1O26A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and dump at 1.6 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
219
structure length
219
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 77
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o26A00
1O29A 4KARA 3AH5A 4GTEA 5CHPA 3G4AA 1O26A 4GTCA 4KATA 4P5BA 5IOQA 1O27A 4GTAA 4GTDA 1O2AA 2CFAB 5IORA 4P5AA 3N0CA 4GTLA 4FZBA 2CFAA 1O2BA 3G4CA 1O28A 5IOTA 1O24A 4GTFA 3N0BA 3N3YA 4GTBA 5JFEA 4GT9A 5IOSA 1O25A 1KQ4A 4KASA
chains in the Genus database with same CATH superfamily
3GEIA 5M5WK 1PJ5A 4AYBL 4P5BA 4J3NA 2XCRB 1EQRA 5C4XC 1XXBA 3HOUC 4G0WA 1EI6A 2V6SA 4C45A 3RZOC 1JOEA 1TWHA 2E2JK 5IP7K 4A3BK 1BGWA 2PPBA 1R9TC 3M4OK 1K83K 4A3CK 1EK8A 2JA6A 2BE5A 2NVXC 1HI9A 4LK1A 4QJVA 5EGHA 2D6FC 2R92C 1ZVUA 1BS2A 3CQZK 4GFQA 3AQPA 4XSZA 3GTOC 1O2BA 4KM8A 3S2HK 3GTLK 3VA7A 5IOTA 5M5XK 1DCOA 4KDDA 2PMZD 1O24A 4A3EC 2E2IC 3S1QK 4C3HK 2JH3A 5JFEA 4YFXA 2A68A 4GTEA 2JA6K 3FOEA 3S0XA 3GTGK 3GTMC 1INNA 3HOVC 1TWAC 2A69A 1YCLA 4GTDA 1WOPA 4FM9A 3K7AK 4XLNA 4Y52K 3G4CA 1B4BA 1I50K 3GTPA 2NVXA 1VRQC 3LAJA 2GSUA 5IYDC 2R92A 1PJ7A 2E2HC 2GSOA 4A3BC 1IS1A 1VH2A 3LPXA 1L0WA 4Y7NC 1TWFA 4A3CC 4BBSC 3GTQA 5C4XK 5JVOA 3HOUK 3GTOA 4KMAA 5IYCC 1DCHA 4FZBA 2E2IA 3HOYC 4BBRC 4A3DK 3RZOK 2P5MA 1Y1WA 1O28A 1R9TK 1IQ0A 2PA8D 3GTLC 1I6HC 4C3JC 2NVXK 1BJTA 1WIHA 4QJVB 4YFKA 3H0GC 3S1QC 1TWAA 1WOSA 5M5YK 2R92K 2NVYC 3IPJA 4O2DA 3S1NC 3GEEA 4P9SA 3GTOK 3GTGC 2WAQD 4P5AA 5FJ8K 3HKZD 1VGXA 4MEXA 3BUEA 4A3EK 1WQHA 1ZQ1C 3NUHA 2E2IK 2E2HA 4RMFA 5M3FK 3S1RC 4ZH4A 3RZDC 1K83A 3GSIA 3S17K 5FLMC 4A3KC 3GTMK 5CJ9A 5CHPA 2JA7C 3HOVK 1O26A 2GAGC 2W7VA 1AB4A 1TWAK 1V5VA 1J98A 3CQZA 3N0CA 3I4MC 4JK1A 2JA5C 3GTLA 4X6AK 2Y0SL 3AD8C 3JSTA 3FHZA 4QIWL 1WSRA 4GZYA 3H0GA 5IYDK 4A3DC 3ERED 2E2HK 1F7VA 4GTBA 2VUMC 4Y7NK 5IOSA 4G7OA 1KQ4A 3HOZC 4G7ZA 4BBSK 3GTGA 5IYCK 1HQMA 5C44C 3HOWC 4GTAA 3HOYK 1TWGC 4BBRK 3H3VL 4YG2A 1F93A 1I50A 3I4NC 3WODA 3TFJA 1I6HK 5C4JC 4C3JK 4PABA 1WOOA 4KN7A 3H0GK 4XCHA 3GDZA 2NVYK 1O29A 3S17C 3S1NK 