1O0SA

Crystal structure of ascaris suum malic enzyme complexed with nadh
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
602
structure length
602
Chain Sequence
SVAHHEDVYSHNLPPMDEKEMALYKLYRPERVTPKKRSAELLKEPRLNKGMGFSLYERQYLGLHGLLPPAFMTQEQQAYRVITKLREQPNDLARYIQLDGLQDRNEKLFYRVVCDHVKELMPIVYTPTVGLACQNFGYIYRKPKGLYITINDNSVSKIYQILSNWHEEDVRAIVVTDGERILGLGDLGAYGIGIPVGKLALYVALGGVQPKWCLPVLLDVGTNNMDLLNDPFYIGLRHKRVRGKDYDTLLDNFMKACTKKYGQKTLIQFEDFANPNAFRLLDKYQDKYTMFNDDIQGTASVIVAGLLTCTRVTKKLVSQEKYLFFGAGAASTGIAEMIVHQMQNEGISKEEACNRIYLMDIDGLVTKNRKEMNPRHVQFAKDMPETTSILEVIRAARPGALIGASTVRGAFNEEVIRAMAEINERPIIFALSNPTSKAECTAEEAYTFTNGAALYASGSPFPNFELNGHTYKPGQGNNAYIFPGVALGTILFQIRHVDNDLFLLAAKKVASCVTEDSLKVGRVYPQLKEIREISIQIAVEMAKYCYKNGTANLYPQPEDLEKYVRAQVYNTEYEELINATYDWPEQDMRHGFPVPVVRHDSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAD-dependent malic enzyme
publication title Crystallographic studies on Ascaris suum NAD-malic enzyme bound to reduced cofactor and identification of an effector site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 219
structure length 602
sequence length 602
chains with identical sequence B
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1370.30 Mainly Alpha Up-down Bundle Hemocyanin, N-terminal domain Hemocyanin, N-terminal domain 1o0sA02
3.30.2330.30 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold arginine biosynthesis bifunctional protein fold 1o0sA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1o0sA04
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1o0sA03
1I2BA 2CMDA 2HCTA 1UP6A 3RROA 2NTVA 3WQSB 3H2SA 2BF7A 2PGJA 4AFNA 1ADCA 1PS9A 2H5LA 4EDFA 1H6CA 3DAPA 3I6IA 3UCFA 1FDUA 2VQ3A 4HWKA 4JBHA 4XRRA 4BMVA 2FY8A 1HDGO 3VC7A 2YY7A 4E2WA 3DZJA 4XDYA 1DO8A 1ISFA 4MO2A 3GR6A 2B4RO 5T64A 3W6ZA 4BUCA 4JK3A 1YDEA 3IJRA 3GA0A 4R54A 3KLPX 1PZHA 4D43A 1GFSA 1WZEA 1NFRA 2HDHA 4TROA 1ZIDA 3KYBA 3DONA 1LDGA 3GN1A 5FI5A 3VH3A 6LDHA 4RV9A 1JU9A 3L4SO 3TPCA 1U3WA 4B8WA 2X58A 2FWMX 1L7EA 2C82A 4CR6A 3NUGA 2WM3A 1TEHA 4L9RA 4Q9NA 4DQUA 5IXSA 2X5OA 2X86A 2VUUA 3D3WB 2Y1EA 1DC5A 3KYDA 3SXPA 5A3JA 4QSMA 4FJ0A 3TZKA 3RI3A 3I4FA 3U4CA 1IB6A 2H9IA 5TS3A 2FPPA 4OQZA 1VL0A 1QYCA 9LDTA 2NU6A 2C5EA 3VPSA 4W99A 5G4KB 2EERA 3KB6A 5ITVA 3H2ZA 5EESA 4R1SA 4EUFA 2HAEA 2V6FA 2YUTA 3RKUA 3Q9NA 3UH1A 4D41A 3JYOA 2G17A 5KJCA 3WICA 3QWBA 1SEPA 1UXGA 3KO8A 4BGEA 3WGTA 1YWGO 1O94A 1DXYA 1AXGA 2X0IA 3GGOA 3PVZA 1BXKA 4AJIA 5I9LA 4U8GA 1XKQA 2Y1FA 5CP8A 8ADHA 1D7OA 3UCEA 5JAZA 2DUWA 1KIFA 2FR0A 2B36A 3MJCA 2A94A 5COQA 1DEHA 3Q2IA 1P1FA 2X8LA 2VRBA 3INGA 5KVCA 4IBOA 4CUZA 1WMBA 1D3AA 4NMHA 4Y8VA 3PK0A 2UAGA 5A04A 4MIEA 3T4XA 1GQ2A 1Y8RA 2NVUB 4K6CA 2DPGA 4JP2A 3HHPA 1EFLA 3I1JA 2O7QA 3DTYA 1VKOA 3U4IA 4GX0A 4XR9A 1LRJA 2O23A 4XJSA 3B1JA 1ENZA 1GQYA 1YXMA 1DRUA 4N5MA 5DBIA 1WLYA 4CV3A 1X7DA 1T2AA 5JC1A 3BAZA 3GC6A 1EFKA 3IJPA 4FGSA 1Y6JA 1PGQA 3IOYA 2C07A 4CM8B 2DTEA 5G0SA 4BNVA 3L9XA 5CPFA 2PY6A 1YONA 1QORA 3WGOA 2Z95A 2DQ4A 1U28A 4O0LA 5L4LA 1OC4A 1RM5A 3ADPA 4IINA 4KTTE 4OKIA 3RC7A 2P5YA 4WK6A 2BD0A 1BXZA 1XHLA 2C7VA 3R0IA 3ZNNA 3DEYX 1JKJA 4FIZA 4QQRA 3KRTA 1MG0A 2WE8A 2VRCD 1TI7A 4D42A 1JVBA 3OQ1A 1DIHA 1EQ2A 1NYTA 1UXHA 3GPDG 4BNNA 4URFA 5DT9A 2RH8A 2GN8A 3EVTA 4R51A 3WTCA 1XR3A 5DDIP 1PZEA 3WIEA 4UREA 1I10A 2YDXA 1CRWG 1P3DA 3TF5A 2IRWA 2JAHA 1I2CA 2EP5A 2BKAA 3GZNB 3ANMA 1TVEA 2B0JA 2JD0A 4CR7A 2ZATA 2PZLA 4J91A 1NAIA 4XB2A 5TX7A 2NNLD 2WYWA 4PZCA 3WNQA 4BMNA 5KTKA 1ADBA 4TVOA 4IY1A 2OMEA 1HE5A 1ZZEA 4YJFA 3OIFA 2OBNA 3O26A 4CL8A 3MTJA 3WGQA 1K6XA 2O4CA 5EQFA 2VWHA 4E12A 1NWCA 4QO7A 5LCXA 3H5AA 4NI5A 3KLMX 3V5NA 4CLXA 1LUAA 5IFLA 3GHHA 5C7OO 5I7SA 4E3ZA 1U8XX 4F45A 2X5KO 3U4HA 2AQIA 3NTRA 4AJHA 1GL3A 4EUHA 3F46A 1T2EA 1DFHA 3PPIA 4CLRB 4PVCA 1W8DA 1LRLA 1DC3A 1IYZA 4KTVE 3ABIA 5T57A 1C0PA 3WGGA 2I9PA 1OBFO 2TMDA 3VPXA 2P9EA 5L51A 2PH5A 1GU7A 3RSHA 3ZNQA 3L6DA 5KWEA 1DSSG 3WSVA 1VSUA 2DPHA 5BSGA 4Q3CA 1MGOA 2NU9A 4XKJA 3UGKA 2Q50A 3QLJA 4OSPA 3PDUA 1I5RA 1LSUA 2Q3EA 2GN9A 3I6QA 1ONOA 1LI4A 2EGGA 4R1NA 1H6BA 5AXAA 3WS7A 3CZMA 1J49A 4MINA 1E3WA 3DMYA 4GSKA 4MIOA 2GR9A 4BB6A 1ENOA 2X4GA 3PGXA 3K31A 3WGHA 4J16A 2ZB3A 3MCVA 5DN9A 5EPOA 3EUWA 4OGWA 2B5VA 3VZSA 1XQ1A 4AJ1A 1VE9A 4N5NA 4CMJA 4R3WA 4RVHA 4TQGA 4CM9D 1EMDA 5JDIC 5T8KC 1C1XA 2D3TA 1NHGA 1WNTA 2I3AA 4JBIA 3CMCO 3JQ6A 5GZ6A 4QXMA 1LU9A 2IYPA 3DZKA 4HY3A 4RVSA 4D46A 2VZ0A 5TLSA 2JCVA 1ML3A 1RM0A 4BO5A 3CIFA 4UAGA 3FSRA 4A0SA 3M1AA 1UDBA 1HSZA 2PH3A 4MOWA 1ZXBA 4OO3A 1NBOA 1IL0A 4LMPA 3F5QA 5U1PA 4D7AA 3DAFA 5KKAA 1GEEA 3ST7A 3PTZA 4ROSA 3ZNPA 1R4NA 2HO5A 1I3KA 1NQOA 3FRJA 2A4KA 3ZWPA 1U5AA 4FJ1A 2XF8A 4HFNA 1XEAA 2EHDA 4ZQGA 1L7DA 2AXQA 2W4QA 2VOEA 4BO2A 3ZWMA 1WAMA 4B7XA 2D5CA 3VKUA 1DLJA 4NU5A 5GMOA 2AG5A 2NADA 2C59A 1B8VA 5DOZA 4RVFA 1RM4A 2VT3A 4YACA 5FI3A 5BSHA 3K2EA 4UVGA 2H6EA 3LF1A 4J4TA 3QE3A 3NEPX 4CJXA 4RQUA 2GF2A 2NM0A 3WMWA 1EBFA 1DLIA 4IDAA 5TT1A 4CM4A 4DWVA 2F1KA 3WMXA 1V3VA 2B37A 4F6CA 4R69A 2YQ4A 4RVGA 4ZRMA 2I65A 3IKVA 4EZBA 1Q7CA 1E5LA 5JNLA 1UZLA 1XG5A 4IQ8A 1NFFA 4KWIA 5A9RA 3N74A 4LMRA 4EJ0A 5KOIA 4H15A 2FPGA 4FB5A 3VH2A 3AK4A 4GMFA 4Z3DA 1EUDA 5IDQA 3DQPA 4Y9DA 4I1IA 2JAPA 