1O1TA

Structure of fpt bound to the cvim-fpp product
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
315
structure length
315
Chain Sequence
b'GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Biochemical and Structural Studies with Prenyl Diphosphate Analogues Provide Insights into Isoprenoid Recognition by Protein Farnesyl Transferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 125
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1o1tA00
3DPYA 3DSXA 1TN8A 2H6IA 1O1TA 3HXDA 1D8EA 4GTOA 1MZCA 1TNUA 3PZ4A 3Q7AA 1TNYA 1JCRA 1TNZA 3E33A 1LTXA 1LD7A 1N4RA 1TN6A 1SA4A 3DSTA 4GTPA 3DSWA 3HXBA 2H6FA 1N4QA 1O1RA 1N95A 3HXEA 3SFYA 1QBQA 3PZ2A 3E30A 1TNOA 1X81A 2ZIRA 1S63A 3SFXA 1SA5A 1S64A 1O1SA 2H6HA 3HXCA 3Q7FA 1KZPA 4GTTA 1TN7A 4EHMA 1LD8A 2BEDA 4LNGA 3E37A 3DSUA 1O5MA 3EU5A 1KZOA 1N4SA 3C72A 1N4PA 3DSSA 3KSQA 1TNBA 1FT2A 3DRAA 2F0YA 1N9AA 4GTQA 4GTMA 2R2LA 4GTSA 3E34A 1DCEA 3HXFA 4YDEA 1FPPA 3Q73A 4GTRA 3PZ3A 1D8DA 2H6GA 3Q78A 1FT1A 4LNBA 2IEJA 3DSVA 4GTVA 4MBGA 3EUVA 3Q75A 2ZISA 4L9PA 3Q79A 3KSLA 1JCQA 1N94A 3PZ1A 1NL4A 1JCSA 4YDOA 3E32A 1NI1A
chains in the Genus database with same CATH superfamily
3HHMA 1NA3A 1X5BA 5FQ8A 1JCRA 4X8QA 3DWLG 2DVWA 4J8YA 1V55E 4WNFA 4O1PA 3ZU7B 4C48B 2NXPA 3FULA 4JHKA 2V5FA 3T8MA 3V79K 4J6IA 5LP0A 4ANXA 2VSXE 5BXOA 4BERA 3NOGD 3ESLA 2KATA 4ATGA 4B89A 2CG2A 2Q7FA 1HX8A 3IXEA 1S64A 4HRLA 2CHXA 3ZHEB 4YDWA 3Q7FA 3ABLE 4NRHB 4PS7A 3QAQA 5CCMA 5FZRA 3IV0A 3EU5A 1NFIE 2FBNA 2XZTG 1MX2A 3TWVA 3JUEA 5G04J 2L9BA 4U07A 3BUAA 2WMOA 3IKOB 3ZGQA 2GRQB 2F0YA 1N9AA 2J8SD 3Q9UC 4UUCA 1DVPA 5DBKA 3UQ3A 4DX1A 1ZB1A 2IONA 3TWTA 1K3ZD 1JUQA 4JL0A 2KCLA 4LNBA 5EIBE 1TYQG 2R17C 1UJKA 3IHVA 2X6KA 3KD7A 2XHEA 1D9SA 4KMOA 3GZ2A 3DPYA 3MJWA 4A3VA 4GTOA 4ILHB 3WG7E 1K8KG 3FEXA 1TN6A 4YDYA 4CZ2D 4GPKA 3PE3A 1HE8A 3DSTA 4FLBA 4GTPA 4GZDA 5FQ7A 2JABA 3PNLB 1OXJA 4DI3A 4HS2A 2OVBA 3WXXA 3JYSA 4Z68A 1OWMA 4IULA 4HOSA 1O1SA 4N39A 2DIWA 2KZTA 3UIPC 1UN9A 3TWSA 1HXIA 2AWIA 3LY7A 2YNQA 3ZIMA 4LNUD 3AG2E 3FUMA 5KNHD 4FC8A 4N2SA 4F1SA 4GTMA 3DBSA 4L23A 3MA5A 5KJLA 5H7PA 4CT4A 4HXIA 1QZ2A 3CVVA 2VYIA 4OVVA 2ETBA 5FT9A 1OWOA 4CGVA 5CECB 4TV3A 3FTVA 3T8KA 5FZSA 3CK8A 4XI0A 3UT7A 3LS8A 4I9CA 3PZ1A 4I1AA 4TUMA 3V2OA 4JW1A 3L9TA 4AJWA 3EU9A 4BESA 3D9IA 3E4BA 5ENPD 1LTXA 1LD7A 1IYGA 5ENSD 1OCOE 2QZAA 1H2UA 1E7VA 4OAUC 1L5JA 2X38A 4BSXA 4A1SA 3D9MA 2WXKA 1WAO1 4A63B 3SF4A 3QDNA 1K1BA 3L82A 4J8EA 4UI9K 1UJJA 2X3MA 1SA5A 2XPIA 2IOSA 3FU5A 4Y6CA 3ZVVA 3RRMB 2QFCA 4I1OB 3ASGA 4WWNA 2BF0X 2KCVA 3MKRA 1LD8A 1QYMA 4L2LA 3L17A 3ZRHA 2ZGGA 2PL2A 4FA6A 4HQDA 4U7EB 2LXMA 2FEZA 2B0OE 4FJYA 2OCCE 3W9GA 2KC7A 3FHEA 2PQRA 3MX3A 1KT1A 3B13A 2R2LA 3TWQA 3NBNB 3RRNB 2C0MA 4AV7A 4GCOA 2Y0BG 3QNKA 4CT0A 3EIJA 4I6EA 3CQGB 2IEJA 5AAOA 2QC9A 1H19A 1OY3D 5AIJA 5ITZF 3FEYA 3QB2A 3FTUA 3B7BA 4KYOB 2ONDA 3Q9NC 3RK6A 4HOUA 3ML8A 3KAEA 3HXDA 2MOWA 3FH5A 2WXLA 3QWWA 3R7RA 2I9CA 4YVOA 2CG3A 1SA4A 3I5PA 4I6JA 3NF1A 3PZDA 1G3NB 2EIJE 3V30A 2R05A 1BLXB 2ZIRA 5EN5D 3PH0C 4XI9A 5J90A 5G2NA 1TJFA 1AWCB 2LO6A 2XQ0A 1WDYA 4LERA 3ZW3A 3ASOE 2Y1LE 3HVEB 3CHPA 2AJAA 2LSUA 5FWQA 4Q96A 4RQIA 3DRAA 4FHJA 2WXRA 3LEWA 3LJNA 3MKQA 3UIOC 4FJZA 4ILGA 5KWDA 2UY1B 5ANLA 2M63A 3Q73A 