1O1TA

Structure of fpt bound to the cvim-fpp product
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Biochemical and Structural Studies with Prenyl Diphosphate Analogues Provide Insights into Isoprenoid Recognition by Protein Farnesyl Transferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 125
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1o1tA00
3Q7AA 1TNUA 4GTSA 1D8DA 1N4PA 3DSTA 1LTXA 3E32A 1X81A 1N94A 3DSXA 1FT2A 1O1TA 3E34A 1S63A 3SFXA 1N4SA 2H6HA 1JCQA 3E30A 1N9AA 4YDEA 4YDOA 1MZCA 1SA5A 1LD7A 1JCSA 1N4QA 4GTQA 3KSLA 2H6GA 4GTTA 1FPPA 4GTMA 1LD8A 3EUVA 1TNOA 3DSUA 3PZ3A 3DSWA 1O1SA 3E37A 3E33A 4GTVA 1TN6A 4GTOA 2R2LA 4GTPA 3C72A 1N95A 4GTRA 1SA4A 3HXBA 3DSSA 3PZ2A 1O1RA 3DRAA 1NL4A 2H6FA 3PZ4A 2F0YA 1S64A 3Q78A 1FT1A 3Q73A 2BEDA 2ZIRA 3PZ1A 1TN8A 4LNGA 3Q79A 3Q7FA 1D8EA 4EHMA 1TNZA 3EU5A 2ZISA 4MBGA 1DCEA 3HXFA 4LNBA 1TNYA 2IEJA 3HXEA 1KZPA 3HXDA 1JCRA 4L9PA 1TN7A 1NI1A 1N4RA 3DPYA 3HXCA 3SFYA 3DSVA 3KSQA 1QBQA 1TNBA 1KZOA 1O5MA 3Q75A 2H6IA
chains in the Genus database with same CATH superfamily
3HDXA 3Q7AA 3HIZA 1TR4A 2KCLA 3EHNA 3FUNA 5B1AE 3MX3A 1SZ9A 4ACKA 2WXIA 2OVBA 3LEWA 3KD7A 2OEWA 4Q69A 2QZAA 3QJZA 2BUGA 5FTPA 3UMVA 2FI7A 3ONLA 3V31A 1MYOA 4J8SA 4FC8A 3RU0A 2H6GA 2HE0A 2NXPA 5G55A 4GTTA 3TWSA 4J7WA 2WXOA 1ELWA 1TNOA 4TXQA 2L0TB 4DPRA 1HU3A 3HVEB 2AW6A 4ANXA 3C5RA 1TN6A 1ZBPA 2V0PA 3UTMA 2YINA 2R59A 2CHWA 2VSXE 4GTRA 2X6JA 4APFA 5BNWA 4ANVA 2V4HC 4HRMB 3CKBA 5ENRD 3CVYA 2OV8A 4I9EA 3SZ7A 1NA3A 1JUQA 2IF4A 5J08A 4LNGA 2FF4A 3OXGA 3Q79A 4X8QA 2WQHA 4I43A 3APDA 5FWQA 4JHJA 3V2XA 3AG2E 4TUUA 2V5QC 3B7TA 4L1BA 3UM0A 4BERA 2IQCA 5J90A 3PUKA 4CDNA 2IO3C 5CMYA 4H7YA 4C0EA 1MX6A 1N4PA 3FUKA 3LCAA 2AXVA 3DBSA 5KJNA 1ELRA 3TAXA 1DC2A 3FTZA 2V5FA 3QK0A 1U3DA 3FHEA 4GMJA 5C2YA 1SA5A 3LKUA 2FO7A 3MGBA 4J0UA 1BU9A 4DI4A 3IBEA 4GTMA 2ONDA 1HXIA 3DSWA 1WG0A 2XQ0A 3PZDA 2CG3A 5LCWC 2GRRB 3AG4E 2EINE 2BKGA 5FZQA 2UY1B 4K0RA 1SA4A 4ZFHA 4LNUD 1WY6A 4F1SA 2ZXWE 2PQRA 2V8SE 4L23A 3ZFWA 2R03A 2A5UA 3B7RL 4A3TA 5EX0A 3VTYA 4KMOA 1K3ZD 3AU5A 4DK5A 1D8EA 4GU5A 2IONA 4BY6A 2KCKA 3AS5A 2I1JA 4C0MA 3FUIA 3S7FA 1KZPA 4M3OA 3FTVA 3I5PA 3HXCA 4DX1A 2GROB 1H2VC 4ILIA 4GPKA 4J8FA 1S70B 3TL5A 2B0OE 2XRYA 3ULQA 3PREA 4GTSA 5EN5D 3DSTA 1LTXA 2WXGA 2J9QA 4ATGA 1FT2A 2P9KG 3SO8A 4HORA 3UIPC 2RFMA 1N54A 3Q15A 3CLJA 5EILA 2P9LG 3FH7A 1DCQA 4JZYA 1LD8A 1PC2A 5CRVA 5AQAA 2I2OA 3TXMA 3PE4A 2IOSA 5AENA 1KPSB 3CVXA 2XHEA 3ASHA 2P9PG 2RFAA 2HO1A 3ZGQA 3FUJA 1OY3D 1YA0A 5KCMA 4CYMD 1Q2ZA 2ETCA 2WXFA 4PS8A 1OT8A 4UUCA 3UUXA 1V55E 4NACA 3CQGB 3PRZA 1X5BA 4CRWA 3Q7FA 1BLXB 4N5QA 4HOUA 1OCZE 3V79K 5BT1A 3T8MA 2KCVA 2OVFA 3UQ3A 5G05J 3TWQA 3CHPA 1FCHA 4I6JA 3RAUA 4YDWA 4NQ0A 1QBQA 3RRMB 2XEVA 5T4YA 3CSFA 4CT4A 4UQYA 2J49A 4G2VA 3C3QA 5FZSA 1INZA 1D8DA 1BPOA 3CK7A 3SY2A 3B7BA 1HS6A 2IU1A 4CT0A 5ENOD 3ASDA 1K8KG 3SFXA 2BKKB 2YQ8A 3JUIA 2XZDG 3LPZA 5LX8A 3EHQA 2AVPA 1MZCA 1RZ4A 4HRNA 2X6KA 3TWXA 4AY5A 1Y6IA 3SBSA 3PZ3A 1Z6TA 5EIBE 3EHRA 3L9TA 1H2TC 4B8CB 4F6RD 4A63B 1OCCE 5HRYA 1U3CA 2AXZA 4FHJA 1FT1A 2ZIRA 4I1AA 2X6HA 4WWPA 2BTDA 5LP0A 3LVRE 3KS2A 4EZJA 4H7XA 1OWLA 2VGYA 3QWWA 3HXDA 2VYIA 3R9MA 3CQCB 2CG2A 2WXMA 2WMOA 5D66A 3CVPA 1K1BA 1OWNA 