSA 2C2EA 2MSSA 5HROA 1Y5IB 3RAMA 3DRRB 4N8OA 2FD2A 4OYPA 2XWXA 1HHTP 2LA4A 4DQIA 5J2QB 3BN4A 3QJJA 1VLOA 1U1QA 1LK5A 1JX4A 3ENQA 3RRGA 1FRIA 2APOA 1Q1KA 2RKIA 2CDQA 1VC6A 2OPRB 3K5NA 4YUDA 4J9OA 1S1WA 4NLSA 3U02A 3EXYA 2WW4A 3D6HB 2UUBJ 2AP6A 1C0TA 3UVJB 3OW2R 3HPOA 3RB4A 2IJFA 4GVBB 1UZDA 3DRPA 1RAEB 5KFSA 2FDNA 3V2UC 3LP0A 1DAXA 2I9SA 2MMYA 1VQMS 3TYTA 1B7FA 1QAYA 1T3NA 3G6YA 1CJKA 3OXGA 3PRDA 4P71A 3PRBA 2I6WA 2B7CB 5HANA 2XC9A 3PW4A 1UJ4A 1N8RT 4K0KF 2FLLA 2FLNA 4CTAB 2MZTA 3HZEA 1GT8A 5CZXA 1PJ6A 2V9KA 2XHWA 2VG7A 3N4WA 4CIOA 3UN3A 2ASDA 3G82B 4O3RA 1DTTB 3KDOA 4EBCA 1ZAVA 2NUUG 3GE9A 1WELA 1HBOA 5D3GB 4WXOA 3C8YA 2UXCJ 1RWMB 4F4KA 3E3XA 2MQMA 5A6PA 3TEHB 2DNGA 3NMRA 4Q0BA 4DSIA 2AW0A 3SV3A 3NNAA 3L7PA 1J5OA 1CQNA 3JSRA 2E5LJ 2VBWA 4YB1P 4KBIA 5M2PA 1RAHB 5DM7Q 3ZC4A 2VQEF 2OAUA 2QSWA 4QOTA 2PA8D 4E98A 4ZDNA 4NLPA 5HK4A 1KKHA 4LSLA 2R4FA 1J5EF 2LQBA 4JI7J 4NE9C 2WSFC 1HNIA 3PEJA 2IDLA 2LEAA 3ZNUA 3L09A 3KJFB 3FBCA 2V4JA 5HATA 2ILYA 4W98A 1X0PA 4PABA 1RT2B 5FJ4A 2YKQA 3A8KA 1NJIT 5D15A 3MUTP 3GV8B 3M32A 2E44A 4Y2CA 4OI4A 2CG8A 2KJWA 3FK4A 1RTDA 3Q8PB 3JB9k 4R0JA 1YRUA 1RT6B 1NB7A 2KT5A 2K7JA 4ERDA 1U2FA 4JI5F 4BBYA 2C2DA 2UU9F 2V8PA 3MXHP 2H1YA 6FDRA 2W8LA 1NAQA 2IAJA 4CLUA 5DQGA 1R6YA 4ZA1A 3LQVA 2HMIA 2LKZA 1L3TA 2N3OA 4TLRA 4NLDA 3UDLA 1FJEB 3I5BA 4J37A 2I38A 3BZQA 2HQGA 1IKVA 2LVWA 4F0HA 2BE2B 1KTQA 1JLQA 1XNRF 4USJC 1U2RA 2DD8S 5ETMA 4RLEA 2DISA 4NL5A 2OPQB 2CQ4A 3OTBA 1O0PA 2YWFA 1R8PA 2DXEA 2WONB 4LBIA 1OMSA 3WIVA 1W25A 4OYXA 2QMXA 1B3TA 1FDNA 3CD0A 4D3HA 2OIHA 1F6TA 1JQGA 3L9ZA 1U1KA 2W24A 3MMAA 3TZYA 3RB0A 3LGNA 4W4MA 3RW7A 4BCAA 2DR9A 4LF2A 1NRKA 2ZH6A 2E9TA 3CJ5A 1W7WA 3E8OA 2MTLA 1U4BA 1P6TA 4A8FA 5KFOA 1JLGB 2ZE2B 2FZKB 3JAMY 1DLOB 2J9EA 2HWHA 2HNYB 1EQMA 1SC1B 4C8OA 4X4SA 1QAXA 2I8EA 4J91A 1A9NB 2RIJA 1GMWA 2FUG9 3CCMS 3J7AN 4GKKJ 3KNAA 3AA9A 2EEYA 3KDNA 2QA2A 2MQQA 2XMJA 1UP1A 1WHXA 1FD8A 1UW9A 2YNFB 1SL1A 3TW0A 2J0XA 4IYQA 2QL9B 3CC2S 4ANEA 5K8NA 1AUSL 3W62A 4N77A 3K5PA 1R0AA 1V3RA 2P9GA 3M1VA 4ILLA 3QIPA 5K8PA 1QD1A 2CJBA 4FKXA 3UFCX 2OFHX 1WF1A 2L48A 1X4GA 3V6HA 4FBUA 2A2CA 1KLMB 2RRNA 2VG5B 2K3IA 3M2VB 1U24A 4EBDA 2ZH5A 1HI8A 2BBEA 5LSOA 4DQSA 1S1VB 2RVJA 1AT1B 3BQ2A 1S9EB 3X1LB 3DYAB 4DV3F 1QE1A 4DHVA 5CA5A 4TYBA 5KFNA 1EKSA 4F4AA 3IRXA 2BKOA 5LSLA 5IT0A 3OLBA 2C22A 2DGUA 3CJKA 5KFEA 2K3KA 4LFCF 2DY1A 5E2QA 1NSKL 1NUEA 5L9XA 1S49A 1SI9A 1HD0A 4Q2MA 1P27B 2DR6A 3KHLA 1M5SA 4F4XA 5L39A 4OHYA 4EBEA 2FC9A 3KYLA 3MTJA 4UUXA 4DX5A 1ZBTA 4HR2A 5BJRA 3H90A 4YS2A 5HO4A 3MF5A 4HDHA 1Y9OA 4FYWB 1JXVA 4LBPA 3W66A 3FSXA 4LUBA 2VFRA 1XC9A 5AE3A 4GMKA 1QVFR 3TUIC 4IKAA 2WSEC 3ZZRA 2DR5A 4I2QB 3H59A 4C3MA 3BBBA 2HRUA 3FVYA 4NRTA 2X7IA 1QSLA 5LJ5Y 5IWAF 3OJUA 1RYSA 2NYHA 3N6LA 4W90B 1S1XB 3ETOA 1FHTA 2W4DA 2FTRA 3FSYA 5KT3A 1JLAB 2ZITA 5KFMA 1X9WA 3GFYA 4XPEA 3H40A 1G1XA 4URSA 3IC1A 1IKXB 2FC8A 3LWLA 2C28A 4V19X 3U27A 2CQPA 2QLFB 3V6DA 2AJFE 1JLFB 1HWUA 1N0UA 1UA0A 3SDEB 3KK3A 4DZ6A 1TU0B 2YKOA 2VPWB 4K5RA 1NHKL 3CMES 5KFUA 3ET6B 3DCAA 4U6PA 3IG1A 4HHUA 3E51A 1LQ9A 1WKLA 5E3AA 4I0WA 4ZKAA 4CYUA 1BQMB 3CUNA 1D8ZA 4J9SA 3KK2A 2ZC4A 3KLIB 3MM7A 1J27A 2ATLA 5BR8J 1S76D 5H9FK 1AROP 1O8BA 2V8DA 4O3QA 4DPUA 5ETTA 3MMCA 2X51A 4D3GA 1NSPA 3CB4A 3EGWB 1F0XA 5KFJA 4AD6A 2HVHA 3UR0A 3OFHA 3SCLE 4IO1A 3BBCA 5B0BA 5T7LB 3W2VA 3MAHA 3K89A 1T95A 3RW6A 5HQLA 4Z7YA 5A8KB 5B0CA 4HTJA 2EWHA 2HW3A 2BJDA 3O5TB 1DY3A 2HHHF 1Q86T 1H0HB 3QT6A 4UQTA 5DRKA 1RAAB 3CE8A 4OX9J 1RAOA 1CS4A 4AQYJ 4EFAC 4C48A 1VQOS 1HNZF 1Q53A 2YX4A 2ROPA 2XI2A 5KFHA 3PW0A 2DEIA 3ZZUA 3G2XA 2ASJA 2QRRA 2V8HA 1AZSB 3C6TA 1LK7A 3Q89A 3N6NA 2QE5A 2B3TB 3GQCA 2C2MB 2BJ8A 2Z58B 3EGNA 2XNRA 3ZTRA 2DPJA 5EN1A 4DL6A 4DV4F 3ZXWA 1T9XA 5KT6A 1VQ7S 4CO3A 3OL7A 4PG4A 5GVQA 1T8EA 2WRMA 2FHJD 5G4DA 4R5PA 1VBZA 3Q8RB 5KG7A 1QM9A 2KZZA 2Q6BA 3IR5B 3HFZB 3R5DA 4A4JA 5EWEA 5HVFA 4RO0A 4ECUA 4P6QA 4DR6F 4R25A 2XULA 4DL7A 1S0VA 4Q5VA 5KFCA 1WEYA 3D54A 3MOJB 2PT0A 1FDAA 4HH0A 5LMUJ 1U49A 1VJWA 4DF8A 5CD4H 3KLEA 3BGUA 1S6QB 1KBRA 3SEOA 1VFJA 4HDGA 3BGOP 3VGVA 1VDHA 3HO1A 3DI6B 1NLKL 3HHDA 2XZTB 3DLHA 1FDDA 2AGQA 1CJUA 4CLKA 4LSNA 3LAMA 2XHCA 3IBCB 4LF7J 2V0NA 4H4MB 1YDLA 1PAUB 