2IQCA 2EIME 1KPSB 2BKGA 2LNIA 2H6GA 3EHRA 2P9UG 5JJ6A 4KVMA 1IHGA 2XGOA 4U8YD 3PRZA 4GZCA 5FIOA 2VGEA 3LPZA 2X6HA 3L22A 3G2WA 1NI1A 1Y8MA 3B95A 3DSXA 5BV0A 2H6IA 5D66A 4EZJA 3UKRG 3Q49B 3UUXA 3LVRE 2XS8A 1N4RA 5A23A 3L16A 4DUIA 4DK5A 3ABKE 4ACKA 3APCA 5AJLA 3ASHA 1H0AA 3DSWA 5ENQD 5FTPA 4ZHBA 4HNAD 1PC2A 4BY6A 5A6CA 4CCAA 1QBQA 4H7XA 2GRLA 2XEEA 3FTXA 3GW4A 3P2BA 4B0ZA 2J9QA 3UMVA 1K1AA 4DX5D 4G8LA 2RFAA 1FVHA 3EHQA 3NAWA 3NB2A 4BEPA 2KBXA 4F1PA 1BI8B 1JPLA 2BEDA 3OXFA 3E37A 1BU9A 1PY1A 5CBNA 3L13A 4U0SA 4BT8A 3C3QA 2IF4A 3RAUA 4L2YA 3B7UX 3C3RA 2PNNA 2DZNA 2P9SG 1U3DA 4G23A 3ZYMA 5HQ8A 4GTSA 3FUHA 4K5AB 1DCQA 4IRUA 3OXGA 3U64A 3DSVA 3U66A 4MBGA 3NZUA 4GPMA 5KNGA 4XZ4A 1JCSA 3QC1A 3E32A 2NYJA 2J4DA 2ZXWE 3TJPA 3FTSA 1A5EA 5AARA 3FTYA 3L6AA 1WG0A 1IQUA 2BTDA 2A4ZA 1H2TC 1H6PA 1HH8A 4I17A 4I6GA 2OVFA 3O4ZA 4J8DA 5JMND 1VDYA 1SVXA 3G2SA 3SFYA 2XGSA 4U0UA 4I43A 3SFXA 2P58C 2L0IA 4UWLA 3CVQA 2IU1A 2IFUA 4JXTA 4PS3A 3HYMB 4J0UA 4UWKA 2ZU6B 4BT9A 2WQ6A 2AXZA 2XCCA 3EDTB 3SBTB 2IJGX 3CVPA 3ISMC 3Q5MA 2IO2C 5T8IA 4F53A 2WXPA 3FUJA 1UN8A 3GZ1A 4KZ0A 4JA7A 4PH4B 4A3TA 3S7JA 2IOLA 2EIKE 5BUZA 3HIZA 3K9IA 3AS8A 5AENA 4BX9A 4NQ0A 2AXUA 4HLLA 4JA9A 4GYYA 4GTVA 5BW8C 4BWRA 5LCWJ 3TWRA 3FH8A 2FF4A 3TG5A 3CKCA 5B1BE 3UPVA 2CFUA 3QWPA 1OWNA 1OWPA 1E96B 2LAIA 3LY8A 1MX6A 3X2QE 5G05J 3SHFA 2BUGA 2KXPC 1MJ0A 2XEHA 3KS2A 5CRUA 3LDZA 4GA0A 3PEUB 5C1DA 2J08A 1IXVA 3LJ3A 3ZXSA 5HRYA 1X81A 2VJ8A 4F6RD 5CEAA 4DX7D 3UKUG 2FULA 1W3BA 3ONKA 1NP7A 4GTTA 1JWFA 3LKUA 4CDRA 1OUVA 1WM5A 4EZKA 3SI5A 3JQ0A 3CGHA 2XPYA 4OVUA 3APDA 2VGXA 4I1MA 3AS5A 3VTXA 4JZYA 2LUHA 2VTBA 4G26A 4DLOA 3BEEA 4B8CB 4BETA 4HOTA 1MX4A 3C98A 3HG0D 4AY5A 1INZA 4L1BA 3Q79A 2WXOA 4U96D 3KSLA 3I4GA 2DZOA 3C5RA 3KEAA 3QOUA 5B3SE 5CMWA 1HZ4A 1SW6A 3EHMA 3MV2B 2I1JA 2WXGA 2CHZA 3QK0A 1Z5SC 3MGBA 4BTBA 5AQ9A 3CKBA 4O60A 4IYPA 3ULQA 1N95A 4KVOA 4QFVA 2HM8A 3DEPA 4JEHA 5AJDA 3N71A 3CVUA 2GROB 2IO3C 3D9OA 3URZA 3LY9A 3APFA 2WXJA 5EX3A 5KCMA 4B8AA 1SZ9A 3DPDA 5KBAA 2HR2A 3MZLB 2WXHA 1O5MA 4G25A 4E6HA 3SD5A 3C3OA 3DSSA 5C2YA 2YHCA 1FVFA 3FP3A 2LAHA 5FZQA 3AG1E 1HS6A 5ANRA 1DC2A 3F6QA 2XPZA 4AY6A 5A7DB 4BX8A 5HS0A 2MRIA 1UW4B 4FULA 2ETCA 2QY7A 4G8KA 2MYOA 1HG2A 3RIBA 3FDHA 2HE0A 2KCKA 3D9LA 3B7TA 3TWWA 4N5CA 3D9PA 4HRNA 5CMYA 4N3BA 4ABNA 1MHQA 4GYOA 2YINA 4UWHA 3RSEG 2Y4TA 1TNYA 4UWGA 4GZ5A 3AU4A 4APFA 5KJNA 4W9RA 3CVWA 2AXVA 4EBAA 1N0QA 4N3AA 3QWVA 5JA4D 1ELKA 3I4RB 3PZ2A 2P2CP 3E30A 3AG4E 1S63A 4YVQC 1Z3XA 3U9WA 3PREA 4WWOA 3RO2A 3DXKG 2J49A 2DYRE 3PUJA 4TXQA 1ELRA 2EILE 2X6IA 2WVIA 3ONLA 3NOCD 2R02A 3RJVA 4O6FA 1KZOA 4GA1A 3ZHEA 4Q69A 5BV1A 3FFLA 3U3WA 3J5PA 2A5EA 2HYZA 3ZFWA 3PS6A 5LOZA 2XRZA 3J5QB 3FUIA 4FHKA 2OEVA 4UWFA 2QYJA 5HI7A 1IKND 3ZYQA 3FY4A 4JEUA 4DPRA 3L08A 3GZSA 4JPSA 1NL4A 2AVPA 4EECA 5M72A 4N3CA 5KJKA 1D8EA 5ENRD 4EZLA 4JB8P 4WUYA 3Q7AA 1N0RA 4AOFA 4APOA 3S7FA 3O48A 5JHAA 1TJCA 3OXLA 3ZUVB 3LXUX 1XNFA 2R03A 5EDSA 2R5SA 4AM9A 3TWXA 2KZTB 4LUNU 4DI4A 4UI9C 4PUCA 3CSFA 1KT0A 2WXNA 4NIKA 2OEWA 5CRVA 3UM3A 3ESKA 3D3MA 3UM1A 1KLXA 3UM0A 2WXIA 4IN3B 4DX6D 2JEKA 2V5QC 3CEQA 3MV3B 5JJTA 3TG4A 2GRRB 1E7UA 3FUEA 4XE0A 4WNEA 2V4HC 4LEUA 5CHEE 4ACLA 1Q2ZA 2XGMA 5ENOD 4GZ3A 4LCTA 2CHWA 3RU0A 2YHEA 