3MTGA 3OQ6A 5IG2A 3O4RA 1JKIA 4RPKA 1B8PA 5F1OA 2NVBA 2CDAA 4DYDA 3RUDA 2Y99A 3FPCA 1IUKA 4E2XA 5IN4A 4J0EA 4XYEA 1RM3A 3HDQA 4L74A 2BI8A 1H5QA 2Z5LA 1PGOA 1G0OA 2I67A 1QP8A 1K5HA 3I4CA 2HMUA 3M1LA 3SJ7A 1DAOA 4UUMA 3VVCA 1N7HA 2EP7A 4NJOA 3W4IA 1NR7A 1Z45A 3D4PA 3ROKA 4FDAA 1LTHR 1U2GA 4IIUA 2C7GA 2O50A 1PSDA 1MXFA 1CEQA 3CINA 4D3SA 1I2ZA 4B3JA 4B4VA 4JBGA 3OJOA 1JN0A 3D64A 3SC4A 3DXFA 1GUZA 2B4QA 2NVUA 2G0TA 3ICCA 3RUCA 1DHRA 3TFQA 5CG1A 1MG5A 4WECA 4J7CA 4IGEA 1P77A 3CTMA 1G6KA 4PG7A 3FNGA 3I52A 2G5CA 3KYDB 3ORFA 3FNEA 4DQVA 3KZVA 3RUEA 4DLBA 1XSEA 3E9NA 4RPGA 3BHIA 3GUCA 4MKXA 4DIFA 1NPTO 4IJVA 1XELA 2PGLA 4CLDA 3EYWA 1HKUA 1SB9A 1VL6A 1X0XA 3NAQA 4PFJA 1B3RA 4BHTA 2YHIA 3KEOA 4QT0A 2JL1A 2RH4A 2Y67A 3F6YA 3L4BC 5TT0A 3IUSA 2D8AA 3DZFA 4M86A 4GH5A 4RZHA 4W6ZA 1K89A 1P74A 3C1AA 3AM3A 4JNKA 4LGVA 3T4EA 3BXXA 1MLDA 3E5MA 4ZD6A 1MXHA 3DHYA 3H9GA 4TZKA 5DBFA 3AU8A 3DZHA 5AQ1A 2G1UA 4YAJA 1ZUD1 5KCZA 5L95A 4II2A 3GLQA 1W6UA 1EE9A 1NTOA 2H63A 4KZPA 3HQ4O 2IXBA 2VHZA 2ZQZA 1KY5A 2I66A 2Y0EA 1GYPA 1ZO8A 1GY8A 2OUIA 4PG5A 1DFIA 3P19A 4K1LA 3DTTA 2GASA 2ET6A 1DBVO 3OEYA 3RJ5A 4K28A 3RUIA 3C7DB 1N1GA 1FDWA 3JQAD 3LT0A 3FR8A 3TDKA 3TZHA 3ZHXA 2VYND 4XGIA 5FEUA 4CQLA 3SC6A 2FMUA 4F6LA 1JWAB 1Y8RB 1YQGA 2NQ8A 3DB2A 1ZW1A 2P9CA 1U7HA 4IGFA 5JY1A 3ZW9A 4WLEA 4YAGA 3NDIA 1NQ5A 3NJ8A 2HK8A 1G1AA 5A03A 1DC6A 2E49A 2Q46A 4Y98A 5G4LA 1BWSA 1KEWA 4XQ9A 3TZQA 1M2WA 4R41A 4PG8A 4OHUA 3AW9A 1R0SA 2VYVD 2R6JA 4KQXA 1KS9A 1X1TA 4J90A 1U3UA 3JCZA 4YVFA 2VT2A 3DWFA 3S8MA 1HEUA 3SEFA 2H1SA 3DFUA 4HFMA 2EW2A 4CV2A 4WCDA 1ZSVA 5A05A 3T7CA 3PQEA 4J3FA 1YB5A 2VTDA 2CY0A 3AUUA 4MP6A 4NBVA 4BGUA 1K6IA 1UAYA 3FNFA 1NQAO 3PI7A 1H9AA 2PKQO 2G76A 2ZTUA 3FBGA 5FFFA 1E3JA 1LSOA 7ADHA 2O3RA 5JAQA 3WYBA 1MA0A 1FJHA 4ZN6A 3K73O 4D3FA 4J1NA 5IDXA 2J6IA 2PGDA 2I6TA 2WYUA 3FD8A 3AJRA 1PL7A 2QHXA 1MX3A 1DOHA 3ZV6A 3DOCA 3QRWA 4OMUA 2AEJA 4IXTA 4OQYA 5F5LA 4J9VA 4AG3A 2CUKA 2OP1A 2NWQA 5TSDA 3N58A 4TZTA 3VAZA 1HYEA 4II3A 2X6TA 3HWRA 4DPLA 4BKUA 2C2XA 1CIVA 5FF9A 3BMOB 1BDMA 4BO4A 1E6WA 1DIGA 1R0KA 4K26A 3RC1A 4YJFB 3GVCA 1MB4A 2FOIA 4E2ZA 1HWYA 4CM1A 2RAFA 4B4OA 3D4OA 1Y5RA 3DZBA 4P4LA 4PLTA 3WFJA 5C5IA 1EVJA 2WTBA 3A14A 4DREA 1PQPA 4FCCA 4BIIA 3JQDA 3QQPA 3GG9A 3H9UA 3R6DA 2IZ1A 2W8ZA 4IJUA 5EMHA 1ONNA 4U6QA 3AWDA 4YT5A 2GGSA 4IS2A 3QVSA 1KEVA 2IYOA 5TIIA 1LLUA 3D4NA 1LX6A 4GPD1 4WNIA 4U7WA 4GLLA 1SNYA 4E5YA 1EK5A 4KUGA 2CFCA 3PJGA 3S55A 2WMDA 3L9WA 4MVJF 3CE6A 4AJ4A 1EVIA 4DGSA 3W8DA 3CH6A 1PS8A 2P91A 1NQTA 1ISIA 3WX0A 4FS3A 2NVWA 4NBTA 4RQTA 3WB9A 2ZCVA 3K5PA 1D1TA 3MJ4A 3RQSA 1OFGA 5ADHA 3GQVA 3GMDA 1GZ6A 2JJYA 4S1VA 1HDRA 8LDHA 4CMIB 2DBZA 3RU9A 4OYRA 1E3WB 1HDOA 4Z0HO 1AHHA 1Y9AA 4PLFA 3FN4A 3N7UA 1M76A 1OMOA 3O03A 1V35A 4DMLA 1O95A 1PJBA 1PGJA 4E5PA 2WD8A 4TRNA 2C5AA 5EINA 5I7VA 3WG9A 1H93A 3E03A 3UF0A 5DCUA 1JVSA 3LSYA 1VJ1A 3COSA 4QECA 1PL8A 1UZNA 3GFGA 1F06A 1A7AA 3L6OO 4ONEA 1C1XB 1O9BA 1UZMA 3EDMA 5L7TA 3B70A 3OETA 4JCOA 3D5TA 5KVQA 3H65A 2HKIA 2A92A 2GZ3A 2ZB4A 4M89A 4OKNA 4P4GA 4WLNA 1NNUA 3NDJA 3GOHA 4N7RA 1NVGA 1YL6A 4L73A 3E9MA 3JQCA 1ZVMA 5JMWA 4BNJA 4WJZA 3GG2A 3WOHA 1HLDA 1Z73A 5JSFA 4IMRA 1YQDA 3VH4A 3NT2A 3GH3A 4ZQFA 1MFZA 1R4NB 2YV2A 5I7FA 3I9JA 4YT4A 4ZU3A 1UJMA 4NBUA 4E13A 4RJTA 5J23A 3Q0EA 1LSJA 5B37A 3ROQA 1RWBA 2FZEA 2J5RA 3AUTA 2FSVA 1OZAA 1VI2A 2O3JA 1RYEA 2UUPA 4W82A 4W9NC 1ZKMA 2GO1A 5ILGA 1WW8A 3PWKA 2WYVA 5KJEA 1Z75A 5IJZA 1QMGA 3U5TA 1B2LA 1QV7A 1U1IA 4UEOA 4PLYA 2PD6A 5IF3A 1Q2XA 2W2LD 1E7QA 3OEWA 4AJNA 1PZGA 4RL6A 1T2DA 2V6GA 1WZIA 4FD3A 4PLZA 3KOUA 4TKMA 4IDBA 4WLFA 4CM4B 4CMCA 4BKPA 5TJ9A 4R1TA 4BO3A 2Y68A 4IIVA 3JYNA 4QEDA 4MPDA 3NT5A 2VNSA 3HFSA 4MKZA 4QFCA 1GCUA 5DF1A 4P22A 2YV3A 3LT4A 2PKRA 3C24A 3SX2A 2P4HX 4PLPA 4L4SA 5EERA 5ER9A 4RF2A 1GPJA 2Q45A 2PK3A 4DUPA 5C3MA 3WFIA 1EUCA 3QWAA 2J5QA 5A9SA 4AJJA 4RLSA 4NFHA 4QFDA 3QVXA 1X15A 2QRJA 2DTDA 4E4YA 1T4DA 3TZCA 3IL2A 1CQIA 4UUOA 2OOSA 4I9UA 4TSKA 1A72A 1HYGA 4HBGA 4D0RA 5ILOA 1KEPA 2HMSA 1NHWA 1ZK3A 4FPXA 4EYEA 3Q1LA 3QWFA 2HRBA 4UVDA 1ONPA 5JCJD 4M87A 1QSGA 5JAIA 3JD1A 3L4BA 3UXYA 2BMAA 4WASA 1AUPA 1ZMTA 5DZSA 4LVCA 2A35A 1HYHA 3VOSA 3GK3A 3EVNA 3PHGA 3GRKA 4O59O 3RIHA 4MVJI 4ND3A 3RWBA 4O1MA 5HRUA 1UUFA 2AE2A 3QVTA 4D44A 4FGWA 3ZDFA 4BNWA 5JFOA 1HE2A 2YW9A 3T7EA 4E5NA 4AJPA 5F5NA 1U3TA 4YR9A 4PLWA 5BR7A 3GUYA 3GVHA 2WDZA 2EGHA 1GEGA 2Q1WA 5BSEA 2O3UA 3HE3A 4RF3A 4RCVA 4DXHA 4AJKA 2DBRA 4IJKA 1KC3A 2DAPA 5KVSA 2YHIB 3QSGA 1MFPA 5HS6A 1PR3A 3C7CB 4LISA 3AU9A 4YRBA 5L7YA 3QWIA 4CODB 1N7GA 1VL8A 2SCUA 4ALMA 3DBRA 4IM7A 1YOVA 1C0IA 1Z74A 3BTUA 3AM5A 3OH8A 2Z1MA 3DBVO 2AQKA 2EIHA 1BRMA 3ZV3A 1QLHA 2VHYA 1T1RA 2C2YA 2ZKLA 3KXDA 4FW8A 4RPLA 4B8ZA 4DYVA 2PFGA 5AXBA 1P0FA 3AY6A 3QJ5A 1Z6ZA 3ZWCA 4TVBA 2Q1UA 1RKXA 4BNIA 5B1YA 5JW6A 4KUHA 2P68A 1JAYA 1P44A 1ADGA 2PV7A 4LK3A 4DVJA 5EL0A 4D45A 3CSDA 2YDYA 5IZCA 3ZCXA 3C7AA 3NTQA 2WD7A 4WEQA 3ZH2A 4I5GA 3WJ7A 1XLTA 3FBTA 1NX6A 3RUAA 4BMSA 3ZU4A 4GKVA 3BMOA 4GVXA 3ZV4A 4B79A 4CQLB 1BTOA 1PWZA 5EQDA 2X0JA 1IHYA 5JXWA 1DFGA 4XYGA 2NUAA 2J3JA 1EDOA 1ZJZA 5AYVA 4L0QA 1GV1A 3S2FA 3RKRA 4C4OA 4MP8A 1GPDG 1MC4A 3JTMA 3EGOA 4Y6SA 4YAIA 1X13A 3PJDA 3CKYA 4GLOA 4RF5A 1FDSA 