2O1PA 5KFDA 3C14B 4TN2A 2BEFA 2FPHX 3P8BB 1NZAA 5KFRA 4OJHA 3BV8A 3PACA 3QT8A 2G1DA 2L08A 2BOPA 5ETNA 3QSIA 3OVBA 3D67A 1NKEA 2DHSA 2C3UA 1O6XA 4B9TA 4HACA 4LR8A 4CT9A 1IBCB 5AXLA 3H20A 3I9V9 5M2UA 4JV1A 4V1Ak 4WF9Q 3OFEA 4ANCA 1D09B 3MR5A 4RUCA 4LSZB 3UD3P 3P6YC 4TQSA 4K4ZA 4JI8F 2GZOA 2W2MP 5BYSA 1TP7A 2UP1A 3T41A 2A1BA 3M6XA 4JBCA 5KFWA 2XLKA 1YJUA 3W61A 2LFVA 3QGGA 2OTLS 3Q0AA 3OL6A 2HSEB 1BHNA 2RJZA 1FRJA 2HVZA 1EZZB 2PA3A 5JMNA 4RW9B 5D4PA 5A8WB 5ETQA 3Q8QB 1TZ0A 3I6PA 4C3KA 1NK8A 1YJ9S 1N36F 4K4VA 2AEMA 3US5A 1VIXA 1UPPA 3A3OB 1CULB 2UV8G 1OPZA 1KR4A 4K59A 3EZUA 2X1FA 3QNWB 2D3ZA 1IBLJ 2GAGC 4RNFA 1VQYA 4LFBJ 3V4IB 2XYPB 5J2PA 2DGWA 1G7CB 1HMVB 4RW8B 1XERA 3OPKA 1N5YA 4PQAA 3AD7C 4AXJA 4PUOA 2MLYA 2QLWA 2KT3A 4ECTA 4NI2A 5DDQC 2RS2A 2BRKA 3D6FB 4TU8A 2ZNZA 5DZ7A 2QA1A 3I0SA 5LMNJ 4OZLA 4OI1A 2KHCA 1TFYA 3GV5B 1VRQC 2UUAF 3KLHA 2K8GA 2LQ9A 4P52A 3W8PA 1DHMA 1SKUB 2YNIA 4F8RA 3M8YA 4CI0B 4Y28C 4O3PA 1OQ3A 4NYPA 4CNYA 3QO9B 4MJKA 5GMEA 1TELA 4ZLLA 4M95A 3BS9A 2W2PP 2QT7A 1TL1A 4CDIA 1RLCL 4ZVEA 1KHVA 1TL7A 3DMJB 3RAQA 1NDKA 3NGDA 4ZVUB 4OJGA 1HBMB 1YRTA 3MD1A 3EJMA 3MOZA 2ZH4A 3DRSB 1FWLA 3THPA 4Q7AA 3EZOA 3QJLA 2EG1A 4ZVSB 3A3PB 2V34A 2J5AA 1VQLS 1KTVA 1R89A 1RJJA 1UVLA 2Z2ZA 2F63A 2VQFJ 4B3MF 1BUXA 4I2PA 3KUEA 1P1LA 2IMWP 4LREA 3M2UA 5J1NA 4UF4A 4QIEA 2V67A 1AUDA 1DRZA 4O4GA 1C0TB 2Y1JA 1S7IA 1S7HA 2H9ZA 3G6XA 1XEZA 3PHTA 3R6GB 5HLFB 5KFIA 2F4VJ 2BVZA 1HHSA 1K1QA 3R5CA 4FVMA 5H9EK 3OVAA 3CJQA 3LP0B 3KNGA 1PAEX 1CJKB 2IA6A 4C0BA 2E5IA 2WTFA 3ILIA 1HA1A 3L7UA 5F8HA 3UNGC 3BGLA 4TVAB 2CJXB 5I4MA 1ZETA 3LANA 5D0RA 4DU7A 1X4HA 1IJFB 1XNQJ 4CO0A 3QPIA 4DV1J 1GX5A 3F56A 4PYAA 1HPZB 2VG7B 4GVLA 3MR3A 1L3SA 3TR5A 3PO4A 2M5YA 1SUQA 3T6JA 1KN6A 1GXUA 1HBOB 4YB6A 5D6GA 1K9MT 3PTWA 5I3UB 1UFLA 2G4BA 7AT1B 3KMQA 4Q0BB 1HBNA 1EIYB 4X65F 1UWBB 3W5ZA 4WFXA 4WIQA 1H7WA 4KKOA 4X62J 4I56A 1J5OB 3IGVA 4ETZA 2C2NA 4IFYB 3M8SA 4L72B 2IVYA 1RTJA 3RRKA 2X3DA 3QBCA 2IHR1 1RGVA 4USTA 5KFKA 1C1BA 3FUYA 2CWXA 3A12A 5KFPA 2MDAA 1HKAA 4NEYA 1KQFB 1N6QA 2UVVA 2V4JB 4PRFA 4KC5A 2PEHA 4RNOA 1I94J 2HIQA 3D9BA 3BH6B 2BE9B 1NSQA 5LM7E 4B3TJ 3JQMA 1IQZA 4PXBA 5MLCV 2JH3A 3M32B 2CZ4A 3F41A 4CLLA 3J7YU 2PN6A 3NXZA 3HX9A 3I55S 2QMWA 3GSDA 1FRXA 1LW0A 3A8JA 3M7VA 4RWXA 2M70A 3AJDA 2VL1A 3QGPA 4DX6A 2V2QA 4WZMA 4ZPBA 1WG1A 4IO9Q 2IAJB 2H5EA 5LT5A 3U1MA 3CD6S 3OR1A 3ZTPA 3HHLA 5K5MA 3VTIA 1VK8A 3VZIA 1IKVB 2KXNB 3JTOA 3ZTSA 3TA0A 2DPIA 4IUFA 2QLBB 1JLQB 4PWUA 1UEVA 2DHAA 3G96A 1RTIB 2AYGA 3SCJE 2HFOA 1TAQA 3HVTB 3HK2A 2VA3A 1VQ4S 5KFLA 3DM2A 1IKWA 2LEBA 1JIHA 3FRYA 2WB4A 1BLUA 4LRFA 3N6MA 4EK2A 1RAGB 1F5BA 3MMAB 4ZOSA 5L46A 2IRUA 2M52A 4EO8A 5LOQA 2N7YA 4C11A 4QR2A 1AYEA 1PSDA 2XO7A 5IM0A 4MK7A 4BDPA 2W7PA 3ZTOA 2FJDB 1WOPA 3A4TA 3WBZA 2IC3B 2ZZTA 4Y0FA 3AXMA 2FJEB 2W8KA 2ALYB 3BYPA 4RUHA 2JOQA 4WE1A 1FF2A 1LWXA 1FVQA 3QGHA 4MFBB 1RT4A 1X8DA 1KONA 3UD4P 1R8CA 3G9CA 2W7OA 2PGCA 1M5VC 3GCWP 4ECXA 4USVA 3KLFA 4JV5F 2WZ1A 1PBAA 2OJ3A 4GO5X 5L1JA 1RT5A 3MPWA 3QJPA 4B9UA 2OD4A 4KGVB 3P5TL 4CO2A 3WQPA 5J2NA 1X5PA 4OLPA 5E41A 1WI6A 3BYRA 2ZVIA 1UFKA 5K8MA 2J0WA 1UFWA 4ES2A 3BM7A 5KT4A 3D3BJ 2IIHA 5AXKA 2ZWOA 2BZ2A 1YVFA 3QLHB 3M6VA 3IP0A 1SVDA 4F4ZA 3BF4A 2K1RA 4LQ3A 1FEHA 5J1EB 1KWMA 4C8MA 3I31A 4BS2A 1GH8A 2G0CA 3D3CJ 1VBKA 2RH3A 3CXCR 5J2MA 2UZAA 2LQJA 1ELOA 3MAAB 2NXEA 3HKZD 2E1AA 2CQ1A 2WBMA 1UAWA 2R2UA 5FD1A 1QE1B 1T94A 2ZBPA 4PPDA 4QU6A 1VQPS 1REGX 2GQCA 4PZVA 3CJKB 4FNHA 1X60A 3GV7B 2Z30B 1KRPA 2RRAA 3DU6A 2DBBA 1KQSR 2HVDA 4ZJOA 1XMQF 2KG0A 3QAUA 1QDUB 3NNCA 5F8JA 5H1SV 5IQQA 1RTHA 2CPZA 2HQCA 4X4UA 3DNCA 4J90A 3M8QB 2O66A 1UZHA 1NHUA 3MECA 3GLJA 3DLEB 3NP5A 3MM6A 5KG6A 2DXDA 3AJ2A 3C15B 3S7RA 3HZGA 3GJRB 3FBBA 2YX7A 4RW4B 2KO1A 2VV5A 1UEKA 1OSDA 4L74A 2DCLA 4PWWA 4URQU 2QEXS 3H5SA 3TJ8A 4RUBA 3EM1A 2BR0A 3OFFA 4E0DA 4FF2A 2HFSA 1UCNA 4WJBA 3SFGA 4DR5F 3SMZA 1SQFA 2LXIA 3R7NB 5C2GA 3CJ0A 3UN2A 5HBMA 1RU2A 5GMKa 4Q45A 4XDCA 3K8VA 2GGPB 3PYGA 4ED3A 1K73T 2V6AA 4YQWA 3MCSA 3P3DA 4K0KJ 2VF3A 4M5DA 3V6DB 1SKWA 2OEMA 4NLXA 3WX4A 1ULRA 4KIAA 1B64A 3H4DA 3KG1A 3KK3B 4NCBA 2DIUA 4FXWA 4KAIA 4C9DA 2B56A 4ZN3A 3PCOB 2FVRA 2V2KA 1KNZA 2HQIA 2IRYA 3EDQB 5GADI 3QSYB 