1O0SA

Crystal structure of ascaris suum malic enzyme complexed with nadh
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
602
structure length
602
Chain Sequence
b'SVAHHEDVYSHNLPPMDEKEMALYKLYRPERVTPKKRSAELLKEPRLNKGMGFSLYERQYLGLHGLLPPAFMTQEQQAYRVITKLREQPNDLARYIQLDGLQDRNEKLFYRVVCDHVKELMPIVYTPTVGLACQNFGYIYRKPKGLYITINDNSVSKIYQILSNWHEEDVRAIVVTDGERILGLGDLGAYGIGIPVGKLALYVALGGVQPKWCLPVLLDVGTNNMDLLNDPFYIGLRHKRVRGKDYDTLLDNFMKACTKKYGQKTLIQFEDFANPNAFRLLDKYQDKYTMFNDDIQGTASVIVAGLLTCTRVTKKLVSQEKYLFFGAGAASTGIAEMIVHQMQNEGISKEEACNRIYLMDIDGLVTKNRKEMNPRHVQFAKDMPETTSILEVIRAARPGALIGASTVRGAFNEEVIRAMAEINERPIIFALSNPTSKAECTAEEAYTFTNGAALYASGSPFPNFELNGHTYKPGQGNNAYIFPGVALGTILFQIRHVDNDLFLLAAKKVASCVTEDSLKVGRVYPQLKEIREISIQIAVEMAKYCYKNGTANLYPQPEDLEKYVRAQVYNTEYEELINATYDWPEQDMRHGFPVPVVRHDSM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAD-dependent malic enzyme
molecule tags Oxidoreductase
publication title Crystallographic studies on Ascaris suum NAD-malic enzyme bound to reduced cofactor and identification of an effector site.
pubmed doi rcsb
total genus 219
structure length 602
sequence length 602
chains with identical sequence B
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1370.30 Mainly Alpha Up-down Bundle Hemocyanin, N-terminal domain Hemocyanin, N-terminal domain 1o0sA02
3.30.2330.30 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold arginine biosynthesis bifunctional protein fold 1o0sA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1o0sA04
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1o0sA03
1MUUA 3ZWYA 2Y93A 1HZJA 2YV1A 1UZMA 3AM3A 4IZHA 4IGEA 4EEZA 1BSVA 2JL1A 4EI2A 3JYPA 5K6AA 4E30A 1PL7A 3HB5X 3ITKA 1UP6A 2EP7A 4MDHA 2VCYA 3HFGA 3QVWA 4IDDA 1LU9A 1PGNA 1GEGA 1VJ0A 3DZFA 4NFHA 4RVGA 3A4VA 2BELA 3ANMA 4MP8A 5IJZA 3DMYA 5KCZA 5JMPA 4EYEA 1H6DA 4KUGA 1DO8A 3KLPX 5JMWA 3K8ZA 1A9YA 4ND2A 4B4VA 1JAXA 1Y81A 1YRLA 2VUTA 4XJSA 4DXHA 4M8SA 3RUEA 2VZ9A 1E7QA 2ZCVA 1VL8A 3KLMX 3UCEA 3PYLA 1P1KA 4EJ6A 4E5MA 2OOSA 4ZGWA 3ZHYA 4XWYA 3MWEB 5EL0A 4JGBA 4DQXA 3ZWWA 1ZK2A 2RH8A 4ID9A 1LNQA 4EEXA 3BTVA 2HMWA 4ZN6A 2TMGA 8LDHA 1YE3A 1LLQA 4P22A 1JWBB 1PGQA 3E5RA 5KKAA 1B7GO 3GGOA 4CM9A 3CMCO 1DC5A 2EP5A 2Q45A 2QQ5A 5IN4A 5EPOA 3FTPA 1VM6A 4J7XA 4CM3A 5G0TA 4AJPA 1NHWA 3MJ4A 2YDYA 5TS3A 3KYCB 3UICA 1NPDA 2YZ7A 3GZNA 1A4UA 4IQGA 4YWJA 4JP2A 3I1JA 3JQFC 5F1KA 3GZ4A 5F5NA 5TIIA 1I01A 3O8QB 1JW9B 1R4NA 4AL4A 2IDZA 1DPGA 1GV0A 1PWXA 3LT1A 1LLCA 3JQGA 4TROA 4CM4B 1DAPA 1NP3A 4DL9A 4FSHA 4A7PA 2J5RA 2VWHA 5T8KC 1PR9A 1ADGA 1RM0A 3H6KA 4L9RA 1LX6A 3GN2A 4UUPA 1NR1A 5G0WA 1KY4A 3GG2A 2Y05A 1JTVA 1R12A 1PJTA 1XSEA 4KWHA 2SCUA 3DAPA 3QWIA 4IS3A 4GKVA 4Q3EA 1BXGA 2Y0CA 3C85A 4KTTE 3RAJA 2AQIA 4Y9DA 1ZFNA 1KC3A 3CE6A 3WTCA 2AXQA 2G0TA 3WGQA 5I9LA 4YJDA 3NYWA 2JFHA 2X5KO 4P4NA 5MDHA 5BNFA 2GYYA 4BNTA 3TQHA 1W0CA 4ALKA 2ZTLA 2HJRA 3ABIA 3OIGA 1I8TA 1I3NA 4CMAA 2X0NA 4BO1A 1ULUA 3OM9A 4R01A 3GVCA 2YQ5A 1DFIA 4FFOA 7ADHA 5ILOA 3ON5A 1KETA 3IOYA 2HK7A 5I7EA 1LQUA 4ALLA 1LSJA 4PLHA 1P1JA 2AQ8A 3QQPA 3ULKA 4QSMA 3KETA 3HQ4O 1DHTA 3DL2A 4K26A 1FF9A 2I9PA 2HRZA 3DBHA 4CLOB 2VWGA 4PVCA 4WASA 5L9AA 4I08A 4R5MA 2CZCA 2Y66A 3NTQA 3I52A 3PGJA 1RM5A 5I9NA 4J2OA 2QRJA 1U4SA 3W6UA 3GGGA 4DQVA 3DMTC 1OAAA 4NK5A 3QVTA 3G0OA 3SLGA 3Q2KA 1HE5A 3HDQA 3ICPA 1V3UA 1HDGO 1I3LA 3PHHA 1WDMA 1X7HA 2Z5LA 4IDEA 2QYTA 2VRCD 3BMQB 3GN1A 3GC6A 4U6QA 4W99A 1UDCA 3DFUA 4TRRA 3OJEA 4D44A 2VWQA 4IZIA 1HDOA 4BGIA 3GOHA 1OBFO 1UAGA 2D8AA 2VYVD 5ITWA 2X1HA 5IG2A 1VE9A 2QX7A 1F12A 3GMSA 5GMOA 4ZICA 3WJAA 3E8XA 3U4HA 2HRBA 4GMGA 5IXYA 1AUPA 4XYGA 3KRTA 3PIIA 5DBGA 4IDBA 4M1QA 2IZ1A 2GASA 4G65A 4BNHA 4D7AA 1P31A 3U49A 3DFZA 3VOSA 3ZW9A 1YGYA 1BW9B 3F1LA 4GLOA 5DBFA 3DOOA 2OXIA 1HRDA 1NXQA 1PJCA 1Q0LA 4XDZA 3HN7A 4RDHA 3DBRB 3V2HA 5CEFA 1ISMA 3BMCA 6ADHA 2G76A 4LISA 3BMOB 4PLTA 1R37A 4YXFA 3GHHA 3RROA 2PZJA 2Y99A 3DTYA 4GX1A 1JKJA 2GNAA 5A05A 4QO8A 2CD9A 4PLPA 4B7XA 2R2GA 4FD3A 4L73A 4M87A 1W8DA 4ZU3A 4O1MA 5FF9A 4ZRNA 3QV1A 2FZEA 1PJBA 4UVIA 1PL8A 2EEZA 4NU6A 2PLAA 3LF2A 4GMFA 1VSVA 4MVJP 2DU8A 2CVOA 2CNBA 1TLTA 1D7OA 2W2LD 2QRKA 1LDEA 3HHPA 3WGZA 3GRPA 2HDHA 1Q1NA 2PK3A 3W8DA 4JROA 2VHVA 3HDYA 4CM1A 3K92A 2NLOA 4K9DA 1JWAB 3JQCA 4YVFA 2CF5A 4MJLA 2NV6A 2C5EA 2NTNA 1P1IA 3GY0A 2O3UA 4BO8A 1X14A 4OAQA 1U8XX 2WE8A 5JCJA 5G0VA 5BSHA 3IDSA 4MIYA 4EUFA 1FDSA 4IQ0A 2EKLA 3Q2IA 4RCVA 1OC2A 4WNIA 2HMUA 3P2YA 4XIYA 4YA6A 3BHIA 3GEMA 3NRCA 3DQPA 3IKVA 4DBZA 3RUIA 4Y8VA 5B1YA 1N1GA 1GQ2A 1PQUA 1Z73A 3ROQA 5KNLA 4J7CA 1I10A 2EWMA 5CEJA 3TZCA 1O95A 1Q7CA 3JD1A 4WCFA 4YDRA 3LQFA 1M75A 1EQUA 5A5FA 1Y5RA 3PLNA 5EESA 4DLAA 3WMXA 3P5SA 4DIOA 1CYDA 1I33A 5HA5A 1CQJA 2GDZA 2UYYA 1GQQA 2X5OA 3ROPA 2DLDA 3A14A 4DMLA 4YBZA 5JXWA 4ZD6A 4E31A 3VZPA 3D4PA 4RPKA 2A9FA 1CDOA 1J4AA 2GZ2A 4YT5A 4IBOA 3QP9A 2C2YA 2DVMA 2JHFA 2O4CA 1SAYA 3ZNNA 3RC1A 2NU8A 5B37A 5IZCA 3JCZA 3WSWA 4B8WA 3FBGA 1I2ZA 3DDNA 1HETA 3TPCA 3KO8A 4F6CA 1M2WA 1OZAA 3RUDA 3KBOA 4Z0TA 1KS9A 5T5QA 5B4TA 5AXAA 3IC5A 5TNXA 3H5NA 1EVYA 4XRGA 2B4TO 3ZNOA 3E9QA 3GVXA 5JFOA 3ASUA 3S2IA 5FYDA 3PZBA 4PZDA 3BMCB 1CERA 4RLSA 1PS9A 1Z74A 3FPCA 1PJ2A 1C0PA 3JYOA 5GY7A 3CZRA 3D7LA 