2NVQC 3LAPA 1XZPA 1J6VA 3TFIA 1WQFA 5TMCA 1ZBSA 2XCOA 4LQYA 4Q4ZA 1JQWA 1VLOA 2R7ZC 3GTKC 3A8KA 4LJZA 3T02A 3S1RK 3PO2C 2VUMA 1IE0A 1R9TA 4A3LC 2YU9C 3RZDK 3AD9C 3S15C 3S14C 4X6AC 2R93C 1EH1A 3N0BA 5FLMK 4A3KK 3S16C 5C3EC 2JA7K 3OPFA 1XXCA 2V6UA 3L4JA 4WILA 1YNJA 1USOA 1TWGA 4DDQA 2XCQA 2PMZL 1ZXOA 3I4MK 4KN4A 2JA5K 4BXXK 3M3YC 1WQGA 1XXAA 2ZFZA 4Q5SA 1J6XA 3T01A 1Y1VC 2VUMK 2WB1D 3EQLA 3GIRA 3HOZK 5L46A 4YFNA 4WJ4A 3GTMA 4GT9A 5D4DA 4C3IC 2P8TA 2V6TA 5C44K 5IYBC 3HOWK 3GTKA 2R7ZA 1TWGK 4G0VA 1O2AA 2YU9A 3FKIC 3I4NK 1EFWA 2R93A 4GTLA 4LOWA 5C4JK 4KB2A 4BLBA 1USMA 3S1MK 4NOIA 3AD7C 4AYBD 3SZZA 3V4GA 3SZYA 3N3YA 1XZPB 4C2MC 2NVQK 5TMFA 1TWHC 2A6HA 4KMUA 4KARA 2O5JA 4BY7C 4OIRA 4KATA 1XZQA 4MQ9A 2PA8L 4PAAA 1WCMK 4BLAA 3GTKK 2R7ZK 1SFOK 3PO2K 1UV7A 4A3LK 2YU9K 3S15K 3S14K 2CFAA 4BXXC 2R93K 3FOFA 3DXJA 4A3IC 3S16K 5C3EK 4BY1K 2JA8C 1TWCC 1BDFA 4ILDA 2WAQL 5HL8A 3HKZL 2NVTC 5M3MK 4KC6A 2NVYA 2ZUFA 3FKIA 2KWAA 3S2DC 4A3FK 4A3GC 3M3YK 1DD5A 3PO3C 2EBBA 3TFHA 2FQTA 4XSXA 1PJ6A 4G7HA 1Y1VK 3OEPA 5TJ3A 3OREA 1YX2A 3S1MC 4C3IK 2JA7A 4MEYA 3GTPC 1SMYA 5IYBK 3HXAA 1WSVA 1O2FB 1I3QC 2GAHC 4LR2A 3FKIK 4XLPA 2JA5A 5IOQA 2CW0A 1JVIA 4A3JC 3GTJC 4G0UA 1TWFC 4A3MC 3GTQC 1WCMC 1TWCA 5IP9C 1SFOC 1GE9A 1IBAA 4WJ3M 2Y3PA 1XPPA 4OINA 4KMDA 4GTFA 4C2MK 1TWHK 1Y1WC 4BKWA 4BY1C 4BY7K 1YNNA 1XZQB 4AH6A 4KASA 3CAGA 2B63C 1ZYRA 3BP3A 4GTCA 3HOXC 1B4AA 3QX3A 4OIOA 3Q3QA 2PHCB 1ISEA 2CFAB 4A3FC 3ADAC 4OIPA 4A3IK 4A93K 2JA8K 1F7UA 1TWCK 2RH6A 4KM9A 2NVTK 1J6WA 1I3QA 3AQOA 1I6VA 1VJEA 2E2JC 5IP7C 2GSNA 3S2DK 3T00A 3GTJA 3M4OC 1K83C 3G4AA 4A3GK 1RU0A 1WCMA 3PO3K 1X31C 1IW7A 4LLGA 2ZUEA 1SFOA 1O27A 1F9NA 4M1XA 3BP8C 3H3VD 3CQZC 3A8JA 5EGEA 3GTPK 3S2HC 4KMHA 2B63A 2FQOA 1IL2A 1I3QK 4KB4A 4C3HC 3AH5A 2Y0SD 1C0AA 4QIWD 4A3JK 4OIQA 3GTJK 1TWFK 5E68A 2WB1L 4A3MK 2JA6C 3GTQK 4KAWX 3L4KA 3GEHA 2O5IA 3MMLB 5IORA 5IP9K 3TTGA 1Y1VA 3A8IA 2A6EA 3K7AC 1G51A 4Y52C 1Y1WK 4A93C 4LK0A 1I50C 1WORA 2B63K 2RGRA 1O25A 3HOXK 1DCPA
chains in the Genus database with same CATH topology