3D9MA 4BT8A 4O1OA 3ASOE 4HOQA 1D9SA 2WXKA 3MJWA 3ZN3A 3T9KA 2CHZA 1V54E 3E32A 3ENEA 3P1UA 2OEVA 4EZLA 4BTBA 5JA4D 3RK6A 4J8YA 4ACLA 5CECB 4BX9A 2DZNA 2GRLA 3FU0A 1WM5A 3L16A 5ARFA 1Z3XA 2Y4TA 2CFUA 4AY6A 5G05C 4TRQA 4GAAA 2LAIA 4GTQA 3QB2A 2PL2A 3LY9A 4HXIA 3O48A 4BSXA 2DVWA 4HLLA 5CEDB 3HRAA 4DX7D 4GTPA 4J8EA 4LUNU 1N0RA 5FQ6A 5A7DB 3VTXA 3ZVVA 2P9UG 5HKPA 4A55A 4GYWA 2R05A 4YVQC 5FINA 1QNFA 5HQ8A 3CKCA 3PZ1A 2QFCA 4GA2A 4N3BA 5ANLA 2ZISA 1DNPA 4JL0A 1TNYA 2I1KA 3ZYLA 3UPVA 4HVBA 3DSVA 3Q49B 1KT0A 2R17C 3ZW3A 5BXUA 3OXLA 4F53A 5BV0A 4HOSA 2VSNA 3GYZA 4XE0A 2LNIA 3L22A 4OAVB 1TNUA 2HYZA 1OUVA 2J8SD 4I1MA 2L6JA 3D9NA 5CEAA 1OCOE 5JHBA 3SBTB 2C2LA 4N3AA 4UWLA 2Y4UA 3L82A 3T5VA 4XKCA 2WVIA 4RVBA 4LEUA 3JQ0A 2LUHA 3DXMG 5CRUA 5AQ9A 3FEYA 4I2ZA 2ZU6B 4KT6B 1FPPA 2DIWA 3DSUA 1NP7A 3PEVB 2LAHA 3NBNB 4GZDA 1TEZA 3CVQA 2J07A 4OAUC 3C72A 3OXFA 2CFZA 2XEEA 3D9HA 2KATA 4IULA 4DX2A 2L0IA 3ML8A 1SVXA 2EQXA 3APCA 2H6FA 4PDXA 3LXUX 3O4ZA 2P9NG 1S64A 3EIQC 3RO3A 2KZTA 4HB5A 1QQEA 3MZLB 5LFAA 1TNZA 3ZXSA 3LS8A 1DCEA 3D9IA 1WAO1 4ILGA 3T5XA 2FBNA 4NRHB 1N4RA 2XGSA 3KSQA 2WXJA 4UQZA 3JYSA 2VGEA 3ZU7B 4LERA 5HI7A 3L08A 4TUMA 4U0UA 5AYWD 3MEKA 1EF1C 3C3RA 3Q4AB 4N5CA 5EIDA 4FJYA 2L9BA 4RG6A 2EILE 1G3NB 1EPUA 4AP2A 4U95D 2AWIA 2A5EA 2MRIA 4AOFA 3B13A 3FFLA 3E33A 2B6CA 2P9IG 3I3NA 4CEMA 3CHRA 2MOWA 4Q96A 5LOZA 5KNGA 4LG6A 1IHGA 1O1RA 2IFUA 3IXEA 4OVUA 1GW6A 4W9RA 2XGOA 4R7LA 1JWGA 2UWJG 4CGWA 2DYSE 4HI8A 4HI9A 3FULA 3QC1A 1E8ZA 3B7SA 2E0IA 2NYJA 1XNFA 1UN9A 4Q94A 1IKND 3PDNA 4HFGA 4GYOA 4MKTA 3CV0A 3DPYA 5KWDA 4B89A 3FU6A 4RLYA 5JHAA 3HG0D 3U9WA 2H6IA 4EPZA 3Q9UC 3RIBA 3JXJA 2PNNA 3DSXA 4FLHA 4I1OB 1TJCA 2WXRA 4L2LA 4MRUA 4JEUA 1EDUA 3S7JA 3FTUA 3UKUG 3FUMA 1TJFA 5G04C 1UOHA 4JHKA 2I9CA 2VJ8A 4B93B 2EIKE 1O1SA 3URZA 5JJTA 3LJ3A 4F7AA 4UWFA 3MKRA 5JJ6A 4HNAD 3LY8A 3HXBA 3ZKJA 1QYMA 5EYPF 3TG5A 3ESKA 5D0OD 2F0YA 3KAEA 4OYSA 3NOCD 3Q73A 1L5JA 3DEOA 2KC7A 3UM1A 3UT4A 1P5QA 3AS4A 2J09A 3GZ2A 3QWVA 1VDYA 3EU5A 4GYYA 4KBQA 2WPVA 2EIME 1SW6A 2YNQA 3CVVA 4DJAA 3DEPA 3DXKG 1N52A 3QKYA 4RSYA 2I6HA 2WXNA 4DRXE 4N39A 1E8YA 4F1PA 3UKRG 3ONKA 2KZTB 3FUEA 4FLBA 3D3MA 4ATZD 3L6AA 3JCKC 4G25A 5E75A 3ZYKA 4PS3A 4GMRA 5T8IA 4HQDA 3FUHA 2BF0X 3IEGA 4DLOA 1MJ0A 1S63A 4K5AB 5BPPA 5FQ7A 3W9FA 1N4SA 3TWUA 2QY7A 3JXIA 3QARA 2GRQB 5AN8A 2XZTG 5ENTD 3CHQA 1OWPA 4L7TA 4WWNA 3VLDA 2YHCA 3JQ1A 3ZYMA 1AP7A 2GW1A 4G8LA 3NF1A 1A5EA 4XI0A 4FA6A 4UWHA 2LO6A 4G11A 2WM9A 5HS0A 2EIJE 1A17A 3UINC 3F6QA 1UN8A 2FULA 3L17A 4I17A 2OCCE 2Y1LE 4G8KA 5A6CA 3LY7A 5JJ7A 5IY5E 2BEDA 2Q7FA 4J8DA 3TJPA 5BV1A 4BETA 2L6BA 1IYGA 4E6HA 3FUDA 3HVEA 3QDNA 1NZNA 4FADA 1HFAA 5CBOA 2DCPA 2LXMA 4TXRA 4BX8A 2AXUA 4GZ6A 3Q75A 4TXPA 4K5BA 3UIOC 5ENPD 4DX5D 4DX6D 1IQUA 4N2QA 4U63A 3MYVA 3ZUVB 5B3SE 2Y0BG 4U0SA 3HHMA 4I2WA 4JW1A 2PZIA 5CHEE 4Z68A 3MKQA 3S7DA 1JCQA 3ZHEA 4YDEA 3FH8A 4ANUA 4BESA 3G2WA 2KM4A 4U7EB 5AAOA 5CBNA 1HH8A 3QWPA 5EX3A 3EU9A 3ABME 1MHQA 3ULEG 2NSZA 4WNGA 4I9CA 3LDZA 2M63A 4BT9A 5A23A 4YNDA 1QZ2A 3FTSA 4A1GA 1HO8A 4U04A 4IRUA 4WWOA 5KJKA 4ANWA 3KEAA 3I4GA 1UG3A 3D9OA 3DWLG 2F8XK 5ENQD 1TYQG 4Y6CA 3SFZA 2RD0A 3ABKE 2VSOE 4URKA 4HBDA 4KVOA 3SI5A 3FUFA 3R7QA 4FU3A 3ZPJA 2VTBA 5FQ8A 4EZKA 