2ETAA 2GRMA 3ASNE 4U95D 5T4YA 5AQ7A 4GTQA 3E34A 3DEOA 3HDXA 4J7WA 2XEVA 5AN8A 1SQMA 4CDNA 2VGYA 1EDUA 2J09A 2I6HA 4C9BB 1FT1A 4CRWA 2OOEA 1OT8A 3IHYA 3ULYA 3LYAA 3EHNA 1JCQA 1HF8A 4J8FA 4ANWA 2P9KG 3QKYA 5G04C 3PNTB 3AU5A 4EPZA 4URKA 5LCWC 1MYOA 1E8WA 2J07A 1UOHA 4HRMB 1N4QA 3SZ7A 3IEGA 2GRNB 3UTMA 3HXEA 1OCCE 2F8XK 3FU0A 4A1GA 3CHOA 4GB9A 3FH7A 4WAFA 3LVQE 1BI7B 3ZKJA 4K0RA 1EPUA 2WXFA 1ZU2A 3KEZA 3NQPA 1TN7A 4PDXA 4AP2A 3R9AB 3SNXA 1NZNA 3MEKA 3MYVA 3PE4A 4K5CA 2V8SE 4ANUA 3VTYA 4F7AA 2WMNA 5EKQD 3W9FA 5CCLA 4D10C 2Y3AA 3UM2A 4AVXA 2XENA 1Z6TA 2XCBA 3PZ3A 2EINE 4G1TA 4O1OA 1FCHA 3Q47B 1S70B 4RLYA 3FUDA 2DCPA 3UX4A 2GGFA 1H6KA 3ML9A 2J4BA 3ASDA 1U2VG 4HVBA 4U63A 5BPPA 5D0OD 4GU5A 2YQ8A 4U0ZA 4RG9A 3SO8A 3S2AA 3ULEG 1V54E 4GA2A 3PVLA 2WXQA 1LF8A 4H7YA 2PM7A 3AS4A 2UWJG 1GW6A 2WQ7A 2WQHA 1TNZA 3SGHA 2PM6A 4B93B 5CBOA 4U8HA 4R7LA 4V3IA 3TWUA 5CERB 1BPOA 2L6BA 5CEDB 2WB2A 3CSTA 1ZBPA 4CDMA 5IY5E 4DLQA 4NURA 2QYUA 3CK7A 4XX5A 3JQ1A 2DYSE 3CIAA 2H6HA 3AG3E 1P5QA 5E75A 2V4LA 4MKTA 2FO7A 4WNGA 4KXKB 3R7QA 4EHMA 3QARA 3UINC 5EYLA 5ENTD 2RG8A 3MKQB 2NSZA 1A17A 4CEMA 4ZFHA 1BD8A 3HVEA 2I1KA 2JLBA 2P9IG 1SZAA 2ZGDA 3D9JA 4YDEA 5D0QD 1D8DA 3FUFA 3ABME 3Q78A 1EF1C 2XS1A 4EQFA 1MQSA 3RO3A 4RSYA 2MHKA 1YA0A 5E76A 4N2QA 2UY1A 1N94A 3MCXA 5T3RA 1N52A 4WWPA 3TGOA 4K03A 4JHJA 1QNFA 3CVXA 1TNUA 3BG0B 3VLDA 4B94A 3PDNA 4AEZC 4JD2G 4HB5A 1RW2A 1Y6IA 3HXBA 1IQRA 2VSNA 4QQIA 5LX8A 5D2MC 3D9NA 3OTNA 4RVBA 3R9MA 4LRZA 1RZ4A 1E8ZA 5FQ6A 2HO1A 3TXMA 1AP7A 1YMPA 1KZPA 4JHRA 1N11A 1H6OA 3G2VA 3CHMA 4LNGA 5AQAA 1ELWA 3FTZA 3VLFA 4WNDA 3S7BA 3V2XA 1OCZE 3I3NA 3FU3A 4XKBA 2E2EA 1FPPA 3V31A 4DJAA 1Z3YA 3ENEA 3FUKA 3AJIA 1H2VC 4FU3A 4Y6WA 5BXUA 2RFMA 2XZDG 4L7TA 5FJYA 2P9PG 3FTWA 3GYZA 4AXHA 4DX2A 2AW6A 3CQCB 2P9NG 1MZCA 1U3CA 4OYSA 4HOQA 3CHSA 2I2OA 4G2VA 4C0MA 2BKKB 2H6FA 2Y69E 3ASFA 4UQYA 2R59A 4U04A 3B7SA 2VQ2A 4AIFA 4RG6A 4Q94A 4UQXA 2E0IA 4HI9A 5ENNA 4JC8A 5FQ4A 5FINA 1OCRE 3DXMG 3VLEA 5EYPF 2RD0A 3DSUA 4G11A 3TXNA 4FADA 3C72A 1N4PA 4E85A 3EJNA 3KSQA 2L0TB 3FU6A 2DWZA 3CVNA 4G24A 4MLPA 4C0EA 5JJ7A 5AQBA 5ARFA 4LG6A 5EIDA 1HFAA 4GMJA 2GRPB 3JCKC 2F8YA 3BG1B 4M3OA 2NC9A 5AYWD 1HO8A 4CGWA 3IBEA 4GTRA 5KJMA 2VSYA 1JWGA 3JXJA 3CV0A 3CHRA 4ILIA 3Q75A 2FI7A 4BTAA 4N5QA 4YNDA 4LSZE 3RKVA 4GMLA 3SY2A 5LFAA 1TN8A 3TAXA 4GZ6A 2LXLA 3P1UA 1DNPA 1UG3A 3S7DA 4DRXE 1E8XA 3E33A 3CK9A 4XKCA 2C2LA 2WXMA 2WPVA 4BSZB 3OAWA 1O1RA 1NA0A 4FLHA 1EYHA 3NZSA 3FUNA 4CYMD 3TL5A 5BT1A 3CVYA 4KZCA 2WM9A 2RKKA 2GW1A 5EX0A 3SBSA 2F37A 3HXCA 4I9EA 5HKPA 3G2TA 2X6JA 4UQZA 1HU3A 4A55A 2V0PA 3Q4AB 2P9LG 5ARGA 3JXIA 3BU8A 2CFZA 2PQNA 2KM4A 3D9HA 2VSOE 1QQEA 1OWLA 2VGXB 1N4SA 3B7RL 2VTBB 4TXRA 3UI2A 4MS6A 1IHBA 1FT2A 3T9KA 3L54A 2PZIA 4TUUA 4OAVB 1DCEA 3PEVB 3ZN3A 2FO1E 3BQOA 3AAAC 1S0PA 4HFGA 3D9KA 3CR3A 3EUVA 3ZPJA 4PS8A 4BFRA 2OV8A 4MRUA 5BNWA 3CHQA 4GMRA 4GAAA 1XGWA 3SQVA 1E8YA 1O1TA 2L6JA 3UXGA 5B1AE 4ANVA 4HORA 4J8SA 3PZ4A 4P29A 2IY0C 2EQXA 3G2UA 2Y4UA 4HI8A 2X6FA 4I2ZA 4I2WA 3EIQC 1YCSB 4HBDA 1PAQA 3UT8A 3Q15A 4F3VA 3JUIA 5J08A 1TNOA 4XEIG 1TEZA 3T5VA 2XRYA 5G55A 3SFZA 5EILA 3QJZA 5JHBA 4EBAG 2LSVA 5DIZA 3LCAA 3UT4A 4XIFA 4U8VD 1B89A 3ZNGA 3T5XA 4GCNA 4JVSA 3PUKA 3RRUA 4NACA 2A5UA 3ZXPA 1TNBA 4TXPA 5G05C 1WY6A 2B6CA 3HRAA 1HG5A 2DBAA 3HXFA 4GYWA 3CVLA 4KBQA 4HLEA 4M7CA 1YYHA 3CLJA 4ATZD 1E90A 2ILRA 4FP7A 4UI9J 1TR4A 2ZISA 4L9PA 3FWVA 4KT6B 3ZYKA 4TRQA 2C0LA 3U4TA 1N54A 4K5BA 4YDOA 3ZEFA 4ME2A 3ZYLA
