1O26A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and dump at 1.6 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
219
structure length
219
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 77
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o26A00
3N0CA 4GTCA 1O24A 4GT9A 1O27A 4GTEA 1O2AA 1O2BA 5IOQA 1KQ4A 3AH5A 4GTBA 4FZBA 4KARA 5CHPA 2CFAB 2CFAA 3N0BA 4GTAA 4KASA 3G4AA 4GTFA 1O25A 1O26A 1O28A 4P5AA 4P5BA 3N3YA 4KATA 4GTLA 5IOTA 5IORA 5JFEA 3G4CA 5IOSA 4GTDA 1O29A
chains in the Genus database with same CATH superfamily
1I3QA 2NVYC 1ISEA 4A3BC 3SZYA 1G51A 2ZFZA 2A6EA 5HL8A 5M5WK 3S17K 3MMLB 3M4OC 4KM8A 5IP9C 3I4MC 3GTGC 5TJ3A 4BXXC 4Q5SA 1ZBSA 2JA7K 4A3CC 3AQOA 3HOYK 2VUMK 3HOVK 4MQ9A 5IYBK 3GEEA 3TFIA 4C3HC 4AH6A 1BDFA 2Y0SL 1J6WA 2PMZL 1VJEA 4OIPA 3CQZK 3GIRA 3AD7C 4LLGA 1C0AA 4C3JC 2O5IA 3NUHA 2XCQA 5IYDK 2V6SA 2O5JA 4G0VA 1BJTA 4BBRK 1TWHA 4KMHA 4BLAA 1I3QK 1WQHA 2YU9A 3RZOC 5IYCC 3HXAA 1R9TC 2E2JK 1F7VA 1XZQB 4A3JC 2R92A 2JA6A 4XLPA 2GAGC 3L4KA 2JH3A 3GTPK 3GTLC 5C4JC 3GTMA 3S2HK 3H3VD 2R7ZK 1XXCA 2CFAA 2E2IC 2P5MA 2WB1D 3AQPA 1WQGA 3GDZA 4C3IC 3GTOC 1RU0A 1Y1VC 3OEPA 4WJ3M 4A93C 4YFNA 3FKIA 3QX3A 3S1QC 2E2HC 2R93C 1VLOA 1JOEA 3HKZL 2B63C 3M3YK 2NVTC 2NVYA 4GTDA 3SZZA 4A3DC 4BLBA 2FQOA 3S2DC 3HOUC 4A3LC 1IBAA 1HQMA 3T01A 4OIRA 1KQ4A 1HI9A 3HOZC 1XZPA 3N0BA 1DCHA 1WSVA 3IPJA 3S16C 4A3IC 4QJVB 1EK8A 3S1NK 2JA6K 3PO2C 4C2MK 4A3GK 2PMZD 5FLMK 5IORA 1DD5A 1WIHA 2JA5A 4P9SA 1PJ6A 5CHPA 3GTMK 5C4XC 1TWCC 3WODA 1TWAC 4M1XA 4BY1C 1O2BA 2A6HA 4AYBD 4GTBA 5L46A 1XXAA 3ERED 3FKIK 1F93A 1I6HC 3JSTA 3AD9C 3I4NK 3AD8C 1Y1WK 1K83C 2V6UA 2ZUFA 1IQ0A 1F9NA 4Y52C 4PAAA 1EI6A 4MEYA 1TWGC 4GTLA 1WCMA 4KMUA 1IS1A 4A3KK 5M5YK 3K7AK 1SMYA 3H0GC 4A3GC 1EH1A 3GTLA 4A3FK 2JA8C 1VRQC 1SFOA 3DXJA 4Y7NK 4O2DA 2NVXC 4KASA 1L0WA 3GTOA 4BBSK 1Y1VA 3LAPA 3GTQC 2JA5K 2Y3PA 4KB4A 3A8IA 2GSNA 1J6XA 3GTJA 3S14K 2D6FC 4KN7A 4OINA 4Q4ZA 3TFHA 1ZXOA 3GSIA 5CJ9A 4ILDA 4LR2A 4OIQA 4X6AK 1DCOA 4KB2A 1WCMK 1B4AA 1O26A 4BKWA 3S17C 4FM9A 3A8KA 1I50A 3RZDK 2JA7C 4OIOA 3HOYC 1SFOK 