The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
219
|
sequence length |
602
|
structure length |
602
|
Chain Sequence |
SVAHHEDVYSHNLPPMDEKEMALYKLYRPERVTPKKRSAELLKEPRLNKGMGFSLYERQYLGLHGLLPPAFMTQEQQAYRVITKLREQPNDLARYIQLDGLQDRNEKLFYRVVCDHVKELMPIVYTPTVGLACQNFGYIYRKPKGLYITINDNSVSKIYQILSNWHEEDVRAIVVTDGERILGLGDLGAYGIGIPVGKLALYVALGGVQPKWCLPVLLDVGTNNMDLLNDPFYIGLRHKRVRGKDYDTLLDNFMKACTKKYGQKTLIQFEDFANPNAFRLLDKYQDKYTMFNDDIQGTASVIVAGLLTCTRVTKKLVSQEKYLFFGAGAASTGIAEMIVHQMQNEGISKEEACNRIYLMDIDGLVTKNRKEMNPRHVQFAKDMPETTSILEVIRAARPGALIGASTVRGAFNEEVIRAMAEINERPIIFALSNPTSKAECTAEEAYTFTNGAALYASGSPFPNFELNGHTYKPGQGNNAYIFPGVALGTILFQIRHVDNDLFLLAAKKVASCVTEDSLKVGRVYPQLKEIREISIQIAVEMAKYCYKNGTANLYPQPEDLEKYVRAQVYNTEYEELINATYDWPEQDMRHGFPVPVVRHDSM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystallographic studies on Ascaris suum NAD-malic enzyme bound to reduced cofactor and identification of an effector site.
pubmed doi rcsb |
| molecule tags |
Oxidoreductase
|
| molecule keywords |
NAD-dependent malic enzyme
|
| total genus |
219
|
| structure length |
602
|
| sequence length |
602
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating). |
| pdb deposition date | 2003-02-24 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00390 | malic | Malic enzyme, N-terminal domain |
| A | PF03949 | Malic_M | Malic enzyme, NAD binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Hemocyanin, N-terminal domain | Hemocyanin, N-terminal domain | ||
| Alpha Beta | 2-Layer Sandwich | arginine biosynthesis bifunctional protein fold | arginine biosynthesis bifunctional protein fold | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | NAD(P)-binding Rossmann-like Domain | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Malic enzyme, N-terminal domain |