chains in the Genus database with same CATH topology
3DPYA 3DSXA 1TN8A 2H6IA 1O1TA 3HXDA 1D8EA 4GTOA 1MZCA 1TNUA 3PZ4A 3Q7AA 1TNYA 1JCRA 1TNZA 3E33A 1LTXA 1LD7A 1N4RA 1TN6A 1SA4A 3DSTA 4GTPA 3DSWA 3HXBA 2H6FA 1N4QA 1O1RA 1N95A 3HXEA 3SFYA 1QBQA 3PZ2A 3E30A 1TNOA 1X81A 2ZIRA 1S63A 3SFXA 1SA5A 1S64A 1O1SA 2H6HA 3HXCA 3Q7FA 1KZPA 4GTTA 1TN7A 4EHMA 1LD8A 2BEDA 4LNGA 3E37A 3DSUA 1O5MA 3EU5A 1KZOA 1N4SA 3C72A 1N4PA 3DSSA 3KSQA 1TNBA 1FT2A 3DRAA 2F0YA 1N9AA 4GTQA 4GTMA 2R2LA 4GTSA 3E34A 1DCEA 3HXFA 4YDEA 1FPPA 3Q73A 4GTRA 3PZ3A 1D8DA 2H6GA 3Q78A 1FT1A 4LNBA 2IEJA 3DSVA 4GTVA 4MBGA 3EUVA 3Q75A 2ZISA 4L9PA 3Q79A 3KSLA 1JCQA 1N94A 3PZ1A 1NL4A 1JCSA 4YDOA 3E32A 1NI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPY A;  3DSX A;  1TN8 A;  2H6I A;  1O1T A;  3HXD A;  1D8E A;  4GTO A;  1MZC A;  1TNU A;  3PZ4 A;  3Q7A A;  1TNY A;  1JCR A;  1TNZ A;  3E33 A;  1LTX A;  1LD7 A;  1N4R A;  1TN6 A;  1SA4 A;  3DST A;  4GTP A;  3DSW A;  3HXB A;  2H6F A;  1N4Q A;  1O1R A;  1N95 A;  3HXE A;  3SFY A;  1QBQ A;  3PZ2 A;  3E30 A;  1TNO A;  1X81 A;  2ZIR A;  1S63 A;  3SFX A;  1SA5 A;  1S64 A;  1O1S A;  2H6H A;  3HXC A;  3Q7F A;  1KZP A;  4GTT A;  1TN7 A;  4EHM A;  1LD8 A;  2BED A;  4LNG A;  3E37 A;  3DSU A;  1O5M A;  3EU5 A;  1KZO A;  1N4S A;  3C72 A;  1N4P A;  3DSS A;  3KSQ A;  1TNB A;  1FT2 A;  3DRA A;  2F0Y A;  1N9A A;  4GTQ A;  4GTM A;  2R2L A;  4GTS A;  3E34 A;  1DCE A;  3HXF A;  4YDE A;  1FPP A;  3Q73 A;  4GTR A;  3PZ3 A;  1D8D A;  2H6G A;  3Q78 A;  1FT1 A;  4LNB A;  2IEJ A;  3DSV A;  4GTV A;  4MBG A;  3EUV A;  3Q75 A;  2ZIS A;  4L9P A;  3Q79 A;  3KSL A;  1JCQ A;  1N94 A;  3PZ1 A;  1NL4 A;  1JCS A;  4YDO A;  3E32 A;  1NI1 A; 
#chains in the Genus database with same CATH topology
 3HHM A;  1NA3 A;  1X5B A;  5FQ8 A;  1JCR A;  4X8Q A;  3DWL G;  2DVW A;  4J8Y A;  1V55 E;  4WNF A;  4O1P A;  3ZU7 B;  4C48 B;  2NXP A;  3FUL A;  4JHK A;  2V5F A;  3T8M A;  3V79 K;  4J6I A;  5LP0 A;  4ANX A;  2VSX E;  5BXO A;  4BER A;  3NOG D;  3ESL A;  2KAT A;  4ATG A;  4B89 A;  2CG2 A;  2Q7F A;  1HX8 A;  3IXE A;  1S64 A;  4HRL A;  2CHX A;  3ZHE B;  4YDW A;  3Q7F A;  3ABL E;  4NRH B;  4PS7 A;  3QAQ A;  5CCM A;  5FZR A;  3IV0 A;  3EU5 A;  1NFI E;  2FBN A;  2XZT G;  1MX2 A;  3TWV A;  3JUE A;  5G04 J;  2L9B A;  4U07 A;  3BUA A;  2WMO A;  3IKO B;  3ZGQ A;  2GRQ B;  2F0Y A;  1N9A A;  2J8S D;  3Q9U C;  4UUC A;  1DVP A;  5DBK A;  3UQ3 A;  4DX1 A;  1ZB1 A;  2ION A;  3TWT A;  1K3Z D;  1JUQ A;  4JL0 A;  2KCL A;  4LNB A;  5EIB E;  1TYQ G;  2R17 C;  1UJK A;  3IHV A;  2X6K A;  3KD7 A;  2XHE A;  1D9S A;  4KMO A;  3GZ2 A;  3DPY A;  3MJW A;  4A3V A;  4GTO A;  4ILH B;  3WG7 E;  1K8K G;  3FEX A;  1TN6 A;  4YDY A;  4CZ2 D;  4GPK A;  3PE3 A;  1HE8 A;  3DST A;  4FLB A;  4GTP A;  4GZD A;  5FQ7 A;  2JAB A;  3PNL B;  1OXJ A;  4DI3 A;  4HS2 A;  2OVB A;  3WXX A;  3JYS A;  4Z68 A;  1OWM A;  4IUL A;  4HOS A;  1O1S A;  4N39 A;  2DIW A;  2KZT A;  3UIP C;  1UN9 A;  3TWS A;  1HXI A;  2AWI A;  3LY7 A;  