1O1LB

Deoxy hemoglobin (a-gly-c:v1m,l29w,h58q; b,d:v1m)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
146
structure length
146
Chain Sequence
MHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genetically Crosslinked Hemoglobin: A Structural Study
doi rcsb
source organism Homo sapiens
molecule tags Oxygen storage/transport
molecule keywords Hemoglobin Alpha chain
total genus 55
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 1o1lB00
3AQ6A 1NPGA 3HEOA 1FHJA 2FALA 3WCWC 5SW7A 1LFTA 1CH4A 3B75B 1HDAA 3LR9A 3PI4A 5EYJA 2ZLXA 4NI1B 4FC3A 4N7OB 1YEOA 1MLSA 2VM0A 3HENA 4F6FA 1HBHA 3NMMB 2ZLTA 3NG6B 3M39A 3IC0B 2OHAA 1MLRA 4N7NB 3ZJLA 1YENA 3ZJOA 1S5XB 1Y0TA 2MYAA 3R0GA 2HHDB 1THBA 1NXFA 3MJPB 1FN3B 1VXGA 1IRCA 1J3ZB 3ZJPA 3V2VA 3UBVA 1Y0CB 1RQAB 3ZJMA 5EUIB 3WCTC 106MA 3SDHA 1C7CB 2DHBB 3PIAB 2CMMA 4O35A 2ZFOA 5EU2A 1UVYA 2QLSA 3QM9A 3UHRA 3DHTB 3GQPB 3G53A 1BINA 2ZS1D 2W6VA 1IBEA 3M38A 3HHBB 1MLFA 3NFEA 3G52A 3GYSB 1K0YB 1HBSA 1S6AA 4ILZA 1O1PB 1I3DA 4H2LB 1FCSA 5CN7A 1YHUC 2M6ZA 1VXHA 2HCOB 3AT6A 1SDLB 2HHBB 3S1IA 1A0UA 3MVCA 3OO4A 1Y46A 2QFKA 4KMVA 3LQDB 1NGKA 2MYCA 1CBLA 4M4AA 2MGJA 1ASHA 1Y7ZB 3PT8A 1IDRA 1A6MA 2QRWA 4NI0B 3LQDA 1HGBB 1Y4VB 1Q1FA 2VLYA 2M6ZB 1MKOB 3FH9A 3HF4B 3S48C 4H2LA 3WFUA 3LR7A 3QJEA 4HBIA 1YVQA 2G0XA 2FRIX 3BJ3A 3HHBA 1V4UB 1J3YA 3K9ZA 1GCWA 2DN3B 3AG0A 2ZT4A 1NWNA 3E55A 3QM7A 3GKVB 2HHEB 4MBNA 2HBFB 1Y4PB 1MYIA 4MQKA 2ZS1B 2W72B 3BOMB 1Y0CA 103MA 1K1KB 1DWRA 3PELA 1HBAB 5E29A 1MTJA 2HHDA 1YMBA 5MBNA 7HBIA 4MQIA 2VLXA 1YENB 1V4UA 3WTGB 1MYMA 3BJ3B 1CPWA 1PBXA 1DXTB 4WJG1 1MODA 4ROMB 3U3EA 1XZ7A 1MLHA 3AT5B 1M6MA 1T1NA 2ZLXB 1FSXA 1CH2A 1NEJA 1OUUA 1NAZA 1YHUB 4F6BA 1YCAA 2V1JA 1MBSA 2MGIA 4F6IA 111MA 1OR4A 3OO4B 3WCWB 1A0UB 2FRKX 2DC3A 1JZMA 1DTIA 4NK2A 1IT2A 3CY5A 1J7YA 1MYHA 3BJ1B 3QM5A 5MBAA 1MYJA 3GYSA 1JW8A 2ZSYA 3D7OB 4AVDA 1LH7A 1DUKA 1J7YB 1VXAA 1Y5KB 1Y83B 3UHGA 1DWTA 2ZLWA 1BZRA 1KD2A 1YGFA 3QJDB 1Y5JB 1O1KB 1ECAA 1JZKA 3G4YA 2ZSTA 1AJ9A 1CIOA 3V2ZA 1J3FA 1RQ4A 1MGNA 1J3ZA 1J52A 1A01B 1NZ3A 4F69A 1HV4B 5C6YA 5B84A 2RI4A 1MLGA 5CN6A 3QJBB 1A0ZB 4MQIB 4L7YA 2MBWA 4N7NA 4NS2A 1NS9A 1SI4B 2GTLC 3EDAA 2BK9A 1LUEA 1NPFA 5AZRA 1Y85A 5EQMA 3UHQA 1K1KA 1J7SA 1RTEA 1DXVB 1LHTA 2D2ND 3D4XA 2ZS1A 3W4UA 2ZSNA 4MQKB 3ZHWA 5KERA 2D2MC 1F65A 2GRZA 1BZ6A 2BMMA 2LH3A 5E6EB 1MBAA 2Z6SA 3LB1A 1Y8WA 1JY7B 1BVCA 4ESAA 1XZ5A 1RQ3B 3LB4A 4F4OB 3MKBA 4XS0B 4YU3B 4SDHA 1Y7CA 3HC9A 5CMVA 3SZKB 1MTIA 1MKOA 3FH9B 5CNGA 1JY7A 1YE2B 4WJGA 1O1MB 1DO4A 1QXDA 1CMYB 4NI0A 3E5OA 4FH7A 1XXTA 2B7HA 1J41A 1HABB 1N9FA 2O5QX 1B0BA 3GQGA 4F6GA 2ZS0A 4G51A 4PQBA 1RVWB 1QXEB 1UMOA 2W31A 4HHBA 1LH3A 5CHQA 1MZ0A 1J40A 3K8BB 3HRWB 1UVXA 1NS6A 3A59A 1Y4GB 2O5SX 1S5YA 1V4XA 2ZFBB 1R1XB 1YZIA 4UURA 1Y4FA 1VWTA 1NIHA 1VXDA 2W6VB 3QJBA 3UHYA 2FRFA 1EW6A 1FLPA 3DHRB 1GVHA 3EDBA 4U8UB 1Y2ZA 2EB8A 1A01A 3MYNA 3WCWD 2R80A 4B4YA 1C7CA 1OUTB 1GDJA 2QSPB 1GCVB 1GBUB 5CHRA 1HBRB 4LPIA 1V5HA 3ZJNA 4VHBA 4O4ZA 2Z6NB 1Y2ZB 1YOHA 1IRDA 1FN3A 3VRFA 1HDBA 3OZVA 3WI8A 4UIQA 3WHMA 3OGBA 3WCUB 3PT7B 2BLIA 3DR9A 1R1XA 1S5YB 3G4RA 1JL6A 2ZLVB 1NS6B 1HDSB 3K8BA 1LFQB 5CN4A 2Z6TA 2BWHA 1U7RA 2AV3A 2MGDA 1OFKA 2GKNA 4H07A 2O5OX 5JDOE 2V1GA 2DXMA 4WCHD 3BCQB 1QXEA 1MLNA 1RVWA 1HDAB 1UX8A 1Y35B 3UHVA 3HYUB 3VAUA 3HXNB 1RPSB 3R5IB 2MYEA 2XKHA 3D1AA 3PI8B 1LA6B 1BVDA 5M3SA 2SPOA 4DWTA 1O1MA 5D1VA 1YE2A 2H35A 1O1NA 4HRTA 2GNWA 4MXKA 1YHUD 1IWHB 4XS0A 3MKBB 4YU3A 4ROMA 1XZ2B 1MNHA 3G46A 1PBXB 2NX0A 3WR1A 107MA 1QSIB 1YVTB 1LFYA 2R4ZA 2DN1B 2LH1A 1ECOA 1QPWA 3CIUB 5HLQA 1HBAA 5E29B 2R50A 1A00A 2Z85A 5B85A 1MCYA 1CP0A 3QQQA 1BZ0A 3KUOA 1Y01B 4NXAA 1J7WA 5HBIA 5KERB 4F6JA 4MQGB 1MOCA 1Y85B 2BLJM 1Y4RA 1SI4A 1EBTA 2QU0B 4L7YB 3ZJSA 3DUTA 2D5XB 1J3YB 1H97A 3BJ2A 3P5QA 1CQXA 1YFFB 3KMFC 3G4WA 5CNFA 2D60A 4MBAA 2DN2B 5CNCA 2GNVA 4O4TA 2AUQA 1A3NB 1HGBA 3OZUA 1QSHA 1WMUA 2KSCA 2YRSA 1Y5JA 3GKTA 1GLIA 1XYEB 2IG3A 1JL7A 5KDQB 1Y46B 3UHIA 2G11A 3QM6A 1YCBA 2MHBB 5EE4D 1O1JB 2QFNA 2D2MB 2ZSPA 3PI2A 1DXCA 2W6YA 4QAUA 2ZLUA 1Y8KB 1BZZB 5KKKA 2V1EA 1Y0WA 5JGGB 1HLMA 4FWYA 4ROLA 1GDLA 1MOHA 3NL7A 3ZJIA 1DUOA 3ECXA 3A5AA 5JOMA 1YHUA 2ZSRA 1MYGA 3PIAA 1MLMA 2DHBA 3IC2B 5JDOC 2EVKA 1G08A 3UI0A 3H58A 1F5PA 1FSXB 5EUIA 2Z8AA 1JEBA 3GQRA 2SPNA 3GDJB 1Y7DB 1LFLB 1XZ7B 2PGHB 3UH6A 1FSLA 1Y31A 3ZJQA 1G0BA 1YHEB 3H57A 3FS4A 2MGMA 3UHSA 1G0BB 1YHEA 2ZS0C 1YIEB 2V1FA 2ZLTB 3EU1A 4FWXA 1LFLA 4FC3B 1Y09A 1Y4QA 2H8DA 3WCPB 1UX9A 2HBFA 5SW7B 1OBMA 1Y8IA 3GKVA 1MLKA 1YDZB 1KFRA 4TWVA 1LJWA 4OODA 4TYXA 2D5ZA 1BZZA 1Y8HB 3ZJJA 4TWUA 5HY8B 1YG5B 1O1IB 3QJEB 1V75A 2D2MA 3UH7A 4MXLA 1O1JA 1O1OA 1X9FD 3HF4A 1BBBA 4O2GA 1JWNA 3ASEA 1G9VB 3M3BA 2EKUA 1WVPA 3TLDA 1LH2A 1Y0AA 2D2NA 3ONZB 4JACA 2EVPA 1FAWB 5CNBA 3PI9A 4KMWA 4M4AB 1BZPA 1Y45A 1DM1A 1HCOA 3KUNA 1QSHB 1WLAA 3QQRA 2ZSXA 1C7DA 3A0GB 1BABA 4NXCA 104MA 3UH3A 1SDLA 3RJNB 3WCUD 1URYA 1V07A 1HGAA 2AUOA 4NZIA 1K0YA 4JYQA 3NFEB 1G0AA 1YG5A 5HY8A 1DO3A 1VXCA 2BLHA 2ZWJA 1Y0DA 2HBCB 2VLZA 1LJWB 1VREA 3DHTA 3ZH0A 1YEUA 1MNJA 1S0HA 2ZFOB 1X9FB 5EOHA 1UFJA 1A3OA 1NQPA 3WCVB 2R1HA 1J7WB 2R4YA 1XQ5A 4ODCA 1MBDA 3WFTA 1CIKA 1CH7A 5EYSA 2H8FA 1THBB 2ZT2A 1YIEA 2NRLA 1CG5B 1QSIA 1G09B 1Y0TB 3FS4B 1XZ2A 3A5GA 3OK5A 1ITHA 1IOPA 4MQHB 3UHTA 3BA2A 2GTLA 1C40A 2AUPA 1ECNA 4HRTB 2H35B 4AVEA 3LB3A 1M9PB 3OJ1A 5C6EA 2HBSB 1G08B 1N9HA 1FHJB 3R5IA 2MGEA 2NSRA 1CQ2A 3PI1A 3OVUC 2HBSA 1LH6A 2MGLA 3VHBA 3MYMA 1AJHA 2O5BX 1O16A 2ZLUB 5F2AA 1LFZB 1LFQA 4N7PA 1LH5A 2ZLVA 1XZUB 2SPLA 1QI8A 3PT7A 1G09A 4UZVA 1EBCA 3ARLA 5IKSA 1LFVA 2R4XA 3MBAA 1GZXB 2HBDA 5CN5A 2VYZA 1XY0B 4G1VA 1Y22B 1H1XA 3WCVA 1Y4BB 1NQPB 4FH6A 1CG8B 2G0VA 5ILEA 1YH9A 4MAXA 1YEVB 2R80B 3S65B 2DN2A 3QZXA 2QSSB 1JP8A 2SPMA 5EETA 5E83A 1MWBA 4MQCB 1Y4FB 1MOAA 2O5TX 3D1KB 1V4XB 3VREB 5ILMA 5E83B 4DC7A 1F63A 1J40B 2FRJX 3LHBA 1HGAB 3UGZA 1YMCA 6HBWA 1C7DB 5CN8A 1VRFA 3ODQA 3GQGB 3KMFA 2B7HB 1UIWB 1JPBA 3ONZA 1MYTA 2RAOA 1CMYA 1ECDA 3TM3A 1A6NA 3HEPA 2MGFA 1GJNA 1ABYB 1XZUA 4KJTA 4F6DA 4HRRB 4X0LA 110MA 1XZ4A 2VRYA 1MLQA 1LFZA 2NSSA 4X0LB 2IN4A 1RQ3A 2ZFOD 2QMBB 3UHXA 5AB8A 3PI3A 108MA 3UHEA 3UHZA 2EB9A 5HU6A 1SWMA 1FDHA 2BNLA 3HXNA 1YDZA 2AA1B 3OO5B 1LTWA 1DKEB 1GBVA 1J7SB 3EOKA 2DXMB 1UC3A 4IROA 1N9XA 1PMBA 3UBCA 4HSXA 4MQJB 3UHNA 2HZ1A 4YU4A 3EU1B 4MQHA 4MU5A 1M6CA 2R4WA 4DWUA 1S69A 1YE0B 3D1KA 2D6CA 1HHOB 3WCUA 1A0ZA 1RTXA 4MQCA 2PEGB 1C7BB 3AQ7A 3K3UA 3A9MA 2PGHA 3LB2A 1YHRB 4MPMA 2V1HA 1A4FA 4M4BB 3GQRB 1JZLA 1GBUA 2R1HB 1GCVA 1JEBB 1DXUA 1A3OB 5F0BA 4B3WA 1A4FB 3IC2A 3IA3B 1X9FA 1KD2B 1X3KA 1YHRA 1MWDA 1UFPA 4U8UA 1COHA 1LFVB 1C7BA 3QMAA 1VWTB 3WFXA 1YZIB 1Y5FA 102MA 1G0AB 1N9IA 1ABSA 1YGDB 2ZSSA 2LH7A 4N7PB 1IT3A 2MGKA 3G4QA 1JP9A 4HHBB 1VXBA 1GBVB 1BABB 3WCWA 4G51B 1HCOB 2O58X 1J41B 2AA1A 2AURA 1OJ6A 2O5MX 1CH9A 1DWSA 3MJUA 1OUUB 3OZWA 1XZVA 1MBCA 1Y0AB 2D2NB 2ZT1A 1NEJB 1TU9A 1QXDB 3WCVD 1MNKA 1DTMA 1OR6A 4NK1A 2HZ3A 5JDOF 2D60B 1Y7CB 4OF9A 1SPGA 2GRHA 3M3AA 3QJCA 5CN9A 1DXTA 1MYFA 1FDHG 1ABYA 1YFFA 3P5QB 1DLYA 2D5XA 1HBBB 3AQ8A 2QU0A 1CH3A 2D2NC 1HBGA 1HGCB 3GOUA 2MB5A 2XKGA 4N8TA 1GDIA 3WCPA 2MYDA 2GRFA 3D4XB 3W4UB 1Y4QB 2W72C 3UHCA 1SDKA 1MYZA 1HGCA 5D5RA 1Y7GA 2DN1A 1GCWB 1NZ5A 1HBBA 1BZ1A 1R1YA 2HBCA 3S1JA 2NRMA 2ZSOA 1Y31B 5CNDA 1MDNA 3QJCB 1SHRA 2E2YA 1JDOA 1HV4A 1IWHA 1MBIA 2QSSA 2WY4A 1Y7DA 3MN0A 1HLBA 3WCTA 1O1NB 1Z8UB 1CG8A 4GZGA 1Y4BA 1JP6A 1LA6A 1AJ9B 1L2KA 1O1KA 1Y45B 2LH2A 1XZVB 2G12A 1AZIA 1Y7ZA 112MA 3PT8B 3HYUA 5HAVA 4U8UD 1Y35A 1HBIA 4U8UC 3A2GA 1G9VA 2HHBA 3BCQA 4C44A 2HCOA 3AT6B 1MWCA 4KN3A 1BBBB 1YIHB 3G4UA 2MGCA 1V75B 2V1IA 3ECLA 2W6WA 1URVA 3QM8A 1O1IA 3BJ1A 1Y5FB 1DLWA 1YIHA 1YOIA 3ZOMA 1UT0A 3WHMB 2G0ZA 2XKIA 3GQPA 3UHUA 5KDQA 1MLUA 1XYEA 2OH8A 2VEBA 5C6EB 2XYKA 2H8DB 2HZ2A 1DO7A 2VEEA 3UHHA 1Y09B 1T1NB 1OUTA 3WCTB 4M4BA 2GTLB 3MJPA 1SHRB 3DHRA 2EKTA 2WTGA 2G0RA 2PEGA 2AV0A 1RSEA 4DC8A 3BJ2B 1HHOA 4O1TA 2MYBA 1R1YB 1BZ1B 2LH6A 3IC0A 1Y4GA 3UHBA 1Y7GB 3NG6A 2LH5A 3O89A 2H8FB 1VXFA 2OHBA 1A9WE 2MGHA 3UGYA 3GDJA 4ODCB 4ZVAA 1SDKB 4NI1A 1DKEA 2W72A 3BOMA 1EMYA 1BJEA 1XCHA 2MGGA 2V1KA 1GDKA 1CH5A 1SPEA 2ZS0B 4N8TB 3B75A 3A5BA 4G1BA 3OO5A 2MGAA 3GOUB 1S61A 2JHOA 1NZ4A 5HU6B 2DN3A 1QPWB 3CIUA 1MOBA 3NL7B 1LFYB 2VYYA 1B86B 1Y0WB 5JGGA 3WR1B 3SZKA 1MBNA 2G3HA 4FWZA 1XZ4B 2VYWA 3VRGB 1S56A 1SPGB 2ZS1C 4XDIA 1X9FC 109MA 3ZJRA 1Y8WB 1Y4VA 2ZT3A 3A0GA 1HSYA 3PI8A 2G10A 2RAOB 4L2MA 3ZOLA 3MJUB 1LH1A 1UIWA 4PQCA 2ZSQA 1FAWA 2MGBA 1MNOA 2FAMA 2YRSB 3ODQB 1WMUB 5HLUA 4ZVBA 6HBWB 1DXVA 1A3NA 5ILRA 3WCUC 1KR7A 2HBEB 1O1PA 1HDSA 1YGDA 1HJTA 1A6KA 2BKMA 3ECZA 1VXEA 2RI4B 2HBGA 1COHB 2ZS0D 2QLSB 3VRFB 2Z6NA 1O1LA 1Y8IB 1YEVA 1HBRA 1YH9B 1RQ4B 1YOGA 2EF2A 6HBIA 1DXUB 1RQAA 2GTLD 1Y22A 4MQGA 1CO9A 2QSPA 3WCVC 1W92A 1XY0A 3QJDA 1MNIA 1YGFB 1V9QA 2HBDB 1D8UA 3ARKA 3MOUA 1MBOA 1CO8A 2ZLWB 1A9WA 1I3EA 1YVTA 5AZQA 1JF3A 1S5XA 4PNJA 105MA 1DO1A 1TESA 1YE0A 4C0NA 3S66B 3A59B 1HBHB 3NMMA 3UHKA 1F5OA 4YU4B 4MQJA 1YEOB 4N7OA 4IROB 1HRMA 4IT8A 3EOKB 3D17A 3O7NA 3NMLA 4BJAA 3ED9A 1LFTB 3D1AB 3IXFA 1CLSB 1RPSA 3SDNA 1CLSA 2G14A 4PQ6A 1BUWA 2GL3A 1M9PA 1YEQB 4ROLB 3D17B 1Y8KA 1C40B 1A6GA 2QMBA 3ARJA 2G0SA 3AT5A 1DXDA 1MTKA 1MLJA 2BW9M 4HRRA 3S66A 5JDOD 2WTHA 2MHBA 5EV5A 3WTGA 1VHBA 1XZ5B 4ESAB 1BIJB 1CG5A 1ABWA 1HDBB 1MLLA 5EE4C 1AJGA 3PELB 5HLXA 1IRDB 1GLIB 3ORDA 1XQ5B 1HACB 4H0BA 1Y4PA 2ZT0A 2C0KA 2HHEA 1V4WA 2ZFOC 4HSWA 1O1LB 2W6XA 3GK9A 3RGKA 1S0HB 3UHWA 1YEUB 1CH1A 1NS9B 1EWAA 3AQ9A 3WFWA 2OLPA 3VREA 4F68A 1NIHB 1Y0DB 3WCTD 1X46A 3DUTB 2ZFBA 5CNEA 1LHSA 1Y4RB 1YVQB 3HRWA 2GDMA 3G4VA 1NWIA 2D2MD 2OH9A 3RJ6A 2HBEA 3S65A 3GLNA 1CBMA 1V4WB 3QZZA 1HACA 3ZJHA 1JF4A 2VHBA 1HABA 3PI9B 1BZ0B 1XXTB 1A00B 2LHBA 1GZXA 1OFJA 3AQ5A 1NZ2A 3UHDA 3E5IA 5ILPA 3TM9A 101MA 2GLNA 1ABWB 1CP5A 2OIFA 1BIJA 1Y5KA 1Y83A 1QI8B 1U7SA 1O1OB 2O5LX 3D7OA 1HBSB 1MLOA 2ZSZA 3VRGA 4F4OA 2GKMA 1Y8HA 3CY5B 1YMAA 3UH5A 2D5ZB 1B86A 1IBEB 1YEQA 1BUWB 5E6EA 3E4NA
