1O26A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and dump at 1.6 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
219
structure length
219
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 77
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o26A00
4P5AA 1O26A 4FZBA 2CFAA 4GTCA 5CHPA 5IOQA 1O24A 3G4CA 4GTLA 4GT9A 4P5BA 4GTAA 4GTFA 3N3YA 5IOSA 5JFEA 1O28A 4GTEA 3AH5A 1O25A 5IOTA 4GTDA 4GTBA 3N0CA 4KASA 4KATA 1O27A 1KQ4A 5IORA 3G4AA 1O2BA 1O29A 3N0BA 2CFAB 1O2AA 4KARA
chains in the Genus database with same CATH superfamily
1SMYA 3BP8C 1TWGA 4BY1K 3BUEA 3HOZK 2JA5A 1F7VA 4A3BK 4A3LC 4C3IC 1J98A 3S17K 1WOOA 4A3KC 5IOSA 3H0GA 3Q3QA 1JOEA 3AD8C 2B63C 3GTKK 4BY7K 4BBRK 2WB1L 1O2BA 3N0BA 3FKIK 2B63A 1YCLA 1EK8A 4A3MK 4Y52K 4A3FK 3H0GC 4P9SA 4DDQA 4O2DA 3GTKA 4LQYA 3OEPA 1HI9A 3TFIA 1BGWA 1IS1A 4YFNA 2JA5C 5C4XK 3FHZA 4PAAA 3HOUC 5JFEA 4GTEA 1TWGC 4LOWA 4G0UA 3RZOK 2R92K 4KASA 4C3JK 2JA6K 3S2DC 3I4MC 3GTJK 4A3BC 4X6AK 1WSRA 3S15K 1Y1VC 1I3QC 1WORA 5EGHA 4C3JC 2R92C 3HKZL 3AQPA 1I6HK 4G7ZA 3HKZD 4OIPA 1I3QA 1Y1VA 4Q4ZA 2NVYA 4P5BA 4AYBD 3H3VD 2BE5A 3GTGA 2WAQD 3S16C 5IP7C 3I4MK 1ZYRA 3A8KA 4GTBA 1WCMC 1L0WA 1TWHA 4YG2A 1TWGK 1WQGA 3S1NK 3T02A 3G4AA 2VUMK 1EH1A 3PO3C 5HL8A 5EGEA 4YFXA 2W7VA 3HOWC 3M4OK 3HOVK 2R7ZC 4WILA 1PJ6A 1DCPA 1I50C 5D4DA 3FKIC 4BY1C 4GTFA 1PJ7A 3VA7A 4MEXA 4BY7C 5TMFA 2XCRB 3AQOA 1IBAA 4XCHA 5M5XK 3FOEA 5E68A 1VLOA 2E2IK 4JK1A 4FZBA 1R9TC 1Y1WA 1TWAA 5CHPA 1I50K 3S15C 1IL2A 1B4BA 1DCOA 3HOWK 2A69A 4OIRA 3S1RK 5IYCC 2O5IA 3CQZA 2Y0SD 3H3VL 2WB1D 3GTLK 2JA5K 1Y1WC 4C3HC 4AYBL 5IYCK 3ADAC 2NVQK 1VH2A 3S1MC 2V6UA 3GTPA 1IQ0A 1DD5A 5IP7K 5IYDK 3H0GK 3TTGA 4KARA 1I6VA 3GTQK 4A3DK 1GE9A 1XZPA 4KM8A 1XZQB 2R93C 4KMAA 2PA8D 2E2HA 1I50A 1X31C 4BKWA 2KWAA 3A8IA 4KATA 4ZH4A 1ZXOA 3GTOA 4A93C 1K83A 2XCQA 2JA8K 3S2DK 4A3JC 3PO2C 2A6EA 2E2HK 2PPBA 1O2AA 5CJ9A 5IP9C 1TWHC 2CFAA 3AD9C 5IOQA 3S2HK 2D6FC 4XLNA 1ZVUA 3N3YA 1F7UA 3HOYC 3AH5A 3CAGA 1JQWA 2E2JC 4GTDA 4A3IK 1EQRA 5C3EK 3A8JA 3MMLB 4ILDA 3S1QC 4KMDA 1K83C 4A3EK 2R92A 4KDDA 1YX2A 1O26A 