2VUMC 3HOVC 4A3MK 4GTCA 5IYBC 1TWFA 3OREA 4G7HA 3AH5A 1DCPA 4KARA 3CQZC 5C44K 3HOXK 3S15K 3GTKA 3G4AA 4GTFA 3GTJK 4QIWL 1O25A 1USMA 3S1RK 2CW0A 1UV7A 1TWGA 5IYDC 2RGRA 5M5XK 4A3EK 3L4JA 5IOTA 4BBRC 3H0GA 3G4CA 3V4GA 4KMDA 1I3QC 3N0CA 2A68A 2FQTA 5D4DA 2NVQK 1TWHK 1VH2A 1WOSA 5M3FK 2E2JC 3GEIA 3HOWK 4G7OA 2YU9K 1I50K 3GTGA 3GTPC 1ZQ1C 4LOWA 2R92K 5IP7K 3S2HC 3FOEA 2Y0SD 2R7ZC 1IE0A 3S1MK 4XLNA 5EGHA 1X31C 4BY7K 3GTKK 5C3EK 1O27A 1ZYRA 2PA8L 4LJZA 3VA7A 5M3MK 3M3YC 2PPBA 2P8TA 4GZYA 1J6VA 4YFXA 3ADAC 2NVYK 4P5BA 4ZH4A 4A3BK 5E68A 3FHZA 1R9TA 1VGXA 5JFEA 1EFWA 3CAGA 1XXBA 2VUMA 1XZQA 1O29A 3S1NC 1USOA 2JA6C 3M4OK 5IP9K 3I4MK 4C2MC 3GTGK 4BXXK 3BUEA 5FLMC 4A3CK 3TTGA 4C45A 3GTMC 1JVIA 4C3HK 2CFAB 2E2IA 4KN4A 2PHCB 4QIWD 4KM9A 1IL2A 1PJ5A 4P5AA 1PJ7A 4G0UA 3FKIC 4NOIA 2R93A 2E2HA 4C3JK 3HKZD 2B63A 3I4NC 1I6VA 5IOSA 1Y1WC 1XPPA 1WOOA 4XSXA 1EQRA 1B4BA 1WSRA 4XCHA 2XCRB 5FJ8K 4A3KC 1XZPB 1BS2A 3K7AC 5EGEA 4LK0A 3RZOK 5IYCK 4WILA 3GTPA 1R9TK 4DDQA 2GSUA 4QJVA 3TFJA 4A3JK 3GEHA 4A3FC 1F7UA 3T02A 2R7ZA 4Y7NC 4JK1A 4BBSC 1AB4A 3GTLK 4LK1A 5C4JK 1WQFA 2JA5C 1YNNA 4RMFA 1INNA 1TWCA 2E2IK 2GSOA 4GFQA 1BGWA 1TWAA 2PA8D 4GT9A 4C3IK 3GTOK 1Y1VK 3S14C 1IW7A 4FZBA 4AYBL 4A93K 3S1QK 2E2HK 2R93K 5TMCA 4J3NA 4KDDA 2A69A 1K83A 2B63K 2NVTK 1O28A 4G7ZA 3OPFA 4MEXA 4A3DK 4X6AC 3S2DK 3HOUK 4A3LK 1WCMC 3HOZK 2WAQL 1O24A 4A3IK 3S16K 4GTEA 2KWAA 1GE9A 3RZDC 3LPXA 3PO2K 2NVXA 1YCLA 1SFOC 4A3MC 3GTQA 2V6TA 2ZUEA 5C4XK 4PABA 1TWCK 4XSZA 1ZVUA 3EQLA 1TWAK 5C44C 3HOXC 4BY1K 3S15C 4YFKA 1TWFK 1Y1WA 3GTJC 2BE5A 3S1RC 3PO3K 1I6HK 4YG2A 4A3EC 1O2AA 1K83K 4LQYA 4Y52K 1WOPA 3T00A 3Q3QA 2EBBA 1TWGK 4GTAA 3LAJA 5TMFA 2NVQC 1TWHC 2W7VA 1J98A 2RH6A 3H0GK 3HOWC 3FOFA 3N3YA 2YU9C 2JA8K 1I50C 2JA7A 4G0WA 3BP3A 2NVXK 3BP8C 1YNJA 5JVOA 2R92C 5IP7C 3GTQK 1TWFC 3S1MC 5IOQA 1O2FB 3PO3C 4BY7C 3CQZA 1V5VA 3GTKC 3A8JA 5C3EC 4KC6A 4WJ4A 3H3VL 2XCOA 3S0XA 2GAHC 2WB1L 4KMAA 4KATA 1JQWA 4KAWX 1WORA 2WAQD 1YX2A
chains in the Genus database with same CATH topology