chains in the Genus database with same CATH superfamily
3AQ6A 1NPGA 3HEOA 1FHJA 2FALA 3WCWC 5SW7A 1LFTA 1CH4A 3B75B 1HDAA 3LR9A 3PI4A 5EYJA 2UULC 2ZLXA 4NI1B 4FC3A 2JLGA 4N7OB 1YEOA 1MLSA 2VM0A 3HENA 4F6FA 1HBHA 3NMMB 2ZLTA 3NG6B 3M39A 3IC0B 4A8OA 2OHAA 1MLRA 4N7NB 3ZJLA 1YENA 3ZJOA 1S5XB 1Y0TA 4F0TA 2MYAA 3R0GA 2HHDB 4YJJA 1THBA 1NXFA 3MJPB 1FN3B 1VXGA 1IRCA 1J3ZB 3ZJPA 3V2VA 3UBVA 1Y0CB 1RQAB 3ZJMA 5EUIB 4RMPA 3WCTC 106MA 3SDHA 1C7CB 2DHBB 3PIAB 2CMMA 4O35A 2ZFOA 5EU2A 1UVYA 2QLSA 3QM9A 3UHRA 3DHTB 3GQPB 3G53A 1BINA 2ZS1D 2W6VA 1IBEA 2C7JB 3M38A 3HHBB 1MLFA 3NFEA 3G52A 3GYSB 1K0YB 1HBSA 1S6AA 4ILZA 1O1PB 3BRPB 1I3DA 4H2LB 1FCSA 5CN7A 1YHUC 2M6ZA 1VXHA 2HCOB 3AT6A 1SDLB 2HHBB 3S1IA 1A0UA 3MVCA 3OO4A 1Y46A 2QFKA 4KMVA 3LQDB 1NGKA 2MYCA 1CBLA 4M4AA 2MGJA 1ASHA 1Y7ZB 3PT8A 1IDRA 1A6MA 2QRWA 4HH1A 4NI0B 3LQDA 2JLFA 1HGBB 1Y4VB 1UVMA 1Q1FA 2VLYA 2M6ZB 1MKOB 3FH9A 3HF4B 3S48C 4H2LA 3WFUA 3LR7A 1I7YB 3QJEA 4HBIA 1YVQA 2G0XA 1HI0P 2FRIX 3BJ3A 3HHBA 1V4UB 1J3YA 3K9ZA 4N6SA 3O2CA 2UUNA 1GCWA 4Q70A 2DN3B 3AG0A 2ZT4A 1NWNA 3E55A 3QM7A 3GKVB 2HHEB 4MBNA 2HBFB 1Y4PB 1MYIA 4MQKA 2ZS1B 2W72B 3BOMB 1Y0CA 103MA 1K1KB 1DWRA 1RH1A 3PELA 1HBAB 5E29A 1MTJA 2HHDA 1YMBA 5MBNA 7HBIA 4MQIA 2VLXA 1YENB 1V4UA 3WTGB 1MYMA 3BJ3B 1CPWA 1PBXA 1DXTB 2VJTB 4WJG1 1MODA 4ROMB 3U3EA 1XZ7A 1MLHA 1UVNA 3AT5B 1M6MA 1T1NA 2ZLXB 1FSXA 1CH2A 1NEJA 1OUUA 1NAZA 1YHUB 4F6BA 1YCAA 2V1JA 1MBSA 2MGIA 4F6IA 111MA 1OR4A 3OO4B 3WCWB 1A0UB 2FRKX 2DC3A 1JZMA 1DTIA 4NK2A 1IT2A 3CY5A 1J7YA 1MYHA 4ESUA 3BJ1B 3MWNA 3QM5A 5MBAA 1MYJA 3GYSA 1JW8A 2ZSYA 3D7OB 4AVDA 1LH7A 1DUKA 1J7YB 1VXAA 1Y5KB 1Y83B 3UHGA 1DWTA 2ZLWA 1BZRA 4H0MB 1KD2A 1YGFA 3QJDB 1Y5JB 1O1KB 1ECAA 1JZKA 3G4YA 2ZSTA 1AJ9A 1CIOA 3L0FA 3V2ZA 1J3FA 1RQ4A 1MGNA 1J3ZA 1J52A 1A01B 1NZ3A 4F69A 1HV4B 5C6YA 5B84A 2RI4A 1MLGA 5CN6A 3QJBB 1A0ZB 2UUMX 4MQIB 4L7YA 2MBWA 4N7NA 4NS2A 1NS9A 1SI4B 2GTLC 3EDAA 2BK9A 1LUEA 1NPFA 2YSKA 5AZRA 1Y85A 5EQMA 3UHQA 1K1KA 1J7SA 1RTEA 1DXVB 1LHTA 2D2ND 3D4XA 2ZS1A 3W4UA 2ZSNA 4MQKB 4GXEA 3ZHWA 1UVLA 5KERA 2D2MC 1F65A 2GRZA 1BZ6A 2BMMA 2LH3A 5E6EB 4Q70B 1MBAA 4A8FA 3O2CB 4ETUA 2Z6SA 3LB1A 1Y8WA 1JY7B 1BVCA 4ESAA 1XZ5A 1RQ3B 4AE0A 3LB4A 4HH0A 4F4OB 3MKBA 4XS0B 4YU3B 4SDHA 2I88A 1Y7CA 3HC9A 5CMVA 3SZKB 1MTIA 1MKOA 3FH9B 5CNGA 1JY7A 1YE2B 4WJGA 1O1MB 1DO4A 1QXDA 1CMYB 4NI0A 3E5OA 4FH7A 1XXTA 2B7HA 1J41A 1HABB 1N9FA 2O5QX 1B0BA 3GQGA 4F6GA 2ZS0A 4G51A 4PQBA 3ZTAA 1RVWB 1QXEB 1UMOA 2W31A 4HHBA 1LH3A 1HI1A 1CPCB 5CHQA 1MZ0A 1J40A 3K8BB 1DDTA 3HRWB 1UVXA 1NS6A 3A59A 1Y4GB 2O5SX 1S5YA 1V4XA 2ZFBB 1R1XB 1YZIA 4UURA 1HHTP 2C7JA 1Y4FA 1VWTA 1NIHA 1VXDA 2W6VB 3QJBA 3UHYA 2FRFA 1EW6A 1FLPA 3DHRB 1GVHA 4F0UB 3EDBA 4U8UB 1Y2ZA 2EB8A 1A01A 3MYNA 3WCWD 2R80A 4B4YA 1C7CA 1OUTB 1GDJA 2QSPB 3L0FB 1GCVB 1GBUB 5CHRA 1HBRB 4LPIA 1V5HA 3ZJNA 4VHBA 4O4ZA 2Z6NB 1Y2ZB 1YOHA 1IRDA 1FN3A 3VRFA 4F0TB 1HDBA 3OZVA 3WI8A 1HI8A 4UIQA 3WHMA 3OGBA 3WCUB 3PT7B 2BLIA 3DR9A 1R1XA 1S5YB 3G4RA 1JL6A 2ZLVB 1NS6B 1HDSB 5AQDM 3K8BA 1LFQB 3V57B 5CN4A 2Z6TA 2BWHA 1U7RA 2AV3A 2MGDA 1OFKA 2GKNA 4H07A 2O5OX 5JDOE 2V1GA 2DXMA 4WCHD 3BCQB 1QXEA 1MLNA 1RVWA 1HDAB 1UX8A 1Y35B 3UHVA 2UULD 2DKDA 3HYUB 3VAUA 3HXNB 1RPSB 3R5IB 2MYEA 2XKHA 3D1AA 3PI8B 1LA6B 1BVDA 5M3SA 2SPOA 4DWTA 1O1MA 3RQRA 4LM6B 5D1VA 1YE2A 2VMLB 2H35A 4Z8KB 1O1NA 4HRTA 4ZIZB 2GNWA 4MXKA 1YHUD 1PHNA 1IWHB 4XS0A 3MKBB 4YU3A 4ROMA 1XZ2B 1MNHA 3G46A 1PBXB 2NX0A 3WR1A 107MA 1QSIB 1YVTB 1LFYA 2R4ZA 2DN1B 2LH1A 1ECOA 1QPWA 3CIUB 5HLQA 1HBAA 5E29B 2R50A 1A00A 2Z85A 5B85A 1MCYA 1CP0A 4ETTA 3QQQA 1BZ0A 3KUOA 1Y01B 4NXAA 1J7WA 5HBIA 5KERB 4F6JA 4MQGB 1MOCA 1Y85B 2BLJM 1A87A 1Y4RA 1TOXA 1SI4A 1EBTA 2QU0B 2UUNB 4L7YB 3ZJSA 3DUTA 2D5XB 1J3YB 1H97A 3BJ2A 3P5QA 1CQXA 1YFFB 3KMFC 3G4WA 5CNFA 2D60A 4MBAA 2DN2B 2V8AA 2GNVA 5CNCA 4O4TA 2AUQA 1A3NB 1HGBA 3OZUA 1QSHA 1WMUA 1KN1A 2KSCA 2YRSA 1ALLB 1Y5JA 4BS9A 4LMSB 3GKTA 1GLIA 1XYEB 2IG3A 1JL7A 5KDQB 1UVIA 1Y46B 3UHIA 2G11A 3QM6A 1YCBA 2MHBB 5EE4D 1O1JB 2QFNA 2D2MB 3O18B 2ZSPA 3PI2A 1DXCA 2W6YA 4QAUA 2ZLUA 1Y8KB 1BZZB 4GY3B 4BJUA 5KKKA 2V1EA 1XF6C 1Y0WA 5JGGB 1HLMA 4FWYA 4ROLA 1GDLA 1MOHA 3NL7A 3ZJIA 1DUOA 3ECXA 3A5AA 5JOMA 1YHUA 2ZSRA 1MYGA 3PIAA 1MLMA 2DHBA 3IC2B 5JDOC 2EVKA 1G08A 3UI0A 3H58A 1F5PA 1FSXB 5EUIA 2Z8AA 1JEBA 2UULB 3GQRA 2SPNA 3GDJB 1Y7DB 1LFLB 1XZ7B 2PGHB 3UH6A 1F99B 1FSLA 1Y31A 3ZJQA 1G0BA 1YHEB 3H57A 3FS4A 2MGMA 3UHSA 1G0BB 1YHEA 2ZS0C 1YIEB 2V1FA 2ZLTB 3EU1A 4FWXA 1LFLA 4FC3B 1Y09A 1Y4QA 2H8DA 3WCPB 1UX9A 2HBFA 5SW7B 1OBMA 1Y8IA 3GKVA 1MLKA 1YDZB 1KFRA 4TWVA 1LJWA 4OODA 4TYXA 2D5ZA 1BZZA 1Y8HB 3ZJJA 4TWUA 5HY8B 2BV8B 1YG5B 1O1IB 3QJEB 1V75A 2D2MA 3O18A 3UH7A 4MXLA 1O1JA 5B13A 1O1OA 4A8MP 1X9FD 3HF4A 1BBBA 4O2GA 1JWNA 3ASEA 1G9VB 3M3BA 2EKUA 1WVPA 1LH2A 3TLDA 1Y0AA 2D2NA 3ONZB 4JACA 2EVPA 1FAWB 5CNBA 3PI9A 4KMWA 4M4AB 1BZPA 1ALLA 1Y45A 1DM1A 1HCOA 3KUNA 1QSHB 3VNCA 1WLAA 3QQRA 1WACA 2ZSXA 1C7DA 3A0GB 1BABA 4NXCA 104MA 3UH3A 1SDLA 3RJNB 3WCUD 1B8DB 1URYA 1V07A 1HGAA 2AUOA 4NZIA 1K0YA 4JYQA 3NFEB 1G0AA 1YG5A 5HY8A 1DO3A 1VXCA 2BLHA 2ZWJA 1Y0DA 2HBCB 2VLZA 1LJWB 1VREA 3DBJA 3DHTA 3ZH0A 1YEUA 2C7LB 1MNJA 1S0HA 2ZFOB 1X9FB 5B13G 5EOHA 1UVJA 1UFJA 1A3OA 1NQPA 3WCVB 3V58B 2R1HA 1J7WB 2R4YA 1XQ5A 4ODCA 3FEWX 1MBDA 3WFTA 1CIKA 1CH7A 5EYSA 2H8FA 1THBB 2X4AA 2ZT2A 1YIEA 2NRLA 1CG5B 1QSIA 1G09B 1Y0TB 3FS4B 2JL9A 1XZ2A 3A5GA 3OK5A 1ITHA 1IOPA 4MQHB 3UHTA 3BA2A 2GTLA 1C40A 2AUPA 1ECNA 4HRTB 2H35B 4AVEA 2VMLA 3LB3A 1M9PB 3OJ1A 5C6EA 2HBSB 1G08B 1N9HA 1FHJB 3R5IA 2MGEA 2NSRA 1CQ2A 3PI1A 1UVKA 3OVUC 2HBSA 1LH6A 2MGLA 3VHBA 3MYMA 1AJHA 2O5BX 1O16A 2ZLUB 5F2AA 1ON7B 1LFZB 1LFQA 3V57A 1NY9A 4N7PA 1CIIA 1LH5A 2ZLVA 1XZUB 2SPLA 1QI8A 3PT7A 1G09A 4UZVA 1EBCA 3ARLA 1LIAA 5IKSA 1LFVA 2R4XA 3MBAA 1GZXB 2HBDA 5CN5A 2VYZA 1XY0B 4G1VA 1KN1B 1Y22B 1H1XA 3WCVA 1Y4BB 1NQPB 4FH6A 1CG8B 2G0VA 5ILEA 4ETVA 1YH9A 4MAXA 1YEVB 2R80B 3S65B 2DN2A 3QZXA 2QSSB 1JP8A 2UUMA 3DBJB 2SPMA 2C7KA 5EETA 5E83A 1GH0A 1MWBA 4MQCB 1Y4FB 1MOAA 2O5TX 3D1KB 1V4XB 3VREB 5ILMA 5E83B 4DC7A 1F63A 1J40B 2FRJX 1CPCA 3LHBA 1HGAB 3UGZA 1YMCA 6HBWA 1C7DB 5CN8A 1VRFA 3ODQA 3GQGB 3KMFA 2B7HB 1KTPA 1UIWB 1JPBA 3ONZA 1MYTA 2RAOA 1CMYA 1ECDA 3TM3A 1A6NA 3HEPA 2VJHB 2MGFA 3PMDA 1GJNA 1ABYB 2UULH 1XZUA 4KJTA 4F6DA 4HRRB 4X0LA 110MA 1XZ4A 2UUND 2VRYA 1MLQA 1LFZA 2NSSA 4X0LB 1PHNB 2IN4A 1RQ3A 2ZFOD 2QMBB 3UHXA 5AB8A 3PI3A 108MA 3UHEA 3UHZA 2EB9A 5HU6A 1SWMA 1FDHA 2BNLA 3HXNA 1KTPB 1YDZA 2AA1B 3OO5B 1LTWA 1SGKA 1DKEB 3GUQA 1GBVA 1J7SB 2DKAA 3EOKA 2DXMB 1UC3A 4IROA 1N9XA 1PMBA 3UBCA 4HSXA 4MQJB 3UHNA 2HZ1A 4YU4A 3EU1B 4MQHA 4MU5A 1M6CA 2R4WA 4DWUA 1S69A 1YE0B 4A8YA 3D1KA 2D6CA 1HHOB 3WCUA 1A0ZA 1RTXA 4MQCA 2PEGB 1C7BB 3AQ7A 3K3UA 3A9MA 2PGHA 3LB2A 1YHRB 4MPMA 2V1HA 1A4FA 4M4BB 3GQRB 1JZLA 1GBUA 2R1HB 3V58A 1GCVA 1JEBB 1DXUA 1A3OB 5F0BA 5AQDA 4B3WA 1A4FB 3IC2A 3IA3B 1X9FA 1KD2B 1X3KA 1YHRA 1MWDA 1UFPA 1MDTA 4U8UA 1COHA 1LFVB 1C7BA 3QMAA 1VWTB 3GIOA 3WFXA 1YZIB 1Y5FA 102MA 1G0AB 1N9IA 1ABSA 1YGDB 2ZSSA 2LH7A 4N7PB 1IT3A 2MGKA 3G4QA 1JP9A 4HHBB 1VXBA 1GBVB 1BABB 3WCWA 3PMCA 4G51B 1HCOB 2O58X 1J41B 2AA1A 2AURA 1OJ6A 2O5MX 1CH9A 1DWSA 3MJUA 1OUUB 3OZWA 1XZVA 1MBCA 1Y0AB 2D2NB 2ZT1A 1NEJB 1TU9A 1QXDB 2WCQA 3WCVD 1MNKA 1DTMA 1OR6A 4NK1A 2HZ3A 5JDOF 2D60B 1Y7CB 4OF9A 1SPGA 2GRHA 3M3AA 3QJCA 2VJTA 5CN9A 1DXTA 1MYFA 1FDHG 1ABYA 1YFFA 3P5QB 1DLYA 2D5XA 1HBBB 1XDTT 3AQ8A 2QU0A 1CH3A 2D2NC 1HBGA 1HGCB 3GOUA 1QGWC 2MB5A 2XKGA 4N8TA 1GDIA 3WCPA 2MYDA 2GRFA 3D4XB 3W4UB 1Y4QB 2W72C 3UHCA 1SDKA 1MYZA 1HGCA 5D5RA 1Y7GA 2DN1A 1GCWB 4A8WA 1NZ5A 1HBBA 4N6SB 1BZ1A 1R1YA 2HBCA 3S1JA 2NRMA 2ZSOA 1Y31B 5CNDA 1MDNA 3QJCB 1SHRA 2E2YA 1JDOA 1HV4A 1IWHA 1MBIA 2QSSA 2WY4A 1JBOA 1Y7DA 3MN0A 1HLBA 3WCTA 1O1NB 1Z8UB 1CG8A 4GZGA 1Y4BA 1JP6A 1LA6A 1AJ9B 1L2KA 1O1KA 1Y45B 2LH2A 1XZVB 2G12A 1AZIA 1Y7ZA 112MA 3PT8B 3HYUA 5HAVA 4ERVA 4U8UD 4H0MA 1Y35A 1HBIA 1EYXA 4U8UC 1LIAB 3A2GA 1G9VA 2HHBA 3NUHB 3BCQA 4C44A 2HCOA 3AT6B 1MWCA 4KN3A 1BBBB 1YIHB 3G4UA 3BRPA 2MGCA 1V75B 2V1IA 3ECLA 2W6WA 1URVA 3QM8A 1O1IA 3BJ1A 1Y5FB 4A8SA 1DLWA 1YIHA 1YOIA 3ZOMA 1UT0A 1HHSA 3WHMB 4AE1A 2G0ZA 1EYXB 2XKIA 3GQPA 3UHUA 5KDQA 1MLUA 1XYEA 2OH8A 2VEBA 5C6EB 2XYKA 2H8DB 2HZ2A 1DO7A 2VEEA 3UHHA 1Y09B 1T1NB 1OUTA 3WCTB 4M4BA 2GTLB 1JBOB 3MJPA 1SHRB 4F0UA 3DHRA 2EKTA 2WTGA 2G0RA 2PEGA 2AV0A 1RSEA 4DC8A 3BJ2B 1HHOA 4O1TA 2MYBA 4B02A 1R1YB 1BZ1B 2LH6A 1F0LA 3IC0A 1Y4GA 3UHBA 1Y7GB 3NG6A 2LH5A 3O89A 2H8FB 1VXFA 2OHBA 1A9WE 4ERTA 2MGHA 3UGYA 3GDJA 4ODCB 4ZVAA 1SDKB 2UULA 4NI1A 1DKEA 2W72A 3BOMA 1EMYA 1BJEA 1XCHA 2MGGA 2V1KA 1GDKA 1CH5A 1SPEA 2ZS0B 4N8TB 3B75A 3A5BA 4G1BA 3OO5A 2MGAA 3GOUB 1S61A 2JHOA 2C7LA 1NZ4A 5HU6B 2DN3A 1QPWB 3CIUA 1MOBA 3NL7B 1LFYB 2VYYA 1B86B 1Y0WB 5JGGA 