2YNQ A;  3ZIM A;  4LNU D;  3AG2 E;  3FUM A;  5KNH D;  4FC8 A;  4N2S A;  4F1S A;  4GTM A;  3DBS A;  4L23 A;  3MA5 A;  5KJL A;  5H7P A;  4CT4 A;  4HXI A;  1QZ2 A;  3CVV A;  2VYI A;  4OVV A;  2ETB A;  5FT9 A;  1OWO A;  4CGV A;  5CEC B;  4TV3 A;  3FTV A;  3T8K A;  5FZS A;  3CK8 A;  4XI0 A;  3UT7 A;  3LS8 A;  4I9C A;  3PZ1 A;  4I1A A;  4TUM A;  3V2O A;  4JW1 A;  3L9T A;  4AJW A;  3EU9 A;  4BES A;  3D9I A;  3E4B A;  5ENP D;  1LTX A;  1LD7 A;  1IYG A;  5ENS D;  1OCO E;  2QZA A;  1H2U A;  1E7V A;  4OAU C;  1L5J A;  2X38 A;  4BSX A;  4A1S A;  3D9M A;  2WXK A;  1WAO 1;  4A63 B;  3SF4 A;  3QDN A;  1K1B A;  3L82 A;  4J8E A;  4UI9 K;  1UJJ A;  2X3M A;  1SA5 A;  2XPI A;  2IOS A;  3FU5 A;  4Y6C A;  3ZVV A;  3RRM B;  2QFC A;  4I1O B;  3ASG A;  4WWN A;  2BF0 X;  2KCV A;  3MKR A;  1LD8 A;  1QYM A;  4L2L A;  3L17 A;  3ZRH A;  2ZGG A;  2PL2 A;  4FA6 A;  4HQD A;  4U7E B;  2LXM A;  2FEZ A;  2B0O E;  4FJY A;  2OCC E;  3W9G A;  2KC7 A;  3FHE A;  2PQR A;  3MX3 A;  1KT1 A;  3B13 A;  2R2L A;  3TWQ A;  3NBN B;  3RRN B;  2C0M A;  4AV7 A;  4GCO A;  2Y0B G;  3QNK A;  4CT0 A;  3EIJ A;  4I6E A;  3CQG B;  2IEJ A;  5AAO A;  2QC9 A;  1H19 A;  1OY3 D;  5AIJ A;  5ITZ F;  3FEY A;  3QB2 A;  3FTU A;  3B7B A;  4KYO B;  2OND A;  3Q9N C;  3RK6 A;  4HOU A;  3ML8 A;  3KAE A;  3HXD A;  2MOW A;  3FH5 A;  2WXL A;  3QWW A;  3R7R A;  2I9C A;  4YVO A;  2CG3 A;  1SA4 A;  3I5P A;  4I6J A;  3NF1 A;  3PZD A;  1G3N B;  2EIJ E;  3V30 A;  2R05 A;  1BLX B;  2ZIR A;  5EN5 D;  3PH0 C;  4XI9 A;  5J90 A;  5G2N A;  1TJF A;  1AWC B;  2LO6 A;  2XQ0 A;  1WDY A;  4LER A;  3ZW3 A;  3ASO E;  2Y1L E;  3HVE B;  3CHP A;  2AJA A;  2LSU A;  5FWQ A;  4Q96 A;  4RQI A;  3DRA A;  4FHJ A;  2WXR A;  3LEW A;  3LJN A;  3MKQ A;  3UIO C;  4FJZ A;  4ILG A;  5KWD A;  2UY1 B;  5ANL A;  2M63 A;  3Q73 A;  2IQC A;  2EIM E;  1KPS B;  2BKG A;  2LNI A;  2H6G A;  3EHR A;  2P9U G;  5JJ6 A;  4KVM A;  1IHG A;  2XGO A;  4U8Y D;  3PRZ A;  4GZC A;  5FIO A;  2VGE A;  3LPZ A;  2X6H A;  3L22 A;  3G2W A;  1NI1 A;  1Y8M A;  3B95 A;  3DSX A;  5BV0 A;  2H6I A;  5D66 A;  4EZJ A;  3UKR G;  3Q49 B;  3UUX A;  3LVR E;  2XS8 A;  1N4R A;  5A23 A;  3L16 A;  4DUI A;  4DK5 A;  3ABK E;  4ACK A;  3APC A;  5AJL A;  3ASH A;  1H0A A;  3DSW A;  5ENQ D;  5FTP A;  4ZHB A;  4HNA D;  1PC2 A;  4BY6 A;  5A6C A;  4CCA A;  1QBQ A;  4H7X A;  2GRL A;  2XEE A;  3FTX A;  3GW4 A;  3P2B A;  4B0Z A;  2J9Q A;  3UMV A;  1K1A A;  4DX5 D;  4G8L A;  2RFA A;  1FVH A;  3EHQ A;  3NAW A;  3NB2 A;  4BEP A;  2KBX A;  4F1P A;  1BI8 B;  1JPL A;  2BED A;  3OXF A;  3E37 A;  1BU9 A;  1PY1 A;  5CBN A;  3L13 A;  4U0S A;  4BT8 A;  3C3Q A;  2IF4 A;  3RAU A;  4L2Y A;  3B7U X;  3C3R A;  2PNN A;  2DZN A;  2P9S G;  1U3D A;  4G23 A;  3ZYM A;  5HQ8 A;  4GTS A;  3FUH A;  4K5A B;  1DCQ A;  4IRU A;  3OXG A;  3U64 A;  3DSV A;  3U66 A;  4MBG A;  3NZU A;  4GPM A;  5KNG A;  4XZ4 A;  1JCS A;  3QC1 A;  3E32 A;  2NYJ A;  2J4D A;  2ZXW E;  3TJP A;  3FTS A;  1A5E A;  5AAR A;  3FTY A;  3L6A A;  1WG0 A;  1IQU A;  2BTD A;  2A4Z A;  1H2T C;  1H6P A;  1HH8 A;  4I17 A;  4I6G A;  2OVF A;  3O4Z A;  4J8D A;  5JMN D;  1VDY A;  1SVX A;  3G2S A;  3SFY A;  2XGS A;  4U0U A;  4I43 A;  3SFX A;  2P58 C;  2L0I A;  4UWL A;  