1TWAA 1TWGA 4DDQA 4LR2A 2XCQA 1ZXOA 4P5BA 4J3NA 2JA5A 5IOQA 2XCRB 4G0UA 1XXBA 4P5AA 4G0WA 1WQGA 1TWCA 1XXAA 3BUEA 1GE9A 2ZFZA 1WQHA 2Y3PA 3NUHA 2E2HA 1TWHA 4KMDA 4GTFA 1K83A 1BGWA 3GTMA 4BKWA 2JA6A 1EK8A 4GT9A 4C3IC 4KASA 3CAGA 5CJ9A 5CHPA 1O26A 5EGHA 4GTCA 1AB4A 3GTKA 2R7ZA 4G0VA 1ZVUA 1B4AA 3CQZA 3QX3A 3Q3QA 2PHCB 1ISEA 1O2AA 2CFAB 4GFQA 2YU9A 3N0CA 3AQPA 2R93A 4GTLA 3GTLA 4KB2A 1O2BA 4KM8A 4BLBA 3FHZA 3VA7A 2RH6A 5IOTA 4KM9A 3H0GA 4KDDA 1O24A 1I3QA 3AQOA 3V4GA 3ERED 3N3YA 4GTBA 2JH3A 5JFEA 4C2MC 5IOSA 2GSNA 1KQ4A 3GTJA 4KARA 4GTEA 3GTGA 3G4AA 1WCMA 3S0XA 3FOEA 4KATA 4BLAA 1SFOA 1O27A 1F9NA 4GTAA 4GTDA 4M1XA 4FM9A 1I50A 2CFAA 3G4CA 1B4BA 3FOFA 5EGEA 3GTPA 2NVXA 4KMHA 2B63A 4ILDA 3LAJA 2GSUA 4KC6A 4KB4A 2NVYA 2R92A 4C3HC 1O29A 2GSOA 3AH5A 1IS1A 3LPXA 3FKIA 1TWFA 2KWAA 3LAPA 3GTQA 5JVOA 3GTOA 1WQFA 1ZBSA 2XCOA 1DD5A 4KAWX 4KMAA 3L4KA 4LQYA 3MMLB 5IORA 4FZBA 2E2IA 1Y1VA 2P5MA 2VUMA 1O28A 3OEPA 1R9TA 1Y1WA 5TJ3A 3OREA 1EH1A 3N0BA 2JA7A 4C3JC 1BJTA 1WIHA 3OPFA 2RGRA 1O25A 1XXCA 3L4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O29 A;  4KAR A;  3AH5 A;  4GTE A;  5CHP A;  3G4A A;  1O26 A;  4GTC A;  4KAT A;  4P5B A;  5IOQ A;  1O27 A;  4GTA A;  4GTD A;  1O2A A;  2CFA B;  5IOR A;  4P5A A;  3N0C A;  4GTL A;  4FZB A;  2CFA A;  1O2B A;  3G4C A;  1O28 A;  5IOT A;  1O24 A;  4GTF A;  3N0B A;  3N3Y A;  4GTB A;  5JFE A;  4GT9 A;  5IOS A;  1O25 A;  1KQ4 A;  4KAS A; 
#chains in the Genus database with same CATH topology
 3GEI A;  5M5W K;  1PJ5 A;  4AYB L;  4P5B A;  4J3N A;  2XCR B;  1EQR A;  5C4X C;  1XXB A;  3HOU C;  4G0W A;  1EI6 A;  2V6S A;  4C45 A;  3RZO C;  1JOE A;  1TWH A;  2E2J K;  5IP7 K;  4A3B K;  1BGW A;  2PPB A;  1R9T C;  3M4O K;  1K83 K;  4A3C K;  1EK8 A;  2JA6 A;  2BE5 A;  2NVX C;  1HI9 A;  4LK1 A;  4QJV A;  5EGH A;  2D6F C;  2R92 C;  1ZVU A;  1BS2 A;  3CQZ K;  4GFQ A;  3AQP A;  4XSZ A;  3GTO C;  1O2B A;  4KM8 A;  3S2H K;  3GTL K;  3VA7 A;  5IOT A;  5M5X K;  1DCO A;  4KDD A;  2PMZ D;  1O24 A;  4A3E C;  2E2I C;  3S1Q K;  4C3H K;  2JH3 A;  5JFE