1O6ZA 2C20A 1BHSA 1HT0A 3H5NA 4I9NA 4J6FA 1C1DB 2POQX 2DFVA 2W2KA 4R3NA 4B7CA 5CDGA 1IE3A 4EITA 3EZYA 3AI3A 4YB8A 5TGDA 1BXGB 5KNLA 3GAZA 3WYCA 4BNMA 3LZ6A 4IZIA 2DM6A 1F12A 4ZJUA 4H7PA 2X9NA 1E7MA 1M67A 5CDSA 4ESOA 1Q1NA 4WE3A 4OH1A 1DIRA 3PFFA 3OA2A 4RZIA 3E48A 1NPYA 1KVTA 3EMKA 2UUOA 2OP0A 4ZA2A 4A7PA 2QZZA 2NV6A 1S6YA 3I9NA 3V1UA 2Y1GA 4ALNA 2IZ0A 3OJLA 1EVYA 2I76A 3H9JA 3WWYA 3KSZO 4C7KA 1IOLA 3DBLA 1Y9EA 1YGYA 4EJ6A 5KKCA 2C54A 3C3XA 2AEFA 4CMIA 4CV1A 2VRCA 5A5FA 3JQ8A 4FBGA 4UULA 3K92A 4N54A 1P9LA 2HMTA 3S2EA 1A4UA 1XQ6A 4MVJM 5DP1A 1ADFA 2BLLA 3RD5A 1HETA 3GEDA 1QYDA 3DHNA 3ZWYA 1OC2A 2JHFA 3TSCA 5JE8A 3GEMA 3L77A 4J1SA 3SJUA 1UP7A 3F4BA 3I5MA 2CF6A 1P1KA 1P45A 3WGYA 1KY4A 1N9GA 3GY0A 2DU8A 1YRLA 1SOWA 1V3TA 4WOJA 4GX2A 1X7HA 4NK5A 1ZEJA 2DKNA 4NQZA 1BMDA 3Q3CA 4E5MA 1LA2A 5G0UA 1PU2A 2QRKA 4MVJD 1B15A 5I8ZA 1C3VA 1LDBA 1U2DA 3HZZA 3O9ZA 1W73A 5LC1A 3OIDA 4NK4A 1I0ZA 1QYXA 3PIIA 3LYLA 2CSUA 2JHGA 3E5RA 1JWBB 1HE3A 3HDYA 1RPNA 5U4QA 2EJWA 3I9LA 2RBEA 2V65A 5DCYA 3AUSA 1U7TA 1PX0A 3QW2A 4BNTA 2E4AA 4HKTA 4DIBA 5IAAA 4NDNE 5JC8A 3OFSA 3TJRA 4PG6A 5TF4A 1AGNA 4YJHA 2GRAA 1ENPA 4BNXA 4BNHA 1LQTA 3HUDA 3ZWNA 1MC5A 1JKFA 2D1YA 5C37A 5CEEA 3QVOA 4FN4A 1KBZA 4NNJA 4KWHA 2V6BA 2WEKA 4BQPA 3F47A 2OL4A 1B3BA 1PEDA 1HDYA 4PGFA 2ZK7A 3TN7A 2QG4A 3I9KA 4ZQHA 1PQWA 3BTSA 1ZSYA 4PVDA 3HG7A 2OGUA 4Q3EA 1E7SA 4Y6RA 3H3FA 5JCXA 2UYYA 3F5SA 1E7WA 3BZUA 3NKLA 4M1QA 2IEDA 1NWHA 3UFXA 2CDCA 2GN6A 2Y1DA 1DDOA 2ZIZA 3E8XA 4I9HA 4OJNA 4A26A 4NBRA 4ZHSA 2J3IA 3U9LA 1I3LA 5IDYA 1MUUA 1YVEI 3UICA 4W9NA 3OSUA 4ALLA 4E31A 1PIWA 4ND5A 4OM8A 3PLRA 4XCVA 3TFOA 1LQUA 4BO0A 4CM9A 2ZYGA 5TC4A 2B35A 2EG9A 2NLOA 4H16A 3RCBA 2GNAA 4J4HA 4BO8A 2DBQA 3DO5A 3MJVA 1Q7GA 3INTA 2GCGA 5IN5A 3VTFA 5A5EA 5A3VA 5B4UA 4TRRA 3QP9A 2VHWA 5MDHA 1XU9A 4I5EA 3HNPA 4DC1A 4OSOA 1NFQA 4PZEA 4R5MA 2XPCA 4JN6B 4R1UA 1KOLA 4BNZA 1N1EA 2PA3A 4XYLA 1XYGA 2CVZA 5AOVA 1CQJA 1YJQA 3AI1A 3W4JA 3BMNA 2AEMA 2R2GA 4WKGA 4XYMA 5C7LO 2EV9A 1H2HA 3OP4A 4YDRA 4BB5A 3HB5X 4NHEA 2O48X 3TQHA 1W4ZA 1E1NA 3B1KA 4R16A 1N92A 5H83A 3GVXA 2PR2A 4CQMD 2J3KA 4B7UA 5CEFA 1FDTA 4L4XA 2QW8A 3ULKA 2Q2WA 4XGNA 3MEQA 3M2TA 2HU2A 1WPQA 4YBZA 3ONFA 5HA5A 3IP1A 1ZMOA 1B8UA 2O3SA 4JXKA 5BNIA 5K9ZA 2X9VA 1L1FA 4GSLA 2W98A 4AJEA 3PJEA 4FC6A 4FFLA 2OO5A 4YQYA 1YBMA 1WVGA 4CMEA 1V8BA 3TOXA 2IEBA 2CF5A 1PTJA 3GNTA 2EXXA 4JROA 3EZLA 1EE2A 5KVVA 4PRLA 4YXFA 4Z9FA 1YE3A 3WLFA 5K0ZA 2J8ZA 4U5QA 4R4JA 4G2NA 3A4VA 5A9SB 3OJEA 2LDBA 2FPIA 3PP8A 1BSVA 1HZJA 2EKLA 4E33A 1J5PA 3HFGA 5JYDA 4IUYA 4ZQEA 2YYYA 4FSHA 1GUYA 3RJ9A 4UVHA 1AE1A 4O5OA 2BFPA 3AOEC 3MJEA 4UUPA 3BA1A 4YQZA 4YWJA 5K6AA 1LSSA 2PWZA 1PS0A 4NBWA 3D3EA 3NTOA 3RFVA 1KERA 1KEUA 3IQDB 2V6MA 5G0TA 3UHAA 3EAGA 4YAEA 4B3IA 1YB1A 3L6EA 2VCYA 1WDKA 1VM6A 4EBFA 5JO0A 1QXSA 2Q2QA 3WBFA 1N2SA 1GYRA 2DBVO 1LXCA 3PZRA 1GADO 1XWFA 5JPIA 1JW9B 4CUKA 3I23A 3CPSA 3IMFA 1LLDA 3P2OA 3VZRA 1T1SA 2YQ5A 3ZGYA 1C1DA 2Y0DA 3C85A 2NU7A 4Z0TA 3PYXA 4U0KA 2I99A 3E9QA 5F3RA 3GF4A 4EW6A 4P8RA 1E7RA 2AW5A 2E82A 1DPGA 2Y05A 4CQMA 1BXGA 5IZCC 2CNBA 3WGZA 4ALIA 3VHRA 3MWDB 1F17A 3R3SA 4MDHA 4PCVA 2VUTA 1P1RA 2JCYA 1EEHA 1BVRA 3LQFA 4GGOA 4MVJE 1UAGA 3JQBC 4K6FA 3GDOA 4Z9YA 4EJMA 3W8EA 5T6BA 4DLLA 2PD3A 3TOZA 1SEVA 5JAMA 3GAFA 3DBRB 3G0OA 1YOVB 4XR4A 3WR5A 1E5QA 4E6PA 4BNUA 3DBHA 1SZJG 1EVZA 5BNTA 1E0DA 1X7GA 2JFFA 3LU1A 2VN8A 3LVFO 4ILKA 4RORA 5CEJA 1PJ4A 1TT7A 3G3EA 1DHTA 1OAAA 1IHXA 4GI2A 1R4MA 3RBZA 3Q9UA 4BV9A 2CVOA 3STHA 3ANNA 3GVIA 3ZWBA 2WD7B 3BMQB 3HSKA 1NVMB 3GT0A 2IODA 3RUHA 1SOVA 1E77A 4HFJA 1A9YA 2AA3A 4XDZA 3KHUA 3SLGA 3SBOA 4AL4A 2FR8A 3KYCB 1DJQA 4Y6PA 4CUJA 1A27A 3MOIA 3Q2KA 4QTZA 1GDHA 1GAEO 4GWGA 4I08A 3KETA 4WCFA 4HV4A 2BI7A 5EIOA 1PR9A 1SO8A 5ICMA 1HRDA 4NZ9A 3JQAA 3Q11A 5I9MA 2PNFA 2VYNA 3DFZA 4BO1A 3EW7A 4MKRA 5MGBA 3LC2O 2FR1A 4BNFA 3JQEA 3X2FA 3ROMA 3HB4X 1I01A 4O6VA 2W2KB 4FFMA 4I5FA 2Y0CA 2YZ7A 3M6IA 4ZICA 3UN1A 3OF2A 3MOGA 2QRLA 3PYMA 2AG8A 2YV1A 3ZV5A 1GD1O 1V0JA 4XX0A 2TMGA 4BV8A 3IP3A 1T4BA 2VYVA 4EEXA 2QZ9A 1KVQA 4PRKA 5L53A 1ARZA 3VZQA 5G0WA 5CPBA 2VNAA 4ITUA 4R9SA 1UR5A 4YPOA 1ID1A 1LC0A 1ULSA 3GDGA 3H6KA 4B4WA 4UVIA 4JLWA 2NACA 3HN2A 3AM4A 4FOSA 3WGIA 3PWZA 4Z0PA 3UW3A 4CMBA 1WP4A 2CZCA 4PLHA 4IS3A 4BNLA 3DBLB 3ZHZA 3DMTC 3CUKA 4FR5A 1E3LA 1VSVA 1HSOA 3GGPA 4FQ8A 3HADA 3JQ8B 2OHXA 2GD1O 4XGKA 2ZQYA 2AQHA 3ZI0A 4LSWA 3RC2A 2DFDA 4ND4A 2BFOA 3GEGA 4FFOA 5L3ZA 1HDCA 1EK6A 3D1LA 2A9FA 2ZYDA 2O2YA 3BYZA 3TNLA 4TRJA 5JO9A 4BO9A 1TT5A 2DLDA 3FPLA 3I9MA 4YT8A 5THKA 2GPTA 4JX8A 2FSSA 3JYPA 3WQQA 4KMSA 1N9GB 3W4KA 1BW9A 1KETA 3DAGA 3FWZA 3PGJA 2RHCA 2YHUA 2CD9A 1Z82A 1UXIA 3UCXA 1QLJA 4H3VA 2BRUA 2VTEA 1R15A 6ADHA 4RPJA 5G2OA 1ZFNA 4ZVVA 2FHSA 3F1LA 1U3VA 5GY7A 4DA9A 4KDFA 4KOAA 2HMWA 1SBYA 5A06A 1ISMA 3H7AA 5F1KA 1UH5A 5TRTA 3UAGA 2PKQP 2E48A 3K2BA 1M6HA 3OJFA 1CJCA 4XYBA 1YB4A 3ONDA 4PN3A 1E7YA 4BQRA 4DQXA 5ITWA 3HDHA 3JSAA 2D5AA 1NR1A 3F9IA 3FWNA 2JCXA 2O2SA 1QRRA 1LJ8A 4DRYA 4XQCA 1QKIA 1HTBA 4O63O 2CDBA 4L4RA 3JQ7A 4OAQA 1FDVA 3H5RA 4FJ2A 4YJHB 2IDZA 1NVTA 5G0VA 3IS3A 3PYLA 4BO6A 4B3HA 5TNXA 3BMCA 3I9OA 3OM9A 5CG2A 1A7KA 4Q39A 2C29D 1EUZA 3A28A 3PXXA 4CR8A 5COBA 1Y1PA 3QY9A 4J4BA 1CETA 