1I3QA 4KMDA 1TWCA 1ISEA 3N0CA 2GSOA 4GFQA 1BGWA 1TWAA 4GT9A 4M1XA 1O2BA 2ZFZA 4GTBA 4FZBA 1XXAA 3ERED 3MMLB 4KM8A 4J3NA 3GTGA 4KDDA 5TJ3A 1K83A 1ZBSA 1O28A 3AQOA 1F9NA 3OPFA 4GTLA 3FOEA 4C3HC 1WCMA 5EGHA 1IS1A 1EH1A 1O24A 1O27A 4GTEA 4C3JC 2KWAA 3NUHA 3GTLA 1GE9A 2XCQA 3VA7A 3LPXA 1SFOA 2NVXA 4KASA 1BJTA 4G0VA 3GTOA 1Y1VA 1TWHA 4KMHA 3LAPA 3GTQA 4BLAA 2Y3PA 1WQHA 2YU9A 4P5BA 4KB4A 1ZVUA 3FHZA 2GSNA 3GTJA 1R9TA 1Y1WA 5JFEA 3CAGA 1XXBA 2VUMA 1O29A 2R92A 2JA6A 4C2MC 1ZXOA 1O2AA 2JH3A 3BUEA 4LQYA 3L4KA 5CJ9A 4ILDA 4LR2A 3Q3QA 3GTMA 1XXCA 2CFAB 2CFAA 4GTAA 2E2IA 2PHCB 4KB2A 1B4AA 2P5MA 3LAJA 3AQPA 1WQGA 4C3IC 4KM9A 1O26A 3OEPA 2RH6A 4P5AA 3FOFA 3FKIA 3N3YA 4BKWA 4G0UA 2R93A 3QX3A 4FM9A 2E2HA 1I50A 2B63A 2JA7A 5IOSA 2NVYA 4GTDA 4G0WA 4BLBA 4GTCA 5JVOA 1TWFA 3OREA 1B4BA 2XCRB 5IOQA 1KQ4A 3AH5A 3CQZA 4KARA 5EGEA 3GTKA 3N0BA 4KC6A 3G4AA 3GTPA 4GTFA 4DDQA 2GSUA 1O25A 2XCOA 1EK8A 3S0XA 4KMAA 1TWGA 2RGRA 2R7ZA 4KATA 3L4JA 5IOTA 5IORA 1DD5A 1WIHA 1AB4A 4KAWX 2JA5A 1WQFA 3H0GA 3G4CA 5CHPA 3V4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N0C A;  4GTC A;  1O24 A;  4GT9 A;  1O27 A;  4GTE A;  1O2A A;  1O2B A;  5IOQ A;  1KQ4 A;  3AH5 A;  4GTB A;  4FZB A;  4KAR A;  5CHP A;  2CFA B;  2CFA A;  3N0B A;  4GTA A;  4KAS A;  3G4A A;  4GTF A;  1O25 A;  1O26 A;  1O28 A;  4P5A A;  4P5B A;  3N3Y A;  4KAT A;  4GTL A;  5IOT A;  5IOR A;  5JFE A;  3G4C A;  5IOS A;  4GTD A;  1O29 A; 
#chains in the Genus database with same CATH topology
 1I3Q A;  2NVY C;  1ISE A;  4A3B C;  3SZY A;  1G51 A;  2ZFZ A;  2A6E A;  5HL8 A;  5M5W K;  3S17 K;  3MML B;  3M4O C;  4KM8 A;  5IP9 C;  3I4M C;  3GTG C;  5TJ3 A;  4BXX C;  4Q5S A;  1ZBS A;  2JA7 K;  4A3C C;  3AQO A;  3HOY K;  2VUM K;  3HOV K;  4MQ9 A;  5IYB K;  3GEE A;  3TFI A;  4C3H C;  4AH6 A;  1BDF A;  2Y0S L;  1J6W A;  2PMZ L;  1VJE A;  4OIP A;  3CQZ K;  3GIR A;  3AD7 C;  4LLG A;  1C0A A;  4C3J C;  2O5I A;  3NUH A;  2XCQ A;  5IYD K;  2V6S A;  2O5J A;  4G0V A;  1BJT A;  4BBR K;  1TWH A;  4KMH A;  4BLA A;  1I3Q K;  1WQH A;  2YU9 A;  3RZO C;  5IYC C;  3HXA A;  1R9T C;  2E2J K;  1F7V A;  1XZQ B;  4A3J C;  2R92 