4OV1A 4FXDA 4Q8EA 4CYUB 2GHWA 2BMBA 2EFGA 3KK2B 1NJYA 4NLGA 1FRMA 2OUGA 1U8WA 2IJRA 3TZXA 1B4SA 4J7CA 3MEGB 2V50A 8AT1B 3MMJA 2ZDPA 4S0MA 2Z57B 1U45A 3UWTA 3W9JA 1MN9A 3X3UA 2OSRA 3MMCB 5IC6B 3CDAA 2EBGA 2DY9A 3UO0A 1RT7B 2GMHA 2VQEJ 1YJNS 4H54A 1KDNA 2JFDA 2MZ1A 1K0TA 3HCXA 1XBWA 3W2VB 1Z2LA 4DUTA 1J5EJ 2NXUA 4YOEA 2MLXA 1H3DA 1OO0B 4UOCA 5ETOA 1PYOB 3VF0B 1SB6A 3E01A 2HS3A 1G6BA 2N4DA 2DRDA 1RZMA 1SC4B 3NG8A 3SCIE 2AD9A 3TAMB 4ELVA 2M88A 4LR9A 4X84A 1F9FA 3CCUS 4QIWD 4K4XA 4PXCA 1I5OB 4A8WA 1S4FA 4IRCA 1NDCA 2JVRA 2CUYA 1T11A 4FS1A 4OYZA 2IVMA 3C6TB 4P2SA 1T03A 5JVHQ 1VQ6S 2IM3A 2G2YA 4P74A 3ZFVA 4JI5J 4OL8A 2UU9J 3HDSA 3AD9C 1FKPA 4A47A 3PJWA 2RMLA 1L5UA 2ZH7A 3OT9A 2BJ3A 3GCXP 2ROEA 3QRQA 3NL0A 3KG4A 3QFWA 5B08A 2M9KA 2OI2A 5F9LA 4B9SA 3I4PA 4IOAQ 1H2TZ 4ECWA 5D8HB 2FJBB 1XNRJ 2NREA 3BSOA 4DF4A 4OIXA 1ZOTA 2G13A 2MZJA 4ZP6A 5HMYA 2R42A 1WC1A 5CYMA 3IWNC 2ACMA 4ZJLA 1S57A 3W9HA 1SCJB 1WHVA 1V3SA 5THWA 2R7WA 4I64A 4U8VA 3KLEB 1WHWA 4ED2A 2CNKB 4QIFA 1KSPA 5D0EA 4KFBA 2P2CB 1SJFA 1YBAA 2LMIA 5AE2A 4OI0A 3J7Z5 5IFMA 3S1TA 1WI8A 2UXBF 1OPIA 3T19A 4LF5F 2LEPA 4K4UA 3W7BA 4C0OC 1U26A 2DO4A 4NLRA 2ZC3A 3S01A 2QYGA 4HACB 3SSRA 4FKYA 1RE1B 3QQCD 1VBXA 3RBDA 3TJ9A 1P8GA 2GQ2A 3CCES 1VI7A 3MM9B 4RU2A 2ZUAA 5CQGA 3EGVA 2CPXA 5DG9A 1F60B 3PIPQ 4A8SA 2JHEA 3EVMA 2AYEA 2XY5A 1R8BA 3JYTB 2R7QA 2RAQA 1HWJA 2JC1A 4LF6F 1G3OA 4DJBA 2VC1A 4LF8F 2H4YB 4P7TA 2HHWA 1Q7YT 3FDSA 1F1BB 1KC8T 2YNHA 2XZWA 3VAGA 2P6SA 2KB2A 4E8UA 5KFBA 3VAJA 1R3NA 2CRLA 2BANA 4DV3J 3PG9A 3OD2A 1U1OA 1NCLA 1Q0NA 2RQCA 1TKTA 4EI2A 4YB5A 2FVSA 4B3RF 4NWBA 2DKOB 3PJ9A 4LFCJ 1TKZA 1X4DA 2KYXA 4OHZA 2E5JA 1LWFA 1ZTTA 3I9ZA 2AGPA 1WACA 5J2PB 4FDFA 3EVOA 3M9NB 2LA6A 1N5YB 2GIFA 4ZVRB 4OI6A 5HAOA 2DHXA 5FDLA 2ZH8A 3O44A 3DLLQ 2XMWA 2M8HA 4NI2B 4J9RA 1C0UA 2UVUA 3J81Y 2B6AB 3TA2A 1LXNA 4B17A 3I0SB 3GYXB 2MZQA 1T05A 1HI0P 3KLHB 3TVYA 1R6VA 1BD6A 2VG6B 3KFWX 4IH6A 2HK3A 4M1KA 2ACYA 1K1SA 1FRKA 4R0EA 2R2SA 1WNEA 5ETRA 1MLAA 1AB8A 1TL7B 3EUNA 2VFTA 5IWAJ 4ECYA 1Y4ZB 2G0IA 2B0GA 2WW8A 1F9HA 1VS3A 4I6WA 2G2OA 1DBDA 1MMDA 2F65A 4PCQA 4JI6F 3PO5A 4UQGA 1TR0A 4LVNP 3N9UC 3CJ2A 3NBPA 3OHBA 3MGJA 3ICLA 5F8LA 2R8JA 3B6BA 1FO1A 1HI1A 4I2PB 2HIYA 1PGZA 3L95X 3HFKA 3AY0A 1S1UB 3CCJS 4XPCA 1F3FA 2OPSB 1FXDA 2LU2A 1WORA 5E3CA 1JNZB 4WYLA 3T1YF 4Q43A 3C6UA 3T1AA 2P9CA 2Q1LA 3T5KA 1NKCA 5E3PA 3BKTA 2A6OA 4WFNQ 3KWMA 1E6YB 3M30A 4ID5B 3MPDA 2YY3A 4KT0C 2WVEA 2CQ0A 2KM8B 2PSZA 4H4OA 5C2CA 2EFPA 4I67A 1ZTWA 5DQHA 3HSJA 2VC0A 1HFEL 3BREA 3LPEA 1JWWA 1HL6A 3CJSA 4ES1A 2YH0A 2QO3A 3H2VE 1RU1A 5D77A 2ZJQQ 3CF5Q 2EK1A 2Y9HA 4M5NA 1C1CA 5ADZA 2IVFB 4FS2A 1EETA 2MKYA 5T14A 1NU4A 4HTIA 2A10A 4JI0F 2AGOA 1RK8A 5DLGA 2EI5A 2PFDA 5HI7A 1A7GE 2VKZG 5JXSA 3EICA 3HHEA 1MNEA 3EXCX 2RUSA 1FX4A 3W2WA 4DXLA 2XCPA 2HHHJ 4CLTA 4KV8A 1NK6A 2HPUA 1PILA 1MROA 4OYMA 2Y8WA 3I32A 3JXOA 4QIVA 1HNZJ 2NPIA 5SUHA 3UR3C 1FVSA 1K44A 3K58A 3CMAS 1EB0A 4ZPWR 2Y0BB 4KKOB 3OJSA 1BQNA 2HZVA 1RA7A 2W9BA 1WDTA 2OEJA 3HHKA 3V6JA 3K5OA 2YBVA 1SH0A 4PPZA 1SQGA 1RHKB 5A0YB 4PXEA 4HT7A 1N56A 3CC4S 3ENAA 1U8SA 4OHVA 2C3OA 2IM2A 4CZCA 4PG6A 3M05A 3Q8YA 4NLTA 3F73A 4DV4J 1C1BB 4JI2F 4OQJA 4Y2MA 3TAQA 4ILRA 1RUSA 3VWSA 1MWYA 1M5PC 2GMJA 1HNWF 3HXMA 4RW7B 4OX8A 3MTKA 2BOAA 1JLCA 2RQ4A 4KTQA 3ISNC 1FNOA 2Y0SD 1W26A 3CDEA 2FY8A 1X9MA 5LSRA 2DEJA 2H4WB 1N54B 2HFVA 1KFDA 1N48A 4DR6J 1KFSA 2ZNYA 2MGZB 4Y2KA 3MM8A 5GAGU 3LP2A 4K4SA 1PC4A 3ISND 4A8YA 1CJTA 3OV7A 1KVKA 1YJRA 2C2OB 3DOLA 3J7ZT 2EPIA 4Q44A 1U1RA 2V2ZA 2ZJRQ 3M4XA 2DNRA 4H4KC 2HFNA 1LFWA 1RHMB 2QIFA 1U1LA 1JNRB 1YITS 3I96A 4G1QA 2B8PA 5LJ3Y 1GXTA 1E6VB 4NZ0A 3CW2C 2AJ1A 2C1EB 4FBTA 1IQTA 3VCDA 1IKWB 1VRUA 2WOMB 2MKSA 1U0HA 2V2VA 3RGIA 1WUUA 1YJTA 5CYJA 2GVZA 5B0FA 4X4OA 4PG5A 2V5HG 1RAIB 4C11B 1FD2A 2VIHA 4JI8J 3KJQB 2CNNB 3W5XA 2M4MA 3EGZA 5IM0B 3AFGA 4WU3A 1VC5A 3VAKA 3OTOF 4FZVA 4USWA 2BDPA 5G0RA 3H5YA 3CULA 3GFHA 4PWDA 3T1HF 1X4BA 1I6JA 4WE1B 3V81A 2XMTA 2JLFA 1RT4B 4G3IA 2DGQA 1MMNA 1GMWD 1R7IA 2EC2A 1Y7PA 3U7JA 2W4PA 2B51A 1LWCA 1N36J 1RT5B 3K0JA 2KHDA 2ZH1A 4OYIA 3NRBA 4B9VA 1RWOB 3DOMB 4ECZA 3BR9A 4IFVA 1A6LA 4KH1B 3K8WA 4F2RA 3J81U 3MI7X 2Y1LB 3VR1A 4KRWA 1N88A 2H54B 1M5HA 