3CVQ A;  2IU1 A;  2IFU A;  4JXT A;  4PS3 A;  3HYM B;  4J0U A;  4UWK A;  2ZU6 B;  4BT9 A;  2WQ6 A;  2AXZ A;  2XCC A;  3EDT B;  3SBT B;  2IJG X;  3CVP A;  3ISM C;  3Q5M A;  2IO2 C;  5T8I A;  4F53 A;  2WXP A;  3FUJ A;  1UN8 A;  3GZ1 A;  4KZ0 A;  4JA7 A;  4PH4 B;  4A3T A;  3S7J A;  2IOL A;  2EIK E;  5BUZ A;  3HIZ A;  3K9I A;  3AS8 A;  5AEN A;  4BX9 A;  4NQ0 A;  2AXU A;  4HLL A;  4JA9 A;  4GYY A;  4GTV A;  5BW8 C;  4BWR A;  5LCW J;  3TWR A;  3FH8 A;  2FF4 A;  3TG5 A;  3CKC A;  5B1B E;  3UPV A;  2CFU A;  3QWP A;  1OWN A;  1OWP A;  1E96 B;  2LAI A;  3LY8 A;  1MX6 A;  3X2Q E;  5G05 J;  3SHF A;  2BUG A;  2KXP C;  1MJ0 A;  2XEH A;  3KS2 A;  5CRU A;  3LDZ A;  4GA0 A;  3PEU B;  5C1D A;  2J08 A;  1IXV A;  3LJ3 A;  3ZXS A;  5HRY A;  1X81 A;  2VJ8 A;  4F6R D;  5CEA A;  4DX7 D;  3UKU G;  2FUL A;  1W3B A;  3ONK A;  1NP7 A;  4GTT A;  1JWF A;  3LKU A;  4CDR A;  1OUV A;  1WM5 A;  4EZK A;  3SI5 A;  3JQ0 A;  3CGH A;  2XPY A;  4OVU A;  3APD A;  2VGX A;  4I1M A;  3AS5 A;  3VTX A;  4JZY A;  2LUH A;  2VTB A;  4G26 A;  4DLO A;  3BEE A;  4B8C B;  4BET A;  4HOT A;  1MX4 A;  3C98 A;  3HG0 D;  4AY5 A;  1INZ A;  4L1B A;  3Q79 A;  2WXO A;  4U96 D;  3KSL A;  3I4G A;  2DZO A;  3C5R A;  3KEA A;  3QOU A;  5B3S E;  5CMW A;  1HZ4 A;  1SW6 A;  3EHM A;  3MV2 B;  2I1J A;  2WXG A;  2CHZ A;  3QK0 A;  1Z5S C;  3MGB A;  4BTB A;  5AQ9 A;  3CKB A;  4O60 A;  4IYP A;  3ULQ A;  1N95 A;  4KVO A;  4QFV A;  2HM8 A;  3DEP A;  4JEH A;  5AJD A;  3N71 A;  3CVU A;  2GRO B;  2IO3 C;  3D9O A;  3URZ A;  3LY9 A;  3APF A;  2WXJ A;  5EX3 A;  5KCM A;  4B8A A;  1SZ9 A;  3DPD A;  5KBA A;  2HR2 A;  3MZL B;  2WXH A;  1O5M A;  4G25 A;  4E6H A;  3SD5 A;  3C3O A;  3DSS A;  5C2Y A;  2YHC A;  1FVF A;  3FP3 A;  2LAH A;  5FZQ A;  3AG1 E;  1HS6 A;  5ANR A;  1DC2 A;  3F6Q A;  2XPZ A;  4AY6 A;  5A7D B;  4BX8 A;  5HS0 A;  2MRI A;  1UW4 B;  4FUL A;  2ETC A;  2QY7 A;  4G8K A;  2MYO A;  1HG2 A;  3RIB A;  3FDH A;  2HE0 A;  2KCK A;  3D9L A;  3B7T A;  3TWW A;  4N5C A;  3D9P A;  4HRN A;  5CMY A;  4N3B A;  4ABN A;  1MHQ A;  4GYO A;  2YIN A;  4UWH A;  3RSE G;  2Y4T A;  1TNY A;  4UWG A;  4GZ5 A;  3AU4 A;  4APF A;  5KJN A;  4W9R A;  3CVW A;  2AXV A;  4EBA A;  1N0Q A;  4N3A A;  3QWV A;  5JA4 D;  1ELK A;  3I4R B;  3PZ2 A;  2P2C P;  3E30 A;  3AG4 E;  1S63 A;  4YVQ C;  1Z3X A;  3U9W A;  3PRE A;  4WWO A;  3RO2 A;  3DXK G;  2J49 A;  2DYR E;  3PUJ A;  4TXQ A;  1ELR A;  2EIL E;  2X6I A;  2WVI A;  3ONL A;  3NOC D;  2R02 A;  3RJV A;  4O6F A;  1KZO A;  4GA1 A;  3ZHE A;  4Q69 A;  5BV1 A;  3FFL A;  3U3W A;  3J5P A;  2A5E A;  2HYZ A;  3ZFW A;  3PS6 A;  5LOZ A;  2XRZ A;  3J5Q B;  3FUI A;  4FHK A;  2OEV A;  4UWF A;  2QYJ A;  5HI7 A;  1IKN D;  3ZYQ A;  3FY4 A;  4JEU A;  4DPR A;  3L08 A;  3GZS A;  4JPS A;  1NL4 A;  2AVP A;  4EEC A;  5M72 A;  4N3C A;  5KJK A;  1D8E A;  5ENR D;  4EZL A;  4JB8 P;  4WUY A;  3Q7A A;  1N0R A;  4AOF A;  4APO A;  3S7F A;  3O48 A;  5JHA A;  1TJC A;  3OXL A;  3ZUV B;  3LXU X;  1XNF A;  2R03 A;  5EDS A;  2R5S A;  4AM9 A;  3TWX A;  2KZT B;  4LUN U;  4DI4 A;  4UI9 C;  4PUC A;  3CSF A;  1KT0 A;  2WXN A;  4NIK A;  2OEW A;  5CRV A;  3UM3 A;  3ESK A;  3D3M A;  3UM1 A;  1KLX A;  3UM0 A;  2WXI A;  4IN3 B;  4DX6 D;  2JEK