A;  2JA6 A;  4XLP A;  2GAG C;  3L4K A;  2JH3 A;  3GTP K;  3GTL C;  5C4J C;  3GTM A;  3S2H K;  3H3V D;  2R7Z K;  1XXC A;  2CFA A;  2E2I C;  2P5M A;  2WB1 D;  3AQP A;  1WQG A;  3GDZ A;  4C3I C;  3GTO C;  1RU0 A;  1Y1V C;  3OEP A;  4WJ3 M;  4A93 C;  4YFN A;  3FKI A;  3QX3 A;  3S1Q C;  2E2H C;  2R93 C;  1VLO A;  1JOE A;  3HKZ L;  2B63 C;  3M3Y K;  2NVT C;  2NVY A;  4GTD A;  3SZZ A;  4A3D C;  4BLB A;  2FQO A;  3S2D C;  3HOU C;  4A3L C;  1IBA A;  1HQM A;  3T01 A;  4OIR A;  1KQ4 A;  1HI9 A;  3HOZ C;  1XZP A;  3N0B A;  1DCH A;  1WSV A;  3IPJ A;  3S16 C;  4A3I C;  4QJV B;  1EK8 A;  3S1N K;  2JA6 K;  3PO2 C;  4C2M K;  4A3G K;  2PMZ D;  5FLM K;  5IOR A;  1DD5 A;  1WIH A;  2JA5 A;  4P9S A;  1PJ6 A;  5CHP A;  3GTM K;  5C4X C;  1TWC C;  3WOD A;  1TWA C;  4M1X A;  4BY1 C;  1O2B A;  2A6H A;  4AYB D;  4GTB A;  5L46 A;  1XXA A;  3ERE D;  3FKI K;  1F93 A;  1I6H C;  3JST A;  3AD9 C;  3I4N K;  3AD8 C;  1Y1W K;  1K83 C;  2V6U A;  2ZUF A;  1IQ0 A;  1F9N A;  4Y52 C;  4PAA A;  1EI6 A;  4MEY A;  1TWG C;  4GTL A;  1WCM A;  4KMU A;  1IS1 A;  4A3K K;  5M5Y K;  3K7A K;  1SMY A;  3H0G C;  4A3G C;  1EH1 A;  3GTL A;  4A3F K;  2JA8 C;  1VRQ C;  1SFO A;  3DXJ A;  4Y7N K;  4O2D A;  2NVX C;  4KAS A;  1L0W A;  3GTO A;  4BBS K;  1Y1V A;  3LAP A;  3GTQ C;  2JA5 K;  2Y3P A;  4KB4 A;  3A8I A;  2GSN A;  1J6X A;  3GTJ A;  3S14 K;  2D6F C;  4KN7 A;  4OIN A;  4Q4Z A;  3TFH A;  1ZXO A;  3GSI A;  5CJ9 A;  4ILD A;  4LR2 A;  4OIQ A;  4X6A K;  1DCO A;  4KB2 A;  1WCM K;  1B4A A;  1O26 A;  4BKW A;  3S17 C;  4FM9 A;  3A8K A;  1I50 A;  3RZD K;  2JA7 C;  4OIO A;  3HOY C;  1SFO K;  2VUM C;  3HOV C;  4A3M K;  4GTC A;  5IYB C;  1TWF A;  3ORE A;  4G7H A;  3AH5 A;  1DCP A;  4KAR A;  3CQZ C;  5C44 K;  3HOX K;  3S15 K;  3GTK A;  3G4A A;  4GTF A;  3GTJ K;  4QIW L;  1O25 A;  1USM A;  3S1R K;  2CW0 A;  1UV7 A;  1TWG A;  5IYD C;  2RGR A;  5M5X K;  4A3E K;  3L4J A;  5IOT A;  4BBR C;  3H0G A;  3G4C A;  3V4G A;  4KMD A;  1I3Q C;  3N0C A;  2A68 A;  2FQT A;  5D4D A;  2NVQ K;  1TWH K;  1VH2 A;  1WOS A;  5M3F K;  2E2J C;  3GEI