2VUSA 1CWUA 4J7UA 2QIOA 1D8AA 1E1MA 5HM8A 5T67A 1QV6A 4WUVA 1VJTA 4M8SA 5JDCC 4CL3A 1TA4A 1T2FA 4U0JA 1PGPA 3U0BA 1YL7A 2P4QA 2O3QA 4ND1A 1ZJYA 2B83A 3LC1O 3GN2A 1VLLA 3G79A 2VHVA 1O8CA 4NJMA 1UXJA 3RC9A 4CLOA 4ALJA 4IDDA 4ZRNA 1SMKA 3KM0A 4Q3AA 1JLLA 3KSDO 3MWEB 2ZTVA 2AHRA 4BKQA 2HLPA 4HUJA 3QA9A 5DBGA 1YKFA 3NV9A 4IQ0A 4WLVA 2HQ1A 2IE0A 1P31A 1T25A 5GZ3A 4XEHA 1HZZA 5L9AA 1X0VA 1Y8QB 4IXWA 5CHEA 4CLEA 2Y1CA 1A4IA 2GLXA 4DC0A 5BT9A 3ZHBA 3IKTA 2F00A 4Z3KA 2Q4BA 4TWRA 4EEZA 1B26A 1P1HA 5GZ1A 1EBUA 3OICA 1QR6A 4AICA 1FMCA 3BMNB 4DPMA 4CMEC 1U4OA 3IC5A 4CV0A 4XJTA 3S1LA 2O4UX 2QYSA 2NU8A 1N5DA 1S7CA 3WNVA 1PJCA 3NGLA 1YQXA 3S2GA 4PG4A 4YYZA 1HXHA 3AOEA 4J2OA 4CMGA 4I8XA 4R68A 5ICSA 2BGLA 3C8MA 3EY4A 3RFXA 3DOOA 1AHIA 2X5JO 4E5KA 5K6AC 5AVOA 3F4LA 3FI9A 2W2LA 4CM3A 4DL9A 2B4TO 4RVUA 4DMMA 3QIVA 1M6WA 3DZGA 1XDWA 1V3UA 3GNSA 3TZ6A 4AJOA 2DTXA 3LF2A 2VZ9A 1BGVA 2X1HA 5AXCA 3PZBA 3B20A 5L7WA 2Y66A 4XQEA 1BG6A 1H0KA 5JS6A 3RU7A 1R16A 4YT2A 3D0OA 2XAAA 3MJTA 3PFWO 1V9LA 2PTGA 3V1TC 5HWSA 3ZU3A 3FTPA 5HBRA 1Q0QA 1LDNA 3K30A 3WLEA 5A02A 2HRZA 4IDCA 1F0YA 2VWQA 4L76A 4J1TA 5CFZA 4PIVA 1PJTA 1D4FA 4PLGA 1DRVA 4WNCA 5ENVA 1W0CA 1AXEA 3BMQA 5IZ4A 4XRGA 4HFRA 3GRPA 4D3DA 2P2SA 4J49A 4K9DA 2NSDA 3JQBA 1ZK0A 2VOJA 3JD4A 1I3NA 4L75A 4YJGA 3VKVA 3BHJA 1I30A 1AN9A 2EF1A 3BIOA 4XB1A 5A1TA 1T26A 3KYCA 4TKLA 3V8BA 5JCJA 4LRTB 2WSBA 1VKNA 3PIDA 4MP3A 4ZQBA 5IXYA 2YFHA 3P2YA 3ON5A 2J3HA 5B4VA 1ISJA 1GUFA 2O3TA 1IY8A 1PWXA 1Y81A 3ENKA 3R1IA 5F1PA 1ZBQA 1HLPA 4BS9A 4J2HA 3P5SA 5HTOA 5I9NA 3IAHA 4C7JA 5L4SA 1RJWA 1K3TA 2I5PO 2J5KA 4DIOA 3G49A 4KP7A 2Q1TA 3ICPA 2Q99A 4BO7A 4CQMB 5LDHA 3G17A 3FNHA 1E1LA 1YBVA 4MIYA 3ZWVA 3KSUA 3JQGA 2X0NA 5LDGA 2RIRA 5KJ6A 2PZMA 4YCAA 2GERA 2GSDA 3OBBA 4RPHA 2BHLA 3ADOA 5C7IO 1CF2O 1EDZA 4IQGA 1CDOA 5BSFA 1JQBA 4N5LA 1ZCJA 3VDRA 2EEZA 3LT2A 3AOGA 5JY6A 3UVEA 4OOFA 2EWMA 1Y5MA 2XOXA 3DC2A 3LLVA 4WCFC 3DZIA 3DBHB 1Q7BA 5JMPA 4BKOA 4BOYA 4UEJA 1T24A 3PRJA 4KUEA 1LLCA 5DP2A 3UUWA 2QYTA 1B7GO 4ID9A 2DC1A 3DR3A 4LVUA 5L40A 4CPDA 3JD0A 4LW8A 3GVPA 4BVAA 1YH3A 3ENNA 5EN4A 5FYDA 4E0BA 1R4MB 2VWGA 3ITDA 3WSWA 5DOVA 3IIEA 1E3SA 3L07A 5TQVA 4DBZA 3W8FA 4I5DA 4LN1A 1KVSA 3OHSX 1ZK4A 2EKPA 3D7LA 2EKQA 3NGXA 4R01A 4BGIA 3UKOA 4WLOA 1R6DA 3ZU2A 5DNAA 4FOOA 1PZFA 4PLCA 2OFPA 1Q0LA 2HJRA 3IUPA 3ZNOA 2ZJ1A 4WCFB 5B12A 4JQCA 3DDNA 2R00A 3O8QA 3JQFA 2ZB7A 3ETDA 3JQAB 3IDSA 5F21A 1J0XO 1HE4A 2E6UX 5T5QA 2G82A 3WYEA 4U6SA 3JYQA 1TXGA 1JTVA 4G81A 4RVDA 5THQA 1DRWA 4EI2A 1SAYA 2Y1OA 4HNGA 3DMTA 4MVJH 1QYWA 1VRWA 1DAPA 1SCUA 2ZTMA 4CM6A 2P5UA 4YA6A 1P0CA 1TLTA 4FFNA 3ZW8A 1A71A 1VJ0A 1LNQA 3VZPA 1C0LA 1ZNQO 4ZGWA 3QV1A 1B14A 4CM5A 1NXQA 3F1KA 1H9BA 3WXBA 1R12A 1U8FO 2FRDA 4BNKA 3NRCA 4A73A 4J1QA 3F3SA 1QYVA 2C0CA 4WEOA 1F8GA 1O89A 2X9GA 1JAXA 4RDIA 1ZK2A 1E6UA 1ZK1A 4D0SA 1IPFA 1GZ4A 2BFAA 1PJ3A 1K0UA 5ER6A 3CZRA 4DPKA 1VPDA 1ZEMA 3H9EO 4AJLA 4E32A 4OOEA 4INAA 3NT4A 5TJHA 2QX7A 3EK2A 4KDEA 5KJFA 1PJQA 5U9CA 4DTIA 1YDWA 1OI7A 3CMMA 2JKVA 1GZ3A 3JD2A 3JQ9A 3PHLA 3KEQA 1FXSA 2X7HA 2VWPA 3A1NA 3V2HA 3P7MA 4D79A 4J0FA 3AY3A 4RDHA 1I8TA 4YRDA 5L45A 4NFYA 1I36A 4IJWA 1GQQA 2ZCUA 1R0LA 3JV7A 4JP3A 1TT5B 1ZXLA 3C1OA 4NR0A 3NJ4A 2YJZA 4MVJG 3AI2A 4Q3BA 4B4UA 4R5HA 1WWKA 4CM7A 1KYQA 3ETGA 4EUEA 1DC4A 1V6AA 4WOKA 3D3WA 4WPGA 1BDBA 3S2IA 1BW9B 2GDZA 2D4AA 1GR0A 1P1JA 1MV8A 3SVTA 5HS4A 4ND2A 2HK9A 4W7IA 1VC2A 3NX4A 2PLAA 4UEKA 2V7PA 3TRIA 3TWOA 1NAHA 5A4DA 5CAEA 5G4KA 2BGMA 1KVRA 2WWRA 1XCBA 3GMSA 3MJSA 1JA9A 5KJ1A 5JLAA 3VH1A 2JD2A 1IZ9A 1Y8QA 3OECA 3VVBA 3DOJA 5JDCA 2WE7A 3Q6IA 2OXIA 4MVJA 3INRA 1FF9A 3GPIA 5CDUA 1DJNA 3W1VA 4RGBA 4CLHA 1M66A 4M55A 4LSMA 4BGVA 2XXBA 4GWKA 4HP8A 3LK7A 4KQWA 3PEFA 1Y7TA 4JJFA 3QWHA 1EQUA 3EHEA 3L0DA 1I33A 4EGFA 3JQ7B 5FWNA 1UXKA 3C1TA 4GL4A 4IDEA 4W4TA 3HN7A 4MVJP 1UDCA 3BMCB 3EC7A 2HSDA 3ASUA 5DCWA 4BL5A 3ZHYA 1I24A 2ZYAA 2XXJA 2VZ8A 4E2YA 1PL6A 2JFHA 4IZHA 5BNFA 1IZ0A 3E6AA 1HL3A 5AXDA 4Q3DA 1E3IA 1LDEA 3K8ZA 4J9UE 3E18A 4RO0A 2BELA 1U5CA 4PZDA 3B1FA 3GGGA 4ALKA 7MDHA 1KC1A 2EJVA 4HXYA 4Q3NA 2BFMA 1J6UA 2HK7A 3KBOA 9LDBA 3VPFA 4YRAA 3OIGA 3OQBA 3UOGA 3R3JA 4TRMA 4YEDA 3U09A 1HF3A 1GCOA 4NJMB 5ES3A 5BQFA 2ZJ0A 1X1EA 3V2GA 3FHLA 2E37A 1SC6A 4NIMA 3ASVA 2Q2VA 2QQ5A 4M54A 4CLOB 1DIBA 4FFPA 3VDQA 4MJLA 1PJLA 4A03A 5JYEA 1FK8A 2OBYA 4NFSA 2W90A 1P33A 2IZZA 4GBJA 1K2WA 5DULA 5H81A 4CM8A 3CXRA 4BKRA 4JJGA 4A2CA 1WMAA 5JBIA 3ETEA 4N18A 2JD1A 2FZWA 4QO8A 1YBAA 4UVEA 2DUUA 4GGPA 4DBVO 3FF4A 4XQGA 1LDMA 1PJSA 3WTBA 4OXNA 1TB4A 2UDPA 1R37A 3PDJA 2UVDA 1O5IA 1R66A 4DLAA 3JYLA 4J43A 3G1TA 4OXKA 1XIVA 2D0IA 4GX5A 3AFMA 4P38A 2IXAA 1H6DA 3PHHA 1E3EA 1XU7A 3ZWXA 1Z7BA 1HDZA 1ORRA 3PWSA 1A9ZA 1A5ZA 1Z7EA 1XA0A 4BNGA 4YJDA 4YTEA 3WQRA 2NTNA 4JGBA 1T2CA 3E1KA 3VPGA 2ILTA 3GFBA 3ANLA 4LCJA 3D5QA 4E21A 3GZNA 1MP0A 4PLVA 4NH4A 2GZ2A 1YL5A 2YFQA 1O0SA 1M75A 2Z1NA 3AFNA 3BHMA 3H3JA 3ROPA 2NTJA 1I3MA 4XD2A 3GNQA 3AY7A 2UV8A 1B16A 4FFRA 2WJPA 4Z6KA 1DB3A 3I3OA 4RLHA 1WDLA 2I3GA 2Y93A 4UUNA 4XA8A 1IULA 4GAEA 2PZKA 3SLKA 4YAKA 1NPDA 1QG6A 4CMAA 3ONEA 3X2EA 1E6EA 3H4VA 4A5OA 4A27A 3AUAA 3CEAA 1LEHA 1SPXA 3RFTA 3ZWOA 4WGGA 3PLNA 4CLRA 2GZ1A 1LBEA 1SB8A 1ISGA 2FN7A 2P9GA 3PQDA 3RUFA 