4LRTB 5IAAA 5CHEA 2RIRA 3KZVA 1NFQA 3P2OA 1RM4A 4BMSA 1YH3A 1PZGA 1IHXA 1ORRA 3LT2A 3S2FA 1BRMA 3PPIA 2UUPA 1I2CA 3WWZA 2DUUA 5C5IA 2FSVA 3I4CA 5L4LA 3RBVA 5TC4A 3JQ9A 3BMNA 3RC2A 3WBBA 4DPKA 5A3JA 1EBFA 4NK4A 4RPJA 5AYVA 4J0FA 2HCTA 4DQUA 1FDWA 4PCVA 2VYNA 5LDGA 3ZWBA 5KJCA 3DWFA 2FPIA 1VKOA 2RAFA 1UZNA 4IUYA 3KUXA 5T64A 1DC3A 4MPDA 3ZWXA 4GX0A 2RBEA 1YOVB 4BNJA 4FGWA 3EC7A 3PTZA 3U4IA 1FDUA 4J9VA 4DWVA 3IS3A 1FK8A 2XF8A 4CMJA 1U3WA 1VJ1A 3HADA 1LDNA 3TZHA 4RPGA 5F3RA 3ZWMA 4F6LA 4CLHA 1RPNA 1B3RA 1P45A 4J6FA 5JO9A 4O0LA 5ADHA 1GTMA 3V2UA 4BQPA 1Z75A 3M2TA 1R15A 1EFKA 1GU7A 3HG7A 3DR3A 1QLHA 2IZZA 3GUYA 5DOZA 3CIFA 3IKTA 5EQDA 3NDRA 4K28A 3PQFA 2FOIA 3RUFA 3PGXA 5EQFA 5FI3A 1DIGA 3ZU2A 1XU7A 3I23A 4CQMD 1AGNA 4D3DA 4OKNA 5JDCC 4FGSA 2CY0A 1XCBA 4JK3A 1DRUA 2I76A 2VTDA 4OHUA 2OP1A 1KEVA 4WLNA 3NUGA 3M1AA 4I5EA 1Y8RA 2IRWA 4ND4A 4IXWA 1A7KA 3GA0A 5ER9A 3GK3A 5KVSA 2CMDA 4BGEA 3CH6A 3N74A 4LCEA 3RU9A 2UVDA 2DBRA 4J91A 1FMCA 3PVZA 1X0XA 3OEWA 1TA4A 4G2NA 1B8PA 5DULA 1V0JA 1XIVA 4HFJA 3U5TA 1XHLA 5MGBA 1PZHA 1IE3A 4O6VA 3VPXA 2R00C 3ITDA 1M6WA 3AM5A 5L7WA 3C8MA 4PVDA 3ZWPA 3DZJA 2Y67A 3TNLA 4QEDA 5BR7A 3WYBA 4AJHA 3F1KA 4YAIA 3OIDA 3LT0A 4OL9A 2BKAA 3W4KA 2GN8A 4TWRA 3I9JA 1H0KA 1EVIA 3FNFA 2JJYA 3HE3A 1KVRA 2P91A 1DSSG 1SMKA 4NHEA 4ZQHA 2VTEA 2O7SA 3ST7A 3H4VA 4PLVA 2ZJ1A 4DVJA 4DTIA 1K3TA 2HUNA 3UCFA 3F46A 4ALJA 1P77A 2VHYA 5COQA 4ONEA 2BGLA 3TL3A 3V1UA 1SPXA 4QQRA 2X58A 4BGUA 4ALMA 2OFPA 3ONEA 4BO4A 3KM0A 1ONOA 2B5WA 4HUJA 1PIWA 1SZJG 2IE0A 3TJRA 3QRWA 3WIEA 2IODA 3TDKA 2O23A 3ETDA 5A03A 2W90A 4IDAA 1XKQA 1XGKA 4BOYA 5JDCA 5C3MA 5JO0A 3O03A 1KYQA 3KYCA 4R1NA 2FHSA 1ISJA 1Z82A 3TF5A 3QE3A 4YYZA 2PGLA 1CJCA 3TN7A 3A06A 4Z9FA 3NT5A 3FCOA 1P74A 3DAGA 1I36A 3QY9A 1RYEA 4A0SA 4TZTA 1CRWG 4XGNA 5A4DA 1X15A 3ZCXA 3FTNA 4JBIA 4W4TA 1PJ4A 1LDMA 4JJFA 2HAEA 4KZPA 1MP0A 5LCXA 4QO7A 2XXBA 1GEEA 1N92A 4CMIB 3PJFA 4BMVA 1MLDA 3NJ8A 1EK5A 1G0NA 4GWGA 4UEKA 5TX7A 3WXBA 3V8BA 3L4BC 4YT4A 2AG8A 4D0SA 2YJZA 4YJGB 1G0OA 3PZRA 1R4NB 2Y1DA 3GVPA 1JAYA 3A9WA 1IYZA 4FN4A 1MA0A 5L45A 1AHHA 1JKIA 2HLPA 4A73A 1U3VA 1R0SA 3OICA 2C20A 4KP7A 3VAZA 4GQAA 4FFMA 1DIBA 1R0KA 2EKPA 2VYND 4ND5A 3WGTA 4S1VA 4PRLA 4R51A 3HJAA 3CZMA 4NNJA 1E6UA 4GVXA 2V6FA 3W8FA 4Y6RA 2ZK7A 1NPTO 4GPD1 3RJ5A 3ICCA 2C7GA 1YJ8A 1GCUA 3IJRA 1NPYA 2AW5A 5DCUA 1KVUA 5FI5A 1GL3A 5B4UA 3F9IA 2J3IA 5DCWA 3TOZA 2C5AA 1R6DA 1A7AA 4IJWA 3L4SO 4WOJA 4QFCA 5A9RA 3DTTA 2NVBA 4NBRA 4TRJA 1L7EA 3JQGB 3WWYA 2ZATA 3WQRA 2IXAA 3IQDB 4NBUA 3FNGA 4CM5A 1U3TA 4INAA 3KYDB 2YY7A 1KVQA 1ENPA 4E2YA 4PG8A 4IIVA 1XA0A 7MDHA 1C0IA 1JVSA 4RO0A 1LUAA 2BH9A 3MTGA 2P5UA 2JKVA 3F47A 1P9LA 3KHUA 4HFMA 1NBOA 1NFFA 1PGOA 4EUHA 2E6UX 1EVJA 5TJ9A 4BNWA 3K6JA 3KEQA 3L9XA 3CINA 1EMDA 3MCVA 2ZTMA 4HWKA 3JQAD 4TKMA 1YDEA 3BAZA 3ZWVA 2B69A 3PDJA 4CPDA 3NGLA 3VPGA 5A5EA 2JAHA 4P4GA 4I5GA 1NQ5A 2VOEA 3UVEA 1WMAA 5BSEA 1GCOA 3DAFA 2DPGA 1EK6A 4IDGA 1ZSNA 2JD0A 4HY3A 4R4JA 3O38A 3RVDA 1IB6A 3AI3A 4CL8A 2XOXA 3UCXA 4KDFA 1WZEA 3WGHA 4NJMA 5LC1A 3D0OA 1UR5A 2YQ4A 4ZQGA 9LDBA 4B8ZA 4BO9A 2F1KA 1E92A 2VNSA 1MXHA 4DLLA 4J4BA 3JD4A 4MVJG 4UVHA 4WLOA 2GUGA 3COSA 3H65A 1BVUA 3JD2A 4DA9A 4CV1A 2A94A 1HDCA 1QORA 1H2HA 2X4GA 3W1VA 4MKRA 1VL0A 5A04A 3I9NA 4CV0A 4CMGA 3ENNA 1VLLA 3EGOA 2G5CA 2PZKA 3WSVA 2QW8A 5ER6A 2V6GA 5JYEA 1E1MA 1JLLA 1FXSA 8ADHA 2H63A 4CMEC 2FR0A 1OI7A 4NJOA 2H6EA 3F6YA 1YBVA 2GZ1A 4W9NA 2Y1FA 3OEYA 2HMSA 1IZ0A 2EG9A 1QMGA 3H8VA 4B3JA 2BFOA 5JNLA 4E5NA 4DRYA 2BFPA 3IP3A 2WD7B 4Z6KA 5DF1A 3QWBA 3VPSA 1Z45A 3U62A 3OA2A 4KMSA 2GZ3A 2NVUA 3M1LA 4N5NA 3FHLA 3PYXA 1N8KA 1TT7A 4R9RA 1VKNA 2Y1EA 2AQKA 2J5QA 1A9ZA 2X0RA 1EE9A 1U4OA 4XDYA 1B26A 3HUDA 3ORFA 4RPHA 1PZFA 4C7JA 4NG5A 1MB4A 2E82A 2PD6A 3FBTA 3T4XA 1O8CA 2O48X 4WKGA 4JP3A 1HDYA 4C7KA 3PWKA 4XIJA 1NQAO 1HYGA 1NVTA 4PG7A 2NWQA 2VOJA 1GY8A 1KC1A 3EZYA 4J90A 2D0IA 4IMRA 1Z6ZA 2D3TA 4W7IA 3SJ7A 4GSKA 1W73A 5DP2A 2C0CA 5KJFA 2VHWA 1LQTA 3QSGA 3QWHA 3LZ6A 2CVZA 1UUFA 3ADPA 1H9AA 2FR1A 2PV7A 2BFAA 3SC4A 1I2BA 3TOXA 5JY1A 3JQ7B 4ZJUA 5J23A 4QFDA 3JQ9C 2ZQYA 4UUMA 4AJ1A 4XKJA 1GQYA 1SEPA 1ML3A 5TT0A 4MIEA 4NBWA 1T2EA 3Q3CA 3ZZNA 1DIHA 4E32A 5L53A 4IMPA 4OXYA 3GDOA 1NQOA 1K0UA 1P33A 2GGSA 4TQGA 5CFZA 3GAFA 1X1EA 4D3FA 4UUOA 2OGUA 1YQDA 1LDBA 1O9BA 2YHIA 3OH8A 3CTMA 5CPBA 5I7SA 3VDRA 2PNFA 2ZB3A 3VDQA 3FF4A 4IY1A 3GHYA 3KTDA 3PK0A 3D3WA 1ZEMA 1LSSA 1MFZA 3IJPA 3PWSA 3EUWA 1P1RA 4W6ZA 9LDTA 1YQGA 4L8VA 1T4BA 2FP4A 1R4MA 3T4EA 1JKFA 1AHIA 1ZJYA 4FJ1A 3F5QA 2DKNA 4MKZA 1K89A 2LDXA 1UZLA 2J3JA 2IYPA 3IUSA 4WLEA 4D79A 1FJHA 3QA9A 1G6KA 4BNUA 1IHYA 2DBQA 3C1TA 4UEJA 1HTBA 3UOGA 2Q1UA 1PQPA 5AQ1A 4P4LA 2Q2VA 1E5QA 1R66A 4GX2A 5T6BA 2JHGA 4AVYA 4WNCA 2DBZA 5L7YA 1XG5A 1LLDA 4N54A 3W4IA 4M89A 3E03A 1JVBA 2DBVO 3PJGA 1N9GB 1SBYA 3JYNA 4JBGA 4NI5A 1MG5A 4U6SA 4XCVA 3JQAB 4G81A 5F1PA 3ZH2A 4ZHSA 3N58A 1NWCA 5DBIA 3UH1A 4LN1A 3EAGA 4DIFA 1E3JA 4IDCA 1C1XB 1QV6A 1Y8QB 1HDZA 3IAHA 3NT4A 1YL6A 3Q0EA 4U0JA 5F21A 1QSGA 3VKUA 1ZH8A 3M6IA 1YB5A 2WE7A 3HFSA 1KEUA 4WJZA 4CL3A 5IDQA 3D5TA 2YW9A 1UP7A 1PJSA 1FDVA 1DEHA 5JC8A 3B70A 3VH1A 4NH4A 1DRVA 4IGFA 2ZTVA 3S55A 1CF2O 2UAGA 4GGOA 1RYDA 1ZK3A 1NR7A 5F1OA 3UGKA 5K6AC 3AWDA 3NAQA 