1SIWB 3UE2A 3O2IA 2IDEA 3SI8A 2CPYA 1VK3A 3ZO7A 5ETSA 4DG1B 3TUZC 3JSYA 3SV4A 3ZNJ1 2MQ8A 4I1TA 2XWYA 3LOUA 3G86A 4DQRA 2IYGA 5J2MB 4DR3F 3UPFA 3CJRA 2QYCA 2UUAJ 2ZJPQ 1TL3B 3TA1A 4X64F 2BABA 1VBYA 3BGRB 2O5DA 2OELA 3PYDA 4WBFA 4ED1A 4JV0A 1FK9A 2XMUA 2BJ9A 1FFWB 4MH8A 4A8QA 1F3VA 1YSJA 4KH0B 3OVSA 3KJVA 3G6ES 1Y00A 3R3TA 4UOFA 1T9WA 1XIQA 3MAQA 2NQPA 4TY9A 2VDIA 2D74B 3NGSA 1W2IA 1XJWB 4O3NA 5F3ZA 3DRRA 2ADBA 1QTMA 3MPYA 4DDFA 4C8ZA 2HHTA 2LQ8A 1UWAA 4ZITA 3P5BP 3CO9A 4Z37A 2QX0A 4RNHA 3HULA 1NDLA 3NKYA 2OPRA 3MECB 5U47A 2QSFA 4B3MJ 5MAOA 3R2CJ 4MYUA 2IFXA 1ROFA 3CIMA 5AT1B 4BC7A 3UVJA 3VGSA 4I6YA 1Q4RA 1SBRA 1CQMA 5BYRA 4M94A 3OUYB 2P8IA 4HI1A 3NGTA 3KLVA 2NS1B 4M8LA 2G9OA 3K17A 1QJHA 3WZ0A 5HBMB 2A2DA 2CQ2A 4IG3A 3TRGA 2IPOB 3MEEB 4F0MA 5EX0A 4GRSA 4N76A 2NLWA 1ZAWA 5L1IA 2DRBA 2GJIA 2CAJA 1HQUB 1H7XA 4CTAA 2W4CA 4M5DB 5CH7B 4FN5A 2EC0A 2DRAA 5C24B 4KR0B 5E3QA 2CQGA 3Q83A 1P1TA 1JMTA 4OX7A 5KFZA 3CCWA 1DTTA 2CA9A 3CO0P 3NGRA 3N28A 3JTNA 4UTGA 3DDIA 5DDPC 4OZ5A 4B08A 4U7UK 2RU9A 1ZM2A 2VBXA 3FZBA 4X65J 1S79A 3CGIA 1BWEA 3IXQA 1T0TV 2SXLA 1T3OA 5HQ8A 4WFYA 1UMJA 2OH2A 2FLOA 2W2NP 3H4BA 4JOUA 1UVKA 4CRJA 3HFVA 4WKYA 3GWCA 3PYEA 3OTCA 1WJ9A 5FLXU 4V19J 2AYBA 3GJTB 4P2MA 1Q8IA 1NKBA 4XDDA 3G8QA 4EZ6A 3E01B 9ATCB 4CLYA 1RHRB 1RT2A 2CQIA 1C4AA 1OSCA 4QYZJ 3GPAA 2VFUA 3N01A 1RABB 4HL9A 5CCLA 3RZAA 3GG1A 4NYZA 4P72A 1NDPA 1UTAA 2WB1D 3B78A 1SPBP 4F36A 1JLBA 2VZ9A 3EVWA 3FCWA 3M8PB 2OEKA 2B9YA 4F4YA 4LRBA 4ZVTB 1FKPB 5DGAA 2PEBA 2W2QP 3R5AA 4AYBD 4QR0A 3I0RB 3M2RB 3V4MA 1OYEA 3F0NA 3ETMA 2RS8A 2XS7A 4RBUA 4Q2LA 2CPEA 2OP5A 2BE2A 3VAFA 3W9IA 4Y6IA 4WZQA 1G4CA 1SQEA 2OPQA 5M2RA 1YHQS 2XCAA 1SJ3P 2WONA 4ECSA 3IM8A 1ZPVA 2AQ4A 1PG5B 1M5KC 2CJYB 3H5UA 4N5SA 1FXRA 1TKXA 2YWHA 2WVDA 4ZHRB 4C8LA 5E5NA 4URGA 3CIZA 3RG6A 2DNNA 2VOPA 2V63A 1GK8A 2J6SA 2FJAB 4NLQA 2ZHAA 1NPPA 1JLGA 3LTOA 3OR2B 2YKPA 2DJWA 1HHQA 4DMZA 5KG4A 1RI7A 4HLBA 2B9EA 3VQSA 3AJ1A 4M63A 2VJUA 3CDUA 2BXJA 1VYAA 5I3PA 3VAHA 1D9DA 4UY85 2L9NA 1WC6A 4LIWA 1RP5A 4KO0A 3GFZA 2E7XA 5IT9U 1U2CA 2MHEA 1UVIA 4IRKA 2HBYB 4JV5J 4NXNF 1PYTA 4EO6A 2YNFA 3FFIB 3GU0A 1YRXA 1H98A 3UDCA 2C2RA 2HQ3A 2UXDF 3D0HE 2R7RA 3M9OB 2PMWA 4DV0F 1YWXA 1VJQA 1Y3KA 1SC6A 2O01C 2P6TA 3R5JB 2IA0A 1HQEA 2RRBA 3ONQA 4Y65A 5GMDA 1KLMA 4MIWA 5D0GA 4F2SA 3M2VA 5HQMA 2HK2A 1B7YB 1FRHA 1GXLA 1YG0A 2NXNA 4CCHA 4CT8A 2LECA 1URRA 4MK8A 2HNDB 4JYAF 2YKAA 3RBZA 2KN4A 1HD1A 4KPCA 1FERA 1S9EA 3DHXA 3PM9A 4XO0A 4MKBA 3AD8C 2XO6A 2DT9A 1TMMA 1SH2A 1SL2A 2EFVA 3G4SS 4JI1F 4P10A 1BC6A 3CJ3A 5KT2A 4EYHB 5EWFA 2YPZA 1RB0A 2Y1IA 2XB2D 4QWEA 1LWFB 1KOOA 3NMAA 1NHVA 1WC3A 3RRHA 1Q7LB 1JLEB 5LXRA 1F5CA 2J8AA 1QAJA 4ZVQB 4LMZA 4ZN1A 4AFFA 1XMQJ 5K14B 4CNZA 3EE3A 1Q82T 4IOCQ 3CPWR 4L3KA 4IQMA 2JJ4D 1S59A 1C0UB 3GP9A 1FKOA 4EUVA 4AL6A 5K9FA 1GFWB 2FJWA 2YPYA 4FF1A 2DNMA 1FXLA 4USMA 2GA7A 2C3YA 2MKCA 4IQXA 4RUAA 3SQOP 2MLZA 1X4CA 1ZPWX 2QL7B 1S6OA 1EP4B 2ZOGA 3DGVA 4I2QA 4K5SA 1S6PB 3DLKA 3LPYA 2RQMA 2RDDA 1TL4A 3TI0A 3H5XA 2BW2A 1R8AA 2GW8A 2PFFB 1ZA2B 4DR5J 3AOAA 3IWLA 3P45B 1JLAA 1T9VA 5EX3A 5KFFA 2JDJA 1U1MA 2GIRA 5IV4A 3VQTA 1FRLA 2HS4A 3NBPB 5KFGA 1IKXA 4QIGA 4O44B 2E1MC 4ED8A 3H8YA 1JLFA 3LGMA 1BY9A 1NJZA 2ASYA 1N5QA 1QUVA 2EG2A 3SDEA 2BX6A 1UJ6A 2YNGA 4KQZA 2HBZB 2ZM6F 1DTQB 5EGYA 2KM8C 3ET6A 5D78A 2DHHA 1V5VA 3E2EA 1KLNA 2E1CA 1MN7A 3TARA 3G71S 2CPHA 4K2XA 2GX8A 3M30B 4YDDB 3DOKA 3KLIA 4TXSA 5JVGQ 4CLWA 4LQ9A 1UW4A 3CJ4A 4MYTA 5GAHI 3QFHA 2VPYB 3F44A 3MM5A 2HBRB 1UL3A 3H0PA 1JJ2R 5L1LA 1LV5A 3VAIA 4JV2A 4CH7A 3HJFA 4NLVA 3TQ1A 3D7SB 5T7LA 1U48A 4F67A 4QCLA 2OTJS 1WG5A 3FCHA 1TK8A 2FYXA 4NLYA 5GAEI 2L41A 2R9LA 5A8KA 4NA3A 3BQ0A 3FRZA 3UCZP 5I42A 3IAM9 1HARA 4UOGA 4KHMA 1RDRA 2J7WA 3W2WB 1TV6A 1YJ7A 4KV8B 3VALA 1FWKA 2MHNA 3WIUA 2D69A 1B70B 3CMQA 2XMMA 2G1HA 2YVSA 2N82B 1LNQA 4J9KA 4G1IA 2MQNA 1HYSB 3EZ5A 2X1BA 1SKRA 2VH7A 1AZSA 2XEXA 1FCAA 4M5IA 1TKDA 3IN5A 1MU2A 3ENWA 2ERRA 3SQGB 1I3OB 1F2HA 4ZVFA 1ZYQA 1OQ6A 3LALA 2MQLA 3M6UA 3D2WA 4WPAA 4U96A 3N5FA 3CWJA 1FTCA 4WTOB 4PAAA 3SXLA 4IH7A 1IVZA 4U67Q 3J7A1 1SJQA 3MMBA 1JLCB 4UW2A 4RPFA 5E0OA 2QC3A 3RR8A 2PI5A 2JL9A 5ETKA 4WK3A 3SYZA 1YLXA 1M1KT 4LFAF 1HNVA 3BPDA 2E5GA 