3K9QO 4HX5A 3H8VA 3VTZA 2O7SA 1NASA 1WDMA 2PD4A 4QX6A 1H94A 3NDRA 1RYDA 4JIGA 1H6AA 2OZPA 4F3YA 1H2BA 3OJ0A 4J7XA 5A9TA 2HMVA 1DIAA 1EZ4A 4LCEA 2D59A 3WDSA 3ZWWA 5B4TA 1XGKA 4YJGB 2NQTA 3B6ZA 1GTMA 3ZZNA 4JJIA 1CERA 4Z9XA 2EW8A 4M49A 4QUKA 4S3MA 1NM5A 3OA0A 1OOEA 4HADA 2X0RA 3QVWA 3ZN2A 3WBBA 2B69A 3WJAA 2HUNA 2HJSA 4GQAA 4IDGA 1ISHA 3GDFA 2GYYA 4BNYA 4NG5A 1KVUA 5CDTA 4GMGA 3GHYA 2ZB8A 1P1IA 2RHRA 3KUXA 3TL2A 1YO6A 5I7EA 1C0KA 1E92A 1PGNA 3FCOA 5CDYA 3RVDA 2JFGA 3PJFA 3JQGB 3G1UA 3O38A 3NYWA 4G65A 1LC3A 5ENDA 3BTOA 1ZH8A 2X23A 3U49A 3DHEA 3KTDA 1WXDA 4AJ2A 3A06A 1IPEA 1B0AA 2FP4A 1YS4A 1J4AA 1GV0A 2LDXA 3ZU5A 3DL2A 1GYQA 2Q4EA 1UP4A 4CMKA 2R00C 3E82A 3JQFC 3V1YA 3KV3O 1NP3A 2BH9A 3U62A 2Q49A 1ENYA 2GUGA 3QHAA 3U3XA 3VPHA 3ZWAA 4IMPA 1F8FA 4HNHA 2Q1SA 4Y67A 2GN4A 3U4DA 1PJ2A 2CVQA 4IPTA 4R9RA 5COAA 4X54A 2DT5A 4OIMA 3K6JA 4XIYA 4GVLA 1U9JA 3HJAA 3PHJA 2BGKA 1I32A 4XWYA 5JDIA 4GKBA 2AQ8A 5T8KA 1CYDA 1YJ8A 5I8WA 2OORA 2PZJA 3GZ4A 4E30A 1G0NA 2X22A 3K96A 3LT1A 4XIJA 4WLUA 4OXYA 3PHIA 3JD3A 1ULUA 5IDWA 1JDJA 3LDHA 1K6JA 3OMLA 5EJ2A 1LRKA 3W6UA 4L8VA 3O8QB 3V2UA 1Q0HA 4XZ3A 1LDYA 3LLSA 5KIAA 1C14A 5L4NA 4TMFA 3RBXA 3ITKA 1HDXA 3I83A 3MZ0A 4P4NA 1X14A 2D2IA 1UDAA 3H9QA 4GX1A 1PQUA 3FTNA 4F46A 4NPCA 4NU6A 1D1SA 3TL3A 3FR7A 5H82A 3WIDA 4IDFA 1F14A 2ZTLA 1N8KA 4A10A 3A9WA 1E1KA 3WWZA 2AMFA 2RCYA 2B5WA 3JQ9C 3LC7O 1ZSNA 3PQFA 4OL9A 3BTVA 4W7HA 4LRSB 3HDJA 4RF4A 3RBVA 2DVMA 4AVYA 1BVUA 2AE1A 4G5HA 3KVOA 3RASA 2VHXA 3M2PA 4CMHA 1U4SA 3RAJA 4FC7A 1LLQA
chains in the Genus database with same CATH superfamily
4YJ3F 1XVTA 3TB4A 1WB6A 1I2BA 2QLJA 3R5JA 4OFXA 3O8BA 3ESZA 3RROA 3WQSB 4DEXA 3LBNA 1Y1TA 3RS5A 1IK4A 5ARDA 2OBBA 1TGYA 2LCFA 4HL6A 3TAUA 1QHNA 4OA5A 2ZVDA 2VYCA 1ADCA 1F4PA 1FBTA 1PS9A 2A3NA 2FUG6 2H57A 2H5LA 2I78A 3CLUD 3OHPA 2QMEA 4XUCA 3VJMA 2QTTA 2XUIA 4AN0A 2IHBA 3RIGA 3UCFA 1FDUA 1NOLA 4O5AA 4E2WA 1Q21A 2Y76A 2FY8A 3L1UA 4C07A 4XDYA 1QOQB 1TH2A 2O2DA 3HHSB 1ISFA 1MPXA 3NRBA 4MO2A 4WBNB 1T9GS 3HCRA 1SCKA 3X2SA 3W6ZA 4BUCA 3EF1A 4YRGA 2DG2A 3SZRA 1D6JA 3I05A 3HJNA 3KLPX 1MB9A 1XMOB 1GFSA 4LVOA 4V0NA 3ODPA 3FCYA 4A8JB 2HV8A 1NI4B 2GM5A 3IEMA 4DA7A 3DYBA 3GN1A 2YY5A 1HL7A 6LDHA 4KK3A 1JSRA 3Q6MA 4ZC1A 2AWOA 2ECPA 2RGNC 4C7OA 2HSZA 1ORVA 2CC2A 5EXDA 3VSCA 2IS2A 4EB0A 5LA6F 2XEDA 3DEHA 2B4YA 2Q8QA 1CHNA 1L7EA 1BA3A 3PR3A 3TIVA 1G21A 1TEHA 4L9RA 4Q9NA 4DQUA 1GZ7A 3HN6A 3MGKA 4GHWA 4MR7B 4U63A 5AW8A 1T4MA 3A9TA 2V0GA 3D3WB 3BKWA 1DC5A 2ICAA 3MILA 2YVQA 3I5UA 1R74A 3DUWA 2WMGA 4QSMA 4HGQA 1BKDR 1QZUA 4ARSA 1NVDA 1UC9A 5TS3A 1RYFA 2FPPA 4QDZA 1L5LA 2LCQA 1QV9A 1VL0A 4PHTA 4PGGA 3TLXA 9LDTA 2V55B 3FTEA 2C5EA 1N57A 1O77A 2IP1A 2NO5A 3ER6A 4X5OA 4B2YA 5I5EA 4LRYA 4LF6B 1XCLA 2ODBA 3SYLA 3VKGA 5AKIA 2WJGA 1VE6A 4EUFA 5JTUA 3SNKA 1P73A 4CDMA 4BASA 5M04A 3AJEA 1AF7A 4F1KA 3Q9NA 1QAOA 4ITRC 3JYOA 5J4YA 3G89A 3TIFA 2B0CA 4F5WA 1F9EA 4FR2A 1UXGA 3KO8A 2EDAA 5H7XA 3SFTA 2Y0PA 2ASVA 3FYHA 3KE9A 3PQ4A 1AHNA 3HZHA 1YJCA 4Z9BA 1O94A 4ZEMA 3N5CA 1DXYA 3UGTA 4JUAA 4U02A 3GLVA 1AXGA 1KQ3A 3CY6A 3A0RB 3GGOA 5IJ9B 2WG0A 1UBTS 1TU0A 2V3VA 4AJIA 4D0GA 3VXKA 2H18A 4BX2A 5I9LA 3UHPA 5JSZB 2HWWA 3KSRA 5TF0A 5LKAA 1WMEA 5CP8A 4ZU6X 1HKHA 3TSZA 4YJ2F 2DUWA 4X91A 4BAZA 4AI6A 4XI9A 2QZ4A 2A94A 2C99A 2ZVQX 1DEHA 5EIHA 3OCZA 4S2EA 3Q2IA 5FA6A 4FYIA 1I94B 3SQXA 4GNKA 4MS1A 2XB6A 4N0QA 1I4WA 2V97A 5TQ0B 3IL2A 3PNLA 4ZAGA 2B4AA 4ESVA 4QOGA 3CKLA 1QRUA 1WMBA 1HI9A 3BCHA 5FOUA 1D3AA 4TMYA 1IN5A 2Q5IA 4Y8VA 5JS7A 1L5HB 4F2GA 3IHLA 3PK0A 2QXTA 3TXAA 1NUAA 3UKJA 2CMFA 2Z43A 5GM1A 4MIEA 1LPSA 2G7ZA 2GEUA 3IXQA 1GQ2A 2ZITA 2D8MA 3ZK7A 2AF3C 2IW3A 4L8LA 1SURA 2Q6VA 3ILVA 4EBBA 3I1JA 2O7QA 2VXBA 5HZHA 1CKEA 2LNDA 4HDCA 2YWEA 4HNTA 1VKOA 1TRHA 4OLFA 2SICE 4I36A 5IAKA 1NBEA 1CZKA 2IYTA 1EFPA 1XEXB 1GQYA 1YXMA 1DAHA 4N5MA 4X84A 5SY6A 1SOMA 2O8BA 1Y63A 3TLKA 1NUTA 1F4VA 1X7DA 1T2AA 2VSQA 1QE0A 4M0EA 4CV3A 2ZPAA 4MV1A 1RZUA 3BAZA 4FGSA 4MO9A 1T36B 4C1BA 1SXQA 1Y6JA 1OQAA 1ZI8A 3TK1A 3TUJC 1CP2A 2HV9A 2P62A 3UJPA 4URXR 1K08A 1KQPA 3FH0A 3L9XA 4KQFA 2PY6A 1QORA 4RS3A 1VHWA 3PXAA 1U28A 4FWIB 3VYWA 5L4LA 3T1YB 5B3JA 1PHRA 4OKIA 4NFLA 5DN6D 3RYTC 3A3PA 4PGAA 3VI3B 1IXZA 2ZJ7A 2WF6A 3L7JA 3PRKE 1HV8A 5T7BA 2QENA 1XHLA 3R0IA 3HUUA 5BSTA 2ZUTA 1ZCFA 5F76A 4FIZA 4QQRA 2DPYA 4EA6A 1R0YA 1BC5A 2VAXA 3KRTA 4N3CA 4PQFA 5FPYA 2VRCD 3E1SA 2IXDA 4CEIB 5EWLB 4U2CA 4K9MA 1PUJA 2BKUA 1NYTA 2G63A 4GT1A 4PICA 4URFA 2GN8A 2FN4A 4R51A 3R3XA 121PA 3A58B 2AZXA 4X44A 1N6OA 1I10A 1CRWG 4LBZA 5A7HA 2QD4A 3I1FA 2IRWA 2ZULA 1A1SA 4D72A 4IFBA 1XNHA 4B81A 3W77A 1NVVQ 4JZYA 2AN3A 4PGMA 4ZT5A 3SBEA 3ANMA 1TVEA 2EFYA 3FCAA 5EOVA 4OHFA 1QDEA 3PT5A 4G4SP 4A1FA 3BBPA 5M7EA 3HKCB 1SHLA 1DBRA 2WZCA 1SD5A 3CF4G 3DMFA 3HN2A 2D0DA 2PZLA 5ESXA 3SX4A 4PZCA 3BWXA 5KTKA 4TVOA 4HDAA 5B2FA 4JI0B 2GAJA 4M0KA 1NF9A 1SBQA 3ZGVA 2CHVA 3LWBA 3O26A 5ELMA 2R6ZA 4DCOA 2F8MA 3DV0B 4OKSA 4E12A 1NWCA 1PUIA 3TSYA 2QN1A 2PT5A 4OHRA 3GHHA 2B8JA 5FUXA 4FU0A 5I7SA 1LS1A 2P5SA 1JDPA 1OXKB 3KJZA 4E3ZA 1W34A 4IIYA 3CWQA 1RBYA 3W79A 1E3TA 1GL3A 2GM9A 4FEGA 1W4LA 3F46A 1T2EA 4D1YA 4PVCA 1B6RA 4I50F 1LRLA 5AKXA 1LF5A 5FWXA 1UJCA 5AVUA 3MUFA 3THWA 3ICEA 5BQOA 2TMDA 3O74A 4OLBA 