3WR1B 3SZKA 1MBNA 1XG0C 2G3HA 4FWZA 1XZ4B 2VYWA 3VRGB 1S56A 1SPGB 1I7YA 2ZS1C 4XDIA 4XXKA 1X9FC 1B8DA 109MA 3ZJRA 1Y8WB 2VJHA 1Y4VA 2ZT3A 3A0GA 1HSYA 3PI8A 2G10A 2RAOB 4L2MA 3ZOLA 3MJUB 2WCRA 1LH1A 1UIWA 4PQCA 2ZSQA 1FAWA 2MGBA 1MNOA 2FAMA 2YRSB 3ODQB 1WMUB 5HLUA 4GXEB 4TMAB 4ZVBA 6HBWB 1DXVA 1A3NA 5ILRA 3WCUC 1KR7A 2HBEB 1O1PA 1HDSA 1YGDA 4XXIA 1HJTA 2J96A 1A6KA 1GH0B 2BKMA 2VJRA 3ECZA 1VXEA 2RI4B 2C7KB 2HBGA 1COHB 2ZS0D 2QLSB 3VRFB 3KVSB 2Z6NA 1O1LA 1Y8IB 1YEVA 1HBRA 1YH9B 1RQ4B 1YOGA 2EF2A 6HBIA 4RMPB 1DXUB 1RQAA 2GTLD 1Y22A 4MQGA 1CO9A 2QSPA 3WCVC 1W92A 1XY0A 3QJDA 1MNIA 1YGFB 1V9QA 2HBDB 1D8UA 3ARKA 3MOUA 1MBOA 4YJJB 1CO8A 2ZLWB 1A9WA 1I3EA 1YVTA 5AZQA 1B33B 1JF3A 1S5XA 4PNJA 105MA 1DO1A 1TESA 3LQ9A 1YE0A 4C0NA 1F99A 3S66B 2X49A 3A59B 1HBHB 3NMMA 3UHKA 1F5OA 4YU4B 4MQJA 1YEOB 4N7OA 4IROB 1HRMA 4IT8A 1ON7A 4ZIZA 3EOKB 3D17A 3O7NA 3NMLA 4BJAA 3ED9A 1LFTB 3D1AB 3IXFA 1CLSB 1RPSA 4A8QA 3SDNA 1CLSA 2G14A 4PQ6A 1BUWA 2GL3A 1M9PA 1YEQB 4ROLB 2DKCA 4GY3A 3D17B 1Y8KA 1C40B 1A6GA 1HA7B 2QMBA 3ARJA 1COLA 2G0SA 3AT5A 1DXDA 1MTKA 1MLJA 2BW9M 4HRRA 3S66A 5JDOD 2WTHA 2MHBA 5EV5A 3WTGA 5FVBA 1VHBA 1XZ5B 4ESAB 1BIJB 1B33A 1CG5A 1ABWA 1HDBB 1MLLA 5EE4C 1AJGA 3PELB 5HLXA 1IRDB 1GLIB 3ORDA 1XQ5B 1HACB 4H0BA 4PO5A 1Y4PA 2ZT0A 2C0KA 2HHEA 4L1EA 1V4WA 2ZFOC 4HSWA 1O1LB 2V8AB 2W6XA 3GK9A 3RGKA 3KVSA 1S0HB 3UHWA 1YEUB 4LMXB 1CH1A 1NS9B 1EWAA 3AQ9A 3WFWA 2VJRB 2OLPA 3VREA 4F68A 1NIHB 1Y0DB 3WCTD 1X46A 3DUTB 2ZFBA 1LHSA 5CNEA 1Y4RB 1YVQB 3HRWA 2UUMB 2GDMA 3G4VA 1NWIA 2D2MD 2OH9A 3RJ6A 2HBEA 3S65A 3GLNA 1CBMA 1V4WB 4L1EB 4PO5B 3QZZA 1HACA 3ZJHA 1JF4A 2VHBA 1HABA 3PI9B 1BZ0B 1XXTB 1A00B 2LHBA 1GZXA 1OFJA 3AQ5A 1NZ2A 3UHDA 3E5IA 5ILPA 3TM9A 101MA 2GLNA 5FVBM 1ABWB 1CP5A 2OIFA 1BIJA 1Y5KA 1Y83A 1QI8B 1U7SA 1O1OB 2O5LX 3D7OA 1HBSB 1MLOA 2ZSZA 3VRGA 4F4OA 2GKMA 2BV8A 1HA7A 1Y8HA 3CY5B 1YMAA 4Z8KA 3UH5A 4A8KA 2D5ZB 1B86A 1IBEB 1YEQA 1BUWB 5E6EA 3E4NA
chains in the Genus database with same CATH topology
3AQ6A 1NPGA 3HEOA 1FHJA 2FALA 3WCWC 5SW7A 1LFTA 1CH4A 3B75B 1HDAA 3LR9A 3PI4A 5EYJA 2ZLXA 4NI1B 4FC3A 4N7OB 1YEOA 1MLSA 2VM0A 3HENA 4F6FA 1HBHA 3NMMB 2ZLTA 3NG6B 3M39A 3IC0B 2OHAA 1MLRA 4N7NB 3ZJLA 1YENA 3ZJOA 1S5XB 1Y0TA 2MYAA 3R0GA 2HHDB 1THBA 1NXFA 3MJPB 1FN3B 1VXGA 1IRCA 1J3ZB 3ZJPA 3V2VA 3UBVA 1Y0CB 1RQAB 3ZJMA 5EUIB 3WCTC 106MA 3SDHA 1C7CB 2DHBB 3PIAB 2CMMA 4O35A 2ZFOA 5EU2A 1UVYA 2QLSA 3QM9A 3UHRA 3DHTB 3GQPB 3G53A 1BINA 2ZS1D 2W6VA 1IBEA 3M38A 3HHBB 1MLFA 3NFEA 3G52A 3GYSB 1K0YB 1HBSA 1S6AA 4ILZA 1O1PB 1I3DA 4H2LB 1FCSA 5CN7A 1YHUC 2M6ZA 1VXHA 2HCOB 3AT6A 1SDLB 2HHBB 3S1IA 1A0UA 3MVCA 3OO4A 1Y46A 2QFKA 4KMVA 3LQDB 1NGKA 2MYCA 1CBLA 4M4AA 2MGJA 1ASHA 1Y7ZB 3PT8A 1IDRA 1A6MA 2QRWA 4NI0B 3LQDA 1HGBB 1Y4VB 1Q1FA 2VLYA 2M6ZB 1MKOB 3FH9A 3HF4B 3S48C 4H2LA 3WFUA 3LR7A 3QJEA 4HBIA 1YVQA 2G0XA 2FRIX 3BJ3A 3HHBA 1V4UB 1J3YA 3K9ZA 1GCWA 2DN3B 3AG0A 2ZT4A 1NWNA 3E55A 3QM7A 3GKVB 2HHEB 4MBNA 2HBFB 1Y4PB 1MYIA 4MQKA 2ZS1B 2W72B 3BOMB 1Y0CA 103MA 1K1KB 1DWRA 3PELA 1HBAB 5E29A 1MTJA 2HHDA 1YMBA 5MBNA 7HBIA 4MQIA 2VLXA 1YENB 1V4UA 3WTGB 1MYMA 3BJ3B 1CPWA 1PBXA 1DXTB 4WJG1 1MODA 4ROMB 3U3EA 1XZ7A 1MLHA 3AT5B 1M6MA 1T1NA 2ZLXB 1FSXA 1CH2A 1NEJA 1OUUA 1NAZA 1YHUB 4F6BA 1YCAA 2V1JA 1MBSA 2MGIA 4F6IA 111MA 1OR4A 3OO4B 3WCWB 1A0UB 2FRKX 2DC3A 1JZMA 1DTIA 4NK2A 1IT2A 3CY5A 1J7YA 1MYHA 3BJ1B 3QM5A 5MBAA 1MYJA 3GYSA 1JW8A 2ZSYA 3D7OB 4AVDA 1LH7A 1DUKA 1J7YB 1VXAA 1Y5KB 1Y83B 3UHGA 1DWTA 2ZLWA 1BZRA 1KD2A 1YGFA 3QJDB 1Y5JB 1O1KB 1ECAA 1JZKA 3G4YA 2ZSTA 1AJ9A 1CIOA 3V2ZA 1J3FA 1RQ4A 1MGNA 1J3ZA 1J52A 1A01B 1NZ3A 4F69A 1HV4B 5C6YA 5B84A 2RI4A 1MLGA 5CN6A 3QJBB 1A0ZB 4MQIB 4L7YA 2MBWA 4N7NA 4NS2A 1NS9A 1SI4B 2GTLC 3EDAA 2BK9A 1LUEA 1NPFA 5AZRA 1Y85A 5EQMA 3UHQA 1K1KA 1J7SA 1RTEA 1DXVB 1LHTA 2D2ND 3D4XA 2ZS1A 3W4UA 2ZSNA 4MQKB 3ZHWA 5KERA 2D2MC 1F65A 2GRZA 1BZ6A 2BMMA 2LH3A 5E6EB 1MBAA 2Z6SA 3LB1A 1Y8WA 1JY7B 1BVCA 4ESAA 1XZ5A 1RQ3B 3LB4A 4F4OB 3MKBA 4XS0B 4YU3B 4SDHA 1Y7CA 3HC9A 5CMVA 3SZKB 1MTIA 1MKOA 3FH9B 5CNGA 1JY7A 1YE2B 4WJGA 1O1MB 1DO4A 1QXDA 1CMYB 4NI0A 3E5OA 4FH7A 1XXTA 2B7HA 1J41A 1HABB 1N9FA 2O5QX 1B0BA 3GQGA 4F6GA 2ZS0A 4G51A 4PQBA 1RVWB 1QXEB 1UMOA 2W31A 4HHBA 1LH3A 5CHQA 1MZ0A 1J40A 3K8BB 3HRWB 1UVXA 1NS6A 3A59A 1Y4GB 2O5SX 1S5YA 1V4XA 2ZFBB 1R1XB 1YZIA 4UURA 1Y4FA 1VWTA 1NIHA 1VXDA 2W6VB 3QJBA 3UHYA 2FRFA 1EW6A 1FLPA 3DHRB 1GVHA 3EDBA 4U8UB 1Y2ZA 2EB8A 1A01A 3MYNA 3WCWD 2R80A 4B4YA 1C7CA 1OUTB 1GDJA 2QSPB 1GCVB 1GBUB 5CHRA 1HBRB 4LPIA 1V5HA 3ZJNA 4VHBA 4O4ZA 2Z6NB 1Y2ZB 1YOHA 1IRDA 1FN3A 3VRFA 1HDBA 3OZVA 3WI8A 4UIQA 3WHMA 3OGBA 3WCUB 3PT7B 2BLIA 3DR9A 1R1XA 1S5YB 3G4RA 1JL6A 2ZLVB 1NS6B 1HDSB 3K8BA 1LFQB 5CN4A 2Z6TA 2BWHA 1U7RA 2AV3A 2MGDA 1OFKA 2GKNA 4H07A 2O5OX 5JDOE 2V1GA 2DXMA 4WCHD 3BCQB 1QXEA 1MLNA 1RVWA 1HDAB 1UX8A 1Y35B 3UHVA 3HYUB 3VAUA 3HXNB 1RPSB 3R5IB 2MYEA 2XKHA 3D1AA 3PI8B 1LA6B 1BVDA 5M3SA 2SPOA 4DWTA 1O1MA 5D1VA 1YE2A 2H35A 1O1NA 4HRTA 2GNWA 4MXKA 1YHUD 1IWHB 4XS0A 3MKBB 4YU3A 4ROMA 1XZ2B 1MNHA 3G46A 1PBXB 2NX0A 3WR1A 107MA 1QSIB 1YVTB 1LFYA 2R4ZA 2DN1B 2LH1A 1ECOA 1QPWA 3CIUB 5HLQA 1HBAA 5E29B 2R50A 1A00A 2Z85A 5B85A 1MCYA 1CP0A 3QQQA 1BZ0A 3KUOA 1Y01B 4NXAA 1J7WA 5HBIA 5KERB 4F6JA 4MQGB 1MOCA 1Y85B 2BLJM 1Y4RA 1SI4A 1EBTA 2QU0B 4L7YB 3ZJSA 3DUTA 2D5XB 1J3YB 1H97A 3BJ2A 3P5QA 1CQXA 1YFFB 3KMFC 3G4WA 5CNFA 2D60A 4MBAA 2DN2B 5CNCA 2GNVA 4O4TA 2AUQA 1A3NB 1HGBA 3OZUA 1QSHA 1WMUA 2KSCA 2YRSA 1Y5JA 3GKTA 1GLIA 1XYEB 2IG3A 1JL7A 5KDQB 1Y46B 3UHIA 2G11A 3QM6A 1YCBA 2MHBB 5EE4D 1O1JB 2QFNA 2D2MB 2ZSPA 3PI2A 1DXCA 2W6YA 4QAUA 2ZLUA 1Y8KB 1BZZB 5KKKA 2V1EA 1Y0WA 5JGGB 1HLMA 4FWYA 4ROLA 1GDLA 1MOHA 3NL7A 3ZJIA 1DUOA 3ECXA 3A5AA 5JOMA 1YHUA 2ZSRA 1MYGA 3PIAA 1MLMA 2DHBA 3IC2B 5JDOC 2EVKA 1G08A 3UI0A 3H58A 1F5PA 1FSXB 5EUIA 2Z8AA 1JEBA 3GQRA 2SPNA 3GDJB 1Y7DB 1LFLB 1XZ7B 2PGHB 3UH6A 1FSLA 1Y31A 3ZJQA 1G0BA 1YHEB 3H57A 3FS4A 2MGMA 3UHSA 1G0BB 1YHEA 2ZS0C 1YIEB 2V1FA 2ZLTB 3EU1A 4FWXA 1LFLA 4FC3B 1Y09A 1Y4QA 2H8DA 3WCPB 1UX9A 2HBFA 5SW7B 1OBMA 1Y8IA 3GKVA 1MLKA 1YDZB 1KFRA 4TWVA 1LJWA 4OODA 4TYXA 2D5ZA 1BZZA 1Y8HB 3ZJJA 4TWUA 5HY8B 1YG5B 1O1IB 3QJEB 1V75A 2D2MA 3UH7A 4MXLA 1O1JA 1O1OA 1X9FD 3HF4A 1BBBA 4O2GA 1JWNA 3ASEA 1G9VB 3M3BA 2EKUA 1WVPA 3TLDA 1LH2A 1Y0AA 2D2NA 3ONZB 4JACA 2EVPA 1FAWB 5CNBA 3PI9A 4KMWA 4M4AB 1BZPA 1Y45A 1DM1A 1HCOA 3KUNA 1QSHB 1WLAA 3QQRA 2ZSXA 1C7DA 3A0GB 1BABA 4NXCA 104MA 3UH3A 1SDLA 3RJNB 3WCUD 1URYA 1V07A 1HGAA 2AUOA 4NZIA 1K0YA 4JYQA 3NFEB 1G0AA 1YG5A 5HY8A 1DO3A 1VXCA 2BLHA 2ZWJA 1Y0DA 2HBCB 2VLZA 1LJWB 1VREA 3DHTA 3ZH0A 1YEUA 1MNJA 1S0HA 2ZFOB 1X9FB 5EOHA 1UFJA 1A3OA 1NQPA 3WCVB 2R1HA 1J7WB 2R4YA 1XQ5A 4ODCA 1MBDA 3WFTA 1CIKA 1CH7A 5EYSA 2H8FA 1THBB 2ZT2A 1YIEA 2NRLA 1CG5B 1QSIA 1G09B 1Y0TB 3FS4B 1XZ2A 3A5GA 3OK5A 1ITHA 1IOPA 4MQHB 3UHTA 3BA2A 2GTLA 1C40A 2AUPA 1ECNA 4HRTB 2H35B 4AVEA 3LB3A 1M9PB 3OJ1A 5C6EA 2HBSB 1G08B 1N9HA 1FHJB 3R5IA 2MGEA 2NSRA 1CQ2A 3PI1A 3OVUC 2HBSA 1LH6A 2MGLA 3VHBA 3MYMA 1AJHA 2O5BX 1O16A 2ZLUB 5F2AA 1LFZB 1LFQA 4N7PA 1LH5A 2ZLVA 1XZUB 2SPLA 1QI8A 3PT7A 1G09A 4UZVA 1EBCA 3ARLA 5IKSA 1LFVA 2R4XA 3MBAA 1GZXB 2HBDA 5CN5A 2VYZA 1XY0B 4G1VA 1Y22B 1H1XA 3WCVA 1Y4BB 1NQPB 4FH6A 1CG8B 2G0VA 5ILEA 1YH9A 4MAXA 1YEVB 2R80B 3S65B 2DN2A 3QZXA 2QSSB 1JP8A 2SPMA 5EETA 5E83A 1MWBA 4MQCB 1Y4FB 1MOAA 2O5TX 3D1KB 1V4XB 3VREB 5ILMA 5E83B 4DC7A 1F63A 1J40B 2FRJX 3LHBA 1HGAB 3UGZA 1YMCA 6HBWA 1C7DB 5CN8A 1VRFA 3ODQA 3GQGB 3KMFA 2B7HB 1UIWB 1JPBA 3ONZA 1MYTA 2RAOA 1CMYA 1ECDA 3TM3A 1A6NA 3HEPA 2MGFA 1GJNA 1ABYB 1XZUA 4KJTA 4F6DA 4HRRB 4X0LA 110MA 1XZ4A 2VRYA 1MLQA 1LFZA 2NSSA 4X0LB 2IN4A 1RQ3A 2ZFOD 2QMBB 3UHXA 5AB8A 3PI3A 108MA 3UHEA 3UHZA 2EB9A 5HU6A 1SWMA 1FDHA 2BNLA 3HXNA 1YDZA 2AA1B 3OO5B 1LTWA 1DKEB 1GBVA 1J7SB 3EOKA 2DXMB 1UC3A 4IROA 1N9XA 1PMBA 3UBCA 4HSXA 4MQJB 3UHNA 2HZ1A 4YU4A 3EU1B 4MQHA 4MU5A 1M6CA 2R4WA 4DWUA 1S69A 1YE0B 3D1KA 2D6CA 1HHOB 3WCUA 1A0ZA 1RTXA 4MQCA 2PEGB 1C7BB 3AQ7A 3K3UA 3A9MA 2PGHA 3LB2A 1YHRB 4MPMA 2V1HA 1A4FA 4M4BB 3GQRB 1JZLA 1GBUA 2R1HB 1GCVA 1JEBB 1DXUA 1A3OB 5F0BA 4B3WA 1A4FB 3IC2A 3IA3B 1X9FA 1KD2B 1X3KA 1YHRA 1MWDA 1UFPA 4U8UA 1COHA 1LFVB 1C7BA 3QMAA 1VWTB 3WFXA 1YZIB 1Y5FA 102MA 1G0AB 1N9IA 1ABSA 1YGDB 2ZSSA 2LH7A 4N7PB 1IT3A 2MGKA 3G4QA 1JP9A 4HHBB 1VXBA 1GBVB 1BABB 3WCWA 4G51B 1HCOB 2O58X 1J41B 2AA1A 2AURA 1OJ6A 2O5MX 1CH9A 1DWSA 3MJUA 1OUUB 3OZWA 1XZVA 1MBCA 1Y0AB 2D2NB 2ZT1A 1NEJB 1TU9A 1QXDB 3WCVD 1MNKA 1DTMA 1OR6A 4NK1A 2HZ3A 5JDOF 2D60B 1Y7CB 4OF9A 1SPGA 2GRHA 3M3AA 3QJCA 5CN9A 1DXTA 1MYFA 1FDHG 1ABYA 1YFFA 3P5QB 1DLYA 2D5XA 1HBBB 3AQ8A 2QU0A 1CH3A 2D2NC 1HBGA 1HGCB 3GOUA 2MB5A 2XKGA 4N8TA 1GDIA 3WCPA 2MYDA 2GRFA 3D4XB 3W4UB 1Y4QB 2W72C 3UHCA 1SDKA 1MYZA 1HGCA 5D5RA 1Y7GA 2DN1A 1GCWB 1NZ5A 1HBBA 1BZ1A 1R1YA 2HBCA 3S1JA 2NRMA 2ZSOA 1Y31B 5CNDA 1MDNA 3QJCB 1SHRA 2E2YA 1JDOA 1HV4A 1IWHA 1MBIA 2QSSA 2WY4A 1Y7DA 3MN0A 1HLBA 3WCTA 1O1NB 1Z8UB 1CG8A 4GZGA 1Y4BA 1JP6A 1LA6A 1AJ9B 1L2KA 1O1KA 1Y45B 2LH2A 1XZVB 2G12A 1AZIA 1Y7ZA 112MA 3PT8B 3HYUA 5HAVA 4U8UD 1Y35A 1HBIA 4U8UC 3A2GA 1G9VA 2HHBA 3BCQA 4C44A 2HCOA 3AT6B 1MWCA 4KN3A 1BBBB 1YIHB 3G4UA 2MGCA 1V75B 2V1IA 3ECLA 2W6WA 1URVA 3QM8A 1O1IA 3BJ1A 1Y5FB 1DLWA 1YIHA 1YOIA 3ZOMA 1UT0A 3WHMB 2G0ZA 2XKIA 3GQPA 3UHUA 5KDQA 1MLUA 1XYEA 2OH8A 2VEBA 5C6EB 2XYKA 2H8DB 2HZ2A 1DO7A 2VEEA 3UHHA 1Y09B 1T1NB 