3GIRA 4QIWL 1BS2A 4A3KK 3S2HC 1J6VA 1K83K 4C3IK 3CQZK 4GT9A 4BXXK 4A3MC 1J6XA 1IW7A 2PHCB 2Y3PA 1O2FB 3L4KA 4M1XA 5M5WK 4KMUA 1PJ5A 4BBRC 4A3IC 2GAGC 1O25A 3GTPK 2GSUA 1B4AA 1V5VA 1VJEA 4J3NA 5IORA 1VRQC 4LLGA 1YNJA 2A6HA 2RGRA 4BLBA 3GDZA 1G51A 4KAWX 3GTQC 4A3FC 3GTJC 2Y0SL 3QX3A 4LK0A 5TMCA 3TFHA 2NVQC 1Y1WK 1RU0A 4BLAA 3M3YK 3I4NC 4G0WA 1JVIA 1WSVA 2FQTA 3HOXK 3K7AC 3WODA 5JVOA 2E2JK 3GEEA 5L46A 1TWFC 5IYDC 2YU9K 1ZBSA 4QJVA 4G7HA 2E2IC 3GTJA 2NVXK 1ZQ1C 4QJVB 4OIQA 4C3HK 5IP9K 3FKIA 2B63K 1XPPA 1USMA 3RZDK 1INNA 3S1NC 2R7ZA 1O28A 1TWAK 4G0VA 4YFKA 1USOA 4A3JK 3PO2K 4C2MK 1SFOK 2YU9A 5M3MK 4A93K 4XLPA 3GTMK 2GAHC 4AH6A 1DCHA 2JA6C 1SFOC 4KN7A 1WCMA 3IPJA 2JA7C 3AD7C 4XSXA 1TWCC 2XCOA 3GTGC 1UV7A 4KM9A 4A3DC 2YU9C 1HQMA 3LAJA 4G7OA 5FLMK 5TJ3A 2NVYC 2PMZD 5FJ8K 1ISEA 1VGXA 4C45A 2PMZL 3K7AK 1AB4A 1WQFA 1XZQA 1BDFA 1XZPB 3S16K 4Q5SA 2R93K 4BBSK 2R7ZK 4PABA 1WIHA 2EBBA 5C44C 1XXAA 2O5JA 2RH6A 4A3EC 4NOIA 3BP3A 3LPXA 4GTAA 4KMHA 1R9TK 4OIOA 2P8TA 2P5MA 4A3GK 3OREA 3GTKC 3HOYK 3GTQA 2V6SA 3GTOC 4GZYA 5IYBK 4RMFA 1YNNA 1WOPA 4P5AA 2E2HC 5C4JK 4GTCA 2R93A 2JA8C 2JH3A 3G4CA 2VUMA 4KC6A 3T01A 1EFWA 1WQHA 4Y7NK 4XSZA 2GSOA 3M3YC 3HOUK 2VUMC 3S1QK 1J6WA 3GEIA 3GTPC 4A3GC 3DXJA 3S0XA 2CFAB 3V4GA 4BXXC 3CQZC 4A3LK 5M3FK 3HOVC 3GEHA 4Y52C 5FLMC 2NVTK 1XXBA 1C0AA 4GTLA 5M5YK 4KN4A 3T00A 3I4NK 1TWHK 3L4JA 2JA7K 3GTLC 2ZUEA 4GFQA 3SZYA 2WAQL 1EI6A 1I3QK 3TFJA 3S17C 2NVXA 4FM9A 3OPFA 3FOFA 3RZOC 1WOSA 1F93A 3GTGK 3HXAA 3S14C 4A3CC 3RZDC 2A68A 5IYBC 5C4XC 2CW0A 3GTMA 4MQ9A 3GTOK 3S14K 1I6HC 3PO3K 2NVTC 2FQOA 1TWFK 4LK1A 4LJZA 4X6AC 4BBSC 1XXCA 3GTMC 4LR2A 1TWCA 3S1MK 4KB2A 1BJTA 1O27A 2JA7A 4WJ4A 2V6TA 3M4OC 4MEYA 5C44K 1SFOA 3JSTA 2NVXC 2JA6A 3LAPA 1TWCK 3ERED 4Y7NC 1O24A 4A3CK 1F9NA 3HOZC 3GTLA 5C4JC 1WCMK 3GSIA 5C3EC 4WJ3M 3EQLA 3HOXC 1Y1VK 2ZFZA 3SZZA 2PA8L 5IOTA 2GSNA 3N0CA 2NVYK 2E2IA 2ZUFA 1IE0A 4C2MC 1KQ4A 1TWAC 1TWFA 3S1RC 1O29A 1R9TA 4KB4A 3NUHA 4QIWD 4OINA
chains in the Genus database with same CATH topology