4BFUA 3HY4A 1JGTA 3OEHD 1SD2A 2C3OA 3FDZB 3LVRE 1VG0B 3RSHA 4C88A 5ITSA 3HKBB 3ZUGA 1V5GA 1XYVA 1VSUA 2P3LA 4R8MA 3F3MA 1T3HA 3KWLA 1CLEA 1JIQA 2JA1A 2JGFA 2YS6A 4EYKA 2KLBA 4ZEOA 3P4XA 3QKSA 4XKJA 3TJMA 2NO4A 5JSQA 3FWHA 2Q3EA 3EEOA 4MV4A 3BIWA 1Z0UA 2XQFA 3U7EB 1DTWA 3CNLA 1BX1A 4GDMA 3GQBB 2B9EA 3NH6A 3WQHA 4GOJA 4HSEA 3FJYA 4F8JA 1C9KA 4W5QA 3ZD6A 1AA6A 3DMYA 4GSKA 5K45A 1E2NA 1ZICA 1G3RA 4ZP1A 1RIIA 2X4GA 5A0TA 4ON9A 4RFSA 3K9LA 3MCVA 3OZAA 1RTTA 3ITNA 2EFJA 1SXJA 3EUWA 1E2BA 3DULA 2I6GA 1TZMA 4NQRA 1OTXA 4AJ1A 4ACAA 3F7OA 2ORED 1J24A 1MQAA 2ZOSA 2IHKA 4TQGA 4DNOA 5KTMA 1W93A 4LDPA 4ZEWA 3UPDA 2I1WA 3FYTA 3I53A 4X1YA 2RG1A 5T8KC 2WJAA 1GJRA 1MC1A 2VJOA 3TNJA 4ZKEA 3ZY4A 6ABPA 3WYGA 2CCKA 2FP4B 3SX0A 4FFDA 4BXOA 1G4UR 1ZNWA 2JI4A 3OT5A 1TUEA 4Z4CA 2P90A 2KB0A 2E18A 2ZAMA 4JLPA 4ZTBA 1LU9A 3OU6A 4I9GA 5GZ6A 2HZBA 3MTEA 3E4DA 1C50A 1FUEA 4HY3A 4RVSA 4BLQA 2VZ0A 1E2JA 1SBIA 1YBFA 2R68A 2R8YA 2PAFA 3NUQA 4L8WB 4UAGA 5LIRA 2BC9A 3R23A 2BFEA 1UDBA 3OPXA 3BJZA 1BCRA 2M2IA 2XWPA 3DLCA 3FFAA 3K0AA 3MAGA 3QZUA 5G1OA 4RK1A 3COVA 4NBSA 1XZJA 5IUNC 2FMHA 4GI3A 1IL0A 2FW0A 5FPPA 5LNK1 5I48A 3T94A 1NATA 5KKAA 2IZOA 3ST7A 2XXAB 1F3OA 2VSOA 1SUAA 4I0WB 5EXPA 1NQOA 2A4KA 2FOXA 4UE6A 2XYVA 3BL6A 4MV6A 2PQ2A 2VL7A 4FDUA 4ZAYA 2OPHA 3LBAA 2BKLA 5LZ5A 3JY6A 4IJMA 4QPZA 4BTVA 3KBBA 2KJQA 5IK2A 3WWEA 4B7XA 3VKUA 5BN5A 1DLJA 4OV6B 3D2CA 1K9SA 3QEAZ 4KRFA 3O4JA 1JHRA 3QKRA 2J09A 4LE1A 4C4PA 3ZY5A 1GRVA 2DEUA 2HK6A 2H2IA 3A1WA 1SCJA 2H7CA 3H42B 4RVFA 3UJ9A 4O4IF 3SZOA 2WZQA 2XGSA 4B73A 5JIBA 4P54A 1Z8NA 2PHZA 2AFIB 4KHZA 3SBXA 4OHCA 5BSHA 1KO4A 5A62A 3V8MA 1YASA 3QE3A 1LV7A 2I4OA 5IVKA 4H1TA 1B0ZA 3I9FA 3K9NA 1TQ6A 6Q21A 2VPWA 5LQUA 2GF2A 1VBMA 1NLFA 4HQRA 5CDFA 1IXKA 4HMOA 5TT1A 3BZBA 4IQFA 3OZUA 1EWYA 4CM4A 2D13A 3WMXA 5FCDA 2NZVG 5DCLA 1L3BA 4G56A 2Q3MA 5AM0A 4BE4A 1YIAA 2YOHA 2FJPA 4ARIA 2YQ4A 1M8JA 2QUZA 3D02A 1X7WB 3OZEA 3SHTA 3ZQUA 2J0VA 3A10A 4IIDA 4ZWNA 1SGWA 3PUXA 2JDID 4RPIA 5AVSA 5JZMA 2P6OA 1XG5A 2C03A 2E2WA 1NFFA 5FR1A 1XTRA 5H16A 3V4SA 1NBHA 1MB0A 2OK7A 3P27A 1PKXA 2FG5A 4LDQA 4ZT3A 3ZE7A 2W00A 3EQ7A 3AB8A 3LX4A 2UYOA 3U3OA 4MW5A 3UMRA 5MHTA 4Z3DA 4GM0A 5IDQA 1R64A 3DQPA 2YJ5A 3EQZA 3L8DA 1IVYA 1H8EA 1NQXA 2QGNA 3IAAA 4HB2A 3ZYZA 3MTGA 3AVOA 3H99A 4BWGA 4QJ3A 4AS1A 2O8FA 3ZLVA 2AN1A 2ZIAA 3LQ4A 5F1OA 3U17A 4EA9A 2Y99A 3F6BX 4AM8A 1FTSA 1VBNA 2PRYA 5DEOA 3PXGA 4XYEA 1XROA 3OZVA 3ESQA 3HDQA 5T3UA 1UAAA 2RIPA 1QP8A 1K5HA 5CVJA 4ZVSA 4ZO7A 1XDGA 1LX7A 3NNDA 1N7HA 2EP7A 4KEAA 1BS1A 4NJOA 3VJKA 4RMJA 1Z45A 4L15A 2VC2B 2FN9A 4DNFA 1PJ8A 1ZD4A 3MGGA 1LTHR 1WCV1 3S1SA 3KQSA 1DI0A 1PSDA 1YCFA 2W2OA 3CRW1 3PE3A 3NHRA 4HWGA 4P4SA 1XNRB 3KNZA 1QONA 3NYRA 4D3SA 3LMKA 5AVTA 3TAHA 3WBJA 3F78A 2CUZA 4B74A 1ZN2A 1JILA 1JN0A 1GCGA 3SC4A 5FTJA 2I62A 2QN6A 4Q9HA 3U3ZA 4GRIA 2XY4A 2QMHA 3ICCA 3RUCA 3TFQA 1Z2OX 3QKIA 4K1XA 5IKMA 3U2QA 1QVRA 2PX5A 1V5IA 4B5KA 1P77A 2ZRGA 1G6KA 4KK4A 5DMHA 4LUCA 1ES9A 3UM9A 2E4UA 3AFOA 1RPZA 4PG7A 4WKCA 4P0QB 1KDRA 3K16A 3KYDB 4DQVA 4BV3A 5CTJA 3TJZA 3K0SA 1XSEA 2FGJA 1DKQA 4CG2A 1UBOS 2OO7A 4EO7A 4KAFA 3QTTA 4QICA 5DHAA 4PINA 1GGEA 4MKXA 4DIFA 4DJFC 4F86A 4DJAA 1M7HA 3PB3A 1YT5A 4K88A 4OQNA 3UXHA 5CM2Z 3EA5A 2NU6B 3L3BA 4FN5A 4R1OA 1HKUA 4JUFA 2W6OA 1RRCA 4IHJA 4MGHA 3VKWA 1B3RA 4UCQA 1U2PA 4JJ4A 1TW3A 2Q6IA 4NOLA 5EE1A 1L4NA 1VCIA 3UT5B 3W3AD 2Y67A 3F6YA 4DR7B 1VL1A 2H16A 4NCXA 3DZFA 3U0VA 3FPKA 4M86A 4HDMB 1ESEA 2DJ5A 4F97A 4CIAA 3HFJA 5L3SB 1E9VA 3I0NA 1L7PA 3KDSE 4RZHA 1ZD8A 2OCBA 4NE7A 2C5SA 4JNKA 1P60A 4LGVA 3T4EA 1R0CA 1V71A 3BILA 4LDJA 4MVWA 4U2DA 2O7RA 1YVUA 4ZD6A 3S7TA 4F4FA 2VBCA 1MXHA 5DBFA 3WO1A 2VHEA 2YJ4A 2G1UA 4HTAA 3JRXA 4MPTA 4RS4A 3GD5A 3ZHOA 1L8XA 2E55A 2PFSA 4JA2A 1W6UA 3ZDYB 1UWVA 2XGOA 3K3PA 5KWJA 3HA3A 1AA9A 4X8OA 1T5LA 2FZKA 3I61A 2H3EA 2I66A 1RI2A 2XRZA 2QV0A 4BGDA 1QHHA 3WWDA 2IIPA 1KOFA 2OUIA 3HWX1 1LPOA 1A5SB 1DFIA 2ZBPA 3BL8A 3M0EA 3P19A 4K1LA 4KVFA 3EARA 5IJAA 2GASA 4TXHA 4K28A 1RFGE 3B85A 3C7DB 5F3WB 1YK1A 3LT0A 4TXNA 3PNPA 3FR8A 3V34A 3ZK9A 4ZFNA 1JG7A 1O5OA 3WK5A 2PM8A 4XGIA 4CQLA 1YRQA 2HWUA 5M2QA 1TTHA 2FMIA 4HVCA 3EPJA 2A58A 1JE1A 4WOPA 4F71A 1FRFS 2AR0A 2NQ8A 3COYA 4O4HF 4FMCB 2A1TR 1HNXB 3PFHA 2WRZA 3HO1A 4IGFA 6AT1A 4EG1A 4WLEA 5KWEA 2JLAA 3WAKA 3TUZC 8GPBA 3D8NA 5KKNB 1ZR4A 1VCNA 3KPWA 4GD3Q 1DC6A 1CRPA 4Y98A 2Q0XA 1CUBA 4Q6WA 3ZIAA 5G4LA 3TZQA 1M2WA 4OHUA 1C30A 3NR2A 3DVAB 5PGMA 3VNBA 1KS9A 3QXCA 1R6AA 1X3SA 4DIEA 4YVFA 4M1TA 3VX3A 3AHJA 1TZCA 1E5DA 4QSHA 3S8MA 4IAOA 2GTHA 1V26A 3KQHA 1EA5A 2CUNA 3U7JA 1OPRA 1IJBA 2EW2A 2PUHA 4JLDA 4LX0A 3RS7A 3ZHCA 3ZXXA 4CV2A 4EATA 3AUJB 1KKLA 4OJKA 2SCUB 1ZSVA 4XCQA 3T5AA 3T7CA 3ZCUA 1L4KA 4J3FA 3AUKA 1YB5A 1Q11A 3AKZA 4OPMA 2VTDA 4D02A 1QP0A 4JJ7A 1JKJB 1E89A 2Q2NA 2CFIA 4F9FA 1UAYA 2GN0A 3ELWA 3FYUA 4G1FA 1H9AA 2PKQO 3IESA 4QNMA 3VTAA 4BVHA 1E3JA 1R0RE 2Y27A 2O3RA 1M8GA 2KQUA 4K05A 4TTIA 3SQMA 1A96A 1MA0A 3IT6B 2YN2A 4XLLA 1Y82A 4JGGA 5ALEA 1NXWA 1Y0BA 3C97A 5IDXA 2HY7A 1Q0TA 2YEPF 3ZJ5A 3G9QA 1DOHA 2I55A 3X1ZA 1EBBA 3R0VA 3TQIA 2AEJA 2GBPA 2XLBA 3OLWA 4FLFA 4J9VA 4AG3A 3I30X 2Z57A 1L5NA 4LSZA 4XWKA 8ATCA 3TQQA 1E0SA 1KAQA 4O2BF 3OCJA 4II3A 1BFDA 2QVZX 3K15A 1Q0RA 