5L4NA 1I5RA 4Q3BA 4B7UA 3H2ZA 2XAAA 2GN6A 3BZUA 1KVSA 1O89A 2ZB7A 2PY6A 3PFWO 1VC2A 2D1YA 3WX0A 4AJIA 2B4RO 3E9NA 2EW8A 2X22A 2QZ9A 4A26A 5A9SB 1U2GA 3HDJA 1GDHA 2Y1OA 1T4DA 2GD1O 3STHA 3MZ0A 3I9MA 1JA9A 3KSZO 3CSDA 2A4KA 4UULA 3WNVA 2H5LA 4FOSA 3V2GA 1C3VA 4B79A 2OUIA 4W82A 3S2EA 4QT0A 1TVEA 3UAGA 4YAGA 3EW7A 1EBUA 1MC4A 3VTZA 3I5MA 3LF1A 1YJQA 4E2ZA 2YYYA 3WB9A 3OQBA 1ZEJA 1ADFA 3DBLB 3A1NA 3VHRA 5I7VA 1NHGA 3PIDA 1I30A 1XELA 4F3YA 3I9LA 1RJWA 1N7GA 3O9ZA 3RASA 1X1TA 4FFLA 3QW2A 5IN5A 3RSHA 2O2YA 1LJ8A 1R0LA 4YT8A 1CIVA 4TKLA 1XU9A 4NBTA 3BTUA 1V3VA 3MEQA 4HFNA 1LSOA 1E3WB 4BB6A 4Y98A 1NVGA 2EJWA 5A9TA 1IL0A 5C7IO 4R68A 1HDXA 4E5PA 3B6ZA 4GKBA 4TMFA 1PWZA 1YO6A 4L74A 4XEHA 1NFRA 3SVTA 1ZSYA 2HU2A 5G4KB 4KUHA 2RHRA 5LDHA 1DC4A 3GDGA 4YAJA 3NDJA 1SOVA 3EK2A 3PI7A 2BD0A 4MO2A 4BNIA 4D3SA 4ZQEA 2Q50A 3RI3A 4YJGA 4CV2A 1WP4A 1HWYA 4PLGA 5HS4A 1NASA 3WG9A 3OIFA 2IEBA 3OHSX 2Q46A 4L76A 4YPOA 5DZSA 5GZ1A 4RVDA 4YAKA 1F8FA 2WD7A 3W4JA 1DXYA 2QG4A 4RPLA 1ZUD1 3VTFA 4UEOA 5JYDA 1WDKA 4WUVA 1P3DA 2EW2A 3OJ0A 3R3SA 1U8FO 4B4UA 4LMRA 5TT1A 3AOGA 1ZSVA 3RFVA 3OMLA 5CDUA 1SO8A 4NFYA 1RWBA 4HXYA 2E4AA 1EDZA 5TGDA 5ILGA 1EZ4A 3P7MA 1TT5A 5CDYA 4CMKA 2DAPA 2RCYA 2FPGA 3TSCA 1LDGA 1BXZA 2OBYA 1NQTA 3BMNB 1HT0A 4S3MA 3RBXA 4Z3DA 2VQ3A 4P8RA 2X0IA 1HF3A 1ISHA 4X54A 2D59A 2NU6A 4Z0PA 4D45A 5I8WA 4GBJA 1SC6A 2Q1SA 3JD3A 4FR5A 4II3A 1KEWA 3AUSA 1H5QA 4WK6A 1O5IA 4M55A 3SX2A 4BB5A 1E7YA 3V1TC 3RUCA 1EE2A 3AOEA 4EUEA 5C7LO 1GYPA 3NDIA 4OOEA 1ZK0A 3C7CB 4LCJA 2LDBA 1DFHA 3B1FA 2JFFA 3F4LA 3WTBA 1WLYA 3EHEA 3VVCA 1E3EA 4IXTA 4BNYA 1W4ZA 3OECA 3D1LA 3ZDFA 3DZKA 2V7PA 2FR8A 3BHMA 4LVCA 4GSLA 2NM0A 1ENYA 2D4AA 1C0KA 3CKYA 1BMDA 2PR2A 2PZLA 4HBGA 5JSFA 3I3OA 4PLWA 1WPQA 2B37A 2H9IA 3BTSA 3T7CA 2B0JA 3ZHZA 1V9LA 4YJHA 4AJ2A 4U8GA 1GADO 3EDMA 4MVJA 1M66A 3QWFA 3GG9A 3RFXA 1OOEA 2VN8A 3ROMA 2JCXA 2D5AA 4BIIA 3H9EO 3NKLA 4QX6A 3WYCA 1P0CA 4BO3A 3WDSA 2WJPA 2Q4EA 1NM5A 3MJSA 2ZB4A 1U1IA 2HMVA 3UFXA 2UDPA 4ZRMA 1QYVA 3UKOA 3GNSA 3GGPA 4RQTA 1E77A 4NIMA 1QR6A 3B20A 4M49A 4N5LA 4BKOA 3ETEA 3SEFA 5L40A 4GL4A 4J4HA 1NYTA 1MC5A 2B83A 2ET6A 1ENOA 4IJUA 2X7HA 2WMDA 3LYLA 3PP8A 4RGBA 2YV3A 1XQ6A 3ZI0A 2EKQA 3FNHA 3GZNB 4R54A 4W9NC 4CV3A 2JFGA 3HZZA 1M6HA 3IL2A 4CJXA 2Z1MA 3RKUA 1P1HA 1IPFA 4URFA 4BNGA 3JV7A 5U1PA 4XA8A 3H5RA 3FRJA 3RKRA 3CXRA 2O7QA 2PKRA 2R6JA 5JLAA 1ZNQO 3GAZA 3ZWNA 3H9GA 5BQFA 1TT5B 2IXBA 3Q11A 3L6OO 1UXHA 3AY7A 3TL2A 1Q2XA 1NAHA 3AU9A 1UDBA 4IINA 5TF4A 3M2PA 2BHLA 2PGJA 4AJ4A 5A1TA 4O59O 4RVSA 3L07A 1T2DA 4ZA2A 4K1LA 4PZCA 4ROSA 5EERA 3PYMA 4A2CA 2OO5A 1KIFA 3TFQA 4E21A 4BV8A 1TI7A 1E7WA 2I65A 4PLCA 4XQEA 3S1LA 2Z1NA 1X0VA 1XWFA 3L6DA 4PRKA 3AW9A 2AE2A 1JDJA 3ENKA 2DT5A 5KTKA 2FPPA 1IPEA 3JSAA 3PHGA 4Q39A 4N5MA 3FN4A 2PH5A 4YJFA 4FFNA 3UUWA 1LDYA 2YHIB 4DLBA 2B5VA 1U5CA 1B15A 1CWUA 5FWNA 4J9UE 4PZEA 1Y1PA 2VHZA 4MIOA 4BNLA 3PJDA 4IIUA 1QYDA 2EXXA 2HKIA 2Q3EA 1HE4A 2CF6A 3AFMA 4EBFA 2YDXA 3L0DA 1O94A 4XRRA 3AY3A 1DOHA 4OYRA 4ESOA 1GUZA 4YJHB 3RUHA 2WD8A 1ZJZA 3E18A 4BNZA 5BSGA 4B4WA 4BVAA 5JW6A 3LU1A 3KSDO 5DT9A 2Y0EA 2C7VA 2CDAA 4KQXA 2RH4A 3I9KA 1BTOA 4BMNA 5BNTA 5B12A 4IQ8A 4BKQA 2CDBA 3E9MA 5HS6A 3WMWA 3IP1A 1KVTA 1LRKA 5JS6A 2HMTA 4E6PA 4NBVA 2O3RA 4GVLA 1NAIA 4OH1A 1F8GA 1QKIA 3U09A 1DAOA 2VRCA 4MKXA 1GV1A 4I5DA 4DYDA 1D1TA 1F06A 1UXGA 3FWNA 2W98A 4BO6A 5KWEA 1ZK1A 5ITVA 3JQFA 1N7HA 1YOVA 1JU9A 3C7DB 3PWZA 3QJ5A 1E1LA 4WLFA 4YRBA 5K0ZA 4A03A 4AJJA 2ILTA 2JCVA 5CDSA 5H83A 3JD0A 1QLJA 2J6IA 3AUUA 1IOLA 4JIGA 4R1UA 4BUCA 2FRDA 1MFPA 4E33A 1AXGA 1E3LA 2OZPA 4OXNA 4WCDA 1BGVA 4O63O 4TRNA 5KVQA 2O3SA 1GZ6A 4OIMA 1H2BA 1B8UA 3RQSA 4EITA 4M54A 2BFMA 2Q1TA 3SXPA 5ES3A 1QP8A 3H9JA 1ZZEA 2POQX 3L77A 2VRBA 1YL5A 3DOJA 3MOIA 4H15A 3LLVA 2EJVA 1GUYA 1E7MA 3AJRA 4ND1A 1Y6JA 2D2IA 3VZQA 1M76A 4NFSA 1D1SA 3HWRA 3ZHXA 2W2LA 1LEHA 2Q99A 3OP4A 2NU9A 2Y1CA 1BG6A 2NADA 1D3AA 3ROKA 2DTXA 2G17A 3L9WA 2FN7A 2ZYAA 3I6QA 4H16A 5L3ZA 4I8XA 3RD5A 3V1YA 1DIRA 3NEPX 3F4BA 1QYCA 2AQHA 5CP8A 4ZQBA 2W2KA 1N1EA 2NSDA 3ZV3A 2Q49A 1LA2A 4MOWA 5HM8A 4BNMA 4BO5A 2VYVA 1SOWA 4FJ0A 4JXKA 1W6UA 2VUSA 2Q2WA 4CLRA 3G17A 4PLYA 3S2GA 4WEQA 2DC1A 2DUWA 3I9OA 1KEPA 4IS2A 1PS0A 4A27A 3Q6IA 4JNKA 3EY4A 4A5OA 3ZW8A 4BV9A 1ZIDA 2PD4A 4MVJD 1GUFA 4U0KA 3EVNA 3U9LA 6LDHA 1LI4A 3VZSA 2GLXA 2WM3A 5DDIP 5IDWA 4FIZA 4J16A 5TQVA 2W4QA 4NDNE 1Q7GA 4XJTA 1H6BA 4N7RA 5JPIA 3WLFA 5G0SA 3TRIA 2J5KA 1U9JA 3O8QA 4Q3AA 1YONA 3KXDA 1QYWA 1XLTA 2Q1WA 1U7TA 4U5QA 3F3SA 4JCOA 1T1SA 2DQ4A 4J43A 2V6BA 1ISIA 1UXIA 4YJFB 2BRUA 2XPCA 3DO5A 1YWGO 1C14A 2HK9A 4MP3A 4E5YA 2CUKA 3JQEA 1BDBA 1K5HA 3MOGA 4GWKA 1KERA 1YB1A 3GPIA 4CMHA 4J7UA 3E5MA 3KYDA 1H9BA 4J1QA 3K2EA 4DUPA 4AJNA 2WEKA 3WS7A 1YKFA 4I9UA 4CM8A 4JJGA 2X0JA 2C2XA 3QVOA 2I6TA 4YAEA 3GPDG 4IM7A 3MJVA 1K6XA 1PR3A 1C1XA 1Y8QA 3GNQA 3WGGA 1PQWA 1ZO8A 5A06A 4RQUA 3EYWA 4R69A 5TJHA 4RZHA 1PU2A 1V3TA 3C7AA 4Z9YA 3BXXA 4YQYA 3ONDA 2X86A 3QLJA 4Q3DA 1P44A 2NUAA 2B35A 4P38A 5JCJD 3GFGA 3ZNQA 4TZKA 3ZHBA 4Q9NA 4NQZA 4RF4A 3HSKA 4RVHA 4L0QA 3RCBA 4RZIA 4OMUA 2GN9A 4DMMA 3R3JA 4II2A 2V6MA 1BHSA 4MVJH 5JE8A 5HBRA 3DOCA 5A9SA 4LVUA 2DPHA 4FBGA 1EUZA 1TB4A 2GN4A 2JD2A 5GZ6A 4BO2A 4Q3CA 3CPSA 4BNFA 