4N3CA 4KYOB 4L2YA 4KZ0A 3C98A 4JHRA 4PS7A 2J08A 2WXHA 2P2CP 3C3OA 3FY4A 1NA0A 2QYUA 2MHKA 2QYJA 1H6OA 3ZXPA 3ESLA 3GZ1A 1N9AA 3QAQA 2IO2C 2Y3AA 4KXKB 5D0QD 1IHBA 2C0MA 1JCSA 1LF8A 2R02A 2HR2A 3AS8A 3LJNA 1YMPA 4WAFA 5EYLA 2C0LA 1ZU2A 3EHMA 3RKVA 4IN3B 3SNXA 3G2SA 2GGFA 1NFIE 2XCCA 3KEZA 3TWRA 1FVHA 5KJMA 1N11A 3TG4A 3FEXA 2F37A 3V30A 3TWTA 1MX2A 3DRAA 4IYPA 3PEUB 2WB2A 2JEKA 3ULYA 2WMNA 3CVLA 4QFVA 1AWCB 3ZNGA 1HG5A 3UXGA 3AJIA 3MA5A 1H6PA 4MBGA 3FDHA 4WNEA 3MCXA 3HXFA 4LNBA 5DIZA 4E85A 5EDSA 4OVVA 4LSZE 4L9PA 1NI1A 3L54A 2FO1E 3EDTB 1ELKA 2VSYA 1IXVA 1TNBA 2VGXA 2A4ZA 1OCRE 3NB2A 4XZ4A 4AIFA 2IY0C 3B95A 2LXLA 3VLFA 3G2UA 4G24A 3S7BA 3UT8A 4AV7A 1X81A 2ETBA 5G04J 4GMLA 3SGHA 3FP3A 5ITZF 2ZGDA 3JUEA 2X6IA 4JEHA 2QC9A 5AIJA 1H2UA 3ASFA 2XPZA 1LD7A 3P2BA 3OTNA 1HE8A 4HLEA 3KSLA 3AG3E 1K1AA 1OXJA 1IQRA 2F8YA 2OOEA 5JMND 4LCTA 3U64A 4XX5A 4EQFA 3MKQB 1U2VG 3ZHEB 3DSSA 4JD2G 4UI9J 1E8XA 3G2TA 3CIAA 4KZCA 5H7PA 1E90A 4HOTA 1PY1A 1OWOA 5CERB 3K9IA 1HF8A 4DI3A 2IJGX 4I6GA 3BEEA 3CR3A 4J6IA 4U0ZA 3HXEA 3X2QE 3VLEA 3V2OA 4Y6WA 3RJVA 3UI2A 3FTXA 3MV2B 1DVPA 3FTYA 4G1TA 5KJLA 4APOA 3CK8A 3CVNA 3EIJA 5CMWA 5AARA 1XGWA 1SQMA 3BUAA 3D9KA 4XI9A 2PQNA 1RW2A 4FJZA 4B8AA 1E96B 1N94A 4JA7A 1BD8A 2JABA 3BG0B 4ILHB 4I6EA 3E30A 3CHOA 3ZEFA 5EKQD 1Y8MA 4UQXA 2VTBB 3W9GA 2XCBA 3DPDA 3SHFA 1N4QA 5KNHD 1KT1A 3L13A 4BFRA 3U3WA 3N71A 4GCNA 2V4LA 5ANRA 1JWFA 1SZAA 4O1PA 4GPMA 2LSVA 3PZ2A 1NL4A 3E4BA 1KLXA 3CEQA 5AJDA 2ZGGA 3EJNA 5BUZA 1YCSB 4O6FA 2LSUA 3LVQE 2X3MA 3NQPA 4V3IA 2R5SA 4C48B 1YYHA 4U96D 5AJLA 2HM8A 3ASNE 3I4RB 3TWWA 3PS6A 4JPSA 1TN7A 3CVWA 3SFYA 4AM9A 2DYRE 2E2EA 4MLPA 4UWGA 3WXXA 2XPYA 2XS8A 4UI9C 3LYAA 3HYMB 1UW4B 3R9AB 2XENA 3ASGA 4JXTA 1OWMA 3RO2A 4BEPA 3NZUA 5FQ4A 4A3VA 1UJJA 5KBAA 1O1TA 3QOUA 4EBAA 4MS6A 3Q47B 2H6HA 3FU3A 2VGXB 4B94A 3TXNA 4YDOA 3PE3A 4KVMA 3PNTB 5T3RA 3U66A 4AXHA 4WUYA 5CCLA 3FWVA 2RKKA 4K03A 4ABNA 4ZHBA 3RSEG 4GZCA 4DUIA 4JC8A 3CVUA 1BI8B 4GTVA 1MQSA 2Y69E 3UT7A 1Z5SC 4ME2A 4NURA 4NIKA 1HG2A 3G2VA 3TWVA 2KXPC 3TGOA 1HX8A 4F3VA 4WNFA 5ENNA 4M7CA 1N0QA 2X38A 1UJKA 4BTAA 4GZ3A 2IEJA 3S2AA 3SD5A 4WNDA 3PVLA 1EYHA 1KZOA 3PUJA 4O60A 1O5MA 4JA9A 3UM2A 2JLBA 4LRZA 5G2NA 3ZYQA 4U8VD 3ML9A 3GZSA 4GZ5A 3IHYA 3Q9NC 2J4DA 4CZ2D 4XIFA 3ZIMA 3CSTA 3FU5A 3CGHA 4XEIG 1HZ4A 3U4TA 3B7UX 3PH0C 3J5QB 4YVOA 4U8YD 2ILRA 4HRLA 2GRMA 2PM7A 2WXQA 2XEHA 4U07A 4CDMA 3EUVA 3NZSA 3OAWA 3E37A 5BXOA 4GTOA 1JPLA 1WDYA 5FJYA 3MV3B 1N95A 2AJAA 4EECA 5B1BE 1MX4A 3QNKA 3T8KA 4RG9A 1H6KA 3PZ4A 4G26A 3FH5A 4TV3A 2MYOA 3D9JA 3Q78A 4YDYA 3WG7E 2WQ6A 4EHMA 2ETAA 2FEZA 1H0AA 2YHEA 4G23A 3D9PA 1BI7B 4FHKA 3NAWA 3AG1E 2WXLA 2XS1A 3D9LA 1JCRA 1B89A 5FZRA 1Z3YA 4K5CA 1E8WA 3BU8A 4AJWA 4DLQA 2DWZA 3J5PA 4RQIA 2DBAA 2GRPB 2RG8A 3CHMA 4BSZB 4GA0A 2VQ2A 4AVXA 5E76A 1E7UA 3FTWA 2PM6A 3UX4A 1ZB1A 1PAQA 1S0PA 5AQBA 3IHVA 4CDRA 4XKBA 4A1SA 3E34A 2UY1A 3PNLB 3RRUA 4QQIA 3SQVA 5C1DA 3RRNB 4AEZC 3APFA 2WXPA 2XPIA 4HS2A 2IOLA 4B0ZA 4PH4B 4D10C 4PUCA 5AQ7A 4GA1A 1FVFA 4N2SA 5M72A 1H19A 3CHSA 2R2LA 1E7VA 2X6FA 2NC9A 5D2MC 3GW4A 3R7RA 4EBAG 5FT9A 4BWRA 2CHXA 3IV0A 2KBXA 3NOGD 3UM3A 4JVSA 4FULA 5BW8C 3SF4A 3AAAC 3Q5MA 1W3BA 4P29A 3ISMC 2P9SG 2J4BA 2XGMA 1TN8A 4UI9K 3ZRHA 3CK9A 3ABLE 4GB9A 5DBKA 4CGVA 4CCAA 2P58C 2DZOA 2GRNB 3AU4A 5CCMA 5FIOA 2XRZA 4U8HA 4JB8P 3BQOA 2WQ7A 4GCOA 4FP7A 3IKOB 5ARGA 4C9BB 5ENSD 4UWKA 5LCWJ 3BG1B