2AJCA 3R09A 5DYIA 5FF9A 4LJYA 3DTVA 4HN4B 1E6WA 2I6SA 2A0YA 3DL7A 1R0KA 5I3ZA 5IWAB 4ISBA 2BBWA 4X61A 2NUAB 3GVCA 2RI0A 1I0IA 3GLKA 1VHQA 1L4GA 4YMLA 2B1JA 5AOAA 5BOSA 3MG9A 3I92A 1UKYA 5ECDA 3AHFA 4QRDA 3D4OA 2IYYA 2QK4A 2XADA 1RAAA 4Y2TA 1ATIA 3UJHA 1Y3HA 3A14A 1ZPDA 1PQPA 4G0XA 1V9SA 3O94A 1I7QB 1TYBE 4RY8A 4MUKA 3UJAA 4LECA 1SRQA 1TA0A 4KE9A 2GBCA 3ZWQA 4BIIA 5HG0A 1GNSA 3ORYA 2W8ZA 2VAWA 3GRZA 3MCTA 3OOYA 4IJUA 1KDYA 3WYFA 1KI1A 3N1UA 3F74A 3EOZA 4XGRA 3T3GA 4U6QA 4A2QA 4DCCA 1NYRA 3OC0A 4LMBA 4YT5A 4I66A 4ZOEA 2ATIA 4IS2A 3BWDD 4PPGA 4H27A 4CXMA 1KEVA 4Q7MB 5TIIA 1SCDA 4ML3A 4C20A 4DLRA 4E46A 3W7VA 3O2QB 4U7WA 3VBCA 4J16C 1WZ2A 2QRUA 2QTWB 1E59A 1PW5A 2PU5A 3PDIA 1EK5A 4O4JF 4XEUA 4ZCLA 4EVRA 5K03A 3JVIA 2GTIA 4G1UC 5GJCA 1DJLA 4H0FA 4MICA 2EGUA 4OEHA 3HL4A 1RI3A 4A6DA 1XVIA 2ZRDA 2W2NA 3W5SA 3VC1A 2IYLD 2VVTA 3H05A 4MQLA 1ISIA 3G2LA 1FFSA 3WX0A 3L6RA 3HO8A 2ZT8A 1ORHA 4M76B 3IT3A 1OZHA 3CV3A 4NBTA 4RQTA 4OAPA 4MUHA 1OFVA 4FKZA 1N34B 5ADHA 1ZKDA 1ZM9A 5FPHA 8LDHA 5CA1A 1Y6QA 2H4ZA 1HUQA 5GONB 2RFLA 5DYTA 4KQ2A 4UATA 1E3WB 2YZGA 1Z4OA 2CHQA 5E2AA 1AHHA 1L5SA 4PLFA 3WB0A 1G17A 1DGBA 1F5SA 5ETJA 2FMXA 2M1ZA 4D6FA 3OQIA 3IAEA 4YCJA 3P2JA 3VR4A 4E5PA 3SQLA 2WD8A 4EL5A 4YX9A 1FW6A 5M3BA 4QM7A 2EFEB 1QH8B 4HB3A 5KYXB 2F3UA 5F51A 4Z1MA 2YWGA 3I2GA 4B9AA 5BW5A 3KU4A 3COSA 3VGJA 5KDDA 4QECA 3C7KA 3GFGA 4B80A 5DSTA 1DAFA 2KBEA 5FBRB 4MA0A 1PJZA 3CG4A 3T7AA 2OV4A 2ZUBA 4JCOA 3NCTA 4WDRA 4X1IB 4ZPXA 3D5TA 1TKRA 3UK0A 2XF2A 3R7WA 3V1KA 2ZCJA 1YS7A 1IBMB 4ZVPA 4CG3A 4X41A 1P75A 1LB1B 4OKNA 3GWZA 1GQRA 2X1VA 3GOHA 4N7RA 4B34A 1YL6A 3M5WA 1DUIA 1A9OA 4G4GA 1SKQA 5ECYA 4U7GA 4D9IA 4BNJA 4WJZA 1K3UB 4QU0A 4HATA 1NBME 4LDAA 2WMIA 1YQDA 3L8YA 5ALKA 5LBIA 5FTNA 2P6MA 2IHUA 5A2GA 5EKUA 4ZQFA 3CVYA 3ZVKA 5EAIA 2YV2A 5ALRA 4AMBA 4AMZA 4CKBA 3RYFB 3GAAA 1LGYA 2C5FA 4FT2A 3LGXA 4XPZA 1MIOA 5I7WA 1TYZA 2QQ0A 4XDGA 4E13A 4RJTA 3Q0EA 3QVGB 5H70A 1F51E 1BD4A 2QW1A 1BCSA 2C2ZA 3ROQA 4DT1B 821PA 2DLCX 4OQQA 2BOVA 2FSVA 3A7DA 1OLXA 1VP3A 1RYEA 2UUPA 2R66A 3AF3A 3DM5A 4W82A 4W9NC 4W1SA 5KOHA 4DSZA 1F7VA 4RJKA 4OB6A 4YV0A 5BSMA 4DVGA 5C1PA 1SD1A 1QMGA 1XD2B 2MWMA 1P4SA 3U5TA 4RIIA 1Z4LA 1SHTX 5AVJA 4JI6B 2QP3A 4FSDA 5C7YA 2C7OA 1X1SA 2OHJA 3T5BA 1AQUA 1E2UA 1Q2XA 2HDWA 5EZ5A 1PZGA 3CYFA 4PX5A 3ROEA 3X1DA 3FLMA 1ZD9A 1U80A 4O2AB 5C8VA 2WK1A 2GSWA 1GZ5A 4LWOA 5KTYA 3NAMA 4EM6A 4CMCA 2IJGX 4C7VA 5CXQA 3FA2A 3VJRA 4MYRA 4DMRA 2IGBA 4EFMA 3VAAA 4HAYA 1P4AA 1NKVA 1K8YB 1W5AA 2B1GA 4NZYA 6NULA 3BD9A 1GCUA 2C31A 1NSFA 4AK9A 5DF1A 4AO8A 1QJCA 2YV3A 1I7NA 4MQBA 2HIHA 5AI8A 2PKRA 4WZBB 3SX2A 4ADSG 4ZIRB 4L4SA 5ER9A 2I4TA 1GPJA 4D9BA 5HCNA 3AIMA 3WFIA 2QVXX 2J5QA 3V4VB 1ZMRA 3DF9A 4KMMA 3DWGA 4QTUB 1T4CB 2BDTA 4QVKA 1EUDB 5DGTA 4E5VA 3G82C 2I3BA 3HVKA 4HD8A 4NAVA 1Z7GA 4Y0NA 3TZCA 4F3CA 1CQIA 2B94A 1CXZA 2OM2A 4HNQA 4I9UA 1FP4B 4EW3A 1C3LA 1LBHA 1X74A 1AQLA 4GI5A 3TCXB 4TSKA 1IPHA 5I45A 1RKQA 4UTPA 1KL7A 3AHIA 3R41A 5JMOA 4GIBA 4EKIA 1YFJA 2Z3ZA 2HREA 2Q9CA 4KLRA 3WZMA 2OE2A 3CNNA 4MHOA 4BE9A 2CVHA 4QYWA 4G0YA 1NHWA 1T5IA 1ZK3A 1HG0A 4FPXA 4EYEA 5BN4A 1U0TA 1BGXT 2FSPA 4TZ6A 3B51X 1USVA 4TLCA 2K2WA 3IDZA 1OGJA 4M87A 4W7SA 4EFNA 1A9PA 1W2GA 4OU5A 1SOUA 3JALA 3C14C 3ENVA 4ERXA 3V3KA 1U2RA 3B2NA 1F8XA 3F71A 2CXXA 2RBGA 5WRFA 4J94A 4UPDA 3GK3A 5GOTA 3WGMA 3MD0A 2Z56A 3RIHA 3FXAA 2RKOA 2XUPA 4IMJB 3RWBA 1UUFA 4A2WA 5K3CA 1WTCA 1XRLA 4S12A 3AO0B 4EMTA 3ZDFA 4KGDA 4JIMA 2EBFX 1YB2A 2ZSAA 4RKQA 3OCYA 1UF9A 1W47A 4PLWA 1XHFA 2O1XA 3TI7A 4FHZA 2P69A 1WKCA 1Z0AA 3QG5A 1C8VB 4B87A 4DS3A 4RFVA 1OLSA 1YCDA 1NONA 4QUDA 1CVRA 5BSEA 4RIEA 5DXAA 1D2MA 2H8KA 2QORA 3MT0A 1NRXA 4QDJA 4DAEA 5B7NA 5AICA 5TE9A 2DBRA 1KAHA 4P35A 1Z8HA 1J99A 4TLBA 3EDRA 5DHSA 1NU6A 5JJIA 2YHIB 1CPYA 1GNQA 4LISA 3C7CB 4V3BA 1O96A 5L7YA 2OAP1 3LOPA 1NRWA 4IQ4A 2LXNA 3A04A 4BY9E 1SFRA 1VL8A 1KARA 1P4JA 2XD9A 1WHSB 5J5VA 3T5CA 3VNRA 4ALMA 4EX6A 2X2EA 3WRVA 4MS4A 1UBGA 4IM7A 2FZ5A 4ETIA 1R3UA 3L1HA 3OH8A 2Z1MA 4HAOA 1U5BA 2MINA 2AQKA 1MOSA 2AGVA 2V7QD 2NNWB 2VZKB 1M6VA 1NYLA 4FW8A 4Y1FA 1JYSA 4B8ZA 4DYVA 3KT6A 2A6PA 3AXTA 1P0FA 4NMLA 3U7QA 1Z6ZA 2C5HA 4TVBA 2Q1UA 5EWMB 4BBAA 3T9DA 3DB1A 4P4UA 5KMGB 4C30A 2Z8ZA 1G66A 2EQBA 2GLUA 1JAYA 2I29A 2P68A 1HFWA 3OZTA 2A67A 2H1RA 1TIKA 2HF7A 4LK3A 2W2VA 2XMBA 4QGFA 3CSDA 5EL0A 4D45A 4DVJA 3ZCXA 3GJRA 3NTQA 3VC3A 4U9UA 2X1MA 1O6FA 2X42A 1XLTA 2ONZA 4OSEA 2P2DA 5F4BA 4ZI7B 2J1LA 2ID4A 3QM1A 2JHAA 3TCNA 3GFVA 4B79A 4MIKA 4MWGA 4QJ5A 5CK4A 5EQDA 1DFGA 3BWCA 3MHTA 4OX9B 1ZJZA 5DTQA 1KEKA 4L0QA 1E5TA 3AKYA 3RKRA 4LA4A 4B6RA 1WEKA 4V0MA 1GPDG 3JTMA 1KSHA 1J23A 4BQIA 4YRMA 1BO6A 1KBQA 1X13A 2JANA 4JZKA 4CEJB 1NL3A 4E6EA 3C41J 3CKYA 1QCCA 2YJNA 2Z98A 5AKYA 2C20A 3VR2D 1FSSA 1K2VN 1QFSA 1C1DB 1UBMS 2C3PA 1LV8A 1MX5A 2DFVA 2NU7B 2W2KA 2F1JA 3KQTA 5CDGA 2HA4A 1U0RA 1FCJA 4EITA 4JJ8A 4WFJA 3AI3A 2WM2A 3D3JA 3M3PA 3LQ1A 2H3HA 4IGKA 2JJ8A 4K0RA 4PNEA 2XRFA 3OI7A 3GAZA 2Z6QA 4Q03A 2FN8A 1FX0B 3EIXA 2PKYX 2F43A 4Y2VA 4CCYA 3OIWA 1VRAB 2YASA 2R7KA 5CDSA 3DT6A 2OGWA 3M4ZA 3PFFA 2C2WA 1NKTA 3E48A 4RZIA 4YR7A 2UZ4A 5HMLA 1ZUWA 3T5GA 3EMKA 5DW0A 3USCS 1JR3E 3JATB 2ZDHA 1CUWA 1A9RA 3RYIA 3PUVA 3W5UA 5CFMA 4D8WA 3WA7A 