A;  2V5Q C;  3CEQ A;  3MV3 B;  5JJT A;  3TG4 A;  2GRR B;  1E7U A;  3FUE A;  4XE0 A;  4WNE A;  2V4H C;  4LEU A;  5CHE E;  4ACL A;  1Q2Z A;  2XGM A;  5ENO D;  4GZ3 A;  4LCT A;  2CHW A;  3RU0 A;  2YHE A;  2ETA A;  2GRM A;  3ASN E;  4U95 D;  5T4Y A;  5AQ7 A;  4GTQ A;  3E34 A;  3DEO A;  3HDX A;  4J7W A;  2XEV A;  5AN8 A;  1SQM A;  4CDN A;  2VGY A;  1EDU A;  2J09 A;  2I6H A;  4C9B B;  1FT1 A;  4CRW A;  2OOE A;  1OT8 A;  3IHY A;  3ULY A;  3LYA A;  3EHN A;  1JCQ A;  1HF8 A;  4J8F A;  4ANW A;  2P9K G;  3QKY A;  5G04 C;  3PNT B;  3AU5 A;  4EPZ A;  4URK A;  5LCW C;  1MYO A;  1E8W A;  2J07 A;  1UOH A;  4HRM B;  1N4Q A;  3SZ7 A;  3IEG A;  2GRN B;  3UTM A;  3HXE A;  1OCC E;  2F8X K;  3FU0 A;  4A1G A;  3CHO A;  4GB9 A;  3FH7 A;  4WAF A;  3LVQ E;  1BI7 B;  3ZKJ A;  4K0R A;  1EPU A;  2WXF A;  1ZU2 A;  3KEZ A;  3NQP A;  1TN7 A;  4PDX A;  4AP2 A;  3R9A B;  3SNX A;  1NZN A;  3MEK A;  3MYV A;  3PE4 A;  4K5C A;  2V8S E;  4ANU A;  3VTY A;  4F7A A;  2WMN A;  5EKQ D;  3W9F A;  5CCL A;  4D10 C;  2Y3A A;  3UM2 A;  4AVX A;  2XEN A;  1Z6T A;  2XCB A;  3PZ3 A;  2EIN E;  4G1T A;  4O1O A;  1FCH A;  3Q47 B;  1S70 B;  4RLY A;  3FUD A;  2DCP A;  3UX4 A;  2GGF A;  1H6K A;  3ML9 A;  2J4B A;  3ASD A;  1U2V G;  4HVB A;  4U63 A;  5BPP A;  5D0O D;  4GU5 A;  2YQ8 A;  4U0Z A;  4RG9 A;  3SO8 A;  3S2A A;  3ULE G;  1V54 E;  4GA2 A;  3PVL A;  2WXQ A;  1LF8 A;  4H7Y A;  2PM7 A;  3AS4 A;  2UWJ G;  1GW6 A;  2WQ7 A;  2WQH A;  1TNZ A;  3SGH A;  2PM6 A;  4B93 B;  5CBO A;  4U8H A;  4R7L A;  4V3I A;  3TWU A;  5CER B;  1BPO A;  2L6B A;  5CED B;  2WB2 A;  3CST A;  1ZBP A;  4CDM A;  5IY5 E;  4DLQ A;  4NUR A;  2QYU A;  3CK7 A;  4XX5 A;  3JQ1 A;  2DYS E;  3CIA A;  2H6H A;  3AG3 E;  1P5Q A;  5E75 A;  2V4L A;  4MKT A;  2FO7 A;  4WNG A;  4KXK B;  3R7Q A;  4EHM A;  3QAR A;  3UIN C;  5EYL A;  5ENT D;  2RG8 A;  3MKQ B;  2NSZ A;  1A17 A;  4CEM A;  4ZFH A;  1BD8 A;  3HVE A;  2I1K A;  2JLB A;  2P9I G;  1SZA A;  2ZGD A;  3D9J A;  4YDE A;  5D0Q D;  1D8D A;  3FUF A;  3ABM E;  3Q78 A;  1EF1 C;  2XS1 A;  4EQF A;  1MQS A;  3RO3 A;  4RSY A;  2MHK A;  1YA0 A;  5E76 A;  4N2Q A;  2UY1 A;  1N94 A;  3MCX A;  5T3R A;  1N52 A;  4WWP A;  3TGO A;  4K03 A;  4JHJ A;  1QNF A;  3CVX A;  1TNU A;  3BG0 B;  3VLD A;  4B94 A;  3PDN A;  4AEZ C;  4JD2 G;  4HB5 A;  1RW2 A;  1Y6I A;  3HXB A;  1IQR A;  2VSN A;  4QQI A;  5LX8 A;  5D2M C;  3D9N A;  3OTN A;  4RVB A;  3R9M A;  4LRZ A;  1RZ4 A;  1E8Z A;  5FQ6 A;  2HO1 A;  3TXM A;  1AP7 A;  1YMP A;  1KZP A;  4JHR A;  1N11 A;  1H6O A;  3G2V A;  3CHM A;  4LNG A;  5AQA A;  1ELW A;  3FTZ A;  3VLF A;  4WND A;  3S7B A;  3V2X A;  1OCZ E;  3I3N A;  3FU3 A;  4XKB A;  2E2E A;  1FPP A;  3V31 A;  4DJA A;  1Z3Y A;  3ENE A;  3FUK A;  3AJI A;  1H2V C;  4FU3 A;  4Y6W A;  5BXU A;  2RFM A;  2XZD G;  4L7T A;  5FJY A;  2P9P G;  3FTW A;  3GYZ A;  4AXH A;  4DX2 A;  2AW6 A;  3CQC B;  2P9N G;  1MZC A;  1U3C A;  4OYS A;  4HOQ A;  3CHS A;  2I2O A;  4G2V A;  4C0M A;  2BKK B;  2H6F A;  2Y69 E;  3ASF A;  4UQY A;  2R59 A;  4U04 A;  3B7S A;  2VQ2 A;  4AIF A;  4RG6 A;  4Q94 A;  4UQX A;  2E0I A;  4HI9 A;  5ENN A;  4JC8 A;  5FQ4 A;  5FIN A;  1OCR E;  3DXM G;  3VLE A;  5EYP F;  2RD0 A;  3DSU A;  4G11 A;  3TXN A;  4FAD