1OUTA 3WCTB 4M4BA 2GTLB 3MJPA 1SHRB 3DHRA 2EKTA 2WTGA 2G0RA 2PEGA 2AV0A 1RSEA 4DC8A 3BJ2B 1HHOA 4O1TA 2MYBA 1R1YB 1BZ1B 2LH6A 3IC0A 1Y4GA 3UHBA 1Y7GB 3NG6A 2LH5A 3O89A 2H8FB 1VXFA 2OHBA 1A9WE 2MGHA 3UGYA 3GDJA 4ODCB 4ZVAA 1SDKB 4NI1A 1DKEA 2W72A 3BOMA 1EMYA 1BJEA 1XCHA 2MGGA 2V1KA 1GDKA 1CH5A 1SPEA 2ZS0B 4N8TB 3B75A 3A5BA 4G1BA 3OO5A 2MGAA 3GOUB 1S61A 2JHOA 1NZ4A 5HU6B 2DN3A 1QPWB 3CIUA 1MOBA 3NL7B 1LFYB 2VYYA 1B86B 1Y0WB 5JGGA 3WR1B 3SZKA 1MBNA 2G3HA 4FWZA 1XZ4B 2VYWA 3VRGB 1S56A 1SPGB 2ZS1C 4XDIA 1X9FC 109MA 3ZJRA 1Y8WB 1Y4VA 2ZT3A 3A0GA 1HSYA 3PI8A 2G10A 2RAOB 4L2MA 3ZOLA 3MJUB 1LH1A 1UIWA 4PQCA 2ZSQA 1FAWA 2MGBA 1MNOA 2FAMA 2YRSB 3ODQB 1WMUB 5HLUA 4ZVBA 6HBWB 1DXVA 1A3NA 5ILRA 3WCUC 1KR7A 2HBEB 1O1PA 1HDSA 1YGDA 1HJTA 1A6KA 2BKMA 3ECZA 1VXEA 2RI4B 2HBGA 1COHB 2ZS0D 2QLSB 3VRFB 2Z6NA 1O1LA 1Y8IB 1YEVA 1HBRA 1YH9B 1RQ4B 1YOGA 2EF2A 6HBIA 1DXUB 1RQAA 2GTLD 1Y22A 4MQGA 1CO9A 2QSPA 3WCVC 1W92A 1XY0A 3QJDA 1MNIA 1YGFB 1V9QA 2HBDB 1D8UA 3ARKA 3MOUA 1MBOA 1CO8A 2ZLWB 1A9WA 1I3EA 1YVTA 5AZQA 1JF3A 1S5XA 4PNJA 105MA 1DO1A 1TESA 1YE0A 4C0NA 3S66B 3A59B 1HBHB 3NMMA 3UHKA 1F5OA 4YU4B 4MQJA 1YEOB 4N7OA 4IROB 1HRMA 4IT8A 3EOKB 3D17A 3O7NA 3NMLA 4BJAA 3ED9A 1LFTB 3D1AB 3IXFA 1CLSB 1RPSA 3SDNA 1CLSA 2G14A 4PQ6A 1BUWA 2GL3A 1M9PA 1YEQB 4ROLB 3D17B 1Y8KA 1C40B 1A6GA 2QMBA 3ARJA 2G0SA 3AT5A 1DXDA 1MTKA 1MLJA 2BW9M 4HRRA 3S66A 5JDOD 2WTHA 2MHBA 5EV5A 3WTGA 1VHBA 1XZ5B 4ESAB 1BIJB 1CG5A 1ABWA 1HDBB 1MLLA 5EE4C 1AJGA 3PELB 5HLXA 1IRDB 1GLIB 3ORDA 1XQ5B 1HACB 4H0BA 1Y4PA 2ZT0A 2C0KA 2HHEA 1V4WA 2ZFOC 4HSWA 1O1LB 2W6XA 3GK9A 3RGKA 1S0HB 3UHWA 1YEUB 1CH1A 1NS9B 1EWAA 3AQ9A 3WFWA 2OLPA 3VREA 4F68A 1NIHB 1Y0DB 3WCTD 1X46A 3DUTB 2ZFBA 5CNEA 1LHSA 1Y4RB 1YVQB 3HRWA 2GDMA 3G4VA 1NWIA 2D2MD 2OH9A 3RJ6A 2HBEA 3S65A 3GLNA 1CBMA 1V4WB 3QZZA 1HACA 3ZJHA 1JF4A 2VHBA 1HABA 3PI9B 1BZ0B 1XXTB 1A00B 2LHBA 1GZXA 1OFJA 3AQ5A 1NZ2A 3UHDA 3E5IA 5ILPA 3TM9A 101MA 2GLNA 1ABWB 1CP5A 2OIFA 1BIJA 1Y5KA 1Y83A 1QI8B 1U7SA 1O1OB 2O5LX 3D7OA 1HBSB 1MLOA 2ZSZA 3VRGA 4F4OA 2GKMA 1Y8HA 3CY5B 1YMAA 3UH5A 2D5ZB 1B86A 1IBEB 1YEQA 1BUWB 5E6EA 3E4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQ6 A;  1NPG A;  3HEO A;  1FHJ A;  2FAL A;  3WCW C;  5SW7 A;  1LFT A;  1CH4 A;  3B75 B;  1HDA A;  3LR9 A;  3PI4 A;  5EYJ A;  2ZLX A;  4NI1 B;  4FC3 A;  4N7O B;  1YEO A;  1MLS A;  2VM0 A;  3HEN A;  4F6F A;  1HBH A;  3NMM B;  2ZLT A;  3NG6 B;  3M39 A;  3IC0 B;  2OHA A;  1MLR A;  4N7N B;  3ZJL A;  1YEN A;  3ZJO A;  1S5X B;  1Y0T A;  2MYA A;  3R0G A;  2HHD B;  1THB A;  1NXF A;  3MJP B;  1FN3 B;  1VXG A;  1IRC A;  1J3Z B;  3ZJP A;  3V2V A;  3UBV A;  1Y0C B;  1RQA B;  3ZJM A;  5EUI B;  3WCT C;  106M A;  3SDH A;  1C7C B;  2DHB B;  3PIA B;  2CMM A;  4O35 A;  2ZFO A;  5EU2 A;  1UVY A;  2QLS A;  3QM9 A;  3UHR A;  3DHT B;  3GQP B;  3G53 A;  1BIN A;  2ZS1 D;  2W6V A;  1IBE A;  3M38 A;  3HHB B;  1MLF A;  3NFE A;  3G52 A;  3GYS B;  1K0Y B;  1HBS A;  1S6A A;  4ILZ A;  1O1P B;  1I3D A;  4H2L B;  1FCS A;  5CN7 A;  1YHU C;  2M6Z A;  1VXH A;  2HCO B;  3AT6 A;  1SDL B;  2HHB B;  3S1I A;  1A0U A;  3MVC A;  3OO4 A;  1Y46 A;  2QFK A;  4KMV A;  3LQD B;  1NGK A;  2MYC A;  1CBL A;  4M4A A;  2MGJ A;  1ASH A;  1Y7Z B;  3PT8 A;  1IDR A;  1A6M A;  2QRW A;  4NI0 B;  3LQD A;  1HGB B;  1Y4V B;  1Q1F A;  2VLY A;  2M6Z B;  1MKO B;  3FH9 A;  3HF4 B;  3S48 C;  4H2L A;  3WFU A;  3LR7 A;  3QJE A;  4HBI A;  1YVQ A;  2G0X A;  2FRI X;  3BJ3 A;  3HHB A;  1V4U B;  1J3Y A;  3K9Z A;  1GCW A;  2DN3 B;  3AG0 A;  2ZT4 A;  1NWN A;  3E55 A;  3QM7 A;  3GKV B;  2HHE B;  4MBN A;  2HBF B;  1Y4P B;  1MYI A;  4MQK A;  2ZS1 B;  2W72 B;  3BOM B;  1Y0C A;  103M A;  1K1K B;  1DWR A;  3PEL A;  1HBA B;  5E29 A;  1MTJ A;  2HHD A;  1YMB A;  5MBN A;  7HBI A;  4MQI A;  2VLX A;  1YEN B;  1V4U A;  3WTG B;  1MYM A;  3BJ3 B;  1CPW A;  1PBX A;  1DXT B;  4WJG 1;  1MOD A;  4ROM B;  3U3E A;  1XZ7 A;  1MLH A;  3AT5 B;  1M6M A;  1T1N A;  2ZLX B;  1FSX A;  1CH2 A;  1NEJ A;  1OUU A;  1NAZ A;  1YHU B;  4F6B A;  1YCA A;  2V1J A;  1MBS A;  2MGI A;  4F6I A;  111M A;  1OR4 A;  3OO4 B;  3WCW B;  1A0U B;  2FRK X;  2DC3 A;  1JZM A;  1DTI A;  4NK2 A;  1IT2 A;  3CY5 A;  1J7Y A;  1MYH A;  3BJ1 B;  3QM5 A;  5MBA A;  1MYJ A;  3GYS A;  1JW8 A;  2ZSY A;  3D7O B;  4AVD A;  1LH7 A;  1DUK A;  1J7Y B;  1VXA A;  1Y5K B;  1Y83 B;  3UHG A;  1DWT A;  2ZLW A;  1BZR A;  1KD2 A;  1YGF A;  3QJD B;  1Y5J B;  1O1K B;  1ECA A;  1JZK A;  3G4Y A;  2ZST A;  1AJ9 A;  1CIO A;  3V2Z A;  1J3F A;  1RQ4 A;  1MGN A;  1J3Z A;  1J52 A;  1A01 B;  1NZ3 A;  4F69 A;  1HV4 B;  5C6Y A;  5B84 A;  2RI4 A;  1MLG A;  5CN6 A;  3QJB B;  1A0Z B;  4MQI B;  4L7Y A;  2MBW A;  4N7N A;  4NS2 A;  1NS9 A;  1SI4 B;  2GTL C;  3EDA A;  2BK9 A;  1LUE A;  1NPF A;  5AZR A;  1Y85 A;  5EQM A;  3UHQ A;  1K1K A;  1J7S A;  1RTE A;  1DXV B;  1LHT A;  2D2N D;  3D4X A;  2ZS1 A;  3W4U A;  2ZSN A;  4MQK B;  3ZHW A;  5KER A;  2D2M C;  1F65 A;  2GRZ A;  1BZ6 A;  2BMM A;  2LH3 A;  5E6E B;  1MBA A;  2Z6S A;  3LB1 A;  1Y8W A;  1JY7 B;  1BVC A;  4ESA A;  1XZ5 A;  1RQ3 B;  3LB4 A;  4F4O B;  3MKB A;  4XS0 B;  4YU3 B;  4SDH A;  1Y7C A;  3HC9 A;  5CMV A;  3SZK B;  1MTI A;  1MKO A;  3FH9 B;  5CNG A;  1JY7 A;  1YE2 B;  4WJG A;  1O1M B;  1DO4 A;  1QXD A;  1CMY B;  4NI0 A;  3E5O A;  4FH7 A;  1XXT A;  2B7H A;  1J41 A;  1HAB B;  1N9F A;  2O5Q X;  1B0B A;  3GQG A;  4F6G A;  2ZS0 A;  4G51 A;  4PQB A;  1RVW B;  1QXE B;  1UMO A;  2W31 A;  4HHB A;  1LH3 A;  5CHQ A;  1MZ0 A;  1J40 A;  3K8B B;  3HRW B;  1UVX A;  1NS6 A;  3A59 A;  1Y4G B;  2O5S X;  1S5Y A;  1V4X A;  2ZFB B;  1R1X B;  1YZI A;  4UUR A;  1Y4F A;  1VWT A;  1NIH A;  1VXD A;  2W6V B;  3QJB A;  3UHY A;  2FRF A;  1EW6 A;  1FLP A;  3DHR B;  1GVH A;  3EDB A;  4U8U B;  1Y2Z A;  2EB8 A;  1A01 A;  3MYN A;  3WCW D;  2R80 A;  4B4Y A;  1C7C A;  1OUT B;  1GDJ A;  2QSP B;  1GCV B;  1GBU B;  5CHR A;  1HBR B;  4LPI A;  1V5H A;  3ZJN A;  4VHB A;  4O4Z A;  2Z6N B;  1Y2Z B;  1YOH A;  1IRD A;  1FN3 A;  3VRF A;  1HDB A;  3OZV A;  3WI8 A;  4UIQ A;  3WHM A;  3OGB A;  3WCU B;  3PT7 B;  2BLI A;  3DR9 A;  1R1X A;  1S5Y B;  3G4R A;  1JL6 A;  2ZLV B;  1NS6 B;  1HDS B;  3K8B A;  1LFQ B;  5CN4 A;  2Z6T A;  2BWH A;  1U7R A;  2AV3 A;  2MGD A;  1OFK A;  2GKN A;  4H07 A;  2O5O X;  5JDO E;  2V1G A;  2DXM A;  4WCH D;  3BCQ B;  1QXE A;  1MLN A;  1RVW A;  1HDA B;  1UX8 A;  1Y35 B;  3UHV A;  3HYU B;  3VAU A;  3HXN B;  1RPS B;  3R5I B;  2MYE A;  2XKH A;  3D1A A;  3PI8 B;  1LA6 B;  1BVD A;  5M3S A;  2SPO A;  4DWT A;  1O1M A;  5D1V A;  1YE2 A;  2H35 A;  1O1N A;  4HRT A;  2GNW A;  4MXK A;  1YHU D;  1IWH B;  4XS0 A;  3MKB B;  4YU3 A;  4ROM A;  1XZ2 B;  1MNH A;  3G46 A;  1PBX B;  2NX0 A;  3WR1 A;  107M A;  1QSI B;  1YVT B;  1LFY A;  2R4Z A;  2DN1 B;  2LH1 A;  1ECO A;  1QPW A;  3CIU B;  5HLQ A;  1HBA A;  5E29 B;  2R50 A;  1A00 A;  2Z85 A;  5B85 A;  1MCY A;  1CP0 A;  3QQQ A;  1BZ0 A;  3KUO A;  1Y01 B;  4NXA A;  1J7W A;  5HBI A;  5KER B;  4F6J A;  4MQG B;  1MOC A;  1Y85 B;  2BLJ M;  1Y4R A;  1SI4 A;  1EBT A;  2QU0 B;  4L7Y B;  3ZJS A;  3DUT A;  2D5X B;  1J3Y B;  1H97 A;  3BJ2 A;  3P5Q A;  1CQX A;  1YFF B;  3KMF C;  3G4W A;  5CNF A;  2D60 A;  4MBA A;  2DN2 B;  5CNC A;  2GNV A;  4O4T A;  2AUQ A;  1A3N B;  1HGB A;  3OZU A;  1QSH A;  1WMU A;  2KSC A;  2YRS A;  1Y5J A;  3GKT A;  1GLI A;  1XYE B;  2IG3 A;  1JL7 A;  5KDQ B;  1Y46 B;  3UHI A;  2G11 A;  3QM6 A;  1YCB A;  2MHB B;  5EE4 D;  1O1J B;  2QFN A;  2D2M B;  2ZSP A;  3PI2 A;  1DXC A;  2W6Y A;  4QAU A;  2ZLU A;  1Y8K B;  1BZZ B;  5KKK A;  2V1E A;  1Y0W A;  5JGG B;  1HLM A;  4FWY A;  4ROL A;  1GDL A;  1MOH A;  3NL7 A;  3ZJI A;  1DUO A;  3ECX A;  3A5A A;  5JOM A;  1YHU A;  2ZSR A;  1MYG A;  3PIA A;  1MLM A;  2DHB A;  3IC2 B;  5JDO C;  2EVK A;  1G08 A;  3UI0 A;  3H58 A;  1F5P A;  1FSX B;  5EUI A;  2Z8A A;  1JEB A;  3GQR A;  2SPN A;  3GDJ B;  1Y7D B;  1LFL B;  1XZ7 B;  2PGH B;  3UH6 A;  1FSL A;  1Y31 A;  3ZJQ A;  1G0B A;  1YHE B;  3H57 A;  3FS4 A;  2MGM A;  3UHS A;  1G0B B;  1YHE A;  2ZS0 C;  1YIE B;  2V1F A;  2ZLT B;  3EU1 A;  4FWX A;  1LFL A;  4FC3 B;  1Y09 A;  1Y4Q A;  2H8D A;  3WCP B;  1UX9 A;  2HBF A;  5SW7 B;  1OBM A;  1Y8I A;  3GKV A;  1MLK A;  1YDZ B;  1KFR A;  4TWV A;  1LJW A;  4OOD A;  4TYX A;  2D5Z A;  1BZZ A;  1Y8H B;  3ZJJ A;  4TWU A;  5HY8 B;  1YG5 B;  1O1I B;  3QJE B;  1V75 A;  2D2M A;  3UH7 A;  4MXL A;  1O1J A;  1O1O A;  1X9F D;  3HF4 A;  1BBB A;  4O2G A;  1JWN A;  3ASE A;  1G9V B;  3M3B A;  2EKU A;  1WVP A;  3TLD A;  1LH2 A;  1Y0A A;  2D2N A;  3ONZ B;  4JAC A;  2EVP A;  1FAW B;  5CNB A;  3PI9 A;  4KMW A;  4M4A B;  1BZP A;  1Y45 A;  1DM1 A;  1HCO A;  3KUN A;  1QSH B;  1WLA A;  3QQR A;  2ZSX A;  1C7D A;  3A0G B;  1BAB A;  4NXC A;  104M A;  3UH3 A;  1SDL A;  3RJN B;  3WCU D;  1URY A;  1V07 A;  1HGA A;  2AUO A;  4NZI A;  1K0Y A;  4JYQ A;  3NFE B;  1G0A A;  1YG5 A;  5HY8 A;  1DO3 A;  1VXC A;  2BLH A;  2ZWJ A;  1Y0D A;  2HBC B;  2VLZ A;  1LJW B;  1VRE A;  3DHT A;  3ZH0 A;  1YEU A;  1MNJ A;  1S0H A;  2ZFO B;  1X9F B;  5EOH A;  1UFJ A;  1A3O A;  1NQP A;  3WCV B;  2R1H A;  1J7W B;  2R4Y A;  1XQ5 A;  4ODC A;  1MBD A;  3WFT A;  1CIK A;  1CH7 A;  5EYS A;  2H8F A;  1THB B;  2ZT2 A;  1YIE A;  2NRL A;  1CG5 B;  1QSI A;  1G09 B;  1Y0T B;  3FS4 B;  1XZ2 A;  3A5G A;  