2HYIC 2WJVA 4EGAA 1DEXA 3Q40A 3QYAA 2IZ0A 1T9DA 3L7CA 5BQPA 2AIRA 1LNSA 5GJBA 3B13B 2I76A 2TS1A 4JBWA 1KQGA 4C7KA 3CUVA 4XVQA 3X1KA 1YGYA 1PRYA 3T3IA 1YZQA 2C54A 2P3SA 3C3XA 4DUZB 1CY2A 2O0LA 3FGZA 1A2BA 4V0LA 5E6SA 4UULA 3K92A 4HLUA 1ECFA 1MX9A 4C4YA 1WY5A 2Z5GA 2WHRA 1XQ6A 5E3IA 2HRDA 2OWDA 3QYJA 2JKZA 4HS9A 2A9JA 1XPOA 4YRLA 2BLLA 3RD5A 1XZCA 2JATA 3CZ5A 1J7KA 5J59A 2W70A 3DHNA 4UMFA 13PKA 3IUYA 2IQIA 1OC2A 4P84A 3DCNA 4M0FA 2H0RA 3OAAD 2HLDA 1ID8A 2VK2A 2FF7A 2Z04A 4AB1A 4ENVA 2JEOA 2RGBA 4BQEA 4J1SA 4ZOLA 1L4EA 2OC4A 1XALA 2VRNA 4JD5A 1P1KA 1IRXA 2VAPA 3BWMA 1AGRA 1P2FA 3WGYA 3E15A 4AZTA 5K4HA 5KU1A 1UBRS 2REBA 3C6XA 2DU8A 1BHO1 4DR2B 2VTBA 3UA4A 4J0GA 1PFVA 1M2GA 1Z06A 3MRVA 3CPEA 1HRKA 2A0FA 3D7RA 1X7HA 2AOTA 1ZEJA 4RXUA 4N39A 2I7XA 3C6BA 4W1RA 2XBMA 1Q95A 3Q3CA 3H0EA 3SR3A 4MVJD 3SMVA 3U3MA 1C3VA 4D80A 2XCTB 4L5AA 4ER6A 3F8WA 3QLUA 3LZCA 4NK4A 1QIDA 4RSGA 4BJ1A 1Y7LA 2CSUA 2JHGA 1GDDA 1O95C 2GPWA 1KWKA 3Q8LA 3TLMA 4J0DA 3PQ3A 1M83A 3KJQA 3PL5A 2YTZA 2BW0A 2IU4A 3TSAA 2ZIXA 3M9XA 2RBEA 2V65A 4GZ5A 3AUSA 1U7TA 1ZINA 5DLEA 4EPVA 2OLJA 3TM5A 4HWRA 5JG7A 4DUGA 4DIBA 3NETA 3ZZ1A 3WBKA 4X85A 1Q5PA 3OFSA 4B5LA 1ENPA 4UM5A 3U3KA 4PONA 2GPJA 3DFIA 3ZWNA 1GUAA 5CEEA 1JKFA 3L7AA 4CTJA 3UHFA 1A8QA 2Y92A 1KS2A 2V6BA 3OSZA 3F47A 2WQ7A 4BLPA 1E94E 1TECE 3F3YA 4IWNA 4NV3A 5JZSA 1MDFA 2MYNA 4QZVA 3UAXA 4EYQA 4ZQHA 1BNCA 3BTSA 1N4DA 1ZSYA 4PY2A 3HG7A 1Y1KE 2IOFA 2OGUA 3I04M 3PEVA 4FNOA 2OQRA 2YBDA 4L95C 1M10A 3H3FA 4OQ4A 4JT8A 3EXHA 5JCXA 4AAYA 2J0UA 3G7NA 3USZA 4OYYA 1NWHA 5DM60 2ZRBA 4WWHA 2Y1DA 2EU8A 4I9HA 3ZEIA 1L1RA 3KT0A 4ZHSA 3U44B 3IB3A 3MGCA 3UUEA 1JWLA 5BVGA 3PNYA 1RLOA 4KWTA 4NICA 3M33A 1NBAA 4WA7A 5HQ3B 4ZVNA 3KKKA 4G4IA 1MO6A 5K3SA 1P8AA 1P3JA 1U6IA 3A1TA 3OSUA 1EPUA 4ZV7A 4ALLA 2EWVA 4AN4A 4DA8A 3EFOA 3GGDA 4C05A 4E31A 4UFPA 3W5DA 1LPMA 4YAFA 1Q19A 4OM8A 1WRBA 3VR6D 1MJ5A 5IP5A 4Q1FA 4HZGA 2ZYGA 5TC4A 2FF5A 2H1OA 2EG9A 4H16A 2GJ4A 3PT9A 4J4HA 2DBQA 3DO5A 3OTQA 3FPEA 1W0JA 3OM0A 4Q4CA 3U19A 4TWZA 2OFXA 5JXGA 2GH1A 3CKKA 3HCOA 2EJTA 2D1SA 5IN5A 3VTFA 3TFWA 4GQIA 3IV9A 4YRPA 4ZV9A 2IWHA 2D1FA 2O1SA 5JNUA 1AXRA 2ACEA 3ZJ4A 4ZVQA 3BH0A 3TVYA 1YQ9A 1JSLA 5TPWB 5JNWA 2XPCA 4JN6B 2JFBA 1KMCA 4XYLA 3KQKA 5FWDA 1AZSC 5AM3A 2GBLA 2C98A 4DFDA 1NVEA 1TU3A 1NF3A 2C2KA 3WL8A 1TK9A 4ECEA 1DO2A 1J8YF 3W4JA 4F3TA 3BMNA 1DBQA 2ZUSA 3SYNA 5ERYA 4LJRA 3NBQA 1K27A 5IABA 2FCRA 5ES4B 3FE2A 2PX8A 4IIBA 1QP4A 1VLZA 2B1IA 2JCSA 4FHFA 4FGJA 4YDRA 4TT8A 1C1YA 1YDFA 3N6RA 2RAVA 4IIGA 2O48X 3EXAA 5FKJA 1K66A 3B1KA 4NJEB 1TZKA 3N8HA 3VZCA 4YCNA 3ZDRA 3S2YA 1RWOA 1JEQB 1E9SA 2PR2A 3NHZA 4MQFA 4CQMD 2C9ZA 4XUGB 4YK7A 4AYWA 1SCBA 2ZU0C 4LJLA 1U9ZA 4Y9UA 1FDTA 4DM7A 5FLXA 2QW8A 3HTXA 1JQ3A 3JVDA 4O4LB 2H5IA 3PUHA 3MEQA 4XGNA 5B6PA 3R5HA 5FUQA 1A97A 1TUBA 4HGOA 1CV2A 2GI4A 4JXKA 4F4CA 5I4KA 3W3AH 2R0QC 1ZIXA 4J0KA 1Z25A 2M1XA 1PNQA 4QXQA 4Y7DA 1KQNA 2OO5A 3TSOA 1YIDA 1XJQA 1R3DA 2XUJA 4LXHA 3TOXA 3GEHA 5BRJA 3WDKA 1EE2A 4PRLA 4RMNA 2MR5A 3WLFA 4DLPA 1YMVA 1AV6A 1H8HD 2WU3A 4U5QA 3PITA 1ZGJA 2OSVA 5HDQA 4DHWA 5KYUB 1NJ6A 3OJEA 2LDBA 3HPQA 5A9SB 1BSVA 3GP3A 5JAHA 4A82A 5ICCA 1Z17A 3L5OA 1OXVA 5G3YA 5K8TA 1RCTE 1HPLA 3ZXIA 3K70D 4I9FA 1GPNA 3RJ9A 4NKRA 4UVHA 1KAEA 3VQTA 4N1AA 4N8SA 1S4QA 3M4NA 3RDPA 3AOEC 4EZIA 4WKNA 4UUPA 2L19A 5DHFA 3RSLA 2P2CA 1NSYA 3RGGA 2BM8A 3AF0A 3DM9B 2Z30A 5ALDA 4BFSA 4NBWA 1CX9B 3DEZA 3NTOA 3N2EA 4Q4DA 2WFLA 3GUHA 3IQDB 3PBKA 1QH1B 4LY6A 4YGYA 4G5OA 5G0TA 4YAEA 3IV6A 3UMGA 1RD4A 2PL1A 1YB1A 3OY7A 3PUIA 3LYHA 3FNBA 3Q0IA 3SKYA 3KWJA 5BVHB 1E2PA 4EUKA 1B93A 2VCYA 1WDKA 3I1YA 2X6QA 3OO1A 4UTVA 4TV9B 2XMDA 3T9CA 3SSNA 2V7BA 4IWYA 5IT4A 2YICA 3W1WA 4B7ZA 4ZVRA 1TA9A 2BP7A 1EZZA 1N2SA 2QG6A 3O83A 4GBMA 2UUAB 3O8NA 2UZ0A 1GADO 5ESRA 2QTCA 1XWFA 1V1RB 5JPIA 1WY7A 2IHJA 2BGJA 4RJ2A 2WU8A 1CRLA 5IAOA 3HVJA 4MGEA 3QQ5A 4PZYA 1CCWA 1V1MB 4HRXA 2AYXA 1AUOA 4MW0A 2GJAA 3HV2A 4RCYA 3HKEA 3STUA 5JFTA 1YS6A 5DRYA 1U2ZA 2I99A 4U0KA 5FWYB 4D4HA 1GTSA 2C3YA 3QFRA 3G0IA 1AO0A 3GJTA 3TRFA 1IIBA 4CQMA 2A5FA 2B8TA 2F3SA 2R86A 4QXPA 1WW3A 5KZMB 3VHRA 3MWDB 2A88A 3GJ6A 4W8OA 3KQUA 3FDIA 1WPGA 1VMAA 2JCYA 3A8TA 3AP3A 3DCJA 4GGOA 2CEKA 1UAGA 3EOBI 3UEOA 3JQBC 1QDUA 4K6FA 3QG1A 1E4EB 4Z9YA 4EJMA 5T6BA 4DLLA 3DD5A 3GJ0A 1SEVA 3A1FA 3SYRA 4U3JB 2HYDA 4PV7A 1R6BX 2VZLA 5E0OA 3DBRB 5LP1A 1VG1A 1PL0A 3HYSA 4HQ6A 4L0DA 3ZQ6A 3WR5A 5IM4A 4LE0A 5TEVA 2CNWD 2IZ7A 3E7DA 1SZJG 1VGRA 1G8FA 3GA5A 3HLKA 3KXLA 3OJCA 4DJTA 3KSAC 3AW8A 4ND6A 3CRQA 4DSTA 2I91A 5BNTA 2JFFA 1VJGA 4ILKA 5CB4A 5GM2A 3R3UA 4QUJA 3G3EA 2GEFA 1DHTA 2Y1WA 1UM9A 1VJRA 5FORA 3CVXA 1R4MA 1TGVA 3Q9UA 5TPZA 1FQKA 3EWSA 1NBMA 3U37A 5BMOA 5IULC 1IY9A 1NVMB 2G9ZA 2ONKA 2ZLBA 2CUTA 4NULA 5BPFA 3RVMA 1AGYA 4UCWA 2BI4A 4JITA 5CITA 2IY7A 2R11A 1GIAA 2IODA 2UVPA 2HQBA 3FMOB 4GPIB 5LLDA 1SOVA 4MYTA 4HFJA 5E6UA 4XDZA 1ZX1A 2YRXA 2YIJA 4XFDA 4OGGA 1JECA 4Y6PA 3MOIA 1JLHA 1SVNA 2DQZA 3BFJA 3CCBA 3VOTA 2UU9B 3HACA 1GAQA 2OHIA 3KCQA 3RRZA 4NZ9A 4M0MA 2PUTA 4NABA 4QDOA 2BM9A 3LP8A 4UU8A 2ZRJA 3EW7A 5MGBA 1US8B 1KPIA 1YI1A 1IDN1 2R7LA 1ZD5A 1QF9A 4RGVA 2FR1A 3RIXA 3X2FA 2PWPA 4GPZA 3C6QA 4RH0A 3C5HA 4D57A 5GWXA 4FFMA 4YUWA 1C29B 4EY6A 2O2JA 1A8UA 2OD9A