2UVRA 1WKJA 4DL4A 2QA4G 4DX7A 3TVZA 3TZZA 3G6VA 1WF2A 2B5JA 3LP2B 4C3LA 2XBPA 2LDIA 4DN0A 1DQAA 3K5LA 4DUYF 2AWZA 4ZP7A 2FJXA 2OFGX 3DOLB 2B4VA 2FHMA 2ZHOA 2MYFA 2UUWA 1RA6A 1FJ7A 2Z56B 2KVIA 4UY8T 3RYLA 2W25A 3DI6A 3FBEA 4WP3A 2UUCF 1CJVB 3Q2SC 3Q8SB 3IGNA 4PG8A 4YP3A 3JS9A 2FLPA 4ID8A 4FPRA 2YXLA 2B9WA 3SSSA 4OZ1A 2UXBJ 3UNYA 4HYKA 3THTA 1N32F 1BWVA 3DN9A 4LF5J 1Y11A 1EHWA 1T7PA 2DNKA 3CCZA 2V9WA 4KJIA 2A0FB 4MAKA 2HRYA 3R27A 4ZLJA 4P73A 1RT1A 1SL0A 2XY6A 4K8RA 2ZKUA 4MT1A 4KHPF 4O0NA 1MSWD 2FQQB 2GVZB 2JLEA 1U6ZA 2RF2A 1HNXF 4ZP8A 2GQQA 4KGZB 4F3OA 3UDVA 3KHHA 2HVEA 3JQJA 3D68A 2YQ1A 3ADAC 3SBMA 1WC0A 3HT3A 4OV6A 1HBUB 3RBXA 3FMWA 2CNOB 2F40A 4AL5A 4L75A 1GNKA 4NPOA 4IH5A 1TK0A 1YGYA 1PKUA 4LF6J 5DETA 2O3DA 3R6LB 3FBFA 5KG3A 4LF8J 2JVOA 2IBOA 1APSA 2XSFA 4RW9A 2YKMA 5A8WA 2XMKA 2N4CA 1WKKA 1K47A 3TX8A 1VLYA 4HVZA 3TWZA 5HP1A 1F9EB 3R1LA 3NS6A 1TVRB 3LGHA 1CULA 3TVKA 3BSNA 3MEDB 4ED4A 1N52B 4UUWA 2Z8QA 3Q8VA 3N5BA 4LRAA 4B3RJ 2ZH9A 3H98A 3ILJA 3V4IA 4LF9F 1NNDA 4RW8A 1S12A 4NA2A 2FHOB 2AX0A 3DLGB 4WKRA 2HZCA 3ITHB 2ZH3A 4ED5A 1Q8BA 1S1TA 4DR7J 3GSIA 2R7TA 2AX1A 1EARA 5C42B 2MKJA 2D3O1 2CPDA 2QN6B 2OD6A 2GJFA 1OY6A 3U1LA 2NXCA 3BBFA 4DQQA 4F4WA 2LYVA 1S9GA 4MK9A 5C7PA 4DWIA 3QO9A 2FIUA 2ZOMA 1FK9B 2AJ4A 2CVIA 1R31A 3ZZYA 1VIOA 2KDOA 3DRXA 4N41A 1GAOA 3DMJA 1Q5YA 3KJVB 3W63A 2GNKA 4A8XA 2B7BB 2M0GB 3CEDA 3I82A 3OTDA 3CT9A 1NEEA 3VAMA 4ZCKA 3DRYA 3CNQP 2C3PA 5A2QU 3QYYA 4LT6A 1S48A 1RT3B 5IZHA 4JI6J 1RWKB 1IBKF 4DV7F 1FDBA 1L3UA 2HGNA 4NLUA 5F9NA 5HROB 4CM2A 1N4LA 2VODA 4CO5A 2YH1A 3UDEA 3DLBA 2VFVA 2ZKTA 3LF0A 1NZ8A 2JFKA 2PE8A 3T1YJ 2RKIB 1S1WB 1CVJA 5HLFA 3PFEA 4B9LA 2R2TA 3BH7B 5K20B 4F50A 4ZIWA 3SFUA 3D0GE 2V4QA 5A8RA 4DSKA 3KMSA 3FQLA 3IBWA 1FFSB 3DRPB 4HKQA 4IG3B 4WP9A 3KHRA 4U9RA 1CLFA 2XQCA 4NZ6A 3TNVA 4WU2A 1RAFB 2YQ0A 4NEZA 4DPOA 3OLAA 2HGMA 5KOWA 4DFJA 3GYGA 2DXFA 4KGKA 1HPZA 4JI0J 4RL1A 5B7WA 4FPIA 1REVA 2R7UA 5KT7A 4K50A 4BWJA 1S0NA 1RBAA 5I3UA 1UKUA 1ZS6A 5IQ6A 2ZBCA 4O0IA 1UWBA 5CHCB 3HKWA 3QGIA 4JUZA 2ZEJA 2R8GA 3MCNA 4NYOA 1DFDA 4B3SF 4IFYA 4K4YA 2DHGA 2G0JA 4ED0A 4PKDB 1YK9A 2AF6A 4E2FB 4CLPA 1VQNS 1M1HA 3K57A 2Z0GA 4QYRA 1YZ6A 4LJMA 2V4RA 2IBKA 4Y2IA 2QGFB 4YR2A 3RU0A 1EAYC 4JI2J 3IMQJ 1NJWA 5B0GA 5AXNA 1HNWJ 5HMXA 1KEKA 2AMCB 3D28A 8RUCA 5HMWA 2B8QA 4LSLB 1X4FA 4PR6A 4BHQA 1IN0A 1B99A 4EGLA 2GHPA 1HNIB 2HBQB 5ETLA 3P4UB 1QLNA 4DR4F 1WWHA 5SZTA 2V94A 1VQKS 1Y10A 1BQXA 2KKHA 2VD3A 3R8YA 2WVCA 1QY7A 1FNXH 3M6WA 5A76A 1JLBB 1KQGB 3POTA 1Q5VA 3MEKA 2H3EB 4R8UA 3BN7A 1YTYA 5DDOC 1RTDB 4ZIVA 3CCRS 2FB0A 4DV6F 5DG8A 3D6TB 2CQCA 3HD2A 3CTRA 3P49B 5KG5A 4I68A 2ZFHA 2HMIB 1UVJA 5JUMA 2WAQD 2MPUA 3VVTA 1RTIA 4LF4F 4ZS6A 4H4KA 3HVTA 3NLCA 4JI4F 2IRXA 4YR3A 1PCAA 2IMOA 2Z2MA 3QRRA 2ROGA 3HF5A 4IDKA 2I5JA 1KVIA 4F3QA 2VONA 3VGTA 4DEZA 3IS9A 4ZLNA 2BQ3A 2F4FA 2RSQA 1Z2ZA 4X66F 1TKXB 2YWWA 2J6UA 2PDAA 3VGUA 2ZBQA 3HT0A 3HP6A 4OJ3A 3HSDA 4DQPA 3B54A 5B0EA 1LWEA 1R8HA 5H9FJ 2HNZA 2CZ9A 2IC3A 2ILZA 2DB1A 3Q24A 3OTOJ 2DGTA 4JI3J 4X4NA 3T1HJ 1WF0A 3D66A 4MFBA 4I7FA 1Q81T 4KE5A 2FVQA 1HLWA 1LKZA 4KO0B 2BKNA 2YTCA 2FJVA 4K4TA 2ZHBA 2OMOA 4IG0A 1RKIA 4YY3F 2QL5B 4QWDA 3QZ7A 2VA2A 2HHXA 5L38A 1Y3JA 2NPFA 3ELHA 2AKWB 2E1RA 2GO8A 5F0WA 2R3VA 3AB4B 3BQ1A 1LFPA 3D1QA 4DPXA 1SJ4P 4OI2A 3TOQA 2CIMA 4OYOA 2JLGA 1RSCA 1G2EA 2J7UA 2O67A 1HQEB 1X4AA 1X7VA 3QLHA 1D0EA 1R0AB 4Y3CA 3M1VB 3QIPB 3L3CA 4WTYA 1XMOF 1YKWA 7FD1A 2NUHA 5J1EA 2XSJA 2ZD1A 3O3LA 4NCGA 3MAAA 2CJKA 4DR3J 3IRWP 2XNQA 2EKYA 4WFAQ 4P2FA 4X4VA 4M5MA 4X64J 1NH8A 2B4PA 3GIJA 2Q3PA 4GKJF 3GG0A 5KFQA 1X5TA 4ZVOB 1PIEA 1VQSA 4DSJA 2LXUA 1RXOB 1XWLA 3QZ8A 2DTJA 4G1PA 3HD1A 3IRXB 1WTBA 1JKHA 5GADU 3BR8A 2W7AA 2AT1B 3GJSB 2HURA 1C2PA 2ZBRA 1S5ZA 4RNMA 5C25A 1N34F 2EFQA 4CH0S 1XR5A 3PV8A 2BYCA 2MJUA 2Q66A 2F7VA 4MKAA 2BM1A 1N33F 4ER8A 3M8QA 1FKOB 2DO0A 2PI4A 4ECQA 1JXLA 3PX6A 2CJQA 4AT1B 3DLEA 2HZAA 3C15A 2UV8A 3OSNA 3GILA 4F04B 3FZ2A 4RW4A 3GJQB 3T6BA 1H2VZ 3MR6A 1NPKA 3C19A 1IBMF 2AJQA 2B9XA 2D1CA 3C46A 3DLKB 3B4DA 2FZGB 3IFEA 2CKWA 5L9NA 4DR2F 5AJ3F 1FKAF 4M5GA 3RUBL 3R5BA 5DZ6A 3IR7B 5KFYA 4C8NA 1HW9A 1U09A 2JZ5A 1ICEB 2JSXA 4OLOA 2GGPA 1IXKA 1XR7A 1SJRA 2DNHA 2HAFA 1KOHA 