3OK5 A;  1ITH A;  1IOP A;  4MQH B;  3UHT A;  3BA2 A;  2GTL A;  1C40 A;  2AUP A;  1ECN A;  4HRT B;  2H35 B;  4AVE A;  3LB3 A;  1M9P B;  3OJ1 A;  5C6E A;  2HBS B;  1G08 B;  1N9H A;  1FHJ B;  3R5I A;  2MGE A;  2NSR A;  1CQ2 A;  3PI1 A;  3OVU C;  2HBS A;  1LH6 A;  2MGL A;  3VHB A;  3MYM A;  1AJH A;  2O5B X;  1O16 A;  2ZLU B;  5F2A A;  1LFZ B;  1LFQ A;  4N7P A;  1LH5 A;  2ZLV A;  1XZU B;  2SPL A;  1QI8 A;  3PT7 A;  1G09 A;  4UZV A;  1EBC A;  3ARL A;  5IKS A;  1LFV A;  2R4X A;  3MBA A;  1GZX B;  2HBD A;  5CN5 A;  2VYZ A;  1XY0 B;  4G1V A;  1Y22 B;  1H1X A;  3WCV A;  1Y4B B;  1NQP B;  4FH6 A;  1CG8 B;  2G0V A;  5ILE A;  1YH9 A;  4MAX A;  1YEV B;  2R80 B;  3S65 B;  2DN2 A;  3QZX A;  2QSS B;  1JP8 A;  2SPM A;  5EET A;  5E83 A;  1MWB A;  4MQC B;  1Y4F B;  1MOA A;  2O5T X;  3D1K B;  1V4X B;  3VRE B;  5ILM A;  5E83 B;  4DC7 A;  1F63 A;  1J40 B;  2FRJ X;  3LHB A;  1HGA B;  3UGZ A;  1YMC A;  6HBW A;  1C7D B;  5CN8 A;  1VRF A;  3ODQ A;  3GQG B;  3KMF A;  2B7H B;  1UIW B;  1JPB A;  3ONZ A;  1MYT A;  2RAO A;  1CMY A;  1ECD A;  3TM3 A;  1A6N A;  3HEP A;  2MGF A;  1GJN A;  1ABY B;  1XZU A;  4KJT A;  4F6D A;  4HRR B;  4X0L A;  110M A;  1XZ4 A;  2VRY A;  1MLQ A;  1LFZ A;  2NSS A;  4X0L B;  2IN4 A;  1RQ3 A;  2ZFO D;  2QMB B;  3UHX A;  5AB8 A;  3PI3 A;  108M A;  3UHE A;  3UHZ A;  2EB9 A;  5HU6 A;  1SWM A;  1FDH A;  2BNL A;  3HXN A;  1YDZ A;  2AA1 B;  3OO5 B;  1LTW A;  1DKE B;  1GBV A;  1J7S B;  3EOK A;  2DXM B;  1UC3 A;  4IRO A;  1N9X A;  1PMB A;  3UBC A;  4HSX A;  4MQJ B;  3UHN A;  2HZ1 A;  4YU4 A;  3EU1 B;  4MQH A;  4MU5 A;  1M6C A;  2R4W A;  4DWU A;  1S69 A;  1YE0 B;  3D1K A;  2D6C A;  1HHO B;  3WCU A;  1A0Z A;  1RTX A;  4MQC A;  2PEG B;  1C7B B;  3AQ7 A;  3K3U A;  3A9M A;  2PGH A;  3LB2 A;  1YHR B;  4MPM A;  2V1H A;  1A4F A;  4M4B B;  3GQR B;  1JZL A;  1GBU A;  2R1H B;  1GCV A;  1JEB B;  1DXU A;  1A3O B;  5F0B A;  4B3W A;  1A4F B;  3IC2 A;  3IA3 B;  1X9F A;  1KD2 B;  1X3K A;  1YHR A;  1MWD A;  1UFP A;  4U8U A;  1COH A;  1LFV B;  1C7B A;  3QMA A;  1VWT B;  3WFX A;  1YZI B;  1Y5F A;  102M A;  1G0A B;  1N9I A;  1ABS A;  1YGD B;  2ZSS A;  2LH7 A;  4N7P B;  1IT3 A;  2MGK A;  3G4Q A;  1JP9 A;  4HHB B;  1VXB A;  1GBV B;  1BAB B;  3WCW A;  4G51 B;  1HCO B;  2O58 X;  1J41 B;  2AA1 A;  2AUR A;  1OJ6 A;  2O5M X;  1CH9 A;  1DWS A;  3MJU A;  1OUU B;  3OZW A;  1XZV A;  1MBC A;  1Y0A B;  2D2N B;  2ZT1 A;  1NEJ B;  1TU9 A;  1QXD B;  3WCV D;  1MNK A;  1DTM A;  1OR6 A;  4NK1 A;  2HZ3 A;  5JDO F;  2D60 B;  1Y7C B;  4OF9 A;  1SPG A;  2GRH A;  3M3A A;  3QJC A;  5CN9 A;  1DXT A;  1MYF A;  1FDH G;  1ABY A;  1YFF A;  3P5Q B;  1DLY A;  2D5X A;  1HBB B;  3AQ8 A;  2QU0 A;  1CH3 A;  2D2N C;  1HBG A;  1HGC B;  3GOU A;  2MB5 A;  2XKG A;  4N8T A;  1GDI A;  3WCP A;  2MYD A;  2GRF A;  3D4X B;  3W4U B;  1Y4Q B;  2W72 C;  3UHC A;  1SDK A;  1MYZ A;  1HGC A;  5D5R A;  1Y7G A;  2DN1 A;  1GCW B;  1NZ5 A;  1HBB A;  1BZ1 A;  1R1Y A;  2HBC A;  3S1J A;  2NRM A;  2ZSO A;  1Y31 B;  5CND A;  1MDN A;  3QJC B;  1SHR A;  2E2Y A;  1JDO A;  1HV4 A;  1IWH A;  1MBI A;  2QSS A;  2WY4 A;  1Y7D A;  3MN0 A;  1HLB A;  3WCT A;  1O1N B;  1Z8U B;  1CG8 A;  4GZG A;  1Y4B A;  1JP6 A;  1LA6 A;  1AJ9 B;  1L2K A;  1O1K A;  1Y45 B;  2LH2 A;  1XZV B;  2G12 A;  1AZI A;  1Y7Z A;  112M A;  3PT8 B;  3HYU A;  5HAV A;  4U8U D;  1Y35 A;  1HBI A;  4U8U C;  3A2G A;  1G9V A;  2HHB A;  3BCQ A;  4C44 A;  2HCO A;  3AT6 B;  1MWC A;  4KN3 A;  1BBB B;  1YIH B;  3G4U A;  2MGC A;  1V75 B;  2V1I A;  3ECL A;  2W6W A;  1URV A;  3QM8 A;  1O1I A;  3BJ1 A;  1Y5F B;  1DLW A;  1YIH A;  1YOI A;  3ZOM A;  1UT0 A;  3WHM B;  2G0Z A;  2XKI A;  3GQP A;  3UHU A;  5KDQ A;  1MLU A;  1XYE A;  2OH8 A;  2VEB A;  5C6E B;  2XYK A;  2H8D B;  2HZ2 A;  1DO7 A;  2VEE A;  3UHH A;  1Y09 B;  1T1N B;  1OUT A;  3WCT B;  4M4B A;  2GTL B;  3MJP A;  1SHR B;  3DHR A;  2EKT A;  2WTG A;  2G0R A;  2PEG A;  2AV0 A;  1RSE A;  4DC8 A;  3BJ2 B;  1HHO A;  4O1T A;  2MYB A;  1R1Y B;  1BZ1 B;  2LH6 A;  3IC0 A;  1Y4G A;  3UHB A;  1Y7G B;  3NG6 A;  2LH5 A;  3O89 A;  2H8F B;  1VXF A;  2OHB A;  1A9W E;  2MGH A;  3UGY A;  3GDJ A;  4ODC B;  4ZVA A;  1SDK B;  4NI1 A;  1DKE A;  2W72 A;  3BOM A;  1EMY A;  1BJE A;  1XCH A;  2MGG A;  2V1K A;  1GDK A;  1CH5 A;  1SPE A;  2ZS0 B;  4N8T B;  3B75 A;  3A5B A;  4G1B A;  3OO5 A;  2MGA A;  3GOU B;  1S61 A;  2JHO A;  1NZ4 A;  5HU6 B;  2DN3 A;  1QPW B;  3CIU A;  1MOB A;  3NL7 B;  1LFY B;  2VYY A;  1B86 B;  1Y0W B;  5JGG A;  3WR1 B;  3SZK A;  1MBN A;  2G3H A;  4FWZ A;  1XZ4 B;  2VYW A;  3VRG B;  1S56 A;  1SPG B;  2ZS1 C;  4XDI A;  1X9F C;  109M A;  3ZJR A;  1Y8W B;  1Y4V A;  2ZT3 A;  3A0G A;  1HSY A;  3PI8 A;  2G10 A;  2RAO B;  4L2M A;  3ZOL A;  3MJU B;  1LH1 A;  1UIW A;  4PQC A;  2ZSQ A;  1FAW A;  2MGB A;  1MNO A;  2FAM A;  2YRS B;  3ODQ B;  1WMU B;  5HLU A;  4ZVB A;  6HBW B;  1DXV A;  1A3N A;  5ILR A;  3WCU C;  1KR7 A;  2HBE B;  1O1P A;  1HDS A;  1YGD A;  1HJT A;  1A6K A;  2BKM A;  3ECZ A;  1VXE A;  2RI4 B;  2HBG A;  1COH B;  2ZS0 D;  2QLS B;  3VRF B;  2Z6N A;  1O1L A;  1Y8I B;  1YEV A;  1HBR A;  1YH9 B;  1RQ4 B;  1YOG A;  2EF2 A;  6HBI A;  1DXU B;  1RQA A;  2GTL D;  1Y22 A;  4MQG A;  1CO9 A;  2QSP A;  3WCV C;  1W92 A;  1XY0 A;  3QJD A;  1MNI A;  1YGF B;  1V9Q A;  2HBD B;  1D8U A;  3ARK A;  3MOU A;  1MBO A;  1CO8 A;  2ZLW B;  1A9W A;  1I3E A;  1YVT A;  5AZQ A;  1JF3 A;  1S5X A;  4PNJ A;  105M A;  1DO1 A;  1TES A;  1YE0 A;  4C0N A;  3S66 B;  3A59 B;  1HBH B;  3NMM A;  3UHK A;  1F5O A;  4YU4 B;  4MQJ A;  1YEO B;  4N7O A;  4IRO B;  1HRM A;  4IT8 A;  3EOK B;  3D17 A;  3O7N A;  3NML A;  4BJA A;  3ED9 A;  1LFT B;  3D1A B;  3IXF A;  1CLS B;  1RPS A;  3SDN A;  1CLS A;  2G14 A;  4PQ6 A;  1BUW A;  2GL3 A;  1M9P A;  1YEQ B;  4ROL B;  3D17 B;  1Y8K A;  1C40 B;  1A6G A;  2QMB A;  3ARJ A;  2G0S A;  3AT5 A;  1DXD A;  1MTK A;  1MLJ A;  2BW9 M;  4HRR A;  3S66 A;  5JDO D;  2WTH A;  2MHB A;  5EV5 A;  3WTG A;  1VHB A;  1XZ5 B;  4ESA B;  1BIJ B;  1CG5 A;  1ABW A;  1HDB B;  1MLL A;  5EE4 C;  1AJG A;  3PEL B;  5HLX A;  1IRD B;  1GLI B;  3ORD A;  1XQ5 B;  1HAC B;  4H0B A;  1Y4P A;  2ZT0 A;  2C0K A;  2HHE A;  1V4W A;  2ZFO C;  4HSW A;  1O1L B;  2W6X A;  3GK9 A;  3RGK A;  1S0H B;  3UHW A;  1YEU B;  1CH1 A;  1NS9 B;  1EWA A;  3AQ9 A;  3WFW A;  2OLP A;  3VRE A;  4F68 A;  1NIH B;  1Y0D B;  3WCT D;  1X46 A;  3DUT B;  2ZFB A;  5CNE A;  1LHS A;  1Y4R B;  1YVQ B;  3HRW A;  2GDM A;  3G4V A;  1NWI A;  2D2M D;  2OH9 A;  3RJ6 A;  2HBE A;  3S65 A;  3GLN A;  1CBM A;  1V4W B;  3QZZ A;  1HAC A;  3ZJH A;  1JF4 A;  2VHB A;  1HAB A;  3PI9 B;  1BZ0 B;  1XXT B;  1A00 B;  2LHB A;  1GZX A;  1OFJ A;  3AQ5 A;  1NZ2 A;  3UHD A;  3E5I A;  5ILP A;  3TM9 A;  101M A;  2GLN A;  1ABW B;  1CP5 A;  2OIF A;  1BIJ A;  1Y5K A;  1Y83 A;  1QI8 B;  1U7S A;  1O1O B;  2O5L X;  3D7O A;  1HBS B;  1MLO A;  2ZSZ A;  3VRG A;  4F4O A;  2GKM A;  1Y8H A;  3CY5 B;  1YMA A;  3UH5 A;  2D5Z B;  1B86 A;  1IBE B;  1YEQ A;  1BUW B;  5E6E A;  3E4N A; 
#chains in the Genus database with same CATH topology
 3AQ6 A;  1NPG A;  3HEO A;  1FHJ A;  2FAL A;  3WCW C;  5SW7 A;  1LFT A;  1CH4 A;  3B75 B;  1HDA A;  3LR9 A;  3PI4 A;  5EYJ A;  2UUL C;  2ZLX A;  4NI1 B;  4FC3 A;  2JLG A;  4N7O B;  1YEO A;  1MLS A;  2VM0 A;  3HEN A;  4F6F A;  1HBH A;  3NMM B;  2ZLT A;  3NG6 B;  3M39 A;  3IC0 B;  4A8O A;  2OHA A;  1MLR A;  4N7N B;  3ZJL A;  1YEN A;  3ZJO A;  1S5X B;  1Y0T A;  4F0T A;  2MYA A;  3R0G A;  2HHD B;  4YJJ A;  1THB A;  1NXF A;  3MJP B;  1FN3 B;  1VXG A;  1IRC A;  1J3Z B;  3ZJP A;  3V2V A;  3UBV A;  1Y0C B;  1RQA B;  3ZJM A;  5EUI B;  4RMP A;  3WCT C;  106M A;  3SDH A;  1C7C B;  2DHB B;  3PIA B;  2CMM A;  4O35 A;  2ZFO A;  5EU2 A;  1UVY A;  2QLS A;  3QM9 A;  3UHR A;  3DHT B;  3GQP B;  3G53 A;  1BIN A;  2ZS1 D;  2W6V A;  1IBE A;  2C7J B;  3M38 A;  3HHB B;  1MLF A;  3NFE A;  3G52 A;  3GYS B;  1K0Y B;  1HBS A;  1S6A A;  4ILZ A;  1O1P B;  3BRP B;  1I3D A;  4H2L B;  1FCS A;  5CN7 A;  1YHU C;  2M6Z A;  1VXH A;  2HCO B;  3AT6 A;  1SDL B;  2HHB B;  3S1I A;  1A0U A;  3MVC A;  3OO4 A;  1Y46 A;  2QFK A;  4KMV A;  3LQD B;  1NGK A;  2MYC A;  1CBL A;  4M4A A;  2MGJ A;  1ASH A;  1Y7Z B;  3PT8 A;  1IDR A;  1A6M A;  2QRW A;  4HH1 A;  4NI0 B;  3LQD A;  2JLF A;  1HGB B;  1Y4V B;  1UVM A;  1Q1F A;  2VLY A;  2M6Z B;  1MKO B;  3FH9 A;  3HF4 B;  3S48 C;  4H2L A;  3WFU A;  3LR7 A;  1I7Y B;  3QJE A;  4HBI A;  1YVQ A;  2G0X A;  1HI0 P;  2FRI X;  3BJ3 A;  3HHB A;  1V4U B;  1J3Y A;  3K9Z A;  4N6S A;  3O2C A;  2UUN A;  1GCW A;  4Q70 A;  2DN3 B;  3AG0 A;  2ZT4 A;  1NWN A;  3E55 A;  3QM7 A;  3GKV B;  2HHE B;  4MBN A;  2HBF B;  1Y4P B;  1MYI A;  4MQK A;  2ZS1 B;  2W72 B;  3BOM B;  1Y0C A;  103M A;  1K1K B;  1DWR A;  1RH1 A;  3PEL A;  1HBA B;  5E29 A;  1MTJ A;  2HHD A;  1YMB A;  5MBN A;  7HBI A;  4MQI A;  2VLX A;  1YEN B;  1V4U A;  3WTG B;  1MYM A;  3BJ3 B;  1CPW A;  1PBX A;  1DXT B;  2VJT B;  4WJG 1;  1MOD A;  4ROM B;  3U3E A;  1XZ7 A;  1MLH A;  1UVN A;  3AT5 B;  1M6M A;  1T1N A;  2ZLX B;  1FSX A;  1CH2 A;  1NEJ A;  1OUU A;  1NAZ A;  1YHU B;  4F6B A;  1YCA A;  2V1J A;  1MBS A;  2MGI A;  4F6I A;  111M A;  1OR4 A;  3OO4 B;  3WCW B;  1A0U B;  2FRK X;  2DC3 A;  1JZM A;  1DTI A;  4NK2 A;  1IT2 A;  3CY5 A;  1J7Y A;  1MYH A;  4ESU