chains in the Genus database with same CATH topology
3Q7AA 1TNUA 4GTSA 1D8DA 1N4PA 3DSTA 1LTXA 3E32A 1X81A 1N94A 3DSXA 1FT2A 1O1TA 3E34A 1S63A 3SFXA 1N4SA 2H6HA 1JCQA 3E30A 1N9AA 4YDEA 4YDOA 1MZCA 1SA5A 1LD7A 1JCSA 1N4QA 4GTQA 3KSLA 2H6GA 4GTTA 1FPPA 4GTMA 1LD8A 3EUVA 1TNOA 3DSUA 3PZ3A 3DSWA 1O1SA 3E37A 3E33A 4GTVA 1TN6A 4GTOA 2R2LA 4GTPA 3C72A 1N95A 4GTRA 1SA4A 3HXBA 3DSSA 3PZ2A 1O1RA 3DRAA 1NL4A 2H6FA 3PZ4A 2F0YA 1S64A 3Q78A 1FT1A 3Q73A 2BEDA 2ZIRA 3PZ1A 1TN8A 4LNGA 3Q79A 3Q7FA 1D8EA 4EHMA 1TNZA 3EU5A 2ZISA 4MBGA 1DCEA 3HXFA 4LNBA 1TNYA 2IEJA 3HXEA 1KZPA 3HXDA 1JCRA 4L9PA 1TN7A 1NI1A 1N4RA 3DPYA 3HXCA 3SFYA 3DSVA 3KSQA 1QBQA 1TNBA 1KZOA 1O5MA 3Q75A 2H6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q7A A;  1TNU A;  4GTS A;  1D8D A;  1N4P A;  3DST A;  1LTX A;  3E32 A;  1X81 A;  1N94 A;  3DSX A;  1FT2 A;  1O1T A;  3E34 A;  1S63 A;  3SFX A;  1N4S A;  2H6H A;  1JCQ A;  3E30 A;  1N9A A;  4YDE A;  4YDO A;  1MZC A;  1SA5 A;  1LD7 A;  1JCS A;  1N4Q A;  4GTQ A;  3KSL A;  2H6G A;  4GTT A;  1FPP A;  4GTM A;  1LD8 A;  3EUV A;  1TNO A;  3DSU A;  3PZ3 A;  3DSW A;  1O1S A;  3E37 A;  3E33 A;  4GTV A;  1TN6 A;  4GTO A;  2R2L A;  4GTP A;  3C72 A;  1N95 A;  4GTR A;  1SA4 A;  3HXB A;  3DSS A;  3PZ2 A;  1O1R A;  3DRA A;  1NL4 A;  2H6F A;  3PZ4 A;  2F0Y A;  1S64 A;  3Q78 A;  1FT1 A;  3Q73 A;  2BED A;  2ZIR A;  3PZ1 A;  1TN8 A;  4LNG A;  3Q79 A;  3Q7F A;  1D8E A;  4EHM A;  1TNZ A;  3EU5 A;  2ZIS A;  4MBG A;  1DCE A;  3HXF A;  4LNB A;  1TNY A;  2IEJ A;  3HXE A;  1KZP A;  3HXD A;  1JCR A;  4L9P A;  1TN7 A;  1NI1 A;  1N4R A;  3DPY A;  3HXC A;  3SFY A;  3DSV A;  3KSQ A;  1QBQ A;  1TNB A;  1KZO A;  1O5M A;  3Q75 A;  2H6I A; 
#chains in the Genus database with same CATH topology
 3HDX A;  3Q7A A;  3HIZ A;  1TR4 A;  2KCL A;  3EHN A;  3FUN A;  5B1A E;  3MX3 A;  1SZ9 A;  4ACK A;  2WXI A;  2OVB A;  3LEW A;  3KD7 A;  2OEW A;  4Q69 A;  2QZA A;  3QJZ A;  2BUG A;  5FTP A;  3UMV A;  2FI7 A;  3ONL A;  3V31 A;  1MYO A;  4J8S A;  4FC8 A;  3RU0 A;  2H6G A;  2HE0 A;  2NXP A;  5G55 A;  4GTT A;  3TWS A;  4J7W A;  2WXO A;  1ELW A;  1TNO A;  4TXQ A;  2L0T B;  4DPR A;  1HU3 A;  3HVE B;  2AW6 A;  4ANX A;  3C5R A;  1TN6 A;  1ZBP A;  2V0P A;  3UTM A;  2YIN A;  2R59 A;  2CHW A;  2VSX E;  4GTR A;  2X6J A;  4APF A;  5BNW A;  4ANV A;  2V4H C;  4HRM B;  3CKB A;  5ENR D;  3CVY A;  2OV8 A;  4I9E A;  3SZ7 A;  1NA3 A;  1JUQ A;  2IF4 A;  5J08 A;  4LNG A;  2FF4 A;  3OXG A;  3Q79 A;  4X8Q A;  2WQH A;  4I43 A;  3APD A;  5FWQ A;  4JHJ A;  3V2X A;  3AG2 E;  4TUU A;  2V5Q C;  3B7T A;  4L1B A;  3UM0 A;  4BER A;  2IQC A;  5J90 A;  3PUK A;  4CDN A;  2IO3 C;  5CMY A;  4H7Y A;  4C0E A;  1MX6 A;  1N4P A;  3FUK A;  3LCA A;  2AXV A;  3DBS A;  5KJN A;  1ELR A;  3TAX A;  1DC2 A;  3FTZ A;  2V5F A;  3QK0 A;  1U3D A;  3FHE A;  4GMJ A;  5C2Y A;  1SA5 A;  3LKU A;  2FO7 A;  3MGB A;  4J0U A;  1BU9 A;  4DI4 A;  3IBE A;  4GTM A;  2OND A;  1HXI A;  3DSW A;  1WG0 A;  2XQ0 A;  3PZD A;  2CG3 A;  5LCW C;  2GRR B;  3AG4 E;  2EIN E;  2BKG A;  5FZQ A;  