1S4EA 2GC8A 2D7SA 2AJ2A 4NLWA 1UPMB 4DCOB 2XY7A 1NB2A 2YNGB 3OFGA 3C2PA 4X2BA 4QJVA 1UVMA 2GHVC 3ZTQA 1S77D 4TLQA 5J1PA 2KL8A 1VQ5S 3PDNA 3BPSP 2GO9A 2E7WA 2B4OA 1HWIA 4DV2F 1VHFA 1O51A 4NXMF 1RKJA 3DOKB 5ITHA 4ENOA 3K7RA 1KP6A 3IG1B 1WOOA 3MEGA 2HHUA 5AE1A 2HAIA 1NPRA 1AFJA 4U95A 4FYYB 3UN5A 2KZMA 2AZ3A 3MM5B 2J9CA 2Y3YA 1RT7A 5HVGA 4A8OA 2HHVA 1OY8A 1H2UX 2KRBA 2VASA 3GYNA 2DGVA 2GAHC 3MM7B 3BB5A 4QPXA 2PO4A 3IR6B 1SC3B 3HJVA 3DGPA 3MPUB 2KFNA 1V5IB 5CXTA 4DU8A 1YBTA 4KHRA 2XZDB 2VHGA 5F41A 2X3GA 1HR0F 3T3FA 4Y00A 4OJ1A 5I42B 3MHYA 3TAMA 1RCOB 1TV6B 2HWTA 1K8AT 1WEZA 1LEOA 4EEYA 2JEGA 3RB6A 3B82A 7FDRA 1U47A 3T5JA 4ZJQA 5F8IA 1NM2A 2JC0A 3NAIA 2AYMA 2HYIB 4MKYA 4WP8A 4ICLA 4KSEB 4X4PA 4ZCIA 5I3QA 1CS4B 1MU2B 4ZLPA 2BA9A 2DR8A 3EX7B 1RWVB 2Q6CA 4ZCMA 4RW6A 2GVDA 1U6FA 2XLIA 2YKNA 3EWGA 1AXQA 1RHUB 2VPXB 4C4WA 1FA0A 2DVIA 1I1GA 1MWZA 1X5OA 3T5LA 2AU0A 1C4CA 3D6MB 3MMBB 1UEUA 3H25A 2MXYA 1CC8A 3O6QA 3NCPA 2ZOFA 3A13A 2HFZA 1FJGF 1OWXA 4WYWA 1HNVB 4R5PB 3JQKA 4QWBA 1GMUA 4OZ0A 3OXFA 2B5JB 2GIQA 4M5LA 3C16A 5H9EJ 3JAMU 3BSAA 2DNZA 5CZVA 2CQDA 4F0KA 3CD7A 3MR2A 2RT3A 3ZZZA 2VBYA 2DNQA 3T9NA 1FWPA 2XYHB 1DJ0A 2Z4PA 2PC6A 4PQUA 2OPPA 4ZP9A 5DS7A 4WFBQ 3LH2S 2QA4S 4ZVGA 1ACMB 3IA0A 1IM6A 3NNHA 4PXDA 3GMGA 2H5IB 4BLGA 3RTVA 1KS2A 3TO8A 4YHHF 2R7OA 3M8ZA 2GCFA 1CJUB 3FC9A 3PR5B 4XK8C 1YJVA 4LSNB 3G8SA 4N47A 1RADB 1IR1A 5CYQA 4I4BA 4NXNJ 1GTEA 2GS8A 2MSTA 3MWBA 3DLJA 1IKYA 1RT1B 2EK6A 2VBZA 2CFXA 3MM9A 1WSRA 4DX8H 3IBFB 2UXDJ 2RF2B 2RD5C 3QT5A 1L3VA 3NCQA 1GTHA 4NLOA 4DV0J 3QMQA 3LUYA 3CCQS 1R27B 4DR1F 1CSJA 4OFZA 4P9SA 1WG4A 4JB8B 3JYTA 3DXSX 3JTPA 2BJEA 1ZA1B 1RWWB 2AHOB 1QUPA 3K5MA 4QU7A 1XN9A 2VUGA 3T5HA 3KLGA 2WBRA 2JRSA 4JYAJ 1VISA 3T9ZA 2YKMB 1EX8A 3CCVS 2J8SA 4QWAA 4ZK7M 2L9DA 2E7VA 1VQ9S 1F2GA 2A6MA 5HP1B 3OTEA 3FNNA 2KVQE 2F5GA 2UVWA 3MD3A 2KFZA 4DUZF 4JI1J 3R7SB 1IJEB 4RBTA 2MJNA 3W60A 1BXNA 3S6EA 3HVWA 4JP8A 2U2FA 4CH1A 2CG4A 2QV6A 4ED6A 1H73A 4DSEA 3WHIA 5E3RA 2WVBA 4B9MA 2HHSA 1S1TB 5D4LA 1X0FA 5KT5A 2CVEA 1HW8A 3HLUA 1OIAA 3AH6A 1VQ8S 3G8TA 2B6AA 1EQ0A 5CCMA 3LW5C 2ZWPA 3AOBA 3TJAA 5D4NA 3GB0A 2VDHA 1WOSA 2VG6A 1M90T 2RHSB 3BO2A 4DFPA 4PUOB 2VOOA 2CQBA 4AXIA 2FY1A 1WDDA 1Y5NB 1S9GB 2ZH2A 1LW2A 3I5AA 1CC7A 4O4RA 2W9CA 1YI2S 5A6WA 4ATNA 1U7LA 2QG9B 2DR7A 1KHWA 5IXUA 2DGSA 1FE0A 4YN3B 2YNIB 3R9LA 4CP5A 1GMVA 5IC4B 3KUGA 4UOHA 3D4JA 2CJ9A 2V8VA 3UD5A 2ZDOA 3CD5A 3NGUA 4MKVA 3KK1A 4J9NA 3Q86A 1TL1B 1RWNB 4LIRA 3GZ7A 4YFUA 5KFVA 3J80Y 4DV5F 2ZZNA 2X1GA 3B8HA 2CWKA 3OL8A 1HQ2A 2IM0A 3BJYA 4HH1A 2Z2YB 3EMTA 4L73A 2H5JB 4WK1A 1Q16B 1U1NA 3QWPA 3W5YA 3CSKA 3PHEA 1ZAXA 4Z2XA 1EJ7L 3H42A 1S1UA 3CCTA 2AV5A 3PYFA 2ZM6J 2OPSA 3MFIA 2BQUA 1NK4A 1Q8KA 1PC5A 3C66A 4KY3A 4RWWA 1FNMA 1E6YA 4G6VB 3KXDA 4DLEA 3M2UB 2UUBF 1HWLA 3PFOA 4ID5A 1V3ZA 4O4GB 1TTHB 3ZZOA 3CJ8A 5A8RB 3SCKE 2WK4A 3NCRA 4DSLA 3MCMA 3HI9A 2N7CA 3NGKA 3HHNB 4FP9A 4ELUA 1SH3A 1RWUA 4EU0A 2E9ZA 1NK7A 1I51B 1W2BR 4LBHA 4OYAA 3JSMA 2MKHA 2NSCA 4DI6A 2XTJP 4DS4A 1REVB 2B43A 1R0CB 4NZ7A 4OI3A 4DSFA 4N8NA 2C3MA 2MQPA 2NXJA 3RJMB 3RBEA 3KHGA 2ALZA 5HVHA 3RB3A 1RHQB 2XLJA 8ATCB 1QSYA 1M1GA 4DCJB 3PW7A 1SUQB 3BEGB 1IR0A 2RQKA 5B0DA 4NRUA 3HSGA 2UXCF 4ECRA 3AQPA 3GIKA 5A0YA 3N0VA 1HBNB 3U1NA 3VHQA 3MDFA 4C8KA 2YQ3A 3J81j 2E5LF 4ZPDA 1VC0A 2YX1A 3TUPA 4P75A 2FZCB 6FD1A 2FHKA 4TNOA 4NCAA 1RTJB 2XI3A 2OMLA 4I69A 3AAWB 4RW7A 1CG2A 2X1AA 3KJNB 3OQ2A 3NWGA 3MR7A 2ATCB 3UW1A 4JI7F 5CD4A 3PIOQ 1NO8A 4LFAJ 1LXJA 5DLFA 2FHJA 3D1OA 2MGZA 2OSQA 3BO4A 1IUJA 1WHYA 1N6QB 1RQ0A 1JXEA 3PZPA 4CM0A 2ASLA 5FLXY 1QTNB 3TP2A 2DK2A 4DZDA 1Z1ZA 3SSQA 1JB0C 4DUYJ 4QPTA 3POTB 2KRRA 2R8HA 4R8UB 4YB7A 2DGOA 1S99A 3DC2A 3SZ2A 4ELTA 4ANDA 4A48A 3W64A 2EFNA 3DDKA 4KGMA 5F8MA 1Q95G 3AOCA 2UUCJ 1LW0B 2EW9A 3AT1B 3R1HA 3FSIA 4OZ3A 3GTYX 1UJ5A 5F3TA 4DL2A 2DNLA 4C7QA 2M2BA 1E6VA 3OR1B 2KT2A 1IM4A 3HHLB 5F8NA 1Q79A 1N32J 1D3WA 1H72C 4O23A 1L3KA 2J0QD 1D1UA 2WOMA 4RX6A 3LP1A 5LL6d 3ILLA 3NS5A 4IDKB 2I5JB 3I4HX 3THVA 2F8HA 4B3OA 4L6V3 3IS9B 2R7SA 2RU3A 4KHPJ 4FF4A 3DM2B 4U8YA 5JJBA 1HNXJ 1VRTA 1RLDA 2HHPA 4DCPB 2WVFA 2F1FA 2ABYA 1LWEB 5KFTA 2HNZB 2BJ1A 4AUKA 3PJXA 2CXEA 2RHQB 2MKIA 4QR1A 4NASA 4TY8A 3IWXA 4J9PA 