4P5AA 2RGRA 4BLBA 1TWGA 4FZBA 1Y1WA 3BUEA 1TWAA 4GTCA 5CHPA 4KAWX 2R93A 2JH3A 3G4CA 2VUMA 2JA5A 4KC6A 1B4BA 4C3IC 1WQHA 5IOSA 3QX3A 2GSOA 3H0GA 3Q3QA 3CQZA 4BLAA 4C3HC 4G0WA 3S0XA 1O2BA 3N0BA 2CFAB 3GTPA 1DD5A 3V4GA 5JVOA 2B63A 1EK8A 4KARA 4DDQA 3GTKA 1ZBSA 4LQYA 3OEPA 1XXBA 1BGWA 4GTLA 3GTJA 1IS1A 1GE9A 4KM8A 3L4JA 3FKIA 3FHZA 4KMAA 2R7ZA 5JFEA 1O28A 4GTEA 2E2HA 4G0VA 4G0UA 4GFQA 1I50A 2YU9A 4KASA 4BKWA 2KWAA 4KATA 2NVXA 1ZXOA 3GTOA 4FM9A 1K83A 3OPFA 2XCQA 5EGHA 4C3JC 3FOFA 3AQPA 1O2AA 5CJ9A 1WCMA 1I3QA 1Y1VA 2CFAA 3GTMA 5IOQA 2NVYA 2XCOA 4P5BA 1ZVUA 4KM9A 3LAJA 5TJ3A 3GTGA 3N3YA 1XXCA 3AH5A 1ISEA 3CAGA 4GTDA 4GTBA 4LR2A 1TWCA 1AB4A 1WQFA 3MMLB 4KB2A 1BJTA 1TWHA 1O27A 2JA7A 1WQGA 3G4AA 4ILDA 4KMDA 1EH1A 1WIHA 1SFOA 2R92A 2JA6A 3LAPA 5EGEA 4KDDA 3ERED 1O26A 1XXAA 2RH6A 1O24A 3LPXA 4GT9A 1F9NA 3GTLA 2PHCB 2Y3PA 4GTAA 4KMHA 3L4KA 4M1XA 4GTFA 3VA7A 2ZFZA 2P5MA 1O25A 3OREA 5IOTA 2GSUA 1B4AA 2GSNA 3N0CA 2E2IA 4J3NA 3GTQA 2XCRB 4C2MC 1KQ4A 5IORA 3AQOA 1TWFA 1O29A 1R9TA 4KB4A 3NUHA 3FOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5A A;  1O26 A;  4FZB A;  2CFA A;  4GTC A;  5CHP A;  5IOQ A;  1O24 A;  3G4C A;  4GTL A;  4GT9 A;  4P5B A;  4GTA A;  4GTF A;  3N3Y A;  5IOS A;  5JFE A;  1O28 A;  4GTE A;  3AH5 A;  1O25 A;  5IOT A;  4GTD A;  4GTB A;  3N0C A;  4KAS A;  4KAT A;  1O27 A;  1KQ4 A;  5IOR A;  3G4A A;  1O2B A;  1O29 A;  3N0B A;  2CFA B;  1O2A A;  4KAR A; 
#chains in the Genus database with same CATH topology
 1SMY A;  3BP8 C;  1TWG A;  4BY1 K;  3BUE A;  3HOZ K;  2JA5 A;  1F7V A;  4A3B K;  4A3L C;  4C3I C;  1J98 A;  3S17 K;  1WOO A;  4A3K C;  5IOS A;  3H0G A;  3Q3Q A;  1JOE A;  3AD8 C;  2B63 C;  3GTK K;  4BY7 K;  4BBR K;  2WB1 L;  1O2B A;  3N0B A;  3FKI K;  2B63 A;  1YCL A;  1EK8 A;  4A3M K;  4Y52 K;  4A3F K;  3H0G C;  4P9S A;  4DDQ A;  4O2D A;  3GTK A;  4LQY A;  3OEP A;  1HI9 A;  3TFI A;  1BGW A;  1IS1 A;  4YFN A;  2JA5 C;  5C4X K;  3FHZ A;  4PAA A;  3HOU C;  5JFE A;  4GTE A;  1TWG C;  4LOW A;  4G0U A;  3RZO K;  2R92 K;  4KAS A;  4C3J K;  2JA6 K;  3S2D C;  3I4M C;  3GTJ K;  4A3B C;  4X6A K;  1WSR A;  3S15 K;  1Y1V