5EMHA 2A35A 1ARZA 4RF5A 5IDYA 2J8ZA 4CM9D 2EIHA 3F5SA 3BTOA 1MV8A 2AEFA 5THKA 1XR3A 4CMBA 2J3KA 1L7DA 2FWMX 4OSOA 4RV9A 5KVCA 3PQDA 4OO3A 3UW3A 3VVBA 1ID1A 5DNAA 1Y5MA 3ANNA 1OFGA 2PH3A 2ZQZA 4XZ3A 2X6TA 3G3EA 4PLZA 4BNKA 1B8VA 1S6YA 2UUOA 3SLKA 5JAQA 3ETGA 4TRMA 4EJMA 3AY6A 3RJ9A 2UV8A 2EHDA 3INGA 1MG0A 5L95A 3D5QA 3DEYX 3EMKA 1EQ2A 1LC0A 2C29D 3H3FA 4R1TA 3ZWOA 4EGFA 5I7FA 4FFPA 5JDIA 4DC0A 3TZ6A 3PHLA 3WOHA 2E37A 3LC1O 4BS9A 1XDWA 4RJTA 2C54A 5I9MA 2P9EA 3GFBA 3KVOA 4YRDA 4PG5A 3WQQA 3PJEA 4HNGA 5GZ3A 3JQ7A 4BL5A 3NJ4A 3JQ8B 4R3NA 3NV9A 3JQBC 4I1IA 4OQZA 4O5OA 3WGIA 1J6UA 3I6IA 2HJSA 4R9SA 1ENZA 3FPLA 3VH2A 4AG3A 3C1OA 5G2OA 4L75A 3RC9A 2VNAA 1Q0QA 1ZCJA 1UXKA 3C3XA 4RDIA 3C1AA 4NMHA 5TRTA 1H6AA 1VRWA 3ZV5A 3CMMA 3DBRA 2GERA 2PGDA 3K30A 4J1TA 3VPFA 3D4NA 3NTRA 1YDWA 1U3UA 2ZTUA 3BIOA 3X2EA 5IXSA 2VWPA 1E3SA 2X9VA 3Q9UA 4E2WA 1TXGA 5KKCA 1WMBA 3DBVO 4WLVA 4Q3NA 3VH4A 2F00A 2VHXA 3GMDA 4YCAA 2GPTA 3ZWCA 3WGOA 1WAMA 3D4OA 1H6CA 5TLSA 1KBZA 3OETA 4HFRA 4OOFA 4CUJA 5IDXA 3A28A 4D46A 2VT3A 2R00A 1O6ZA 4CQLA 2O3JA 4HNHA 1EDOA 5KIAA 1GAEO 3OQ1A 3NTOA 1C1DA 5AVOA 1GZ3A 4R3WA 3WJ7A 3U3XA 1N2SA 1B3BA 2BF7A 5DOVA 3D3WB 2H1SA 1E1NA 1ZKMA 1YB4A 4WECA 1I24A 2OP0A 1XYGA 3LDHA 2G1UA 2Z95A 1MGOA 1HL3A 1H93A 4CLXA 3AFNA 3RC7A 1R16A 2DTEA 4CR8A 1ULSA 4XGKA 2BI7A 1T1RA 2I3GA 1T2FA 1GZ4A 4ZVVA 1XEAA 1HLDA 2PKQP 3NGXA 3ZNPA 5KJ1A 1T24A 3BHJA 3D64A 4TVBA 4JQCA 1VL6A 1ZVMA 3O26A 4ALNA 4OJNA 5IFLA 2O3QA 1A71A 3DONA 1I32A 4B7CA 4WLUA 3L6EA 3OA0A 4FJ2A 4GLLA 3UN1A 1HXHA 2HQ1A 3QWAA 3UXYA 2XXJA 3IUPA 4R1SA 4CR7A 4NR0A 4R16A 3X2FA 3OQ6A 1YBMA 2DFVA 4HX5A 3DZGA 4RF2A 4JJIA 4WCFB 1J49A 5B4VA 5HWSA 4E5KA 1ZXBA 4K6CA 4NZ9A 4CLEA 5A02A 3UF0A 2P2SA 3U4CA 5JCXA 1CQIA 3AI2A 4IJKA 1ZK4A 1D4FA 2VT2A 4CLDA 1S7CA 4G5HA 4L4XA 4WEOA 3GLQA 4D42A 5G4LA 1QYXA 5F5LA 5AXDA 3GRKA 3JYQA 3SBOA 3WFIA 1U28A 2BGMA 4GX5A 1E7RA 1LXCA 3R1IA 1E6EA 1YBAA 5BT9A 5CG1A 5CEEA 3TZKA 3RU7A 3PLRA 5JAZA 3ZV4A 1GYRA 1A5ZA 4AJLA 5KOIA 1HE3A 1NNUA 5COAA 4FFRA 4HV4A 4ALIA 5EN4A 3PHJA 3AM4A 1ONNA 5EINA 4PIVA 4BQRA 1T2AA 4KOAA 4CM4A 4ITUA 2GR9A 1IUKA 2X9NA 3WBFA 1V35A 3MJCA 3P19A 4LMPA 1I3MA 3GF4A 1U2DA 4XQGA 2CFCA 2QIOA 2X23A 1HEUA 3RFTA 3JTMA 1ZBQA 1B14A 5JY6A 4MINA 2X8LA 1N9GA 3R0IA 3AU8A 3VKVA 4BNXA 1A4IA 2B4QA 1DDOA 1T25A 3PEFA 1MXFA 2CDCA 3OJLA 3KSUA 5KJEA 3H3JA 2J3HA 4EJ0A 1LLUA 4DIBA 4GI2A 4Y6PA 3HDHA 1DJQA 1YXMA 1EEHA 4YEDA 1NVMB 4EDFA 3ONFA 4QUKA 3KOUA 2FY8A 1PTJA 1A27A 1ONPA 4HADA 3H7AA 4BHTA 4KQWA 4D43A 1EFLA 2A92A 2P9GA 2HO5A 3R6DA 3ZV6A 3MTJA 4FB5A 4XYLA 5CDGA 3LC2O 1I3KA 1EUDA 4DPLA 1YL7A 3DBHB 4E2XA 1WNTA 2FMUA 3FWZA 3W6ZA 1GFSA 4I5FA 4H7PA 4FCCA 3WLEA 4F46A 1MX3A 3GEGA 1QXSA 4LGVA 4Z0HO 4B4OA 3WYEA 1EVZA 1YQXA 4UVGA 1D8AA 1GPDG 1LBEA 4OM8A 1UXJA 3DB2A 5IF3A 3E48A 3K96A 1B2LA 2P4QA 4CUKA 2PTGA 1KY5A 5TSDA 3KV3O 4GGPA 2ZYGA 4JX8A 3ZGYA 3LSYA 4UVEA 2PWZA 3PFFA 4YR9A 4LW8A 1EUCA 3G79A 4FOOA 2VUUA 4I9NA 2BLLA 4FC7A 2P4HX 4RF3A 4NJMB 5JAMA 3CUKA 2DTDA 1LTHR 3WFJA 2IEDA 4XD2A 1RKXA 5HRUA 4CLRB 1U5AA 2O3TA 3OBBA 4AJEA 5ICMA 1V6AA 1T2CA 1WDLA 2G82A 1BW9A 3NT2A 1Y8RB 2C07A 3AUTA 4R41A 4BNNA 3TZQA 1ZXLA 4CQLB 4XGIA 3JQBA 5AXBA 3FR8A 1ADCA 1SCUA 4ZQFA 1E0DA 3EVTA 4OSPA 1HKUA 1NTOA 4YB8A 2I99A 2YHUA 1JN0A 3BMOA 3LLSA 3FSRA 2YV2A 2TMDA 4YT2A 4KDEA 5KJ6A 1DLJA 2DFDA 3ZN2A 5JDIC 2QHXA 4CODB 2PKQO 4DPMA 3PHIA 3SC6A 2ZYDA 1RM3A 5C37A 5U4QA 2GF2A 1YS4A 4PLFA 3G49A 1Q0HA 3ZU3A 3JYLA 2JD1A 4MVJI 5BSFA 1AN9A 4XYMA 1UJMA 2AE1A 3BMQA 2NVUB 4AICA 3DZBA 2OBNA 1C1DB 2NQTA 2WYVA 3MJTA 1VPDA 5I8ZA 4XQ9A 4CM7A 1E3IA 1BXKA 1VJTA 1Z7BA 3DBLA 5CDTA 4WPGA 3H9UA 2QRLA 2I3AA 2CSUA 2FSSA 1YVEI 3O4RA 2GRAA 1LRJA 4LRSB 4DBVO 2EERA 4CQMA 3DC2A 4DYVA 3GVHA 5AOVA 2I67A 2PFGA 3ADOA 2W8ZA 4RL6A 4XYBA 1UP4A 4L4RA 1PX0A 4Z3KA 4FS3A 4BKRA 1V8BA 3WR5A 1H94A 1CETA 1BDMA 1SNYA 5T8KA 3H5AA 3S8MA 5ENDA 2JAPA 1I0ZA 3ZU4A 3JQAA 4PG4A 1Z7EA 1OMOA 1Y9EA 2EGHA 2V65A 5U9CA 2NU7A 2ZB8A 3AK4A 3H2SA 1ISFA 4CQMB 2BGKA 3GEDA 1HYEA 2WSBA 1PEDA 3WICA 5A3VA 3VC7A 4D41A 1PGPA 2AEJA 1AE1A 3G1TA 1PJQA 3FNEA 3LK7A 4JBHA 3RBZA 4J1NA 4RVUA 4UVDA 3OJOA 3TFOA 2NACA 1SB8A 4J1SA 4XR4A 4PN3A 2CVQA 5CPFA 2E49A 3GUCA 5L51A 2NTJA 5T57A 1BWSA 4OKIA 3E6AA 2AMFA 2QYSA 4Y67A 1JQBA 1C0LA 3OFSA 1HE2A 4WOKA 2WDZA 1WWKA 2IYOA 5FEUA 4UUNA 1NX6A 4AFNA 2PZMA 2QZZA 5FFFA 3TWOA 3WQSB 3DXFA 1O0SA 4CM6A 2I66A 4MVJM 2AHRA 4R5HA 1HDRA 3FD8A 4M86A 3GR6A 4NPCA 4YTEA 5H82A 5ICSA 4TVOA 1IZ9A 1WVGA 4UAGA 1F14A 4DREA 2E48A 4BKPA 5K9ZA 2Q4BA 4PFJA 4E13A 3DZHA 2D5CA 4BO0A 3NX4A 2B36A 1X7GA 1B0AA 3OF2A 2P5YA 2ZJ0A 3G1UA 4CR6A 4DGSA 4JLWA 3RUAA 1WW8A 2O2SA 4PGFA 3VPHA 5HTOA 3V5NA 1UDAA 1J5PA 2ZKLA 4J3FA 3HNPA 1U7HA 4AJKA 5THQA 2Q2QA 4IJVA 1P1FA 4MP6A 5G0UA 3Q9NA 3INRA 1L1FA 3VH3A 3HB4X 1A72A 4BO7A 3PXXA 1M67A 1J0XO 1K2WA 3WNQA 1P0FA 2YFQA 1VSUA 4ILKA 5H81A 3FR7A 1DRWA 5KVVA 5BNIA 1SB9A 1LC3A 4J49A 4WGGA 4JN6B 5L7TA 5JAIA 1QV7A 1BVRA 2VZ8A 2GCGA 3QVXA 4QECA 5AXCA 1ZMOA 4EZBA 2OHXA 4U7WA 5COBA 2BMAA 4E12A 4J0EA 1GD1O 2OL4A 4CMIA 3W8EA 4FDAA 1DB3A 4KTVE 4LSMA 4E4YA 2Y1GA 1DC6A 1E1KA 3MWDB 4XB2A 2WWRA 5JC1A 2EV9A 1R4MB 3K5PA 1TEHA 2AEMA 4ND3A 3K73O 4UREA 5DP1A 1PGJA 4TSKA 4WE3A 4I9HA 2Y0DA 4J2HA 1E6WA 2JCYA 1B16A 