2UY1 B;  4K0R A;  1SA4 A;  4ZFH A;  4LNU D;  1WY6 A;  4F1S A;  2ZXW E;  2PQR A;  2V8S E;  4L23 A;  3ZFW A;  2R03 A;  2A5U A;  3B7R L;  4A3T A;  5EX0 A;  3VTY A;  4KMO A;  1K3Z D;  3AU5 A;  4DK5 A;  1D8E A;  4GU5 A;  2ION A;  4BY6 A;  2KCK A;  3AS5 A;  2I1J A;  4C0M A;  3FUI A;  3S7F A;  1KZP A;  4M3O A;  3FTV A;  3I5P A;  3HXC A;  4DX1 A;  2GRO B;  1H2V C;  4ILI A;  4GPK A;  4J8F A;  1S70 B;  3TL5 A;  2B0O E;  2XRY A;  3ULQ A;  3PRE A;  4GTS A;  5EN5 D;  3DST A;  1LTX A;  2WXG A;  2J9Q A;  4ATG A;  1FT2 A;  2P9K G;  3SO8 A;  4HOR A;  3UIP C;  2RFM A;  1N54 A;  3Q15 A;  3CLJ A;  5EIL A;  2P9L G;  3FH7 A;  1DCQ A;  4JZY A;  1LD8 A;  1PC2 A;  5CRV A;  5AQA A;  2I2O A;  3TXM A;  3PE4 A;  2IOS A;  5AEN A;  1KPS B;  3CVX A;  2XHE A;  3ASH A;  2P9P G;  2RFA A;  2HO1 A;  3ZGQ A;  3FUJ A;  1OY3 D;  1YA0 A;  5KCM A;  4CYM D;  1Q2Z A;  2ETC A;  2WXF A;  4PS8 A;  1OT8 A;  4UUC A;  3UUX A;  1V55 E;  4NAC A;  3CQG B;  3PRZ A;  1X5B A;  4CRW A;  3Q7F A;  1BLX B;  4N5Q A;  4HOU A;  1OCZ E;  3V79 K;  5BT1 A;  3T8M A;  2KCV A;  2OVF A;  3UQ3 A;  5G05 J;  3TWQ A;  3CHP A;  1FCH A;  4I6J A;  3RAU A;  4YDW A;  4NQ0 A;  1QBQ A;  3RRM B;  2XEV A;  5T4Y A;  3CSF A;  4CT4 A;  4UQY A;  2J49 A;  4G2V A;  3C3Q A;  5FZS A;  1INZ A;  1D8D A;  1BPO A;  3CK7 A;  3SY2 A;  3B7B A;  1HS6 A;  2IU1 A;  4CT0 A;  5ENO D;  3ASD A;  1K8K G;  3SFX A;  2BKK B;  2YQ8 A;  3JUI A;  2XZD G;  3LPZ A;  5LX8 A;  3EHQ A;  2AVP A;  1MZC A;  1RZ4 A;  4HRN A;  2X6K A;  3TWX A;  4AY5 A;  1Y6I A;  3SBS A;  3PZ3 A;  1Z6T A;  5EIB E;  3EHR A;  3L9T A;  1H2T C;  4B8C B;  4F6R D;  4A63 B;  1OCC E;  5HRY A;  1U3C A;  2AXZ A;  4FHJ A;  1FT1 A;  2ZIR A;  4I1A A;  2X6H A;  4WWP A;  2BTD A;  5LP0 A;  3LVR E;  3KS2 A;  4EZJ A;  4H7X A;  1OWL A;  2VGY A;  3QWW A;  3HXD A;  2VYI A;  3R9M A;  3CQC B;  2CG2 A;  2WXM A;  2WMO A;  5D66 A;  3CVP A;  1K1B A;  1OWN A;  3D9M A;  4BT8 A;  4O1O A;  3ASO E;  4HOQ A;  1D9S A;  2WXK A;  3MJW A;  3ZN3 A;  3T9K A;  2CHZ A;  1V54 E;  3E32 A;  3ENE A;  3P1U A;  2OEV A;  4EZL A;  4BTB A;  5JA4 D;  3RK6 A;  4J8Y A;  4ACL A;  5CEC B;  4BX9 A;  2DZN A;  2GRL A;  3FU0 A;  1WM5 A;  3L16 A;  5ARF A;  1Z3X A;  2Y4T A;  2CFU A;  4AY6 A;  5G05 C;  4TRQ A;  4GAA A;  2LAI A;  4GTQ A;  3QB2 A;  2PL2 A;  3LY9 A;  4HXI A;  3O48 A;  4BSX A;  2DVW A;  4HLL A;  5CED B;  3HRA A;  4DX7 D;  4GTP A;  4J8E A;  4LUN U;  1N0R A;  5FQ6 A;  5A7D B;  3VTX A;  3ZVV A;  2P9U G;  5HKP A;  4A55 A;  4GYW A;  2R05 A;  4YVQ C;  5FIN A;  1QNF A;  5HQ8 A;  3CKC A;  3PZ1 A;  2QFC A;  4GA2 A;  4N3B A;  5ANL A;  2ZIS A;  1DNP A;  4JL0 A;  1TNY A;  2I1K A;  3ZYL A;  3UPV A;  4HVB A;  3DSV A;  3Q49 B;  1KT0 A;  2R17 C;  3ZW3 A;  5BXU A;  3OXL A;  4F53 A;  5BV0 A;  4HOS A;  2VSN A;  3GYZ A;  4XE0 A;  2LNI A;  3L22 A;  4OAV B;  1TNU A;  2HYZ A;  1OUV A;  2J8S D;  4I1M A;  2L6J A;  3D9N A;  5CEA A;  1OCO E;  5JHB A;  3SBT B;  2C2L A;  4N3A A;  4UWL A;  2Y4U A;  3L82 A;  3T5V A;  4XKC A;  2WVI A;  4RVB A;  4LEU A;  3JQ0 A;  2LUH A;  3DXM G;  5CRU A;  5AQ9 A;  3FEY A;  4I2Z A;  2ZU6 B;  4KT6 B;  1FPP A;  2DIW A;  3DSU A;  1NP7 A;  3PEV B;  2LAH A;  3NBN B;  4GZD A;  1TEZ A;  3CVQ A;  2J07 A;  4OAU C;  