A;  3BJ1 B;  3MWN A;  3QM5 A;  5MBA A;  1MYJ A;  3GYS A;  1JW8 A;  2ZSY A;  3D7O B;  4AVD A;  1LH7 A;  1DUK A;  1J7Y B;  1VXA A;  1Y5K B;  1Y83 B;  3UHG A;  1DWT A;  2ZLW A;  1BZR A;  4H0M B;  1KD2 A;  1YGF A;  3QJD B;  1Y5J B;  1O1K B;  1ECA A;  1JZK A;  3G4Y A;  2ZST A;  1AJ9 A;  1CIO A;  3L0F A;  3V2Z A;  1J3F A;  1RQ4 A;  1MGN A;  1J3Z A;  1J52 A;  1A01 B;  1NZ3 A;  4F69 A;  1HV4 B;  5C6Y A;  5B84 A;  2RI4 A;  1MLG A;  5CN6 A;  3QJB B;  1A0Z B;  2UUM X;  4MQI B;  4L7Y A;  2MBW A;  4N7N A;  4NS2 A;  1NS9 A;  1SI4 B;  2GTL C;  3EDA A;  2BK9 A;  1LUE A;  1NPF A;  2YSK A;  5AZR A;  1Y85 A;  5EQM A;  3UHQ A;  1K1K A;  1J7S A;  1RTE A;  1DXV B;  1LHT A;  2D2N D;  3D4X A;  2ZS1 A;  3W4U A;  2ZSN A;  4MQK B;  4GXE A;  3ZHW A;  1UVL A;  5KER A;  2D2M C;  1F65 A;  2GRZ A;  1BZ6 A;  2BMM A;  2LH3 A;  5E6E B;  4Q70 B;  1MBA A;  4A8F A;  3O2C B;  4ETU A;  2Z6S A;  3LB1 A;  1Y8W A;  1JY7 B;  1BVC A;  4ESA A;  1XZ5 A;  1RQ3 B;  4AE0 A;  3LB4 A;  4HH0 A;  4F4O B;  3MKB A;  4XS0 B;  4YU3 B;  4SDH A;  2I88 A;  1Y7C A;  3HC9 A;  5CMV A;  3SZK B;  1MTI A;  1MKO A;  3FH9 B;  5CNG A;  1JY7 A;  1YE2 B;  4WJG A;  1O1M B;  1DO4 A;  1QXD A;  1CMY B;  4NI0 A;  3E5O A;  4FH7 A;  1XXT A;  2B7H A;  1J41 A;  1HAB B;  1N9F A;  2O5Q X;  1B0B A;  3GQG A;  4F6G A;  2ZS0 A;  4G51 A;  4PQB A;  3ZTA A;  1RVW B;  1QXE B;  1UMO A;  2W31 A;  4HHB A;  1LH3 A;  1HI1 A;  1CPC B;  5CHQ A;  1MZ0 A;  1J40 A;  3K8B B;  1DDT A;  3HRW B;  1UVX A;  1NS6 A;  3A59 A;  1Y4G B;  2O5S X;  1S5Y A;  1V4X A;  2ZFB B;  1R1X B;  1YZI A;  4UUR A;  1HHT P;  2C7J A;  1Y4F A;  1VWT A;  1NIH A;  1VXD A;  2W6V B;  3QJB A;  3UHY A;  2FRF A;  1EW6 A;  1FLP A;  3DHR B;  1GVH A;  4F0U B;  3EDB A;  4U8U B;  1Y2Z A;  2EB8 A;  1A01 A;  3MYN A;  3WCW D;  2R80 A;  4B4Y A;  1C7C A;  1OUT B;  1GDJ A;  2QSP B;  3L0F B;  1GCV B;  1GBU B;  5CHR A;  1HBR B;  4LPI A;  1V5H A;  3ZJN A;  4VHB A;  4O4Z A;  2Z6N B;  1Y2Z B;  1YOH A;  1IRD A;  1FN3 A;  3VRF A;  4F0T B;  1HDB A;  3OZV A;  3WI8 A;  1HI8 A;  4UIQ A;  3WHM A;  3OGB A;  3WCU B;  3PT7 B;  2BLI A;  3DR9 A;  1R1X A;  1S5Y B;  3G4R A;  1JL6 A;  2ZLV B;  1NS6 B;  1HDS B;  5AQD M;  3K8B A;  1LFQ B;  3V57 B;  5CN4 A;  2Z6T A;  2BWH A;  1U7R A;  2AV3 A;  2MGD A;  1OFK A;  2GKN A;  4H07 A;  2O5O X;  5JDO E;  2V1G A;  2DXM A;  4WCH D;  3BCQ B;  1QXE A;  1MLN A;  1RVW A;  1HDA B;  1UX8 A;  1Y35 B;  3UHV A;  2UUL D;  2DKD A;  3HYU B;  3VAU A;  3HXN B;  1RPS B;  3R5I B;  2MYE A;  2XKH A;  3D1A A;  3PI8 B;  1LA6 B;  1BVD A;  5M3S A;  2SPO A;  4DWT A;  1O1M A;  3RQR A;  4LM6 B;  5D1V A;  1YE2 A;  2VML B;  2H35 A;  4Z8K B;  1O1N A;  4HRT A;  4ZIZ B;  2GNW A;  4MXK A;  1YHU D;  1PHN A;  1IWH B;  4XS0 A;  3MKB B;  4YU3 A;  4ROM A;  1XZ2 B;  1MNH A;  3G46 A;  1PBX B;  2NX0 A;  3WR1 A;  107M A;  1QSI B;  1YVT B;  1LFY A;  2R4Z A;  2DN1 B;  2LH1 A;  1ECO A;  1QPW A;  3CIU B;  5HLQ A;  1HBA A;  5E29 B;  2R50 A;  1A00 A;  2Z85 A;  5B85 A;  1MCY A;  1CP0 A;  4ETT A;  3QQQ A;  1BZ0 A;  3KUO A;  1Y01 B;  4NXA A;  1J7W A;  5HBI A;  5KER B;  4F6J A;  4MQG B;  1MOC A;  1Y85 B;  2BLJ M;  1A87 A;  1Y4R A;  1TOX A;  1SI4 A;  1EBT A;  2QU0 B;  2UUN B;  4L7Y B;  3ZJS A;  3DUT A;  2D5X B;  1J3Y B;  1H97 A;  3BJ2 A;  3P5Q A;  1CQX A;  1YFF B;  3KMF C;  3G4W A;  5CNF A;  2D60 A;  4MBA A;  2DN2 B;  2V8A A;  2GNV A;  5CNC A;  4O4T A;  2AUQ A;  1A3N B;  1HGB A;  3OZU A;  1QSH A;  1WMU A;  1KN1 A;  2KSC A;  2YRS A;  1ALL B;  1Y5J A;  4BS9 A;  4LMS B;  3GKT A;  1GLI A;  1XYE B;  2IG3 A;  1JL7 A;  5KDQ B;  1UVI A;  1Y46 B;  3UHI A;  2G11 A;  3QM6 A;  1YCB A;  2MHB B;  5EE4 D;  1O1J B;  2QFN A;  2D2M B;  3O18 B;  2ZSP A;  3PI2 A;  1DXC A;  2W6Y A;  4QAU A;  2ZLU A;  1Y8K B;  1BZZ B;  4GY3 B;  4BJU A;  5KKK A;  2V1E A;  1XF6 C;  1Y0W A;  5JGG B;  1HLM A;  4FWY A;  4ROL A;  1GDL A;  1MOH A;  3NL7 A;  3ZJI A;  1DUO A;  3ECX A;  3A5A A;  5JOM A;  1YHU A;  2ZSR A;  1MYG A;  3PIA A;  1MLM A;  2DHB A;  3IC2 B;  5JDO C;  2EVK A;  1G08 A;  3UI0 A;  3H58 A;  1F5P A;  1FSX B;  5EUI A;  2Z8A A;  1JEB A;  2UUL B;  3GQR A;  2SPN A;  3GDJ B;  1Y7D B;  1LFL B;  1XZ7 B;  2PGH B;  3UH6 A;  1F99 B;  1FSL A;  1Y31 A;  3ZJQ A;  1G0B A;  1YHE B;  3H57 A;  3FS4 A;  2MGM A;  3UHS A;  1G0B B;  1YHE A;  2ZS0 C;  1YIE B;  2V1F A;  2ZLT B;  3EU1 A;  4FWX A;  1LFL A;  4FC3 B;  1Y09 A;  1Y4Q A;  2H8D A;  3WCP B;  1UX9 A;  2HBF A;  5SW7 B;  1OBM A;  1Y8I A;  3GKV A;  1MLK A;  1YDZ B;  1KFR A;  4TWV A;  1LJW A;  4OOD A;  4TYX A;  2D5Z A;  1BZZ A;  1Y8H B;  3ZJJ A;  4TWU A;  5HY8 B;  2BV8 B;  1YG5 B;  1O1I B;  3QJE B;  1V75 A;  2D2M A;  3O18 A;  3UH7 A;  4MXL A;  1O1J A;  5B13 A;  1O1O A;  4A8M P;  1X9F D;  3HF4 A;  1BBB A;  4O2G A;  1JWN A;  3ASE A;  1G9V B;  3M3B A;  2EKU A;  1WVP A;  1LH2 A;  3TLD A;  1Y0A A;  2D2N A;  3ONZ B;  4JAC A;  2EVP A;  1FAW B;  5CNB A;  3PI9 A;  4KMW A;  4M4A B;  1BZP A;  1ALL A;  1Y45 A;  1DM1 A;  1HCO A;  3KUN A;  1QSH B;  3VNC A;  1WLA A;  3QQR A;  1WAC A;  2ZSX A;  1C7D A;  3A0G B;  1BAB A;  4NXC A;  104M A;  3UH3 A;  1SDL A;  3RJN B;  3WCU D;  1B8D B;  1URY A;  1V07 A;  1HGA A;  2AUO A;  4NZI A;  1K0Y A;  4JYQ A;  3NFE B;  1G0A A;  1YG5 A;  5HY8 A;  1DO3 A;  1VXC A;  2BLH A;  2ZWJ A;  1Y0D A;  2HBC B;  2VLZ A;  1LJW B;  1VRE A;  3DBJ A;  3DHT A;  3ZH0 A;  1YEU A;  2C7L B;  1MNJ A;  1S0H A;  2ZFO B;  1X9F B;  5B13 G;  5EOH A;  1UVJ A;  1UFJ A;  1A3O A;  1NQP A;  3WCV B;  3V58 B;  2R1H A;  1J7W B;  2R4Y A;  1XQ5 A;  4ODC A;  3FEW X;  1MBD A;  3WFT A;  1CIK A;  1CH7 A;  5EYS A;  2H8F A;  1THB B;  2X4A A;  2ZT2 A;  1YIE A;  2NRL A;  1CG5 B;  1QSI A;  1G09 B;  1Y0T B;  3FS4 B;  2JL9 A;  1XZ2 A;  3A5G A;  3OK5 A;  1ITH A;  1IOP A;  4MQH B;  3UHT A;  3BA2 A;  2GTL A;  1C40 A;  2AUP A;  1ECN A;  4HRT B;  2H35 B;  4AVE A;  2VML A;  3LB3 A;  1M9P B;  3OJ1 A;  5C6E A;  2HBS B;  1G08 B;  1N9H A;  1FHJ B;  3R5I A;  2MGE A;  2NSR A;  1CQ2 A;  3PI1 A;  1UVK A;  3OVU C;  2HBS A;  1LH6 A;  2MGL A;  3VHB A;  3MYM A;  1AJH A;  2O5B X;  1O16 A;  2ZLU B;  5F2A A;  1ON7 B;  1LFZ B;  1LFQ A;  3V57 A;  1NY9 A;  4N7P A;  1CII A;  1LH5 A;  2ZLV A;  1XZU B;  2SPL A;  1QI8 A;  3PT7 A;  1G09 A;  4UZV A;  1EBC A;  3ARL A;  1LIA A;  5IKS A;  1LFV A;  2R4X A;  3MBA A;  1GZX B;  2HBD A;  5CN5 A;  2VYZ A;  1XY0 B;  4G1V A;  1KN1 B;  1Y22 B;  1H1X A;  3WCV A;  1Y4B B;  1NQP B;  4FH6 A;  1CG8 B;  2G0V A;  5ILE A;  4ETV A;  1YH9 A;  4MAX A;  1YEV B;  2R80 B;  3S65 B;  2DN2 A;  3QZX A;  2QSS B;  1JP8 A;  2UUM A;  3DBJ B;  2SPM A;  2C7K A;  5EET A;  5E83 A;  1GH0 A;  1MWB A;  4MQC B;  1Y4F B;  1MOA A;  2O5T X;  3D1K B;  1V4X B;  3VRE B;  5ILM A;  5E83 B;  4DC7 A;  1F63 A;  1J40 B;  2FRJ X;  1CPC A;  3LHB A;  1HGA B;  3UGZ A;  1YMC A;  6HBW A;  1C7D B;  5CN8 A;  1VRF A;  3ODQ A;  3GQG B;  3KMF A;  2B7H B;  1KTP A;  1UIW B;  1JPB A;  3ONZ A;  1MYT A;  2RAO A;  1CMY A;  1ECD A;  3TM3 A;  1A6N A;  3HEP A;  2VJH B;  2MGF A;  3PMD A;  1GJN A;  1ABY B;  2UUL H;  1XZU A;  4KJT A;  4F6D A;  4HRR B;  4X0L A;  110M A;  1XZ4 A;  2UUN D;  2VRY A;  1MLQ A;  1LFZ A;  2NSS A;  4X0L B;  1PHN B;  2IN4 A;  1RQ3 A;  2ZFO D;  2QMB B;  3UHX A;  5AB8 A;  3PI3 A;  108M A;  3UHE A;  3UHZ A;  2EB9 A;  5HU6 A;  1SWM A;  1FDH A;  2BNL A;  3HXN A;  1KTP B;  1YDZ A;  2AA1 B;  3OO5 B;  1LTW A;  1SGK A;  1DKE B;  3GUQ A;  1GBV A;  1J7S B;  2DKA A;  3EOK A;  2DXM B;  1UC3 A;  4IRO A;  1N9X A;  1PMB A;  3UBC A;  4HSX A;  4MQJ B;  3UHN A;  2HZ1 A;  4YU4 A;  3EU1 B;  4MQH A;  4MU5 A;  1M6C A;  2R4W A;  4DWU A;  1S69 A;  1YE0 B;  4A8Y A;  3D1K A;  2D6C A;  1HHO B;  3WCU A;  1A0Z A;  1RTX A;  4MQC A;  2PEG B;  1C7B B;  3AQ7 A;  3K3U A;  3A9M A;  2PGH A;  3LB2 A;  1YHR B;  4MPM A;  2V1H A;  1A4F A;  4M4B B;  3GQR B;  1JZL A;  1GBU A;  2R1H B;  3V58 A;  1GCV A;  1JEB B;  1DXU A;  1A3O B;  5F0B A;  5AQD A;  4B3W A;  1A4F B;  3IC2 A;  3IA3 B;  1X9F A;  1KD2 B;  1X3K A;  1YHR A;  1MWD A;  1UFP A;  1MDT A;  4U8U A;  1COH A;  1LFV B;  1C7B A;  3QMA A;  1VWT B;  3GIO A;  3WFX A;  1YZI B;  1Y5F A;  102M A;  1G0A B;  1N9I A;  1ABS A;  1YGD B;  2ZSS A;  2LH7 A;  4N7P B;  1IT3 A;  2MGK A;  3G4Q A;  1JP9 A;  4HHB B;  1VXB A;  1GBV B;  1BAB B;  3WCW A;  3PMC A;  4G51 B;  1HCO B;  2O58 X;  1J41 B;  2AA1 A;  2AUR A;  1OJ6 A;  2O5M X;  1CH9 A;  1DWS A;  3MJU A;  1OUU B;  3OZW A;  1XZV A;  1MBC A;  1Y0A B;  2D2N B;  2ZT1 A;  1NEJ B;  1TU9 A;  1QXD B;  2WCQ A;  3WCV D;  1MNK A;  1DTM A;  1OR6 A;  4NK1 A;  2HZ3 A;  5JDO F;  2D60 B;  1Y7C B;  4OF9 A;  1SPG A;  2GRH A;  3M3A A;  3QJC A;  2VJT A;  5CN9 A;  1DXT A;  1MYF A;  1FDH G;  1ABY A;  1YFF A;  3P5Q B;  1DLY A;  2D5X A;  1HBB B;  1XDT T;  3AQ8 A;  2QU0 A;  1CH3 A;  2D2N C;  1HBG A;  1HGC B;  3GOU A;  1QGW C;  2MB5 A;  2XKG A;  4N8T A;  1GDI A;  3WCP A;  2MYD A;  2GRF A;  3D4X B;  3W4U B;  1Y4Q B;  2W72 C;  3UHC A;  1SDK A;  1MYZ A;  1HGC A;  5D5R A;  1Y7G A;  2DN1 A;  1GCW B;  4A8W A;  1NZ5 A;  1HBB A;  4N6S B;  1BZ1 A;  1R1Y A;  2HBC A;  3S1J A;  2NRM A;  2ZSO A;  1Y31 B;  5CND A;  1MDN A;  3QJC B;  1SHR A;  2E2Y A;  1JDO A;  1HV4 A;  1IWH A;  1MBI A;  2QSS A;  2WY4 A;  1JBO A;  1Y7D A;  3MN0 A;  1HLB A;  3WCT A;  1O1N B;  1Z8U B;  1CG8 A;  4GZG A;  1Y4B A;  1JP6 A;  1LA6 A;  1AJ9 B;  