4U7UD 4I7FB 1DURA 2OKQA 2U1AA 3R2DJ 3ZZTA 3MPVA 4HHJA 2D3UA 4F25A 1YQHA 4IG0B 2XMVA 5HN0A 4DOZA 2J6TA 4LVOP 4Q8FA 1SV5A 2AEFA 3J7YI 1S0MA 2VB6A 3LO3A 1XQIA 5F8GA 1WC5A 2HLTA 4DPWA 4GKKF 2NZ4A 3DOMA 1D9FA 3KLFB 2J76E 4HEA9 1DARA 2IJNA 2W2OP 2K06A 4ZMMA 2DH9A 2E9RX 4LF9J 3TANA 1QAIA 3G87A 4C2MA 4UT4A 2CQHA 1T9UA 5IT4A 2EBEA 1Z4UA 3FGVA 5DDRC 4ILMA 5IT9Y 3PVXA 1TUGB 4RKUC 4DG1A 5J2NB 2NYIA 4QQBA 3L7OA 2QLXA 2ZBIA 3QRPA 4WXWA 2A18A 1TL5A 2XSJB 2ZD1B 3M8WA 4GO7X 2F8EX 4NCGB 3MZIA 3DFEA 3MFHA 4C97A 2DNOA 1TL3A 4FF3A 2KYZA 2Z2LA 3OXLA 4DFKA 3BGRA 2K1RB 4C98A 3C3LA 3NOCA 3R7BB 1P9QC 2EXUA 3J80U 2WHOA 2JEIA 2A3JA 3AXKA 3KKFA 2KJVA 2I1RA 1F5AA 1RHJB 4U7CA 1GQEA 2NSBA 2P9EA 3PR4A 3OL9A 1JKHB 4AL7A 1TQLA 1ZM3A 4WWSA 3ILOA 3PY8A 5C25B 4KB7A 5F0UA 1IBKJ 4DV7J 3GR1A 4WCEQ 3CDBA 4MIBA 4OHWA 3QWUA 3FEZA 4FYVB 1ZM4A 5J2QA 4KPYA 1OY9A 2E66A 2CJAA 3FEXB 1RTHB 3CCSS 1NBEB 3QT7A 4NMLA 2JWNA 5L1KA 2IY5B 1JJHA 4LRCA 4WIIA 5DQIA 4USIA 2HKEA 2CPJA 4A8KA 3PW5A 3MM6B 3OUYA 2J9DE 5ETVA 2KI2A 5T41A 3LA0A 3WC2A 3BO3A 1WSVA 5K8OA 4GVBA 3TZWA 4FYDA 2RUGA 1FESA 3MEEA 5EWGA 2R8IA 1KD1T 3DXBA 1CBKA 3M9MB 2CNLB 3O8WA 3TQEA 1HQUA 4W92B 2BJ7A 1RBOB 3AODA 4OZNA 5C24A 2AZ1A 4RR5A 3V5RA 2AJ0A 3NS7B 5EUHA 1R0BG 4I6AA 1XTZA 5EHHA 3R97A 3AA8A 3K59A 1FE4A 4OZ2A 2Y1RI 4OX6A 3OBIA 1QVGR 3UQSA 4XAKA 3G82A 2K7KA 2AEJA 3VV2B 1K0VA 1X5SA 1VHIA 3TX0A 2GMLA 3N79A 5D3GA 3R5GA 1ZH5A 3DU5A 2QMUB 3CVKA 2E1PA 4B3SJ 1OS5A 2KXFA 2XS2A 4KYZA 1CEZA 2RB7A 3PW2A 1HWKA 4NMXA 5BR8F 4UZBA 4B9NA 2XGPA 2MY7A 3D1HA 3DGPB 4L76A 3UCUP 3Q23A 2OLWA 5ETPA 1V9OA 3PKMA 3ENVA 4ED7A 2V68A 1KQKA 4OYBA 4P7VA 2HEKA 2PIIA 2DITA 3A3NB 1FTRA 1VMBA 3PX0A 2GJ2A 1U0SA 3ULHA 2ZUGA 3FKBA 1N5SA 1JK9B 4DR4J 2R8KA 1VGYA 5E33A 3W1YC 4L3NA 4NX9A 4MTPA 4OX9F 4ICLB 1TUVA 4RZRA 5DM6Q 2JNJA 4AQYF 2KH9A 1X9SA 1VCTA 4Y34A 3M8PA 1TMJA 2DYAA 3O1LA 4B02A 4DL5A 1U25A 4QW9A 1KVJA 1WTFA 3A8EA 1AW0A 1SIZA 4X4RA 4RW6B 2GVDB 1RT6A 2CZVC 3D5MA 2YKNB 3I0RA 5KFAA 1T03B 3M2RA 4WFZA 4DV6J 5KAKA 2HLUA 5KG2A 4NA1A 4GC7A 1OYDA 3GONA 1RACB 3PEHA 1UETA 2R7XA 2D41A 2LDYA 4ZCLA 3TEGA 4LF4J 1TFWA 2H65B 5KOXA 3A1YG 4JI4J 2HQFA 3BGFA 4X4TA 2HWIA 2DGXA 3BSCA 1NSAA 1S72S 3MCOA 4YDXA 4N7TA 2POKA 1CPZA 1S9FA 3C16B 3IM9A 3S8SA 3HVAA 2QFIA 4FVCA 4TU9A 4ZHRA 4X66J 4ZVHA 1XR6A 4QW8A 2HFUA 5CYMB 2CYYA 1M5OC 3AHPA 1WEXA 4CQ1A 5LMUF 3VVUA 1R43A 4PQUB 2OPPB 3OR2A 4PG7A 1RTZA 2DNYA 1H74A 2RDJA 5E7OB 1H38A 1N5TA 4FXVA 2AIRB 4KFBB 3DKDA 2ZE2A 4LF7F 4XTTA 1D8YA 2NZCA 3EYZA 1DLOA 3Q2TC 4O3SA 3BKFA 2HNYA 4YY3J 2RNEA 2R2RA 2ADCA 4DFMA 5CYQB 1T9TA 4TQRA 3FFIA 2Y8YA 3IAS9 2CQ3A 1TAUA 1IKYB 1U1PA 3I5CA 3K2YA 4NOHA 1HIYA 3W65A 2QTWA 3M8RA 1PJ5A 4LF1A 4EMDA 2HGLA 1YX2A 2W01A 4HT5A 2M7SA 1FX2A 4F7VA 1XMBA 1XMOJ 1NMEB 4QZVB 2PD1A 2H48B 2PMHA 2HQDA 5DJBA 3KLGB 1FI4A 2HNDA 4K2JA 1RYRA 2YWGA 2E29A 4M5JA 2COLA 2JEJA 4TKTA 4J9QA 2CDRB 2VG5A 3B4MA 4USUA 4K4WA 1YBUA 2K2PA 3MUMP 2OGUA 1Q78A 4GKJJ 5DGBA 4J9VA 4RJVA 4BC9A 2J9DA 2YNHB 3GIRA 1S1VA 2E5HA 4DS5A 1GX6A 4ECVA 3DYAA 2GFFA 2RDIA 2BANB 2IYIA 4QWCA 2LU1A 2HG4A 1MW7A 1JLEA 2IM1A 1WC4A 3NOGA 1TKTB 2W1BA 4DR7F 5K14A 1VOMA 3Q22A 4DN9A 1IBLF 5IOLA 5L8RC 1DQ9A 1TKZB 1N34J 1RAJA 4LFBF 1TUWA 3W8GA 3OHAA 1UVNA 5GAHU 1N33J 5IS2A 3FMBA 1S6UA 4LRDA 2M8DB 5KTQA 5FDLB 3LAKA 2LLZA 4FNIA 1O5JA 3FEYB 3BDPA 3HM9A 5LMNF 1EP4A 2JEFA 1LW2B 2CPIA 5KFXA 1OJ4A 1T05B 2W9CB 4RU9A 1IBMJ 3A8IA 3NAHA 5DO2A 5KG1A 5GAEU 1S6PA 4QYZK 3PRVA 3AB2B 2QLJB 2FGCA 2BQRA 4RBVA 3CCLS 1RWXB 4K7QA 4YEAA 5HJYA 1YJWS 3D0IE 2MB0B 4J9LA 2FVCA 4DR2J 3QATA 5AJ3J 2F3JA 2WCXA 3KK1B 3GIIA
chains in the Genus database with same CATH topology