1HLPA 1K6IA 3GT0A 4K6FA 4NU5A 2I5PO 1HZZA 3OSUA 3INTA 5IZCC 4AJOA 1XQ1A 4PG6A 4KWIA 3Q1LA 4DC1A 1CEQA 5CG2A 1SEVA 3K2BA 5ENVA 1DIAA 4FPXA 4IDFA 2ZIZA 3DMTA 3KYBA 1ISGA 3RIHA 4XQCA 3DHEA 3AI1A 5G4KA 3GVIA 4YQZA 4F45A 1NWHA 3ZU5A 4OXKA 3JQ6A 1QRRA 2EGGA 2FZWA 3SJUA 3JQDA 3I4FA 3OJFA 1DJNA 1E5LA 1HSZA 5EIOA 4B3HA 4H3VA 4W7HA 4IPTA 3T7EA 1E3WA 2PA3A 4FQ8A 4MVJE 1F17A 3EZLA 3U4DA 4J4TA 1X13A 1HSOA 4B3IA 3U0BA 2EF1A 2AG5A 2WTBA 3VZRA 2P68A 4E3ZA 3BA1A 1ZMTA 1ZW1A 2HSDA 2OMEA 1WZIA 3GH3A 3LVFO 2GSDA 4CM8B 4CMCA 3QVSA 3IMFA 3IIEA 3D3EA 3GQVA 4XB1A 3B1KA 3JQ8A 2X5JO 4QTZA 1GPJA 4MVJF 1PS8A 2PD3A 2O4UX 1DLIA 3QIVA 4RORA 5C7OO 4QXMA 1OC4A 4L4SA 1LRLA 2NQ8A 3E1KA 1F0YA 4BGVA 1PL6A 4BKUA 1PJ3A 3L4BA 2O50A 3DHNA 4CUZA 2VZ0A 2HK8A 2NTVA 1Q7BA 5T67A 4YRAA 1IY8A 3RWBA 2DM6A 4HKTA 3N7UA 2C82A 3UHAA 1Y9AA 1DHRA 1WXDA 4EW6A 2YFHA 3K31A 1Y7TA 1E7SA 4XR9A 3HN2A 4D0RA 4RVFA 4XYEA 3C24A 4CLOA 4CMEA 4FC6A 2GO1A 5DN9A 3WIDA 2P9CA 5DCYA 3E82A 4FW8A 3KB6A 4GAEA 1N5DA 3H9QA 3LC7O 3LT4A 4HP8A 3PQEA 4LK3A 2X9GA 3ZWAA 3ANLA 2AA3A 1PJLA 1K6JA 3GDFA 3QHAA 3K9QO 4YACA 1KOLA 4KUEA 3ASVA 1UH5A 1DFGA 3FI9A 2BI8A 4XX0A 4Y6SA 5EJ2A 2OORA 2W2KB 2Y68A 4Z9XA 2NVWA 3BYZA 1IULA 3WGYA 1HYHA 1PZEA 1BXGB 3DHYA 3CEAA 5L4SA 2NNLD 1G1AA 4RLHA 1DBVO 1X7DA 3AOEC 1ADBA 2YUTA 1VI2A 3MJEA 1GR0A 2WYUA 4A10A 3B1JA 2ZCUA 3PDUA 3KEOA 3AUAA 3DZIA 3GNTA 1PSDA 5JBIA 4BNVA 4C4OA 1T26A 2IZ0A 3PRJA 4N18A 4LSWA 4OQYA 1AXEA 4WCFC 4OGWA 2RHCA 3I83A 1UAYA 4GH5A 2C59A 2WYWA 1LSUA 4E0BA 5CAEA 1GYQA 1QG6A 5IZ4A 1FDTA
chains in the Genus database with same CATH superfamily
3EA4A 1LVHA 4G2TA 4RHXA 3ER6A 4N49A 1HZJA 2YV1A 1U11A 2QAGB 4X45A 1UZMA 1Q74A 1KI4A 4H7KA 4MQFB 2Q21A 5IAKA 3BWBA 1N0IA 4EY6A 2ATVA 3RS0A 2A3RA 4MPTA 2EWWA 2DHRA 2E18A 2FR8C 4XGRA 2G9NA 1ZA1A 1PL7A 3HB5X 1QFZA 5CVUA 2VF7A 1NUPA 4WFKA 5KQRA 4OHKA 5IMBA 1L7QA 5I45A 2C96A 3FWKA 2OXTA 2JJ8A 3MA0A 4LY3A 2IFTA 1G21B 3KQYA 4IDDA 1VJ0A 2A1IA 4LHSA 2XW6A 2F3SA 4ENTA 3MOSA 3D6NB 3DBIA 3E7XA 3W5VA 4OP3A 4NYJR 2OHGA 2WY2D 1D4ZA 4MP8A 4Z49A 1XA4A 2OK8A 3RRXA 4LJLA 4DG5A 4UCXA 2FG7C 2IPXA 4ZAWA 1WF6A 5HJ2A 4KUGA 3NOXA 1MOQA 3K8ZA 1A9YA 1QX3A 3C15C 1EUDB 1MNQA 4GR9A 4ND2A 5KOHA 1CS4C 2CSXA 2VUTA 3F6CA 1CW2B 1W0KA 3HWX1 2VAMA 3O3NB 4Q7LA 4S1WA 3RUEA 3SD7A 4P84A 2RHDA 3KLMX 3O47A 3ZK9A 4DSAA 4X62B 3EUEA 1GZUA 5K3AA 3I0NA 3EDYA 3M83A 4RY9A 3FVTA 4E5MA 2PMDA 4EJ6A 4I55A 4CEIA 5IVIA 1MEOA 4WKPA 3TZEA 1U9IC 1V48A 2X8BA 2XHEA 4XWYA 5EL0A 3T99A 3KU4A 1CQJB 2N1BA 4O4JF 4KKVA 4XVUA 5CA1A 5A0TA 1HG1A 2TMGA 3VR2D 2AKAB 1VKRA 3IQEA 4P22A 1JWBB 3AILA 4RAOA 5CHYA 4BAGA 3W5BA 4CM9A 1W5SA 4UNIA 5DNWA 4B48A 4GHWA 2Q45A 3Q8WA 3CZCA 2RONA 1ISRA 2WM2A 5DXAA 5EPOA 3TNDA 5C1DA 4BKMA 2BI4A 4EKDA 4AJPA 4AKGA 1NHWA 1WB4A 2VXYA 2ZI6A 5KNDH 5B3LA 3H13A 1P8AA 1PL0A 4I1VA 5CNJA 1OGIA 3GZNA 2GLTA 3IERA 3K53A 5FBZA 1WG8A 1Y3DE 5CCDA 1DE0A 5HKBA 3IEMA 4QAJA 4MNTA 4RTSA 3K0FB 2R7MA 1VG1A 2ZWPA 1DGHB 2EDAA 1QO0A 1CS0B 2R25B 2CLLB 1Q11A 1R4NA 4G4SO 4S05A 4AL4A 3CLTC 4BZZA 3LUJA 4Q7QA 2IDZA 2V9ZA 2J0VA 3O1HB 5JVDF 1WD7A 2RC5A 4YN3A 1A9XA 1RWMA 1PWXA 2V7VA 4CM4B 3OFJA 4H7DA 3DR5A 1Z4PX 5DE3A 4DILA 4W9MC 1HR0B 1V6CA 3SICE 4FLFA 5HF8A 1YKSA 3TAXA 4BPRA 1T9CA 5EE0A 3QKSB 5SZIA 3QNWA 1HC7A 1NR1A 1KY4A 1NT2A 3MGAA 5DKFA 1H66A 4IHAA 3RAPR 8MHTA 2OPBA 2SCUA 4K05A 4LZWA 4ZAXA 1VLVA 2JJ1D 4KTTE 2NXWA 3MINA 3I32A 5TARA 3RAJA 4Y9DA 1ZFNA 4YP5A 1KXZA 2G0TA 2FX3A 3HGTA 4IZ6A 4ISBA 4YJDA 2X5KO 5D1NA 4O29A 3SYMA 5L6LB 2Z83A 4EHDA 1ECLA 1PW5A 3EZ6A 5FO0A 2IU6A 1Q1BA 1W0CA 2ZTLA 3ABIA 5ABPA 3AVWA 3L93A 4HVLA 1I8TA 1N57A 3IE2A 4Z53A 3GIDA 4BO1A 2QN3A 2NVOA 3OM9A 4LHXA 5EQJB 4ETNA 5HUHA 2I62A 3GVCA 4MLCA 2YQ5A 1Z0DA 2C5HA 1ZI9A 3EZGA 1IY1A 4TV8B 1I4WA 1X9HA 3K6RA 3ROTA 3ON5A 1U2PA 4YALA 2GPYA 2Y6UA 4CYMA 3A2NA 3QQPA 4QWMA 3ULKA 4QSMA 2Z3VA 1RJ9A 3EEBA 4GL2A 1NV8A 1FF9A 1KZ1A 1WCYA 3TI9A 2VWGA 4PVCA 1S01A 2QLTA 5FA5A 3S44A 3U1BA 2Z08A 1U3DA 2B8NA 1W5BA 1Q12A 2NZ8A 2QRMA 3EHDA 3NTQA 1GPLA 1M5UA 2H9AA 3QBVA 2QRJA 1T13A 1U2RA 2A9QA 4ADSG 1XX6A 1OAAA 2HMAA 1KJQA 2O20A 2WSSA 3G0OA 3OZIA 3SLGA 3ICPA 3LMKA 3FMFA 3MTEA 4ZO7A 1I3LA 4MROA 3N2KB 3PHHA 3QPBA 4IDEA 1BFDA 4Q82A 4Y9SA 2FE1A 2BFNA 2H0RA 5IEJA 4O2BB 4IVPA 721PA 2Z2YA 3JAMA 2NXJA 1E79D 2J67A 4A2QA 1UDCA 3DFUA 3PKJA 2C4NA 1X1SA 2XQGA 1ZS9A 1HDOA 1WNFA 4LJ7A 3AWIA 3GOHA 1WVMA 2JGRA 4AX8A 2FF7A 5EYPB 3G0HA 2H2IA 4EVRA 3GMSA 2AFIE 3D8UA 3E35A 4A8TA 2HRBA 4YMHA 2HM7A 3SM9A 1YOBA 3X1ZA 4BBZA 1P4GA 4E1BA 5JLJA 4FMCB 4UOEA 5JWOA 1X7YA 2A59A 1AUPA 1U0OC 1YJAA 3PIIA 2WJAA 1XZEA 3EVAA 3M4JA 4OUDA 1V41E 5DBGA 4IDBA 4M1QA 2IZ1A 5FTNA 3CO0S 3U49A 2F9LA 2OZLB 1FTWA 3AUYA 2MYUA 1TVCA 3BCHA 3R7LA 3ZW9A 3JYHA 3RFUA 3HPRA 4Q1CA 2YCBA 2PUEA 1BW9B 3JR7A 1N6NA 2JI4A 2OVBA 2IUYA 3VJKA 1Q0LA 5GOTA 2HA0A 3RYHB 1OKKD 3GEIA 4P3XA 3V2HA 1QTRA 4E4TA 4P7BA 2G76A 1ECPA 4U3JB 4MKHA 1R64A 4TQAA 3Q6NA 4Q3LA 3CLVA 2PO5A 1Y8ZA 1DTEA 4PLTA 2JIBA 4UDOA 2V7WA 5BQPA 3ILVA 5TF0A 4LDNA 2PZJA 3DTYA 5E2AA 5A05A 3EG9B 1XDSA 4QO8A 2CNDA 4CG1A 3NVDA 2VP4A 2GZMA 2QT0A 4FD3A 3ICQB 1Q21A 1LB1B 1SBCA 1RC0A 2BV3A 2GPAA 1N8TA 1OT5A 2QGZA 3A2MA 1RSZA 3GAAA 4K8OA 3QEKA 5T6MA 1KPGA 1PJBA 1W5TA 1PL8A 2EEZA 2CNOA 5BW5A 3R20A 1RYYA 