A;  3HOW K;  4G7O A;  2YU9 K;  1I50 K;  3GTG A;  3GTP C;  1ZQ1 C;  4LOW A;  2R92 K;  5IP7 K;  3S2H C;  3FOE A;  2Y0S D;  2R7Z C;  1IE0 A;  3S1M K;  4XLN A;  5EGH A;  1X31 C;  4BY7 K;  3GTK K;  5C3E K;  1O27 A;  1ZYR A;  2PA8 L;  4LJZ A;  3VA7 A;  5M3M K;  3M3Y C;  2PPB A;  2P8T A;  4GZY A;  1J6V A;  4YFX A;  3ADA C;  2NVY K;  4P5B A;  4ZH4 A;  4A3B K;  5E68 A;  3FHZ A;  1R9T A;  1VGX A;  5JFE A;  1EFW A;  3CAG A;  1XXB A;  2VUM A;  1XZQ A;  1O29 A;  3S1N C;  1USO A;  2JA6 C;  3M4O K;  5IP9 K;  3I4M K;  4C2M C;  3GTG K;  4BXX K;  3BUE A;  5FLM C;  4A3C K;  3TTG A;  4C45 A;  3GTM C;  1JVI A;  4C3H K;  2CFA B;  2E2I A;  4KN4 A;  2PHC B;  4QIW D;  4KM9 A;  1IL2 A;  1PJ5 A;  4P5A A;  1PJ7 A;  4G0U A;  3FKI C;  4NOI A;  2R93 A;  2E2H A;  4C3J K;  3HKZ D;  2B63 A;  3I4N C;  1I6V A;  5IOS A;  1Y1W C;  1XPP A;  1WOO A;  4XSX A;  1EQR A;  1B4B A;  1WSR A;  4XCH A;  2XCR B;  5FJ8 K;  4A3K C;  1XZP B;  1BS2 A;  3K7A C;  5EGE A;  4LK0 A;  3RZO K;  5IYC K;  4WIL A;  3GTP A;  1R9T K;  4DDQ A;  2GSU A;  4QJV A;  3TFJ A;  4A3J K;  3GEH A;  4A3F C;  1F7U A;  3T02 A;  2R7Z A;  4Y7N C;  4JK1 A;  4BBS C;  1AB4 A;  3GTL K;  4LK1 A;  5C4J K;  1WQF A;  2JA5 C;  1YNN A;  4RMF A;  1INN A;  1TWC A;  2E2I K;  2GSO A;  4GFQ A;  1BGW A;  1TWA A;  2PA8 D;  4GT9 A;  4C3I K;  3GTO K;  1Y1V K;  3S14 C;  1IW7 A;  4FZB A;  4AYB L;  4A93 K;  3S1Q K;  2E2H K;  2R93 K;  5TMC A;  4J3N A;  4KDD A;  2A69 A;  1K83 A;  2B63 K;  2NVT K;  1O28 A;  4G7Z A;  3OPF A;  4MEX A;  4A3D K;  4X6A C;  3S2D K;  3HOU K;  4A3L K;  1WCM C;  3HOZ K;  2WAQ L;  1O24 A;  4A3I K;  3S16 K;  4GTE A;  2KWA A;  1GE9 A;  3RZD C;  3LPX A;  3PO2 K;  2NVX A;  1YCL A;  1SFO C;  4A3M C;  3GTQ A;  2V6T A;  2ZUE A;  5C4X K;  4PAB A;  1TWC K;  4XSZ A;  1ZVU A;  3EQL A;  1TWA K;  5C44 C;  3HOX C;  4BY1 K;  3S15 C;  4YFK A;  1TWF K;  1Y1W A;  3GTJ C;  2BE5 A;  3S1R C;  3PO3 K;  1I6H K;  4YG2 A;  4A3E C;  1O2A A;  1K83 K;  4LQY A;  4Y52 K;  1WOP A;  3T00 A;  3Q3Q A;  2EBB A;  1TWG K;  4GTA A;  3LAJ A;  5TMF A;  2NVQ C;  1TWH C;  2W7V A;  