C;  1I3Q C;  1WOR A;  5EGH A;  4C3J C;  2R92 C;  3HKZ L;  3AQP A;  1I6H K;  4G7Z A;  3HKZ D;  4OIP A;  1I3Q A;  1Y1V A;  4Q4Z A;  2NVY A;  4P5B A;  4AYB D;  3H3V D;  2BE5 A;  3GTG A;  2WAQ D;  3S16 C;  5IP7 C;  3I4M K;  1ZYR A;  3A8K A;  4GTB A;  1WCM C;  1L0W A;  1TWH A;  4YG2 A;  1TWG K;  1WQG A;  3S1N K;  3T02 A;  3G4A A;  2VUM K;  1EH1 A;  3PO3 C;  5HL8 A;  5EGE A;  4YFX A;  2W7V A;  3HOW C;  3M4O K;  3HOV K;  2R7Z C;  4WIL A;  1PJ6 A;  1DCP A;  1I50 C;  5D4D A;  3FKI C;  4BY1 C;  4GTF A;  1PJ7 A;  3VA7 A;  4MEX A;  4BY7 C;  5TMF A;  2XCR B;  3AQO A;  1IBA A;  4XCH A;  5M5X K;  3FOE A;  5E68 A;  1VLO A;  2E2I K;  4JK1 A;  4FZB A;  1R9T C;  1Y1W A;  1TWA A;  5CHP A;  1I50 K;  3S15 C;  1IL2 A;  1B4B A;  1DCO A;  3HOW K;  2A69 A;  4OIR A;  3S1R K;  5IYC C;  2O5I A;  3CQZ A;  2Y0S D;  3H3V L;  2WB1 D;  3GTL K;  2JA5 K;  1Y1W C;  4C3H C;  4AYB L;  5IYC K;  3ADA C;  2NVQ K;  1VH2 A;  3S1M C;  2V6U A;  3GTP A;  1IQ0 A;  1DD5 A;  5IP7 K;  5IYD K;  3H0G K;  3TTG A;  4KAR A;  1I6V A;  3GTQ K;  4A3D K;  1GE9 A;  1XZP A;  4KM8 A;  1XZQ B;  2R93 C;  4KMA A;  2PA8 D;  2E2H A;  1I50 A;  1X31 C;  4BKW A;  2KWA A;  3A8I A;  4KAT A;  4ZH4 A;  1ZXO A;  3GTO A;  4A93 C;  1K83 A;  2XCQ A;  2JA8 K;  3S2D K;  4A3J C;  3PO2 C;  2A6E A;  2E2H K;  2PPB A;  1O2A A;  5CJ9 A;  5IP9 C;  1TWH C;  2CFA A;  3AD9 C;  5IOQ A;  3S2H K;  2D6F C;  4XLN A;  1ZVU A;  3N3Y A;  1F7U A;  3HOY C;  3AH5 A;  3CAG A;  1JQW A;  2E2J C;  4GTD A;  4A3I K;  1EQR A;  5C3E K;  3A8J A;  3MML B;  4ILD A;  3S1Q C;  4KMD A;  1K83 C;  4A3E K;  2R92 A;  4KDD A;  1YX2 A;  1O26 A;  3GIR A;  4QIW L;  1BS2 A;  4A3K K;  3S2H C;  1J6V A;  1K83 K;  4C3I K;  3CQZ K;  4GT9 A;  4BXX K;  4A3M C;  1J6X A;  1IW7 A;  2PHC B;  2Y3P A;  1O2F B;  3L4K A;  4M1X A;  5M5W K;  4KMU A;  1PJ5 A;  4BBR C;  4A3I C;  2GAG C;  1O25 A;  3GTP K;  2GSU A;  1B4A A;  1V5V A;  1VJE A;  4J3N A;  5IOR A;  1VRQ C;  4LLG A;  1YNJ A;  2A6H A;  2RGR A;  4BLB A;  3GDZ A;  1G51 A;  4KAW X;  3GTQ C;  4A3F C;  3GTJ C;  2Y0S L;  3QX3 A;  4LK0 A;  5TMC A;  