3LF2A 2J45A 4MVJP 2IP2A 3CU5A 4B7GA 1TJ5A 3RVNA 5K4GA 2Y2VA 5FH9A 4K6OA 2PZGA 1D7OA 2W2LD 4GS5A 4C0KA 1ZIYA 1CY0A 2ODWA 4FZ5A 3D7SA 3DT6A 3GRPA 1BQ3A 3VU1A 1P60A 3PSAA 1CE8A 5LOVA 5IAOA 3AO0B 4E6EA 3FAKA 3K92A 1BDJA 4YVFA 3QOWA 4B34A 1VDZA 2WUDA 3K9CA 1E2HA 4C4AA 4X65B 3T7DA 2BOVA 4PHHA 5AK6A 1G5RA 3U7GA 2A9OA 4NMMA 2NTNA 1P1IA 3H1EA 3VISA 2OGZA 5H02A 2D7CA 4OAQA 1TK3A 3TW8B 2PS0A 1KQOA 1U0RA 3F78A 5PGMA 4WY8A 4MIYA 2FPGB 4EUFA 1H05A 4S35A 1GTRA 2ZUBA 3IPAA 2BTQA 1O1YA 1UJ5A 1PJRA 5G02A 5GQSA 2HMUA 1ZUIA 1TQ4A 4KGVA 4BFZA 4YA6A 1YCHA 4XQEA 5EXEA 1WD5A 3BHIA 3GEMA 3NRCA 3M89A 2OWDA 4PX3A 1DUVG 3QZUA 3QVJA 5T4FA 3UA3A 5B1YA 5CURA 1J90A 3TCNA 2VF8A 2VK2A 3CZAA 1Z73A 4QE3A 1RLOA 3L8MA 1A88A 5HFAA 1ID8A 1O95A 1CY8A 1B41A 1Q7CA 1YGPA 2EZ8A 2W6OA 2IYUA 2WJYA 3IT2A 1XAJA 1ZDMA 2P6UA 1GJRA 2G9QA 3FLEA 1KK0A 4DLAA 5DPMA 1A9XB 4D6XA 1I33A 1VBFA 1QFMA 1W5FA 221PA 2GDZA 2PLRA 4Y2TA 2PZ8A 2UYYA 5HA5A 1SCQA 3KL4A 1RHQA 2D6FA 4DMLA 2QTMA 5E4YA 3B48A 4ND6A 5DW3A 5FL7A 4RQAA 2W6QA 3ZW7A 3WV5A 4B33A 5I7UA 4OLAA 5GJBA 4R05A 1L9KA 3W5HA 4E31A 4YROA 3N0RA 3KIPA 4FEAA 3VZPA 1J4AA 4YT5A 1RKUA 3R3UA 2DY0A 4IBOA 4MWGA 3ZK8A 1BKSB 3EGDA 3IDFA 2J3EA 2OCGA 3BFVA 3I76A 3AP3A 3MLEA 4WRRA 4EB3A 2QMOA 5DFAA 1KSHA 4J6EA 2NU8A 3R5SA 3RBAA 3JCZA 2HI0A 2M6RA 4BECA 3TO5A 1F2UB 4G5YA 3RNOA 3WGVA 1Y82A 4BB9A 2JIRA 2ZRBA 4D5EA 1GSIA 2QB5A 2PCLA 4TYQA 5HQ3B 3LDAA 1TCAA 5JD6A 1IXZA 1M2WA 2V0NA 3LRXA 4F6CA 3LTNC 3QXGA 1OZAA 3H16A 4JOQA 3RB8A 3RUDA 3VU0A 4BVEA 4TVKA 5J9FA 3KBOA 1I7DA 1N6HA 2EKBA 1A9SA 4JUDX 2YWGA 1USWA 2GM3A 3BXOA 4K03A 4LWZA 4QBHA 1ZLYA 2HDOA 3IC5A 5G1OA 1YQWA 4G86A 5B4TA 3GOQA 1EVYA 1WXWA 3PGLA 3DVSX 4KAJA 3L6UA 2QL9A 2H2GA 2C4TA 3GVXA 5FYDA 2XDQB 3C3YA 1LZKA 3NP9A 4J2TA 4PZDA 4WXRA 4D8YA 1BVHA 1O57A 1WR8A 3GUZA 3HDTA 3I9V6 1NC1A 1DBPA 1Z74A 1TC2A 4M0LA 5IS2A 1A8HA 4X6YA 1WDTA 2ZYWX 2WJ6A 1PG5A 4NYMQ 4V24A 3CX4A 4YRCA 4GT1A 1JFLA 2DT8A 5CHEA 1LJLA 1XJWA 3TRJA 3ESDA 4OXXA 5K0JA 1FYDA 2P9YA 4PX5A 4YHHB 1E2GA 1F1JA 1GGMA 3A4YA 3IPLA 3LPNA 5KX5A 3LT2A 2VP0A 2WRZA 4KQMA 4ICIA 4Q93A 4QPNA 4YP6A 3WWZA 5B57C 2FSVA 5ALXA 3RBVA 3BMNA 5GPBA 3RC2A 1T4MA 4KO1S 5EXSA 1W47A 5AYVA 5A3JA 4J0FA 4D8UA 4MUGA 3RYFB 4JSYA 4CKBB 4BVJA 1LBTA 2FPIA 1G3UA 2RAFA 4N9WA 4MRAA 3PNQA 2WWFA 1AKQA 4YMUA 4GOLD 4GX0A 4C7OA 1M8FA 2RBEA 4M9UA 2A58A 4KX5A 3PTZA 3U4IA 4DWVA 2LCIA 3CNEA 3IS3A 1FK8A 1RAIA 1U3WA 1YR9A 1IEXA 2PBZA 1AGRA 3TW4A 1KNXA 2HWUA 4CLHA 4QLBA 3TPFA 2NO4A 3ZDQA 4DCVA 2XKKA 1P45A 1G6HA 2CXSA 5JO9A 4ZWNA 3S7TA 5HZMA 1ABEA 4NARA 1Z75A 3M2TA 4Y30A 2OWEA 2V8OA 1UKVY 4AUMA 4MS4A 2IZZA 2YIMA 3ZH9B 2WU3A 5EJIA 4E70A 3HXLA 1Z63A 1R6AA 4CCSA 1ODCA 2VUHB 5DOZA 4OHFA 3MQ2A 2F2TA 3PE4A 3TQSA 4ZYWA 2FOIA 4QHYA 3N8NA 5HHTA 1JMVA 2CEAA 1Q6YA 3CNNA 3BICA 1EI9A 1BZYA 3ZGVA 5FI3A 3REQA 2NYAA 4DEYA 1TM2A 1XU7A 3L6CA 2FETA 2OCLA 4ZV4A 1YNSA 3GRRA 2ZB2A 5JDCC 3CLSC 3VO9A 3RC3A 2CY0A 2IGBA 5HDQA 4F2WA 1L5QA 1DRUA 1VG9B 3ZE8A 1OXSC 2BHSA 2OP1A 4DZTA 4DJDC 1AT1A 3DTNA 4I5EA 1NOIA 1H2ZA 3SJAA 2IRWA 3GB9A 4IXWA 1A7KA 3AVOA 5ER9A 3TBHA 4MGIR 4F1WA 2CZGA 4BGEA 5CLJA 2N75A 3N74A 2HNKA 2WYHA 3IMGA 2CL0X 4RANA 2I9KA 1D9XA 2DBRA 2UVDA 2HT1A 4M0FA 4UUQA 3OEWA 5FBQB 4TSFA 2J33A 5FWXA 2B78A 3GARA 1G8HA 4O6VA 5ETJA 4AJ9A 4FMDB 3UBMA 1VPVA 2F1HA 3UJNA 3ZGLA 3CA8A 2C31A 3JAWA 3NXKA 1ECFA 1A2OA 1HMPA 2HYDA 1E8NA 4L4YA 3WYBA 4AJHA 3DPIA 3F1KA 3OIDA 5DISB 4YAIA 3FGOA 2OV4A 2W11A 2GN8A 2WNSA 4TWRA 1H0KA 1SULA 1EVIA 1G21A 2JJYA 2OO5C 3HE3A 1XKLA 4MJ7A 4DLTA 5JXHA 4W5QA 7CATA 4ZALA 2LV8A 3CUTA 3TIGA 2JLVA 2VK1A 2I6UA 1J09A 1G5PA 3JPWA 4IIBA 5CXXA 3HB7A 4PLVA 4H31A 4A8JC 4DVJA 1K3TA 2HUNA 1OLUA 3RT1A 3ICVA 2A88A 3UCFA 3V4VB 4ALJA 3EZFA 1GGVA 3LOUA 2IDMA 4BVGA 1GPMA 1IBSA 4ER5A 5COQA 3WLPA 2FWPA 3SYRA 4EGJA 3KFVA 5JCPA 1L5WA 1CEXA 3ITNA 3JARA 4F96A 3WL8A 5F3WB 3TD2A 3AC0A 2LD4A 5LU9A 5B3JA 2C4HA 2PRKA 4YI5A 4BGUA 2OFPA 4HO1X 4XIGS 4BO4A 3KM0A 2JASA 1ONOA 5LZ7A 1I1NA 1ZWLA 1PIWA 4JB0A 1SIBE 3FJOA 1FLNA 1WY7A 1OFUA 1OR8A 2QX9A 3SM3A 4BBPA 1H4VB 2G08A 2MINA 5K0SA 2G25A 3OZ7A 2CJYA 1PYDA 1KZ6A 2DEUA 4FFVA 1DPFA 1N4AA 3SOPA 4JH0A 1K6EA 1CDZA 2NZWA 2ETXA 4B6GA 4YUXA 1COZA 2F4NA 3ENQA 1KYQA 2IZ7A 1JLLB 3KYCA 4DKXA 2Q3DA 3ANSA 5CIWA 1Z82A 4OGFA 1XCLA 2IYQA 1F9EA 3KJXA 4F38A 5KI6A 1CJCA 2GAIA 4XUDA 5FPHA 3X2SA 3NT5A 3R0JA 1ESDA 3QY9A 4AXBA 1ETHA 2YRWA 1EIZA 1Y6QA 1RYEA 2ORVA 2SKCA 4ZOAA 4A0SA 4F8YA 4TZTA 1CRWG 3PF9A 4MCJA 3T7KA 2P5TB 5CBPB 4Q7EA 3OC0A 4G41A 1CUUA 4RH1A 4NZOA 4A3SA 3SZRA 1CRQA 1G9XA 4RD0A 3KYJB 4I7EA 4G1UC 4UM5A 1Z5UA 3STVA 5P21A 3CR3C 3R6WA 5IYZA 3CRZA 3I01A 3CC8A 4JJFA 1J2YA 2HTEA 2I4TA 3CM0A 3NHZA 1A4XA 3ECCA 1Q0SA 5AVTA 1MP0A 1KO1A 1PT6A 2BJWA 2NT4A 4TZ6A 2GAOA 3RFFA 4X00A 5FUVA 4B45A 3PJFA 4BMVA 3ZK7A 1MLDA 2OFXA 1EK5A 1G0NA 1UK7A 2MWMA 4ZO9A 3ZE6A 1F51E 5TX7A 2PMFA 4HTFB 1OB2A 5ESWA 1HPLA 4NSNA 4GZ6A 2LWIA 4JYMA 2EFCB 2XKAA 3ZDBA 1Z7YA 1G0OA 2MSCB 3IUNA 2Y1DA 1Z2PX 1UOEA 3GVPA 3OLZA 3QI2A 4UZEA 1RBQA 1AHHA 3OICA 3IALA 2C20A 3W04A 1QC5B 2VAXA 2EKPA 4AF8A 1NXXA 4WZBE 4TM8A 3FI0A 3A6ZA 2O1SA 1MIOA 4KL8S 3HJAA 3CZMA 2OYCA 1I0IA 1O77A 2R3SA 3KT3A 4NNJA 4M8IA 3SX4A 3BGDA 3TUJC 4GVXA 4X7BA 3NWPA 2MHCA 3OZCA 5EPEA 4TYWA 4A36A 4TYYA 1FXWF 