3C46A 2J5AA 3DLKB 2IFXA 1ROFA 3B4DA 3CIMA 3IFEA 1Q8LA 4F3MA 2CKWA 4BC7A 1S1XA 1VQLS 1KTVA 5L9NA 1R89A 2DCUB 4O44A 4DR2F 1ZZFA 1Q4RA 4I6YA 1SBRA 1CQMA 4AE5A 5AJ3F 1FKAF 4C0HA 1RJJA 1UVLA 3R5BA 5BYRA 3IR7B 4M94A 2MZSA 4B3MF 1NK5A 2MKKA 5KFYA 4I2PA 4C8NA 1HW9A 3ISZA 1U09A 2V8GA 2HS0A 1P1LA 3OUYB 2JZ5A 2FVPA 2JSXA 2IMWP 3M2UA 4HI1A 2GGPA 4OLOA 5J1NA 4RNNA 3KLVA 3WC0A 2NS1B 1DTQA 4QIEA 1PO6A 4IR1A 1IXKA 1AUDA 1DRZA 2J7KA 4O4GA 1XR7A 4M8LA 1SJRA 1C0TB 2G9OA 2DNHA 2Y1JA 3I87A 5BYQA 1KOHA 2I2YA 1QJHA 2B4UA 2VQFF 3ZZ0A 1S7HA 2H9ZA 3WZ0A 4ES3A 2GC8A 3G6XA 2D7SA 1XEZA 2R7VA 4DBQA 5HBMB 2A2DA 4MIAA 5A2QY 1X4EA 4NLWA 5HLFB 5KFIA 2CQ2A 4IG3A 3TRGA 2DH8A 2BVZA 1FT8A 1HHSA 1K1QA 3MEEB 3R5CA 4FVMA 2XY7A 5EX0A 3OVAA 3LP0B 2YNGB 3KNGA 4N76A 4N56A 3OFGA 1KN6A 3C2PA 2QFJA 4QBUA 2ZZMA 4X2BA 2NLWA 3LWMA 2KTQA 2LCWA 1ZAWA 4QJVA 1UVMA 2GHVC 3KOAA 5L1IA 2DRBA 2GJIA 3PNIA 3C6UB 3H2UB 1HQUB 1H7XA 3FJ2A 4TLQA 1S77D 4CTAA 5J1PA 2W4CA 2IA6A 4M5DB 2F4VF 5CH7B 1VQ5S 4C0BA 2E5IA 3PDNA 4FN5A 2EC0A 2W9AA 2GO9A 1LOUA 2E7WA 4Y2AA 2WTFA 2B4OA 4ZPCA 1BQMA 2DRAA 5C24B 1HWIA 2KXHA 1HA1A 4KR0B 5E3QA 4DV2F 2CQGA 1VHFA 1O51A 4NXMF 1RKJA 1P1TA 2YWEA 1JMTA 4OX7A 5F8HA 5KFZA 3BGLA 3UNGC 3CCWA 2KFYA 1DTTA 3DOKB 5ITHA 3K7RA 1J2VA 4H4OB 3N28A 3IG1B 5I4MA 3MEGA 2XS5A 5AE1A 2HHUA 2HAIA 1ZETA 3LANA 4OZJA 1AFJA 1X4HA 1Y0HA 3JTNA 1IJFB 4CO0A 3QPIA 2KZMA 1GX5A 5DDPC 4OZ5A 2MZRA 3MM5B 1S0OA 2J9CA 3F56A 3JSMB 4B08A 1TK5A 1HPZB 1RT7A 2VG7B 4A8OA 2HHVA 4U7UK 3MR3A 1SXLA 1H2UX 2KRBA 1SKSA 1L3SA 2RU9A 1ZM2A 2VASA 3TR5A 3PO4A 3GYNA 2HVIA 2DGVA 2VBXA 3FZBA 2M5YA 3BB5A 1C1CB 1S79A 1SUQA 3MM7B 3CGIA 2PO4A 4OMFG 3T6JA 4QPXA 4A8MP 1BWEA 3IR6B 1XNQF 1EETB 3IXQA 2SXLA 3PKYA 1T3OA 5HQ8A 4XIUA 3DGPA 1GXUA 1HBOB 1UMJA 2FLOA 4WFYA 4DV1F 3H4BA 2OH2A 2KFNA 2Q43A 2YWKA 4JOUA 1S10A 4YB6A 1UVKA 5CXTA 5D6GA 1K9MT 3EPGA 5I3UB 1UFLA 4KHRA 2VFSA 2G4BA 2MY8A 4WKYA 3GWCA 3KMQA 5F41A 2X3GA 3H2LA 4Q0BB 1HBNA 1HR0F 2BRLA 3T3FA 4X65F 1UWBB 1DQ8A 3OTCA 4WFXA 4A46A 4Y00A 4OJ1A 2UUTA 1H7WA 1HYSA 3I56S 2F9JA 4KKOA 5I42B 4V19J 2AYBA 4I56A 3MHYA 3TAMA 1J5OB 2HWTA 1TV6B 1Q8IA 4C8YA 1K8AT 1U6BA 3VZHA 1WEZA 4EEYA 4XDDA 3IGVA 1NKBA 1MROB 3DDNA 4ETZA 5B09A 2JEGA 3RB6A 3M8SA 3G8QA 4IFYB 4EZ6A 3SQGA 3TUJC 4L72B 2IVYA 1RTJA 3B82A 3RRKA 7FDRA 3QAEA 1U47A 3E01B 3T5JA 3PX4A 1MMLA 3GFXA 2EFOA 5F8IA 4X62F 2JC0A 3NAIA 2IHR1 1RGVA 2AYMA 2HYIB 4MKYA 1RT2A 1BQNB 2CQIA 1C4AA 4ICLA 5KFKA 1OSCA 2VKRA 4QYZJ 3TAPA 1C1BA 1XK8A 3PXGa 2VFUA 3N01A 2W9BB 4HL9A 4KSEB 4X4PA 1ZZNA 4ZCIA 5I3QA 5KFPA 2D9PA 5CCLA 4MMOA 1MU2B 2MDAA 3GG1A 4NYZA 3RZAA 4ZLPA 2BA9A 2DR8A 3EX7B 2Q6CA 5B0AA 2WB1D 1KQFB 4ZCMA 1N6QA 3B78A 1FEEA 2UVVA 4RW6A 1U6FA 2V4JB 2XLIA 2YKNA 1AXQA 4GC6A 4PRFA 4KC5A 2PEHA 4RNOA 1QSSA 2VPXB 4C4WA 2HIQA 1JLBA 2VZ9A 1IQZA 4PXBA 4DLGA 3M8PB 1FA0A 5MLCV 2B9YA 2JH3A 2RE1A 3M32B 4F4YA 1NK9A 2DVIA 2CZ4A 3F41A 1I1GA 1MWZA 3J7YU 3WDOA 1X5OA 2PN6A 1FKPB 5DGAA 3T5LA 2AU0A 2RILA 1C4CA 3HX9A 3R5AA 3MMBB 1UEUA 3H25A 2MXYA 4AYBD 4QR0A 1CC8A 1I94F 3I55S 3I0RB 2QMWA 3GSDA 3O6QA 3GR0A 1M0SA 3NCPA 4B3TF 2ZOFA 3M2RB 3KTQA 4J9MA 1FRXA 1LW0A 3V4MA 4ZPTR 3CDWA 4RWXA 2M70A 4DL0C 2XGQA 2HFZA 1FJGF 1OWXA 2VL1A 3MURP 3QGPA 2RS8A 4WYWA 1HNVB 2F8MA 2XS7A 4WZMA 4ZPBA 1WG1A 1Y5LB 4R5PB 4RBUA 4ZPAA 4IO9Q 4Q2LA 2IAJB 4DL3A 3BDEA 2CPEA 2OP5A 2BE2A 4YR0A 3VAFA 2H5EA 3MM8B 3DHWC 4QWBA 5LT5A 4Y6IA 4OZ0A 4WZQA 3HHLC 3U1MA 3CD6S 1BGXT 1SQEA 3OR1A 3OXFA 2B5JB 2GIQA 3HHLA 2OPQA 5K5MA 5M2RA 1YHQS 3VTIA 2XCAA 5H9EJ 3BSAA 1VK8A 1SJ3P 2P5VA 2DNZA 2J0SD 2WONA 3VZIA 1S6QA 1IKVB 5CZVA 2ZVSA 3JTOA 2CQDA 2KXNB 3P96A 3CD7A 2F9DA 3TA0A 2DPIA 4ECSA 4IUFA 3MR2A 2RT3A 2PMZD 3ZZZA 1JLQB 2VBYA 1ZPVA 5D4OA 2DNQA 5LXYA 3T9NA 4PWUA 1UEVA 3V6KA 1V6HA 1DJ0A 2AQ4A 3HHLD 2DHAA 2Z4PA 3G96A 1M5KC 2PC6A 1RTIB 4PQUA 2OPPA 1AFIA 2AYGA 4ZPVR 3SCJE 4ZP9A 2HFOA 1TAQA 3JSBA 3HVTB 3H5UA 5DS7A 4WFBQ 2VA3A 3HK2A 2JX2A 4N5SA 3LH2S 1VQ4S 2QA4S 1FXRA 4ZVGA 1T02A 5KFLA 1TKXA 3IA0A 2QZ8A 3DM2A 2YWHA 2OO4A 4H4MA 1IKWA 5C5JA 2LEBA 4ZHRB 4C8LA 3NNHA 1JIHA 4PXDA 3FRYA 3GMGA 2WB4A 1BLUA 4G1QB 5E5NA 1N0VC 4URGA 3CIZA 2DNNA 3LP1B 3RTVA 2D3OR 4F02A 1KS2A 3N6MA 4CO4A 3TO8A 2VOPA 4ITSA 4YHHF 2J6SA 1NH7A 2FJAB 3IO1A 4NLQA 2ZHAA 1F5BA 2R7OA 4B3OB 1JLGA 2GCFA 4J5OA 3OR2B 3MMAB 4ZOSA 4EYIB 3PR5B 2YKPA 4XK8C 1YJVA 4LSNB 3G8SA 2DJWA 2IRUA 1B0TA 2M52A 2D9OA 4EO8A 2N7YA 4DMZA 5KG4A 1RI7A 4C11A 4HLBA 4N47A 2BV3A 3VQSA 3AJ1A 4M63A 4QR2A 1VRUB 3FQKA 3CDUA 1VRTB 5CYQA 2BXJA 4I4BA 1PSDA 2XO7A 5I3PA 3VAHA 1D9DA 5IM0A 4MK7A 1RISA 4BDPA 2N3LA 2L9NA 3RR7A 2W7PA 1GTEA 4UY85 2MSTA 3MWBA 4LIWA 3DLJA 1HBUA 1RP5A 2BM0A 2FJDB 4KO0A 1IKYA 3GFZA 1FJCA 1RT1B 1DZ5A 2EK6A 4USHA 2E7XA 2FGOA 2VBZA 3WBZA 2MHEA 2CFXA 3RAXA 1UVIA 4IRKA 3MM9A 4DX8H 2BUNA 2IC3B 4Y0FA 5HMZA 2RF2B 5HL7Q