1J98 A;  2RH6 A;  3H0G K;  3HOW C;  3FOF A;  3N3Y A;  2YU9 C;  2JA8 K;  1I50 C;  2JA7 A;  4G0W A;  3BP3 A;  2NVX K;  3BP8 C;  1YNJ A;  5JVO A;  2R92 C;  5IP7 C;  3GTQ K;  1TWF C;  3S1M C;  5IOQ A;  1O2F B;  3PO3 C;  4BY7 C;  3CQZ A;  1V5V A;  3GTK C;  3A8J A;  5C3E C;  4KC6 A;  4WJ4 A;  3H3V L;  2XCO A;  3S0X A;  2GAH C;  2WB1 L;  4KMA A;  4KAT A;  1JQW A;  4KAW X;  1WOR A;  2WAQ D;  1YX2 A; 
#chains in the Genus database with same CATH homology
 1I3Q A;  4KMD A;  1TWC A;  1ISE A;  3N0C A;  2GSO A;  4GFQ A;  1BGW A;  1TWA A;  4GT9 A;  4M1X A;  1O2B A;  2ZFZ A;  4GTB A;  4FZB A;  1XXA A;  3ERE D;  3MML B;  4KM8 A;  4J3N A;  3GTG A;  4KDD A;  5TJ3 A;  1K83 A;  1ZBS A;  1O28 A;  3AQO A;  1F9N A;  3OPF A;  4GTL A;  3FOE A;  4C3H C;  1WCM A;  5EGH A;  1IS1 A;  1EH1 A;  1O24 A;  1O27 A;  4GTE A;  4C3J C;  2KWA A;  3NUH A;  3GTL A;  1GE9 A;  2XCQ A;  3VA7 A;  3LPX A;  1SFO A;  2NVX A;  4KAS A;  1BJT A;  4G0V A;  3GTO A;  1Y1V A;  1TWH A;  4KMH A;  3LAP A;  3GTQ A;  4BLA A;  2Y3P A;  1WQH A;  2YU9 A;  4P5B A;  4KB4 A;  1ZVU A;  3FHZ A;  2GSN A;  3GTJ A;  1R9T A;  1Y1W A;  5JFE A;  3CAG A;  1XXB A;  2VUM A;  1O29 A;  2R92 A;  2JA6 A;  4C2M C;  1ZXO A;  1O2A A;  2JH3 A;  3BUE A;  4LQY A;  3L4K A;  5CJ9 A;  4ILD A;  4LR2 A;  3Q3Q A;  3GTM A;  1XXC A;  2CFA B;  2CFA A;  4GTA A;  2E2I A;  2PHC B;  4KB2 A;  1B4A A;  2P5M A;  3LAJ A;  3AQP A;  1WQG A;  4C3I C;  4KM9 A;  1O26 A;  3OEP A;  2RH6 A;  4P5A A;  3FOF A;  3FKI A;  3N3Y A;  4BKW A;  4G0U A;  2R93 A;  3QX3 A;  4FM9 A;  2E2H A;  1I50 A;  2B63 A;  2JA7 A;  5IOS A;  2NVY A;  4GTD A;  4G0W A;  4BLB A;  4GTC A;  5JVO A;  1TWF A;  3ORE A;  1B4B A;  2XCR B;  5IOQ A;  1KQ4 A;  3AH5 A;  3CQZ A;  4KAR A;  5EGE A;  3GTK A;  3N0B A;  4KC6 A;  3G4A A;  3GTP A;  4GTF A;  4DDQ A;  2GSU A;  1O25 A;  2XCO A;  1EK8 A;  3S0X A;  4KMA A;  1TWG A;  2RGR A;  2R7Z A;  4KAT A;  3L4J A;  5IOT A;  5IOR A;  1DD5 A;  1WIH A;  1AB4 A;  4KAW X;  2JA5 A;  1WQF A;  3H0G A;  3G4C A;  5CHP A;  3V4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...