1L2K A;  1O1K A;  1Y45 B;  2LH2 A;  1XZV B;  2G12 A;  1AZI A;  1Y7Z A;  112M A;  3PT8 B;  3HYU A;  5HAV A;  4ERV A;  4U8U D;  4H0M A;  1Y35 A;  1HBI A;  1EYX A;  4U8U C;  1LIA B;  3A2G A;  1G9V A;  2HHB A;  3NUH B;  3BCQ A;  4C44 A;  2HCO A;  3AT6 B;  1MWC A;  4KN3 A;  1BBB B;  1YIH B;  3G4U A;  3BRP A;  2MGC A;  1V75 B;  2V1I A;  3ECL A;  2W6W A;  1URV A;  3QM8 A;  1O1I A;  3BJ1 A;  1Y5F B;  4A8S A;  1DLW A;  1YIH A;  1YOI A;  3ZOM A;  1UT0 A;  1HHS A;  3WHM B;  4AE1 A;  2G0Z A;  1EYX B;  2XKI A;  3GQP A;  3UHU A;  5KDQ A;  1MLU A;  1XYE A;  2OH8 A;  2VEB A;  5C6E B;  2XYK A;  2H8D B;  2HZ2 A;  1DO7 A;  2VEE A;  3UHH A;  1Y09 B;  1T1N B;  1OUT A;  3WCT B;  4M4B A;  2GTL B;  1JBO B;  3MJP A;  1SHR B;  4F0U A;  3DHR A;  2EKT A;  2WTG A;  2G0R A;  2PEG A;  2AV0 A;  1RSE A;  4DC8 A;  3BJ2 B;  1HHO A;  4O1T A;  2MYB A;  4B02 A;  1R1Y B;  1BZ1 B;  2LH6 A;  1F0L A;  3IC0 A;  1Y4G A;  3UHB A;  1Y7G B;  3NG6 A;  2LH5 A;  3O89 A;  2H8F B;  1VXF A;  2OHB A;  1A9W E;  4ERT A;  2MGH A;  3UGY A;  3GDJ A;  4ODC B;  4ZVA A;  1SDK B;  2UUL A;  4NI1 A;  1DKE A;  2W72 A;  3BOM A;  1EMY A;  1BJE A;  1XCH A;  2MGG A;  2V1K A;  1GDK A;  1CH5 A;  1SPE A;  2ZS0 B;  4N8T B;  3B75 A;  3A5B A;  4G1B A;  3OO5 A;  2MGA A;  3GOU B;  1S61 A;  2JHO A;  2C7L A;  1NZ4 A;  5HU6 B;  2DN3 A;  1QPW B;  3CIU A;  1MOB A;  3NL7 B;  1LFY B;  2VYY A;  1B86 B;  1Y0W B;  5JGG A;  3WR1 B;  3SZK A;  1MBN A;  1XG0 C;  2G3H A;  4FWZ A;  1XZ4 B;  2VYW A;  3VRG B;  1S56 A;  1SPG B;  1I7Y A;  2ZS1 C;  4XDI A;  4XXK A;  1X9F C;  1B8D A;  109M A;  3ZJR A;  1Y8W B;  2VJH A;  1Y4V A;  2ZT3 A;  3A0G A;  1HSY A;  3PI8 A;  2G10 A;  2RAO B;  4L2M A;  3ZOL A;  3MJU B;  2WCR A;  1LH1 A;  1UIW A;  4PQC A;  2ZSQ A;  1FAW A;  2MGB A;  1MNO A;  2FAM A;  2YRS B;  3ODQ B;  1WMU B;  5HLU A;  4GXE B;  4TMA B;  4ZVB A;  6HBW B;  1DXV A;  1A3N A;  5ILR A;  3WCU C;  1KR7 A;  2HBE B;  1O1P A;  1HDS A;  1YGD A;  4XXI A;  1HJT A;  2J96 A;  1A6K A;  1GH0 B;  2BKM A;  2VJR A;  3ECZ A;  1VXE A;  2RI4 B;  2C7K B;  2HBG A;  1COH B;  2ZS0 D;  2QLS B;  3VRF B;  3KVS B;  2Z6N A;  1O1L A;  1Y8I B;  1YEV A;  1HBR A;  1YH9 B;  1RQ4 B;  1YOG A;  2EF2 A;  6HBI A;  4RMP B;  1DXU B;  1RQA A;  2GTL D;  1Y22 A;  4MQG A;  1CO9 A;  2QSP A;  3WCV C;  1W92 A;  1XY0 A;  3QJD A;  1MNI A;  1YGF B;  1V9Q A;  2HBD B;  1D8U A;  3ARK A;  3MOU A;  1MBO A;  4YJJ B;  1CO8 A;  2ZLW B;  1A9W A;  1I3E A;  1YVT A;  5AZQ A;  1B33 B;  1JF3 A;  1S5X A;  4PNJ A;  105M A;  1DO1 A;  1TES A;  3LQ9 A;  1YE0 A;  4C0N A;  1F99 A;  3S66 B;  2X49 A;  3A59 B;  1HBH B;  3NMM A;  3UHK A;  1F5O A;  4YU4 B;  4MQJ A;  1YEO B;  4N7O A;  4IRO B;  1HRM A;  4IT8 A;  1ON7 A;  4ZIZ A;  3EOK B;  3D17 A;  3O7N A;  3NML A;  4BJA A;  3ED9 A;  1LFT B;  3D1A B;  3IXF A;  1CLS B;  1RPS A;  4A8Q A;  3SDN A;  1CLS A;  2G14 A;  4PQ6 A;  1BUW A;  2GL3 A;  1M9P A;  1YEQ B;  4ROL B;  2DKC A;  4GY3 A;  3D17 B;  1Y8K A;  1C40 B;  1A6G A;  1HA7 B;  2QMB A;  3ARJ A;  1COL A;  2G0S A;  3AT5 A;  1DXD A;  1MTK A;  1MLJ A;  2BW9 M;  4HRR A;  3S66 A;  5JDO D;  2WTH A;  2MHB A;  5EV5 A;  3WTG A;  5FVB A;  1VHB A;  1XZ5 B;  4ESA B;  1BIJ B;  1B33 A;  1CG5 A;  1ABW A;  1HDB B;  1MLL A;  5EE4 C;  1AJG A;  3PEL B;  5HLX A;  1IRD B;  1GLI B;  3ORD A;  1XQ5 B;  1HAC B;  4H0B A;  4PO5 A;  1Y4P A;  2ZT0 A;  2C0K A;  2HHE A;  4L1E A;  1V4W A;  2ZFO C;  4HSW A;  1O1L B;  2V8A B;  2W6X A;  3GK9 A;  3RGK A;  3KVS A;  1S0H B;  3UHW A;  1YEU B;  4LMX B;  1CH1 A;  1NS9 B;  1EWA A;  3AQ9 A;  3WFW A;  2VJR B;  2OLP A;  3VRE A;  4F68 A;  1NIH B;  1Y0D B;  3WCT D;  1X46 A;  3DUT B;  2ZFB A;  1LHS A;  5CNE A;  1Y4R B;  1YVQ B;  3HRW A;  2UUM B;  2GDM A;  3G4V A;  1NWI A;  2D2M D;  2OH9 A;  3RJ6 A;  2HBE A;  3S65 A;  3GLN A;  1CBM A;  1V4W B;  4L1E B;  4PO5 B;  3QZZ A;  1HAC A;  3ZJH A;  1JF4 A;  2VHB A;  1HAB A;  3PI9 B;  1BZ0 B;  1XXT B;  1A00 B;  2LHB A;  1GZX A;  1OFJ A;  3AQ5 A;  1NZ2 A;  3UHD A;  3E5I A;  5ILP A;  3TM9 A;  101M A;  2GLN A;  5FVB M;  1ABW B;  1CP5 A;  2OIF A;  1BIJ A;  1Y5K A;  1Y83 A;  1QI8 B;  1U7S A;  1O1O B;  2O5L X;  3D7O A;  1HBS B;  1MLO A;  2ZSZ A;  3VRG A;  4F4O A;  2GKM A;  2BV8 A;  1HA7 A;  1Y8H A;  3CY5 B;  1YMA A;  4Z8K A;  3UH5 A;  4A8K A;  2D5Z B;  1B86 A;  1IBE B;  1YEQ A;  1BUW B;  5E6E A;  3E4N A; 
#chains in the Genus database with same CATH homology
 3AQ6 A;  1NPG A;  3HEO A;  1FHJ A;  2FAL A;  3WCW C;  5SW7 A;  1LFT A;  1CH4 A;  3B75 B;  1HDA A;  3LR9 A;  3PI4 A;  5EYJ A;  2ZLX A;  4NI1 B;  4FC3 A;  4N7O B;  1YEO A;  1MLS A;  2VM0 A;  3HEN A;  4F6F A;  1HBH A;  3NMM B;  2ZLT A;  3NG6 B;  3M39 A;  3IC0 B;  2OHA A;  1MLR A;  4N7N B;  3ZJL A;  1YEN A;  3ZJO A;  1S5X B;  1Y0T A;  2MYA A;  3R0G A;  2HHD B;  1THB A;  1NXF A;  3MJP B;  1FN3 B;  1VXG A;  1IRC A;  1J3Z B;  3ZJP A;  3V2V A;  3UBV A;  1Y0C B;  1RQA B;  3ZJM A;  5EUI B;  3WCT C;  106M A;  3SDH A;  1C7C B;  2DHB B;  3PIA B;  2CMM A;  4O35 A;  2ZFO A;  5EU2 A;  1UVY A;  2QLS A;  3QM9 A;  3UHR A;  3DHT B;  3GQP B;  3G53 A;  1BIN A;  2ZS1 D;  2W6V A;  1IBE A;  3M38 A;  3HHB B;  1MLF A;  3NFE A;  3G52 A;  3GYS B;  1K0Y B;  1HBS A;  1S6A A;  4ILZ A;  1O1P B;  1I3D A;  4H2L B;  1FCS A;  5CN7 A;  1YHU C;  2M6Z A;  1VXH A;  2HCO B;  3AT6 A;  1SDL B;  2HHB B;  3S1I A;  1A0U A;  3MVC A;  3OO4 A;  1Y46 A;  2QFK A;  4KMV A;  3LQD B;  1NGK A;  2MYC A;  1CBL A;  4M4A A;  2MGJ A;  1ASH A;  1Y7Z B;  3PT8 A;  1IDR A;  1A6M A;  2QRW A;  4NI0 B;  3LQD A;  1HGB B;  1Y4V B;  1Q1F A;  2VLY A;  2M6Z B;  1MKO B;  3FH9 A;  3HF4 B;  3S48 C;  4H2L A;  3WFU A;  3LR7 A;  3QJE A;  4HBI A;  1YVQ A;  2G0X A;  2FRI X;  3BJ3 A;  3HHB A;  1V4U B;  1J3Y A;  3K9Z A;  1GCW A;  2DN3 B;  3AG0 A;  2ZT4 A;  1NWN A;  3E55 A;  3QM7 A;  3GKV B;  2HHE B;  4MBN A;  2HBF B;  1Y4P B;  1MYI A;  4MQK A;  2ZS1 B;  2W72 B;  3BOM B;  1Y0C A;  103M A;  1K1K B;  1DWR A;  3PEL A;  1HBA B;  5E29 A;  1MTJ A;  2HHD A;  1YMB A;  5MBN A;  7HBI A;  4MQI A;  2VLX A;  1YEN B;  1V4U A;  3WTG B;  1MYM A;  3BJ3 B;  1CPW A;  1PBX A;  1DXT B;  4WJG 1;  1MOD A;  4ROM B;  3U3E A;  1XZ7 A;  1MLH A;  3AT5 B;  1M6M A;  1T1N A;  2ZLX B;  1FSX A;  1CH2 A;  1NEJ A;  1OUU A;  1NAZ A;  1YHU B;  4F6B A;  1YCA A;  2V1J A;  1MBS A;  2MGI A;  4F6I A;  111M A;  1OR4 A;  3OO4 B;  3WCW B;  1A0U B;  2FRK X;  2DC3 A;  1JZM A;  1DTI A;  4NK2 A;  1IT2 A;  3CY5 A;  1J7Y A;  1MYH A;  3BJ1 B;  3QM5 A;  5MBA A;  1MYJ A;  3GYS A;  1JW8 A;  2ZSY A;  3D7O B;  4AVD A;  1LH7 A;  1DUK A;  1J7Y B;  1VXA A;  1Y5K B;  1Y83 B;  3UHG A;  1DWT A;  2ZLW A;  1BZR A;  1KD2 A;  1YGF A;  3QJD B;  1Y5J B;  1O1K B;  1ECA A;  1JZK A;  3G4Y A;  2ZST A;  1AJ9 A;  1CIO A;  3V2Z A;  1J3F A;  1RQ4 A;  1MGN A;  1J3Z A;  1J52 A;  1A01 B;  1NZ3 A;  4F69 A;  1HV4 B;  5C6Y A;  5B84 A;  2RI4 A;  1MLG A;  5CN6 A;  3QJB B;  1A0Z B;  4MQI B;  4L7Y A;  2MBW A;  4N7N A;  4NS2 A;  1NS9 A;  1SI4 B;  2GTL C;  3EDA A;  2BK9 A;  1LUE A;  1NPF A;  5AZR A;  1Y85 A;  5EQM A;  3UHQ A;  1K1K A;  1J7S A;  1RTE A;  1DXV B;  1LHT A;  2D2N D;  3D4X A;  2ZS1 A;  3W4U A;  2ZSN A;  4MQK B;  3ZHW A;  5KER A;  2D2M C;  1F65 A;  2GRZ A;  1BZ6 A;  2BMM A;  2LH3 A;  5E6E B;  1MBA A;  2Z6S A;  3LB1 A;  1Y8W A;  1JY7 B;  1BVC A;  4ESA A;  1XZ5 A;  1RQ3 B;  3LB4 A;  4F4O B;  3MKB A;  4XS0 B;  4YU3 B;  4SDH A;  1Y7C A;  3HC9 A;  5CMV A;  3SZK B;  1MTI A;  1MKO A;  3FH9 B;  5CNG A;  1JY7 A;  1YE2 B;  4WJG A;  1O1M B;  1DO4 A;  1QXD A;  1CMY B;  4NI0 A;  3E5O A;  4FH7 A;  1XXT A;  2B7H A;  1J41 A;  1HAB B;  1N9F A;  2O5Q X;  1B0B A;  3GQG A;  4F6G A;  2ZS0 A;  4G51 A;  4PQB A;  1RVW B;  1QXE B;  1UMO A;  2W31 A;  4HHB A;  1LH3 A;  5CHQ A;  1MZ0 A;  1J40 A;  3K8B B;  3HRW B;  1UVX A;  1NS6 A;  3A59 A;  1Y4G B;  2O5S X;  1S5Y A;  1V4X A;  2ZFB B;  1R1X B;  1YZI A;  4UUR A;  1Y4F A;  1VWT A;  1NIH A;  1VXD A;  2W6V B;  3QJB A;  3UHY A;  2FRF A;  1EW6 A;  1FLP A;  3DHR B;  1GVH A;  3EDB A;  4U8U B;  1Y2Z A;  2EB8 A;  1A01 A;  3MYN A;  3WCW D;  2R80 A;  4B4Y A;  1C7C A;  1OUT B;  1GDJ A;  2QSP B;  1GCV B;  1GBU B;  5CHR A;  1HBR B;  4LPI A;  1V5H A;  3ZJN A;  4VHB A;  4O4Z A;  2Z6N B;  1Y2Z B;  1YOH A;  1IRD A;  1FN3 A;  3VRF A;  1HDB A;  3OZV A;  3WI8 A;  4UIQ A;  3WHM A;  3OGB A;  3WCU B;  3PT7 B;  2BLI A;  3DR9 A;  1R1X A;  1S5Y B;  3G4R A;  1JL6 A;  2ZLV B;  1NS6 B;  1HDS B;  3K8B A;  1LFQ B;  5CN4 A;  2Z6T A;  2BWH A;  1U7R A;  2AV3 A;  2MGD A;  1OFK A;  2GKN A;  4H07 A;  2O5O X;  5JDO E;  2V1G A;  2DXM A;  4WCH D;  3BCQ B;  1QXE A;  1MLN A;  1RVW A;  1HDA B;  1UX8 A;  1Y35 B;  3UHV A;  3HYU B;  3VAU A;  3HXN B;  1RPS B;  3R5I B;  2MYE A;  2XKH A;  3D1A A;  3PI8 B;  1LA6 B;  1BVD A;  5M3S A;  2SPO A;  4DWT A;  1O1M A;  5D1V A;  1YE2 A;  2H35 A;  1O1N A;  4HRT A;  2GNW A;  4MXK A;  1YHU D;  1IWH B;  4XS0 A;  3MKB B;  4YU3 A;  4ROM A;  1XZ2 B;  1MNH A;  3G46 A;  1PBX B;  2NX0 A;  3WR1 A;  107M A;  1QSI B;  1YVT B;  1LFY A;  2R4Z A;  2DN1 B;  2LH1 A;  1ECO A;  1QPW A;  3CIU B;  5HLQ A;  1HBA A;  5E29 B;  2R50 A;  1A00 A;  2Z85 A;  5B85 A;  1MCY A;  1CP0 A;  3QQQ A;  1BZ0 A;  3KUO A;  1Y01 B;  4NXA A;  1J7W A;  5HBI A;  5KER B;  4F6J A;  4MQG B;  1MOC A;  1Y85 B;  2BLJ M;  1Y4R A;  1SI4 A;  1EBT A;  2QU0 B;  4L7Y B;  