3TFH A;  2NVQ C;  1Y1W K;  1RU0 A;  4BLA A;  3M3Y K;  3I4N C;  4G0W A;  1JVI A;  1WSV A;  2FQT A;  3HOX K;  3K7A C;  3WOD A;  5JVO A;  2E2J K;  3GEE A;  5L46 A;  1TWF C;  5IYD C;  2YU9 K;  1ZBS A;  4QJV A;  4G7H A;  2E2I C;  3GTJ A;  2NVX K;  1ZQ1 C;  4QJV B;  4OIQ A;  4C3H K;  5IP9 K;  3FKI A;  2B63 K;  1XPP A;  1USM A;  3RZD K;  1INN A;  3S1N C;  2R7Z A;  1O28 A;  1TWA K;  4G0V A;  4YFK A;  1USO A;  4A3J K;  3PO2 K;  4C2M K;  1SFO K;  2YU9 A;  5M3M K;  4A93 K;  4XLP A;  3GTM K;  2GAH C;  4AH6 A;  1DCH A;  2JA6 C;  1SFO C;  4KN7 A;  1WCM A;  3IPJ A;  2JA7 C;  3AD7 C;  4XSX A;  1TWC C;  2XCO A;  3GTG C;  1UV7 A;  4KM9 A;  4A3D C;  2YU9 C;  1HQM A;  3LAJ A;  4G7O A;  5FLM K;  5TJ3 A;  2NVY C;  2PMZ D;  5FJ8 K;  1ISE A;  1VGX A;  4C45 A;  2PMZ L;  3K7A K;  1AB4 A;  1WQF A;  1XZQ A;  1BDF A;  1XZP B;  3S16 K;  4Q5S A;  2R93 K;  4BBS K;  2R7Z K;  4PAB A;  1WIH A;  2EBB A;  5C44 C;  1XXA A;  2O5J A;  2RH6 A;  4A3E C;  4NOI A;  3BP3 A;  3LPX A;  4GTA A;  4KMH A;  1R9T K;  4OIO A;  2P8T A;  2P5M A;  4A3G K;  3ORE A;  3GTK C;  3HOY K;  3GTQ A;  2V6S A;  3GTO C;  4GZY A;  5IYB K;  4RMF A;  1YNN A;  1WOP A;  4P5A A;  2E2H C;  5C4J K;  4GTC A;  2R93 A;  2JA8 C;  2JH3 A;  3G4C A;  2VUM A;  4KC6 A;  3T01 A;  1EFW A;  1WQH A;  4Y7N K;  4XSZ A;  2GSO A;  3M3Y C;  3HOU K;  2VUM C;  3S1Q K;  1J6W A;  3GEI A;  3GTP C;  4A3G C;  3DXJ A;  3S0X A;  2CFA B;  3V4G A;  4BXX C;  3CQZ C;  4A3L K;  5M3F K;  3HOV C;  3GEH A;  4Y52 C;  5FLM C;  2NVT K;  1XXB A;  1C0A A;  4GTL A;  5M5Y K;  4KN4 A;  3T00 A;  3I4N K;  1TWH K;  3L4J A;  2JA7 K;  3GTL C;  2ZUE A;  4GFQ A;  3SZY A;  2WAQ L;  1EI6 A;  1I3Q K;  3TFJ A;  3S17 C;  2NVX A;  4FM9 A;  3OPF A;  3FOF A;  3RZO C;  1WOS A;  1F93 A;  3GTG K;  3HXA A;  3S14 C;  4A3C C;  3RZD C;  2A68 A;  5IYB C;  5C4X C;  2CW0 A;  3GTM A;  4MQ9 A;  3GTO K;  3S14 K;  1I6H C;  3PO3 K;  2NVT C;  2FQO A;  1TWF K;  4LK1 A;  4LJZ A;  4X6A C;  4BBS C;  1XXC A;  3GTM C;  4LR2 A;  1TWC A;  3S1M K;  4KB2 A;  1BJT A;  1O27 A;  2JA7 A;  4WJ4 A;  2V6T A;  3M4O C;  