3WAGA 1NMQA 4GPD1 5AVKA 4DJAA 1IZZA 1MH9A 2VP6A 2IH4A 1GCUA 3TLBA 3W9SA 2HB6A 4LJKA 3UEOA 1NBEA 3KVNA 4KN8A 4IW3B 5KINB 3EPJA 2YTZA 4HI0E 2BMDA 4TKUA 2J3IA 3D8NA 3WHPA 1HNZB 4PE5B 4LZPA 5FTMA 1JTFA 4PFKA 1B8OA 4WOJA 2NV0A 3U3ZA 1PG2A 1J7KA 3TVDA 4NBRA 3GW8A 4TRJA 1L7EA 1QUFA 2FMTA 2PFSA 1D5WA 1R0CA 4O4LB 2B30A 5AKGA 3HP4A 4PWZA 5J2TF 3V4OA 3WK7A 2HLHA 2BMFA 3HEAA 2QVCA 2YXDA 3FNGA 3O95A 3DFKA 1QK3A 2ZG6A 3IUQA 4GSYA 4INAA 1RYBA 3H4TA 4P0TA 2QI9F 1FFCA 3UHFA 2ZWOA 4PG8A 1R5OA 2E9SA 5B55A 5NULA 3I4LA 1GNRA 1NUAA 4RO0A 5GV8A 4TL7A 8GPBA 1JEDA 2JKVA 2V98A 4H08A 2W8BB 2VT7A 4HFMA 4M9RA 4EFLA 5IJ0B 1FNNA 2H8KA 4H1UA 4UBLA 5EHZA 1QZXA 1XVLA 3LHSA 4I6EA 1U63A 1SC4A 4KACA 4N03A 2LIPA 4JJ7A 3VZDA 5KBYA 3ROZA 1MO3A 1QH0A 3RHTA 4XWOA 3JQAD 1J99A 4CKCA 3ZWVA 2B69A 2Q3HA 2BBWA 2C58A 4KAAA 1XTRA 3VPGA 2JAHA 4D8VA 4ROTA 4TMXA 4QKQA 1KMHA 4RMGA 2YMLA 2FMHA 4H7FA 5BSEA 3DAFA 2DPGA 5KTOA 3ESAA 1GCIA 4Z2YA 5AESA 3D7KA 3M3DA 1KJNA 3K0EA 2IITA 1T5DX 4BYMA 3T0GA 5IJ9B 3OWOA 2QRNA 1YA8A 3URMA 3G0DA 4HDSB 1WZEA 4MUMA 2CT8A 1EA5A 3D0OA 3D2CA 3TIFA 4B3XA 1UR5A 3D7NA 3PFNA 5KZMB 9LDBA 1H2AS 3LIIA 3NPMA 4ZU1X 4LOKA 2CZQA 4IOKA 3TXXA 4GLJA 4UEQA 4M1EA 3JD4A 1ZGBA 3ND6A 2XNDD 3SEQA 2ODAA 3TLGA 1XB2A 2G3YA 4FONA 5DVZA 3R7NA 3JD2A 1OTHA 1H9CA 2H11A 4RK7A 1Z5NA 1F0PA 1GTZA 1HDCA 2EZTA 1H2HA 2G77B 3IV6A 4HYQA 1FSPA 1XD9A 3K0BA 1U94A 1VL0A 3NDBB 3P2EA 1Y3FE 1Q0TA 3IO3A 5JANA 1Z13A 1ZOIA 2ARKA 2J0UA 2QSYA 9ATCA 3P0HA 1B1AA 2QW8A 3CCFA 4XDGA 2X0DA 3WSVA 1YQUA 4Q1DA 5DEOA 2E4XA 5F7JA 1M1NB 5HNKA 4X66B 1DADA 2W9XA 4PGGA 4UTXA 5C81A 1FPQA 2F90A 4GXNA 2H63A 8ADHA 2E85A 2D5BA 1AIPA 3AETA 4NHOA 3MRTA 2CVPA 5F7XA 2P9ZA 1XZPA 2E5FA 3CY6A 4YP1A 5TEVA 2ACVA 2FN4A 3DZ8A 2Q07A 5JBNA 4MQLA 4LTNA 1G18A 5TMDA 4JLVA 3IAXA 1IZ0A 1Z33A 2OUKA 2EG9A 3AB8A 3COVA 4ZV7A 4B3JA 3OHMA 3U7FB 4JQSA 5D2CA 3UAWA 1BVYF 2QG6A 3FIUA 1MR3F 4XLTA 3ZTWA 4AIRA 4E5NA 5LP6A 2PUCA 4DOMA 3IP3A 3F7TA 4D5GA 4W7SA 4AY4A 2RJNA 3EDOA 1OZ0A 2XRYA 2RGAA 3CNQS 1NP7A 3DTVD 3QWBA 1TQ2A 4MW1A 5H4GA 3EVCA 4EARA 1DUSA 3OA2A 2NO9A 3LOPA 5BSKA 1FFXB 1TT7A 1PJ8A 2ASEA 2EBHX 2REQA 2E55A 3HJBA 3IHLA 2OAQ1 2AQKA 3DW1X 3NI2A 1UWKA 1G8JA 3G0CA 3WMRA 3HUDA 4BEBA 1PZFA 3AEQB 2JFVA 3ZX4A 1BO6A 1MB4A 4DNFA 3QMVA 3CEPB 2OQ2A 4QQKA 1P75A 1WHSB 1Z2CA 3PWKA 5K3CA 2FJPA 1XBTA 3G6KA 1RQRA 1JPVA 4HQRA 1JB1A 1PTKA 3J81k 2H52A 3EZYA 4J90A 4A8JA 2AMVA 4IMRA 2OQIA 1Z6ZA 2GBGA 2Q28A 3SK0A 4DUGA 1ORHA 2C0CA 4YRJA 1JSRA 2VHWA 2X3YA 4YMSA 4ZVTA 3N2NA 2XWPA 3AH8A 1XFAA 1MC8A 1N25A 3GU3A 3LK6A 4UAVA 4UQPA 1XNGA 1XK6A 4LDPA 3SC4A 3GUHA 1JEQB 5JY1A 5H3LA 1QH9A 2W6NA 1J0DA 1EFRA 4QYMA 4ZJUA 1K3UB 1PZXA 1QIMA 2XTNA 3CHYA 2W6ID 3NWOA 1NGSA 1GQYA 4UUMA 2J9RA 1ML3A 4OHRA 4HVCA 5ADWA 1T2EA 4EUKA 5DTIA 5CITA 1QF7A 1Z37A 2H1WA 2QOEA 2RAUA 3ICOA 1NQOA 3JW8A 4FZVA 4OXYA 3V8VA 1JHAA 1YUNA 2OSBA 1KNQA 1P33A 2X14A 3A8TA 3EFBA 4XLZA 4BU1A 4CKWA 1RAEA 1X1EA 5IC6A 3U3KA 4D3FA 2YKGA 3PKIA 1XRRA 4UEWA 4Z5XA 1ADYA 1YQDA 4ZIRA 3TSYA 3QYFA 4Q6WA 2RARA 2YHIA 3IAS6 4URXR 1Y98A 4LRYA 5CPBA 4EMTA 1B0PA 2ZB3A 1HQYE 4FFWA 1NDUA 4DCMA 1T3ZA 3KTDA 1RTTA 3F5MA 5AVJA 2GMWA 1U2SA 2R8OA 3EASA 3IJPA 1MFZA 5GWXA 1UKCA 4EWLA 2JLYA 1WXXA 3KV1A 2ZRAA 1T9BA 5H5JA 2G80A 4FX2A 3LWDA 1T4BA 2FP4A 2AFHE 5KX5B 2FSFA 3GLFB 4FJ1A 3F5QA 2DKNA 1ZAKA 3IR6A 2LDXA 5AD1A 1IN4A 2IYPA 4P86A 3QA9A 1OLOA 1NC3A 1T8WA 2C4MA 2RHHA 3OM8A 3QLUC 2QTGA 3RJZA 3CEHA 1UCFA 3HV0A 3KNZA 3WLNA 2ADFA 1VYTA 5AJXA 2D13A 2C2ZA 3A27A 4LXQA 1E99A 1XZGA 1H5UA 2VBFA 1V8DA 1LBSA 4X94A 5DLYA 3DAHA 3RU3A 4ERNA 4EL0A 1DQNA 1C4KA 2BCEA 4NMXB 4RCZA 4ZCLA 1GM5A 4WNCA 3R76A 3UYKA 2LIVA 1OXBB 2IHZA 2QUKA 1YVPA 4UU7A 3DYBA 3W4IA 3KFLA 4YX9A 4ZOQI 4C3UA 4HUQB 5BUQA 1NU8A 1SBYA 3JYNA 3PXEA 4PX9A 1MG5A 4U6SA 1M34A 1J8QA 3DE0X 3CLSD 1KJ8A 4GD3Q 4PICA 3EBOA 5F1PA 3ZH2A 5JS2A 1IQUA 1NWCA 1XHEA 2W8BA 4NYJQ 2RMKA 4IDCA 4OA5A 2FEAA 4RIGA 4U0JA 3V7NA 1YL6A 3VKUA 2AMYA 4LZNA 3KHTA 5BSUA 1YB5A 3MYYA 4A0HA 4MRPA 4Q66C 4TMVA 4WJZA 1IXSB 4JMPA 4KYUA 4I4TB 2IXTA 2WNIA 2ZS7A 5ICEA 5CJJA 3M9WA 1DRVA 2SECE 3Q2OA 1SOAA 5FOTA 2XIJA 2GCIA 3WNZA 2OY0A 3OEED 3F6PA 5F1OA 2HCRA 2M98A 4HTAA 4TN5A 4UHKA 3H2ZA 5U4XA 2OQVA 3HBMA 4M8NE 3DA8A 2ZBDA 3C1UA 4IGIA 1VRAB 1JDBB 1O89A 4L7QA 3PFWO 3WX0A 3X0DA 4UCFA 4MUNA 3W5UA 3HHSB 3IAM6 3K0CA 1DV2A 3QUBA 4RS3A 1CX9B 4A26A 2QRUA 4F4UA 5A9SB 3BC1A 3HDJA 5HIAA 1GDHA 2Y1OA 1J56A 1W36B 1I5OA 5CXUA 1A95A 5DWVA 3I9MA 1L4HA 5IKXA 3V00A 3DSRA 4UULA 4H0CA 4FOSA 4HF7A 1R8QA 4G4IA 1O0BA 3ZHOA 1AKUA 4MUHA 4N3GA 1MC4A 2G5PA 1JXQA 4B4KA 3KJHA 3I5MA 1E6MA 1MEEA 1P61B 3HACA 2YYYA 3LF1A 4E2ZA 4MV3A 3LYAA 2J0UB 1XZNA 4YUVA 3X1KA 1KJWA 3KELA 4N40A 2OZKA 3R9XA 2OV6A 3ACCA 3B5EA 4UPVA 3AEXA 2G06A 5K0LA 3VHRA 1YZKA 4WBXC 1L4UA 1IN1A 2HWWA 1K2VN 1K7FB 2NYRA 2PYDA 1FVOA 4K86A 4FFLA 3QKWA 1D6SA 4OF4A 5AKXA 3RASA 4U7PB 2PNJA 3UJDA 1JG1A 2OAP1 1ZGGA 4YT8A 5ALIA 2ZBQA 2XB6A 4YRNA 2GJAA 4HWGA 4FE4A 1E3WB 3JASB 2OZLA 4OI1A 2ZVDA 5C34B 1BEUB 3SFVA 4LF6B 2BMEA 1NVGA 4Y98A 1L5RA 1MX1A 2G70A 2O2HA 4LX0A 1G5TA 3L7NA 3OO0A 3A9UA 4E5PA 3W7AA 5KS2A 4GKBA 3GBPA 2VJPA 4H1VA 4QLAA 1N1MA 2XQKA 3AHCA 3E53A 4TZ0A 2P9HA 3W79A 3GLHE 1CULC 1GRVA 4AYTA 2ZSEA 2ANCA 1A97A 3MM4A 2A5GA 2IOFA 