A;  3C72 A;  1N4P A;  4E85 A;  3EJN A;  3KSQ A;  2L0T B;  3FU6 A;  2DWZ A;  3CVN A;  4G24 A;  4MLP A;  4C0E A;  5JJ7 A;  5AQB A;  5ARF A;  4LG6 A;  5EID A;  1HFA A;  4GMJ A;  2GRP B;  3JCK C;  2F8Y A;  3BG1 B;  4M3O A;  2NC9 A;  5AYW D;  1HO8 A;  4CGW A;  3IBE A;  4GTR A;  5KJM A;  2VSY A;  1JWG A;  3JXJ A;  3CV0 A;  3CHR A;  4ILI A;  3Q75 A;  2FI7 A;  4BTA A;  4N5Q A;  4YND A;  4LSZ E;  3RKV A;  4GML A;  3SY2 A;  5LFA A;  1TN8 A;  3TAX A;  4GZ6 A;  2LXL A;  3P1U A;  1DNP A;  1UG3 A;  3S7D A;  4DRX E;  1E8X A;  3E33 A;  3CK9 A;  4XKC A;  2C2L A;  2WXM A;  2WPV A;  4BSZ B;  3OAW A;  1O1R A;  1NA0 A;  4FLH A;  1EYH A;  3NZS A;  3FUN A;  4CYM D;  3TL5 A;  5BT1 A;  3CVY A;  4KZC A;  2WM9 A;  2RKK A;  2GW1 A;  5EX0 A;  3SBS A;  2F37 A;  3HXC A;  4I9E A;  5HKP A;  3G2T A;  2X6J A;  4UQZ A;  1HU3 A;  4A55 A;  2V0P A;  3Q4A B;  2P9L G;  5ARG A;  3JXI A;  3BU8 A;  2CFZ A;  2PQN A;  2KM4 A;  3D9H A;  2VSO E;  1QQE A;  1OWL A;  2VGX B;  1N4S A;  3B7R L;  2VTB B;  4TXR A;  3UI2 A;  4MS6 A;  1IHB A;  1FT2 A;  3T9K A;  3L54 A;  2PZI A;  4TUU A;  4OAV B;  1DCE A;  3PEV B;  3ZN3 A;  2FO1 E;  3BQO A;  3AAA C;  1S0P A;  4HFG A;  3D9K A;  3CR3 A;  3EUV A;  3ZPJ A;  4PS8 A;  4BFR A;  2OV8 A;  4MRU A;  5BNW A;  3CHQ A;  4GMR A;  4GAA A;  1XGW A;  3SQV A;  1E8Y A;  1O1T A;  2L6J A;  3UXG A;  5B1A E;  4ANV A;  4HOR A;  4J8S A;  3PZ4 A;  4P29 A;  2IY0 C;  2EQX A;  3G2U A;  2Y4U A;  4HI8 A;  2X6F A;  4I2Z A;  4I2W A;  3EIQ C;  1YCS B;  4HBD A;  1PAQ A;  3UT8 A;  3Q15 A;  4F3V A;  3JUI A;  5J08 A;  1TNO A;  4XEI G;  1TEZ A;  3T5V A;  2XRY A;  5G55 A;  3SFZ A;  5EIL A;  3QJZ A;  5JHB A;  4EBA G;  2LSV A;  5DIZ A;  3LCA A;  3UT4 A;  4XIF A;  4U8V D;  1B89 A;  3ZNG A;  3T5X A;  4GCN A;  4JVS A;  3PUK A;  3RRU A;  4NAC A;  2A5U A;  3ZXP A;  1TNB A;  4TXP A;  5G05 C;  1WY6 A;  2B6C A;  3HRA A;  1HG5 A;  2DBA A;  3HXF A;  4GYW A;  3CVL A;  4KBQ A;  4HLE A;  4M7C A;  1YYH A;  3CLJ A;  4ATZ D;  1E90 A;  2ILR A;  4FP7 A;  4UI9 J;  1TR4 A;  2ZIS A;  4L9P A;  3FWV A;  4KT6 B;  3ZYK A;  4TRQ A;  2C0L A;  3U4T A;  1N54 A;  4K5B A;  4YDO A;  3ZEF A;  4ME2 A;  3ZYL A; 
#chains in the Genus database with same CATH homology
 3DPY A;  3DSX A;  1TN8 A;  2H6I A;  1O1T A;  3HXD A;  1D8E A;  4GTO A;  1MZC A;  1TNU A;  3PZ4 A;  3Q7A A;  1TNY A;  1JCR A;  1TNZ A;  3E33 A;  1LTX A;  1LD7 A;  1N4R A;  1TN6 A;  1SA4 A;  3DST A;  4GTP A;  3DSW A;  3HXB A;  2H6F A;  1N4Q A;  1O1R A;  1N95 A;  3HXE A;  3SFY A;  1QBQ A;  3PZ2 A;  3E30 A;  1TNO A;  1X81 A;  2ZIR A;  1S63 A;  3SFX A;  1SA5 A;  1S64 A;  1O1S A;  2H6H A;  3HXC A;  3Q7F A;  1KZP A;  4GTT A;  1TN7 A;  4EHM A;  1LD8 A;  2BED A;  4LNG A;  3E37 A;  3DSU A;  1O5M A;  3EU5 A;  1KZO A;  1N4S A;  3C72 A;  1N4P A;  3DSS A;  3KSQ A;  1TNB A;  1FT2 A;  3DRA A;  2F0Y A;  1N9A A;  4GTQ A;  4GTM A;  2R2L A;  4GTS A;  3E34 A;  1DCE A;  3HXF A;  4YDE A;  1FPP A;  3Q73 A;  4GTR A;  3PZ3 A;  1D8D A;  2H6G A;  3Q78 A;  1FT1 A;  4LNB A;  2IEJ A;  3DSV A;  4GTV A;  4MBG A;  3EUV A;  3Q75 A;  2ZIS A;  4L9P A;  3Q79 A;  3KSL A;  1JCQ A;  1N94 A;  3PZ1 A;  1NL4 A;  1JCS A;  4YDO A;  3E32 A;  1NI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...