4MEY A;  5C44 K;  1SFO A;  3JST A;  2NVX C;  2JA6 A;  3LAP A;  1TWC K;  3ERE D;  4Y7N C;  1O24 A;  4A3C K;  1F9N A;  3HOZ C;  3GTL A;  5C4J C;  1WCM K;  3GSI A;  5C3E C;  4WJ3 M;  3EQL A;  3HOX C;  1Y1V K;  2ZFZ A;  3SZZ A;  2PA8 L;  5IOT A;  2GSN A;  3N0C A;  2NVY K;  2E2I A;  2ZUF A;  1IE0 A;  4C2M C;  1KQ4 A;  1TWA C;  1TWF A;  3S1R C;  1O29 A;  1R9T A;  4KB4 A;  3NUH A;  4QIW D;  4OIN A; 
#chains in the Genus database with same CATH homology
 4P5A A;  2RGR A;  4BLB A;  1TWG A;  4FZB A;  1Y1W A;  3BUE A;  1TWA A;  4GTC A;  5CHP A;  4KAW X;  2R93 A;  2JH3 A;  3G4C A;  2VUM A;  2JA5 A;  4KC6 A;  1B4B A;  4C3I C;  1WQH A;  5IOS A;  3QX3 A;  2GSO A;  3H0G A;  3Q3Q A;  3CQZ A;  4BLA A;  4C3H C;  4G0W A;  3S0X A;  1O2B A;  3N0B A;  2CFA B;  3GTP A;  1DD5 A;  3V4G A;  5JVO A;  2B63 A;  1EK8 A;  4KAR A;  4DDQ A;  3GTK A;  1ZBS A;  4LQY A;  3OEP A;  1XXB A;  1BGW A;  4GTL A;  3GTJ A;  1IS1 A;  1GE9 A;  4KM8 A;  3L4J A;  3FKI A;  3FHZ A;  4KMA A;  2R7Z A;  5JFE A;  1O28 A;  4GTE A;  2E2H A;  4G0V A;  4G0U A;  4GFQ A;  1I50 A;  2YU9 A;  4KAS A;  4BKW A;  2KWA A;  4KAT A;  2NVX A;  1ZXO A;  3GTO A;  4FM9 A;  1K83 A;  3OPF A;  2XCQ A;  5EGH A;  4C3J C;  3FOF A;  3AQP A;  1O2A A;  5CJ9 A;  1WCM A;  1I3Q A;  1Y1V A;  2CFA A;  3GTM A;  5IOQ A;  2NVY A;  2XCO A;  4P5B A;  1ZVU A;  4KM9 A;  3LAJ A;  5TJ3 A;  3GTG A;  3N3Y A;  1XXC A;  3AH5 A;  1ISE A;  3CAG A;  4GTD A;  4GTB A;  4LR2 A;  1TWC A;  1AB4 A;  1WQF A;  3MML B;  4KB2 A;  1BJT A;  1TWH A;  1O27 A;  2JA7 A;  1WQG A;  3G4A A;  4ILD A;  4KMD A;  1EH1 A;  1WIH A;  1SFO A;  2R92 A;  2JA6 A;  3LAP A;  5EGE A;  4KDD A;  3ERE D;  1O26 A;  1XXA A;  2RH6 A;  1O24 A;  3LPX A;  4GT9 A;  1F9N A;  3GTL A;  2PHC B;  2Y3P A;  4GTA A;  4KMH A;  3L4K A;  4M1X A;  4GTF A;  3VA7 A;  2ZFZ A;  2P5M A;  1O25 A;  3ORE A;  5IOT A;  2GSU A;  1B4A A;  2GSN A;  3N0C A;  2E2I A;  4J3N A;  3GTQ A;  2XCR B;  4C2M C;  1KQ4 A;  5IOR A;  3AQO A;  1TWF A;  1O29 A;  1R9T A;  4KB4 A;  3NUH A;  3FOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...