3LCJA 3PPXA 1RQLA 1WU7A 5LDHA 3GDGA 2UYCA 4L7VA 2R751 3OKPA 5C1OA 1SOVA 3PI7A 4U4AA 4U63A 1BFKA 3RHSA 4B2PA 5SYAA 4BNIA 2Q50A 4D3SA 5BXQC 1Z62A 3EUAA 4JHLA 4NULA 5CVCA 5HQTA 4PLGA 1G8AA 4HAYA 2JIMA 3EA5A 1PDOA 1P9RA 2IEBA 5AKEA 4N41A 3F6EX 4KWEA 3ZZ0A 5FFMA 1MJHA 3VC2A 5I3ZA 5C53B 3WLOA 3DKVA 3KVYA 4L28A 5HBGA 2O7NA 3DCJA 4IG9A 3I45A 4RKQA 1DXYA 3PRHA 3W4JA 4AMZA 4AY5A 3PFGA 3TSZA 3TX6A 3VTFA 1SHZA 2XITA 3L7OA 5JYDA 3NS7A 5KO2A 3KQLA 1P3DA 3OJ0A 3R3SA 3DE4X 3JRXA 2GLUA 3R6TA 1C80A 4KBYA 1C3LA 4J0KA 1ZCZA 5EYPA 2JGMA 3RFVA 3LPMA 3OMLA 4D4HA 3BK7A 4DJ5X 3T4PA 5C8YA 3A9CA 3FBWA 1U9IA 1CHDA 1TT5A 1SGWA 2QUBA 2WWGA 2GBLA 3HGQA 1EWQA 1OH5A 1GZDA 3TW0A 3UZUA 4YQFA 2B98A 2GTPA 4JMLA 1VIMA 5JS7A 2FPGA 1LDGA 1Q0UA 4X6LA 2OBYA 3R3WA 3RBXA 1IU9A 2SCUB 3G8AA 1KQ3A 1T5LA 3HU3A 4TUYF 5I8WA 4EI7A 5BV7A 1K7XB 1SC6A 2FSIA 1DTWA 1QVAA 2VJKA 3JD3A 4II3A 3PC8A 4RZSA 1O5IA 4M55A 5CB4A 4QTXA 4OOEA 3EA0A 1D0SA 5CFNA 1ZK0A 4MGYR 5DT2A 5HCNA 3CNBA 4TLDA 1W35A 2F8SA 3V7UA 1N2CE 2QM0A 5BRAA 2LDBA 3B7WA 1DFHA 1S2MA 4O8CA 4BLPA 3VVCA 3NV7A 3A2KA 3BDIA 3D1LA 3ZDFA 4D9FA 1QP0A 2V96A 4W6QA 2FR8A 3ZI7A 4OP1A 2O1EA 1XF9A 1LV8A 2HA3A 3M49A 4MUIA 4GSLA 4IMIB 2HC9A 2Q5FA 4QULA 4REQB 4XUGB 3SSNA 4MEJA 1KF0A 1Z4NA 1ENYA 3B3QA 3WISA 4D4LA 3DJYA 4KQ1A 3C5EA 3I92A 2PR2A 2W6PA 3IV7A 4DR1B 3AVYA 2PZLA 1E2KA 2QRGA 4B9AA 2H9IA 1A8IA 2UXCB 5HE8A 1MABA 1DBSA 2V03A 4B7ZA 1XVVA 2RIPA 1V7QA 4Z4HA 1OU4A 3L7JA 4GPTA 4O4IB 4MVJA 4POOA 1OOEA 2M1ZA 1ZAYA 3GFVA 3LQ2A 2D5AA 4M7PA 2HCJB 2WU4A 1WZCA 3IDQA 4AT1A 4DTCA 4K9SA 3ONVA 4HJXA 3U37A 3E27A 3MJSA 1ZD3A 1U1IA 3ECSA 3TLMA 1IDN1 2OB1A 2RGBA 3OIWA 4I4IA 3E7WA 1QYVA 4TKUB 3GNSA 4H7EA 3AF1A 4EHAA 1CZUA 4NIMA 4BTLA 2PGXA 5AKYA 5FJJA 4HRYA 1ZNYA 1H65A 4N5LA 2XUIA 3ETEA 1HYBA 4BKOA 3JATB 2IIPA 1ZRSA 3PDCA 3R7WA 1D1PA 3AI7A 1MC5A 2B83A 4L3OA 3DVRX 4YIKA 3TXYA 3DMRA 3NW9A 3TSAA 2XDQA 3ZI0A 1IBLB 3TOCA 3SDZA 5DYYA 2BFFA 2WAAA 3AETB 2XLCA 3E61A 3MUFA 2Z1MA 1P1HA 3DD5A 2J41A 3JV7A 5U1PA 3MGCA 1R27A 5EIEA 1GN8A 4LYGA 2QXYA 3CXRA 4RK4A 1ZNQO 3C3AA 5BQFA 2VSNA 3I2HA 2IXBA 3NHRA 1EM8A 3L6OO 1UXHA 3AY7A 3TL2A 1Q2XA 4MHTA 3IQZA 2G0AA 5FPKA 3M2PA 1GLNA 2PGJA 2GK3A 4JITA 5A1TA 4NTZA 4O59O 1XHFA 2VZEA 4YBRA 4EG8A 4QDTA 2AOVA 5CT5A 3U2QA 5CIYA 5EERA 1VI6A 1QLWA 4BQIA 4PAOA 3TFQA 5CTAA 2QLMA 3OKCA 4D4KA 4G25A 3H11A 4IILA 1VE6A 4QOHA 1C7RA 1H2EA 3EFOA 3C3BA 1RYHA 3DKKA 3L6DA 4Q03A 5AKHA 2OHIA 2AE2A 3PRYA 1Z6GA 3LUHA 3NKVA 1Y1RA 2O2CA 3IPXA 3TGPA 5LQDA 4JVMA 5AOBA 4RMHA 2VDMB 5KYVA 1OASA 1T8RA 5REQB 4MWEA 4EJSB 2DR3A 1SQGA 3TLCA 1B76A 1REQB 3FN4A 4NLLA 3HEBA 4YJFA 1U7PA 3KVRA 2PXHA 1R0RE 4ZT5A 5M04A 1BQ4A 1SG0A 4LC0A 1DAFA 1B15A 1CWUA 2V7TA 2XE7A 4Y2QA 4KGZA 4IIGA 2ZAYA 5FWNA 5IU6A 3TEMA 2XGMA 3PJDA 2VTBA 3L7IA 3FLMA 2JGNA 2NUPA 4KN9S 3DDZX 3Q85A 2JI9A 2JCBA 2QL7A 1IRIA 3PEEA 3AY3A 4Q7KA 4DR5B 1DOHA 4OYRA 3LZCA 1GUZA 2GWRA 5DI3A 2AL7A 4PQGA 2BP7B 3TRHA 4L8LA 1E1DA 2FWJA 2IV7A 2PMWB 2DJ5A 4UOZA 4BNZA 2R6CA 2WF9A 3E5HA 3KSRA 1N5KA 2Z1DA 3FOAA 3OEEA 4LXGA 4RVOA 4B4WA 3GGJA 5JW6A 1G20B 4PIMA 1J0BA 2CDAA 1QHNA 3EZ7A 4LZAA 4BZQA 2O0JA 5HTKA 4B3MB 1TD9A 1BTOA 2WTNA 3STWA 5BNTA 2FX5A 1YUMA 2CDBA 3OQIA 5JRJA 2DFPA 3AZPA 1KVTA 1CZKA 2FN3A 3PD1A 2YJGA 1IVYA 4OJTA 3ABOB 2CHFA 4CKEB 1VRVA 1P18A 3L04A 4ZK6A 1ODLA 1IVSA 4DG8A 1E5TA 1KRHA 4NDAA 4OFWA 1MBZA 2H1CA 4RESA 5JS6A 4XWAA 4QC2A 5EJGA 2QMYA 1NN3A 3RQIA 1DGFA 3O2QB 1AQUA 1UWCA 2XNSA 2IHJA 5EP3A 2ESRA 2CN1A 1NAIA 2FFRA 1F8GA 2ZYTX 3FCAA 4OH1A 3LPCA 1DAOA 1JQDA 4MKXA 4RZ3A 2AVDA 3NXSA 1IM5A 2IYLD 1F06A 3H2GA 3FWNA 4FDVA 4I4CA 5LQMA 4Q9JA 5ITVA 4FR0A 3X1XA 3JQFA 3G9QA 3KLOA 4LQCA 3DCNA 3PWZA 3QJ5A 3EIEA 1E1LA 3QY0A 2Z5FA 3OVMA 4H6WA 4WLFA 1J97A 3FETA 3WIOA 4ETWA 5LUAA 4A03A 1J1IA 4AJJA 2ILTA 2ZRFA 4N3NA 4TV8F 3WYGA 3TGWA 3B85A 3WRXC 4DR2B 4EYQA 3WLKX 4K46A 1H3FA 1YZVA 4LJAA 3JD0A 5LQCA 2YIVX 1IOLA 4K0RA 5EG5A 3A25A 4ZTBA 1TM5E 2HXGA 1MFPA 4WWHA 4E33A 1W85A 1DJPA 1E3LA 2OZPA 3LUFA 4OXNA 1PI3A 1BGVA 3ZCUA 3O3CA 4TRNA 5KVQA 1VDMA 3KTFA 3QW4B 4OIMA 3SS9X 2JC3A 3IUMA 4AROA 4EITA 4IHQA 5HZGA 3NFYA 3PFCA 4M54A 4LI0A 1U1DA 3CF2A 2POQX 2J31A 3E58A 3L77A 2A0YA 4TLEA 5ENZA 3S3TA 3W9BA 3LUGA 3MOIA 5E6RB 3LLVA 3ZBTA 5LOVB 1RLTA 4LC1A 4OHOA 4BQOA 3FYUA 3QVKA 4GI1A 4YPVA 4ND1A 2X4IA 4UASA 3K9HA 4IGKA 4PHGA 1AURA 1BWQA 4XIFA 4D9KA 4DC9A 9GPBA 2GVNA 5K20A 3TNFA 4IEIA 1I7PA 4MK4A 1C1HA 3PKZA 4FNAA 1LEHA 3E7FA 4HSEA 2NU9A 1POXA 2FGJA 1XCMA 4KCGA 4OL0A 1JHUA 3NLLA 5LNK6 3TUIC 2AG6A 1RI3A 2ATCA 3IOCA 4B43A 2A9KA 2FN7A 1AKYA 1F4LA 2JGJA 2Y2UA 4Z51A 5EFOA 3V1YA 3IEKA 2W93A 1SIWA 3NEPX 4DDTA 3PL5A 3A1TA 4R31A 1V7ZA 4V0OA 3Q7SA 4FMCF 1E63A 3IELA 2NSDA 4RZ2A 3WKDA 4DLKA 4D26A 3DV2A 3ZLUA 3Q3EA 5HM8A 2PRIA 4UBJA 2OBBA 2JAUA 1NKSA 4IQ4A 1DV1A 4BO5A 2ECOA 4P54A 1SUFA 1EIWA 2V6IA 4JXKA 4BX8A 1JHOA 1QQAA 2VUSA 3ICEA 4TLLB 3ZUPA 3I9OA 4DEVA 1M5TA 3KBBA 3QF4A 4KE8A 3URKA 4CGYA 2J9FB 1JKMA 3RDPA 3UW1A 5HKLA 421PA 4BUZA 4E0BA 1PS0A 5I7HA 4E4RA 1QAQA 1RAGA 2D2VA 2PGOA 3ZW8A 4BV9A 1ZIDA 1JMYA 1HFKA 2ZJBA 3CLRD 1GRNA 2NXCA 3SY8A 1I3CA 1I6WA 3AV0B 3VZSA 4PC1A 1A3CA 2R11A 1BGXT 1OX4B 4HYYA 5DDIP 2P2ZA 3EOZA 5AM5A 2W4QA 4AAYA 1BA3A 3LXUX 4QUDA 1IN8A 4N7RA 3WLFA 5DHTA 2AZMA 2J5KA 1M34