3C72 A;  3OXF A;  2CFZ A;  2XEE A;  3D9H A;  2KAT A;  4IUL A;  4DX2 A;  2L0I A;  3ML8 A;  1SVX A;  2EQX A;  3APC A;  2H6F A;  4PDX A;  3LXU X;  3O4Z A;  2P9N G;  1S64 A;  3EIQ C;  3RO3 A;  2KZT A;  4HB5 A;  1QQE A;  3MZL B;  5LFA A;  1TNZ A;  3ZXS A;  3LS8 A;  1DCE A;  3D9I A;  1WAO 1;  4ILG A;  3T5X A;  2FBN A;  4NRH B;  1N4R A;  2XGS A;  3KSQ A;  2WXJ A;  4UQZ A;  3JYS A;  2VGE A;  3ZU7 B;  4LER A;  5HI7 A;  3L08 A;  4TUM A;  4U0U A;  5AYW D;  3MEK A;  1EF1 C;  3C3R A;  3Q4A B;  4N5C A;  5EID A;  4FJY A;  2L9B A;  4RG6 A;  2EIL E;  1G3N B;  1EPU A;  4AP2 A;  4U95 D;  2AWI A;  2A5E A;  2MRI A;  4AOF A;  3B13 A;  3FFL A;  3E33 A;  2B6C A;  2P9I G;  3I3N A;  4CEM A;  3CHR A;  2MOW A;  4Q96 A;  5LOZ A;  5KNG A;  4LG6 A;  1IHG A;  1O1R A;  2IFU A;  3IXE A;  4OVU A;  1GW6 A;  4W9R A;  2XGO A;  4R7L A;  1JWG A;  2UWJ G;  4CGW A;  2DYS E;  4HI8 A;  4HI9 A;  3FUL A;  3QC1 A;  1E8Z A;  3B7S A;  2E0I A;  2NYJ A;  1XNF A;  1UN9 A;  4Q94 A;  1IKN D;  3PDN A;  4HFG A;  4GYO A;  4MKT A;  3CV0 A;  3DPY A;  5KWD A;  4B89 A;  3FU6 A;  4RLY A;  5JHA A;  3HG0 D;  3U9W A;  2H6I A;  4EPZ A;  3Q9U C;  3RIB A;  3JXJ A;  2PNN A;  3DSX A;  4FLH A;  4I1O B;  1TJC A;  2WXR A;  4L2L A;  4MRU A;  4JEU A;  1EDU A;  3S7J A;  3FTU A;  3UKU G;  3FUM A;  1TJF A;  5G04 C;  1UOH A;  4JHK A;  2I9C A;  2VJ8 A;  4B93 B;  2EIK E;  1O1S A;  3URZ A;  5JJT A;  3LJ3 A;  4F7A A;  4UWF A;  3MKR A;  5JJ6 A;  4HNA D;  3LY8 A;  3HXB A;  3ZKJ A;  1QYM A;  5EYP F;  3TG5 A;  3ESK A;  5D0O D;  2F0Y A;  3KAE A;  4OYS A;  3NOC D;  3Q73 A;  1L5J A;  3DEO A;  2KC7 A;  3UM1 A;  3UT4 A;  1P5Q A;  3AS4 A;  2J09 A;  3GZ2 A;  3QWV A;  1VDY A;  3EU5 A;  4GYY A;  4KBQ A;  2WPV A;  2EIM E;  1SW6 A;  2YNQ A;  3CVV A;  4DJA A;  3DEP A;  3DXK G;  1N52 A;  3QKY A;  4RSY A;  2I6H A;  2WXN A;  4DRX E;  4N39 A;  1E8Y A;  4F1P A;  3UKR G;  3ONK A;  2KZT B;  3FUE A;  4FLB A;  3D3M A;  4ATZ D;  3L6A A;  3JCK C;  4G25 A;  5E75 A;  3ZYK A;  4PS3 A;  4GMR A;  5T8I A;  4HQD A;  3FUH A;  2BF0 X;  3IEG A;  4DLO A;  1MJ0 A;  1S63 A;  4K5A B;  5BPP A;  5FQ7 A;  3W9F A;  1N4S A;  3TWU A;  2QY7 A;  3JXI A;  3QAR A;  2GRQ B;  5AN8 A;  2XZT G;  5ENT D;  3CHQ A;  1OWP A;  4L7T A;  4WWN A;  3VLD A;  2YHC A;  3JQ1 A;  3ZYM A;  1AP7 A;  2GW1 A;  4G8L A;  3NF1 A;  1A5E A;  4XI0 A;  4FA6 A;  4UWH A;  2LO6 A;  4G11 A;  2WM9 A;  5HS0 A;  2EIJ E;  1A17 A;  3UIN C;  3F6Q A;  1UN8 A;  2FUL A;  3L17 A;  4I17 A;  2OCC E;  2Y1L E;  4G8K A;  5A6C A;  3LY7 A;  5JJ7 A;  5IY5 E;  2BED A;  2Q7F A;  4J8D A;  3TJP A;  5BV1 A;  4BET A;  2L6B A;  1IYG A;  4E6H A;  3FUD A;  3HVE A;  3QDN A;  1NZN A;  4FAD A;  1HFA A;  5CBO A;  2DCP A;  2LXM A;  4TXR A;  4BX8 A;  2AXU A;  4GZ6 A;  3Q75 A;  4TXP A;  4K5B A;  3UIO C;  5ENP D;  4DX5 D;  4DX6 D;  1IQU A;  4N2Q A;  4U63 A;  3MYV A;  3ZUV B;  5B3S E;  2Y0B G;  4U0S A;  3HHM A;  4I2W A;  4JW1 A;  2PZI A;  5CHE E;  4Z68 A;  3MKQ A;  3S7D A;  1JCQ A;  3ZHE A;  4YDE A;  3FH8 A;  4ANU A;  4BES A;  3G2W A;  2KM4 A;  4U7E B;  5AAO A;  5CBN A;  1HH8 A;  3QWP A;  5EX3 A;  3EU9 A;  3ABM E;  1MHQ A;  3ULE G;  2NSZ A;  4WNG A;  4I9C A;  3LDZ A;  2M63 A;  4BT9 A;  5A23 A;  4YND A;  1QZ2 A;  3FTS