3ZJS A;  3DUT A;  2D5X B;  1J3Y B;  1H97 A;  3BJ2 A;  3P5Q A;  1CQX A;  1YFF B;  3KMF C;  3G4W A;  5CNF A;  2D60 A;  4MBA A;  2DN2 B;  5CNC A;  2GNV A;  4O4T A;  2AUQ A;  1A3N B;  1HGB A;  3OZU A;  1QSH A;  1WMU A;  2KSC A;  2YRS A;  1Y5J A;  3GKT A;  1GLI A;  1XYE B;  2IG3 A;  1JL7 A;  5KDQ B;  1Y46 B;  3UHI A;  2G11 A;  3QM6 A;  1YCB A;  2MHB B;  5EE4 D;  1O1J B;  2QFN A;  2D2M B;  2ZSP A;  3PI2 A;  1DXC A;  2W6Y A;  4QAU A;  2ZLU A;  1Y8K B;  1BZZ B;  5KKK A;  2V1E A;  1Y0W A;  5JGG B;  1HLM A;  4FWY A;  4ROL A;  1GDL A;  1MOH A;  3NL7 A;  3ZJI A;  1DUO A;  3ECX A;  3A5A A;  5JOM A;  1YHU A;  2ZSR A;  1MYG A;  3PIA A;  1MLM A;  2DHB A;  3IC2 B;  5JDO C;  2EVK A;  1G08 A;  3UI0 A;  3H58 A;  1F5P A;  1FSX B;  5EUI A;  2Z8A A;  1JEB A;  3GQR A;  2SPN A;  3GDJ B;  1Y7D B;  1LFL B;  1XZ7 B;  2PGH B;  3UH6 A;  1FSL A;  1Y31 A;  3ZJQ A;  1G0B A;  1YHE B;  3H57 A;  3FS4 A;  2MGM A;  3UHS A;  1G0B B;  1YHE A;  2ZS0 C;  1YIE B;  2V1F A;  2ZLT B;  3EU1 A;  4FWX A;  1LFL A;  4FC3 B;  1Y09 A;  1Y4Q A;  2H8D A;  3WCP B;  1UX9 A;  2HBF A;  5SW7 B;  1OBM A;  1Y8I A;  3GKV A;  1MLK A;  1YDZ B;  1KFR A;  4TWV A;  1LJW A;  4OOD A;  4TYX A;  2D5Z A;  1BZZ A;  1Y8H B;  3ZJJ A;  4TWU A;  5HY8 B;  1YG5 B;  1O1I B;  3QJE B;  1V75 A;  2D2M A;  3UH7 A;  4MXL A;  1O1J A;  1O1O A;  1X9F D;  3HF4 A;  1BBB A;  4O2G A;  1JWN A;  3ASE A;  1G9V B;  3M3B A;  2EKU A;  1WVP A;  3TLD A;  1LH2 A;  1Y0A A;  2D2N A;  3ONZ B;  4JAC A;  2EVP A;  1FAW B;  5CNB A;  3PI9 A;  4KMW A;  4M4A B;  1BZP A;  1Y45 A;  1DM1 A;  1HCO A;  3KUN A;  1QSH B;  1WLA A;  3QQR A;  2ZSX A;  1C7D A;  3A0G B;  1BAB A;  4NXC A;  104M A;  3UH3 A;  1SDL A;  3RJN B;  3WCU D;  1URY A;  1V07 A;  1HGA A;  2AUO A;  4NZI A;  1K0Y A;  4JYQ A;  3NFE B;  1G0A A;  1YG5 A;  5HY8 A;  1DO3 A;  1VXC A;  2BLH A;  2ZWJ A;  1Y0D A;  2HBC B;  2VLZ A;  1LJW B;  1VRE A;  3DHT A;  3ZH0 A;  1YEU A;  1MNJ A;  1S0H A;  2ZFO B;  1X9F B;  5EOH A;  1UFJ A;  1A3O A;  1NQP A;  3WCV B;  2R1H A;  1J7W B;  2R4Y A;  1XQ5 A;  4ODC A;  1MBD A;  3WFT A;  1CIK A;  1CH7 A;  5EYS A;  2H8F A;  1THB B;  2ZT2 A;  1YIE A;  2NRL A;  1CG5 B;  1QSI A;  1G09 B;  1Y0T B;  3FS4 B;  1XZ2 A;  3A5G A;  3OK5 A;  1ITH A;  1IOP A;  4MQH B;  3UHT A;  3BA2 A;  2GTL A;  1C40 A;  2AUP A;  1ECN A;  4HRT B;  2H35 B;  4AVE A;  3LB3 A;  1M9P B;  3OJ1 A;  5C6E A;  2HBS B;  1G08 B;  1N9H A;  1FHJ B;  3R5I A;  2MGE A;  2NSR A;  1CQ2 A;  3PI1 A;  3OVU C;  2HBS A;  1LH6 A;  2MGL A;  3VHB A;  3MYM A;  1AJH A;  2O5B X;  1O16 A;  2ZLU B;  5F2A A;  1LFZ B;  1LFQ A;  4N7P A;  1LH5 A;  2ZLV A;  1XZU B;  2SPL A;  1QI8 A;  3PT7 A;  1G09 A;  4UZV A;  1EBC A;  3ARL A;  5IKS A;  1LFV A;  2R4X A;  3MBA A;  1GZX B;  2HBD A;  5CN5 A;  2VYZ A;  1XY0 B;  4G1V A;  1Y22 B;  1H1X A;  3WCV A;  1Y4B B;  1NQP B;  4FH6 A;  1CG8 B;  2G0V A;  5ILE A;  1YH9 A;  4MAX A;  1YEV B;  2R80 B;  3S65 B;  2DN2 A;  3QZX A;  2QSS B;  1JP8 A;  2SPM A;  5EET A;  5E83 A;  1MWB A;  4MQC B;  1Y4F B;  1MOA A;  2O5T X;  3D1K B;  1V4X B;  3VRE B;  5ILM A;  5E83 B;  4DC7 A;  1F63 A;  1J40 B;  2FRJ X;  3LHB A;  1HGA B;  3UGZ A;  1YMC A;  6HBW A;  1C7D B;  5CN8 A;  1VRF A;  3ODQ A;  3GQG B;  3KMF A;  2B7H B;  1UIW B;  1JPB A;  3ONZ A;  1MYT A;  2RAO A;  1CMY A;  1ECD A;  3TM3 A;  1A6N A;  3HEP A;  2MGF A;  1GJN A;  1ABY B;  1XZU A;  4KJT A;  4F6D A;  4HRR B;  4X0L A;  110M A;  1XZ4 A;  2VRY A;  1MLQ A;  1LFZ A;  2NSS A;  4X0L B;  2IN4 A;  1RQ3 A;  2ZFO D;  2QMB B;  3UHX A;  5AB8 A;  3PI3 A;  108M A;  3UHE A;  3UHZ A;  2EB9 A;  5HU6 A;  1SWM A;  1FDH A;  2BNL A;  3HXN A;  1YDZ A;  2AA1 B;  3OO5 B;  1LTW A;  1DKE B;  1GBV A;  1J7S B;  3EOK A;  2DXM B;  1UC3 A;  4IRO A;  1N9X A;  1PMB A;  3UBC A;  4HSX A;  4MQJ B;  3UHN A;  2HZ1 A;  4YU4 A;  3EU1 B;  4MQH A;  4MU5 A;  1M6C A;  2R4W A;  4DWU A;  1S69 A;  1YE0 B;  3D1K A;  2D6C A;  1HHO B;  3WCU A;  1A0Z A;  1RTX A;  4MQC A;  2PEG B;  1C7B B;  3AQ7 A;  3K3U A;  3A9M A;  2PGH A;  3LB2 A;  1YHR B;  4MPM A;  2V1H A;  1A4F A;  4M4B B;  3GQR B;  1JZL A;  1GBU A;  2R1H B;  1GCV A;  1JEB B;  1DXU A;  1A3O B;  5F0B A;  4B3W A;  1A4F B;  3IC2 A;  3IA3 B;  1X9F A;  1KD2 B;  1X3K A;  1YHR A;  1MWD A;  1UFP A;  4U8U A;  1COH A;  1LFV B;  1C7B A;  3QMA A;  1VWT B;  3WFX A;  1YZI B;  1Y5F A;  102M A;  1G0A B;  1N9I A;  1ABS A;  1YGD B;  2ZSS A;  2LH7 A;  4N7P B;  1IT3 A;  2MGK A;  3G4Q A;  1JP9 A;  4HHB B;  1VXB A;  1GBV B;  1BAB B;  3WCW A;  4G51 B;  1HCO B;  2O58 X;  1J41 B;  2AA1 A;  2AUR A;  1OJ6 A;  2O5M X;  1CH9 A;  1DWS A;  3MJU A;  1OUU B;  3OZW A;  1XZV A;  1MBC A;  1Y0A B;  2D2N B;  2ZT1 A;  1NEJ B;  1TU9 A;  1QXD B;  3WCV D;  1MNK A;  1DTM A;  1OR6 A;  4NK1 A;  2HZ3 A;  5JDO F;  2D60 B;  1Y7C B;  4OF9 A;  1SPG A;  2GRH A;  3M3A A;  3QJC A;  5CN9 A;  1DXT A;  1MYF A;  1FDH G;  1ABY A;  1YFF A;  3P5Q B;  1DLY A;  2D5X A;  1HBB B;  3AQ8 A;  2QU0 A;  1CH3 A;  2D2N C;  1HBG A;  1HGC B;  3GOU A;  2MB5 A;  2XKG A;  4N8T A;  1GDI A;  3WCP A;  2MYD A;  2GRF A;  3D4X B;  3W4U B;  1Y4Q B;  2W72 C;  3UHC A;  1SDK A;  1MYZ A;  1HGC A;  5D5R A;  1Y7G A;  2DN1 A;  1GCW B;  1NZ5 A;  1HBB A;  1BZ1 A;  1R1Y A;  2HBC A;  3S1J A;  2NRM A;  2ZSO A;  1Y31 B;  5CND A;  1MDN A;  3QJC B;  1SHR A;  2E2Y A;  1JDO A;  1HV4 A;  1IWH A;  1MBI A;  2QSS A;  2WY4 A;  1Y7D A;  3MN0 A;  1HLB A;  3WCT A;  1O1N B;  1Z8U B;  1CG8 A;  4GZG A;  1Y4B A;  1JP6 A;  1LA6 A;  1AJ9 B;  1L2K A;  1O1K A;  1Y45 B;  2LH2 A;  1XZV B;  2G12 A;  1AZI A;  1Y7Z A;  112M A;  3PT8 B;  3HYU A;  5HAV A;  4U8U D;  1Y35 A;  1HBI A;  4U8U C;  3A2G A;  1G9V A;  2HHB A;  3BCQ A;  4C44 A;  2HCO A;  3AT6 B;  1MWC A;  4KN3 A;  1BBB B;  1YIH B;  3G4U A;  2MGC A;  1V75 B;  2V1I A;  3ECL A;  2W6W A;  1URV A;  3QM8 A;  1O1I A;  3BJ1 A;  1Y5F B;  1DLW A;  1YIH A;  1YOI A;  3ZOM A;  1UT0 A;  3WHM B;  2G0Z A;  2XKI A;  3GQP A;  3UHU A;  5KDQ A;  1MLU A;  1XYE A;  2OH8 A;  2VEB A;  5C6E B;  2XYK A;  2H8D B;  2HZ2 A;  1DO7 A;  2VEE A;  3UHH A;  1Y09 B;  1T1N B;  1OUT A;  3WCT B;  4M4B A;  2GTL B;  3MJP A;  1SHR B;  3DHR A;  2EKT A;  2WTG A;  2G0R A;  2PEG A;  2AV0 A;  1RSE A;  4DC8 A;  3BJ2 B;  1HHO A;  4O1T A;  2MYB A;  1R1Y B;  1BZ1 B;  2LH6 A;  3IC0 A;  1Y4G A;  3UHB A;  1Y7G B;  3NG6 A;  2LH5 A;  3O89 A;  2H8F B;  1VXF A;  2OHB A;  1A9W E;  2MGH A;  3UGY A;  3GDJ A;  4ODC B;  4ZVA A;  1SDK B;  4NI1 A;  1DKE A;  2W72 A;  3BOM A;  1EMY A;  1BJE A;  1XCH A;  2MGG A;  2V1K A;  1GDK A;  1CH5 A;  1SPE A;  2ZS0 B;  4N8T B;  3B75 A;  3A5B A;  4G1B A;  3OO5 A;  2MGA A;  3GOU B;  1S61 A;  2JHO A;  1NZ4 A;  5HU6 B;  2DN3 A;  1QPW B;  3CIU A;  1MOB A;  3NL7 B;  1LFY B;  2VYY A;  1B86 B;  1Y0W B;  5JGG A;  3WR1 B;  3SZK A;  1MBN A;  2G3H A;  4FWZ A;  1XZ4 B;  2VYW A;  3VRG B;  1S56 A;  1SPG B;  2ZS1 C;  4XDI A;  1X9F C;  109M A;  3ZJR A;  1Y8W B;  1Y4V A;  2ZT3 A;  3A0G A;  1HSY A;  3PI8 A;  2G10 A;  2RAO B;  4L2M A;  3ZOL A;  3MJU B;  1LH1 A;  1UIW A;  4PQC A;  2ZSQ A;  1FAW A;  2MGB A;  1MNO A;  2FAM A;  2YRS B;  3ODQ B;  1WMU B;  5HLU A;  4ZVB A;  6HBW B;  1DXV A;  1A3N A;  5ILR A;  3WCU C;  1KR7 A;  2HBE B;  1O1P A;  1HDS A;  1YGD A;  1HJT A;  1A6K A;  2BKM A;  3ECZ A;  1VXE A;  2RI4 B;  2HBG A;  1COH B;  2ZS0 D;  2QLS B;  3VRF B;  2Z6N A;  1O1L A;  1Y8I B;  1YEV A;  1HBR A;  1YH9 B;  1RQ4 B;  1YOG A;  2EF2 A;  6HBI A;  1DXU B;  1RQA A;  2GTL D;  1Y22 A;  4MQG A;  1CO9 A;  2QSP A;  3WCV C;  1W92 A;  1XY0 A;  3QJD A;  1MNI A;  1YGF B;  1V9Q A;  2HBD B;  1D8U A;  3ARK A;  3MOU A;  1MBO A;  1CO8 A;  2ZLW B;  1A9W A;  1I3E A;  1YVT A;  5AZQ A;  1JF3 A;  1S5X A;  4PNJ A;  105M A;  1DO1 A;  1TES A;  1YE0 A;  4C0N A;  3S66 B;  3A59 B;  1HBH B;  3NMM A;  3UHK A;  1F5O A;  4YU4 B;  4MQJ A;  1YEO B;  4N7O A;  4IRO B;  1HRM A;  4IT8 A;  3EOK B;  3D17 A;  3O7N A;  3NML A;  4BJA A;  3ED9 A;  1LFT B;  3D1A B;  3IXF A;  1CLS B;  1RPS A;  3SDN A;  1CLS A;  2G14 A;  4PQ6 A;  1BUW A;  2GL3 A;  1M9P A;  1YEQ B;  4ROL B;  3D17 B;  1Y8K A;  1C40 B;  1A6G A;  2QMB A;  3ARJ A;  2G0S A;  3AT5 A;  1DXD A;  1MTK A;  1MLJ A;  2BW9 M;  4HRR A;  3S66 A;  5JDO D;  2WTH A;  2MHB A;  5EV5 A;  3WTG A;  1VHB A;  1XZ5 B;  4ESA B;  1BIJ B;  1CG5 A;  1ABW A;  1HDB B;  1MLL A;  5EE4 C;  1AJG A;  3PEL B;  5HLX A;  1IRD B;  1GLI B;  3ORD A;  1XQ5 B;  1HAC B;  4H0B A;  1Y4P A;  2ZT0 A;  2C0K A;  2HHE A;  1V4W A;  2ZFO C;  4HSW A;  1O1L B;  2W6X A;  3GK9 A;  3RGK A;  1S0H B;  3UHW A;  1YEU B;  1CH1 A;  1NS9 B;  1EWA A;  3AQ9 A;  3WFW A;  2OLP A;  3VRE A;  4F68 A;  1NIH B;  1Y0D B;  3WCT D;  1X46 A;  3DUT B;  2ZFB A;  5CNE A;  1LHS A;  1Y4R B;  1YVQ B;  3HRW A;  2GDM A;  3G4V A;  1NWI A;  2D2M D;  2OH9 A;  3RJ6 A;  2HBE A;  3S65 A;  3GLN A;  1CBM A;  1V4W B;  3QZZ A;  1HAC A;  3ZJH A;  1JF4 A;  2VHB A;  1HAB A;  3PI9 B;  1BZ0 B;  1XXT B;  1A00 B;  2LHB A;  1GZX A;  1OFJ A;  3AQ5 A;  1NZ2 A;  3UHD A;  3E5I A;  5ILP A;  3TM9 A;  101M A;  2GLN A;  1ABW B;  1CP5 A;  2OIF A;  1BIJ A;  1Y5K A;  1Y83 A;  1QI8 B;  1U7S A;  1O1O B;  2O5L X;  3D7O A;  1HBS B;  1MLO A;  2ZSZ A;  3VRG A;  4F4O A;  2GKM A;  1Y8H A;  3CY5 B;  1YMA A;  3UH5 A;  2D5Z B;  1B86 A;  1IBE B;  1YEQ A;  1BUW B;  5E6E A;  3E4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...