A;  4A1G A;  1HO8 A;  4U04 A;  4IRU A;  4WWO A;  5KJK A;  4ANW A;  3KEA A;  3I4G A;  1UG3 A;  3D9O A;  3DWL G;  2F8X K;  5ENQ D;  1TYQ G;  4Y6C A;  3SFZ A;  2RD0 A;  3ABK E;  2VSO E;  4URK A;  4HBD A;  4KVO A;  3SI5 A;  3FUF A;  3R7Q A;  4FU3 A;  3ZPJ A;  2VTB A;  5FQ8 A;  4EZK A;  4N3C A;  4KYO B;  4L2Y A;  4KZ0 A;  3C98 A;  4JHR A;  4PS7 A;  2J08 A;  2WXH A;  2P2C P;  3C3O A;  3FY4 A;  1NA0 A;  2QYU A;  2MHK A;  2QYJ A;  1H6O A;  3ZXP A;  3ESL A;  3GZ1 A;  1N9A A;  3QAQ A;  2IO2 C;  2Y3A A;  4KXK B;  5D0Q D;  1IHB A;  2C0M A;  1JCS A;  1LF8 A;  2R02 A;  2HR2 A;  3AS8 A;  3LJN A;  1YMP A;  4WAF A;  5EYL A;  2C0L A;  1ZU2 A;  3EHM A;  3RKV A;  4IN3 B;  3SNX A;  3G2S A;  2GGF A;  1NFI E;  2XCC A;  3KEZ A;  3TWR A;  1FVH A;  5KJM A;  1N11 A;  3TG4 A;  3FEX A;  2F37 A;  3V30 A;  3TWT A;  1MX2 A;  3DRA A;  4IYP A;  3PEU B;  2WB2 A;  2JEK A;  3ULY A;  2WMN A;  3CVL A;  4QFV A;  1AWC B;  3ZNG A;  1HG5 A;  3UXG A;  3AJI A;  3MA5 A;  1H6P A;  4MBG A;  3FDH A;  4WNE A;  3MCX A;  3HXF A;  4LNB A;  5DIZ A;  4E85 A;  5EDS A;  4OVV A;  4LSZ E;  4L9P A;  1NI1 A;  3L54 A;  2FO1 E;  3EDT B;  1ELK A;  2VSY A;  1IXV A;  1TNB A;  2VGX A;  2A4Z A;  1OCR E;  3NB2 A;  4XZ4 A;  4AIF A;  2IY0 C;  3B95 A;  2LXL A;  3VLF A;  3G2U A;  4G24 A;  3S7B A;  3UT8 A;  4AV7 A;  1X81 A;  2ETB A;  5G04 J;  4GML A;  3SGH A;  3FP3 A;  5ITZ F;  2ZGD A;  3JUE A;  2X6I A;  4JEH A;  2QC9 A;  5AIJ A;  1H2U A;  3ASF A;  2XPZ A;  1LD7 A;  3P2B A;  3OTN A;  1HE8 A;  4HLE A;  3KSL A;  3AG3 E;  1K1A A;  1OXJ A;  1IQR A;  2F8Y A;  2OOE A;  5JMN D;  4LCT A;  3U64 A;  4XX5 A;  4EQF A;  3MKQ B;  1U2V G;  3ZHE B;  3DSS A;  4JD2 G;  4UI9 J;  1E8X A;  3G2T A;  3CIA A;  4KZC A;  5H7P A;  1E90 A;  4HOT A;  1PY1 A;  1OWO A;  5CER B;  3K9I A;  1HF8 A;  4DI3 A;  2IJG X;  4I6G A;  3BEE A;  3CR3 A;  4J6I A;  4U0Z A;  3HXE A;  3X2Q E;  3VLE A;  3V2O A;  4Y6W A;  3RJV A;  3UI2 A;  3FTX A;  3MV2 B;  1DVP A;  3FTY A;  4G1T A;  5KJL A;  4APO A;  3CK8 A;  3CVN A;  3EIJ A;  5CMW A;  5AAR A;  1XGW A;  1SQM A;  3BUA A;  3D9K A;  4XI9 A;  2PQN A;  1RW2 A;  4FJZ A;  4B8A A;  1E96 B;  1N94 A;  4JA7 A;  1BD8 A;  2JAB A;  3BG0 B;  4ILH B;  4I6E A;  3E30 A;  3CHO A;  3ZEF A;  5EKQ D;  1Y8M A;  4UQX A;  2VTB B;  3W9G A;  2XCB A;  3DPD A;  3SHF A;  1N4Q A;  5KNH D;  1KT1 A;  3L13 A;  4BFR A;  3U3W A;  3N71 A;  4GCN A;  2V4L A;  5ANR A;  1JWF A;  1SZA A;  4O1P A;  4GPM A;  2LSV A;  3PZ2 A;  1NL4 A;  3E4B A;  1KLX A;  3CEQ A;  5AJD A;  2ZGG A;  3EJN A;  5BUZ A;  1YCS B;  4O6F A;  2LSU A;  3LVQ E;  2X3M A;  3NQP A;  4V3I A;  2R5S A;  4C48 B;  1YYH A;  4U96 D;  5AJL A;  2HM8 A;  3ASN E;  3I4R B;  3TWW A;  3PS6 A;  4JPS A;  1TN7 A;  3CVW A;  3SFY A;  4AM9 A;  2DYR E;  2E2E A;  4MLP A;  4UWG A;  3WXX A;  2XPY A;  2XS8 A;  4UI9 C;  3LYA A;  3HYM B;  1UW4 B;  3R9A B;  2XEN A;  3ASG A;  4JXT A;  1OWM A;  3RO2 A;  4BEP A;  3NZU A;  5FQ4 A;  4A3V A;  1UJJ A;  5KBA A;  1O1T A;  3QOU A;  4EBA A;  4MS6 A;  3Q47 B;  2H6H A;  3FU3 A;  2VGX B;  4B94 A;  3TXN A;  4YDO A;  3PE3 A;  4KVM A;  3PNT B;  5T3R A;  3U66 A;  4AXH A;  4WUY A;  5CCL A;  3FWV A;  2RKK A;  4K03 A;  4ABN A;  4ZHB A;  3RSE G;  4GZC A;  4DUI A;  4JC8 A;  3CVU A;  1BI8 B;  4GTV A;  1MQS A;  2Y69 E;  3UT7 A;  1Z5S C;  4ME2 A;  4NUR A;  4NIK A;  1HG2 A;  3G2V A;  3TWV A;  2KXP C;  3TGO A;  1HX8 A;  4F3V A;  4WNF A;  5ENN A;  4M7C A;  1N0Q A;  2X38 A;  1UJK A;  4BTA A;  4GZ3 A;  2IEJ A;  3S2A A;  3SD5 A;  4WND A;  3PVL A;  1EYH A;  1KZO A;  3PUJ A;  4O60 A;  1O5M A;  4JA9 A;  3UM2 A;  2JLB A;  4LRZ A;  5G2N A;  3ZYQ A;  4U8V D;  3ML9 A;  3GZS A;  4GZ5 A;  3IHY A;  3Q9N C;  2J4D A;  4CZ2 D;  4XIF A;  3ZIM A;  3CST A;  3FU5 A;  3CGH A;  4XEI G;  1HZ4 A;  3U4T A;  3B7U X;  3PH0 C;  3J5Q B;  4YVO A;  4U8Y D;  2ILR A;  4HRL A;  2GRM A;  2PM7 A;  2WXQ A;  2XEH A;  4U07 A;  4CDM A;  3EUV A;  3NZS A;  3OAW A;  3E37 A;  5BXO A;  4GTO A;  1JPL A;  1WDY A;  5FJY A;  3MV3 B;  1N95 A;  2AJA A;  4EEC A;  5B1B E;  1MX4 A;  3QNK A;  3T8K A;  4RG9 A;  1H6K A;  3PZ4 A;  4G26 A;  3FH5 A;  4TV3 A;  2MYO A;  3D9J A;  3Q78 A;  4YDY A;  3WG7 E;  2WQ6 A;  4EHM A;  2ETA A;  2FEZ A;  1H0A A;  2YHE A;  4G23 A;  3D9P A;  1BI7 B;  4FHK A;  3NAW A;  3AG1 E;  2WXL A;  2XS1 A;  3D9L A;  1JCR A;  1B89 A;  5FZR A;  1Z3Y A;  4K5C A;  1E8W A;  3BU8 A;  4AJW A;  4DLQ A;  2DWZ A;  3J5P A;  4RQI A;  2DBA A;  2GRP B;  2RG8 A;  3CHM A;  4BSZ B;  4GA0 A;  2VQ2 A;  4AVX A;  5E76 A;  1E7U A;  3FTW A;  2PM6 A;  3UX4 A;  1ZB1 A;  1PAQ A;  1S0P A;  5AQB A;  3IHV A;  4CDR A;  4XKB A;  4A1S A;  3E34 A;  2UY1 A;  3PNL B;  3RRU A;  4QQI A;  3SQV A;  5C1D A;  3RRN B;  4AEZ C;  3APF A;  2WXP A;  2XPI A;  4HS2 A;  2IOL A;  4B0Z A;  4PH4 B;  4D10 C;  4PUC A;  5AQ7 A;  4GA1 A;  1FVF A;  4N2S A;  5M72 A;  1H19 A;  3CHS A;  2R2L A;  1E7V A;  2X6F A;  2NC9 A;  5D2M C;  3GW4 A;  3R7R A;  4EBA G;  5FT9 A;  4BWR A;  2CHX A;  3IV0 A;  2KBX A;  3NOG D;  3UM3 A;  4JVS A;  4FUL A;  5BW8 C;  3SF4 A;  3AAA C;  3Q5M A;  1W3B A;  4P29 A;  3ISM C;  2P9S G;  2J4B A;  2XGM A;  1TN8 A;  4UI9 K;  3ZRH A;  3CK9 A;  3ABL E;  4GB9 A;  5DBK A;  4CGV A;  4CCA A;  2P58 C;  2DZO A;  2GRN B;  3AU4 A;  5CCM A;  5FIO A;  2XRZ A;  4U8H A;  4JB8 P;  3BQO A;  2WQ7 A;  4GCO A;  4FP7 A;  3IKO B;  5ARG A;  4C9B B;  5ENS D;  4UWK A;  5LCW J;  3BG1 B; 
#chains in the Genus database with same CATH homology
 3Q7A A;  1TNU A;  4GTS A;  1D8D A;  1N4P A;  3DST A;  1LTX A;  3E32 A;  1X81 A;  1N94 A;  3DSX A;  1FT2 A;  1O1T A;  3E34 A;  1S63 A;  3SFX A;  1N4S A;  2H6H A;  1JCQ A;  3E30 A;  1N9A A;  4YDE A;  4YDO A;  1MZC A;  1SA5 A;  1LD7 A;  1JCS A;  1N4Q A;  4GTQ A;  3KSL A;  2H6G A;  4GTT A;  1FPP A;  4GTM A;  1LD8 A;  3EUV A;  1TNO A;  3DSU A;  3PZ3 A;  3DSW A;  1O1S A;  3E37 A;  3E33 A;  4GTV A;  1TN6 A;  4GTO A;  2R2L A;  4GTP A;  3C72 A;  1N95 A;  4GTR A;  1SA4 A;  3HXB A;  3DSS A;  3PZ2 A;  1O1R A;  3DRA A;  1NL4 A;  2H6F A;  3PZ4 A;  2F0Y A;  1S64 A;  3Q78 A;  1FT1 A;  3Q73 A;  2BED A;  2ZIR A;  3PZ1 A;  1TN8 A;  4LNG A;  3Q79 A;  3Q7F A;  1D8E A;  4EHM A;  1TNZ A;  3EU5 A;  2ZIS A;  4MBG A;  1DCE A;  3HXF A;  4LNB A;  1TNY A;  2IEJ A;  3HXE A;  1KZP A;  3HXD A;  1JCR A;  4L9P A;  1TN7 A;  1NI1 A;  1N4R A;  3DPY A;  3HXC A;  3SFY A;  3DSV A;  3KSQ A;  1QBQ A;  1TNB A;  1KZO A;  1O5M A;  3Q75 A;  2H6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...