A;  4YFX A;  2A68 A;  4GTE A;  2JA6 K;  3FOE A;  3S0X A;  3GTG K;  3GTM C;  1INN A;  3HOV C;  1TWA C;  2A69 A;  1YCL A;  4GTD A;  1WOP A;  4FM9 A;  3K7A K;  4XLN A;  4Y52 K;  3G4C A;  1B4B A;  1I50 K;  3GTP A;  2NVX A;  1VRQ C;  3LAJ A;  2GSU A;  5IYD C;  2R92 A;  1PJ7 A;  2E2H C;  2GSO A;  4A3B C;  1IS1 A;  1VH2 A;  3LPX A;  1L0W A;  4Y7N C;  1TWF A;  4A3C C;  4BBS C;  3GTQ A;  5C4X K;  5JVO A;  3HOU K;  3GTO A;  4KMA A;  5IYC C;  1DCH A;  4FZB A;  2E2I A;  3HOY C;  4BBR C;  4A3D K;  3RZO K;  2P5M A;  1Y1W A;  1O28 A;  1R9T K;  1IQ0 A;  2PA8 D;  3GTL C;  1I6H C;  4C3J C;  2NVX K;  1BJT A;  1WIH A;  4QJV B;  4YFK A;  3H0G C;  3S1Q C;  1TWA A;  1WOS A;  5M5Y K;  2R92 K;  2NVY C;  3IPJ A;  4O2D A;  3S1N C;  3GEE A;  4P9S A;  3GTO K;  3GTG C;  2WAQ D;  4P5A A;  5FJ8 K;  3HKZ D;  1VGX A;  4MEX A;  3BUE A;  4A3E K;  1WQH A;  1ZQ1 C;  3NUH A;  2E2I K;  2E2H A;  4RMF A;  5M3F K;  3S1R C;  4ZH4 A;  3RZD C;  1K83 A;  3GSI A;  3S17 K;  5FLM C;  4A3K C;  3GTM K;  5CJ9 A;  5CHP A;  2JA7 C;  3HOV K;  1O26 A;  2GAG C;  2W7V A;  1AB4 A;  1TWA K;  1V5V A;  1J98 A;  3CQZ A;  3N0C A;  3I4M C;  4JK1 A;  2JA5 C;  3GTL A;  4X6A K;  2Y0S L;  3AD8 C;  3JST A;  3FHZ A;  4QIW L;  1WSR A;  4GZY A;  3H0G A;  5IYD K;  4A3D C;  3ERE D;  2E2H K;  1F7V A;  4GTB A;  2VUM C;  4Y7N K;  5IOS A;  4G7O A;  1KQ4 A;  3HOZ C;  4G7Z A;  4BBS K;  3GTG A;  5IYC K;  1HQM A;  5C44 C;  3HOW C;  4GTA A;  3HOY K;  1TWG C;  4BBR K;  3H3V L;  4YG2 A;  1F93 A;  1I50 A;  3I4N C;  3WOD A;  3TFJ A;  1I6H K;  5C4J C;  4C3J K;  4PAB A;  1WOO A;  4KN7 A;  3H0G K;  4XCH A;  3GDZ A;  2NVY K;  1O29 A;  3S17 C;  3S1N K;  2NVQ C;  3LAP A;  1XZP A;  1J6V A;  3TFI A;  1WQF A;  5TMC A;  1ZBS A;  2XCO A;  4LQY A;  4Q4Z A;  1JQW A;  1VLO A;  2R7Z C;  3GTK C;  3A8K A;  4LJZ A;  3T02 A;  3S1R K;  3PO2 C;  2VUM A;  1IE0 A;  1R9T A;  4A3L C;  2YU9 C;  3RZD K;  3AD9 C;  3S15 C;  3S14 C;  4X6A C;  2R93 C;  1EH1 A;  3N0B A;  5FLM K;  4A3K K;  3S16 C;  5C3E C;  2JA7 K;  3OPF A;  1XXC A;  2V6U A;  3L4J A;  4WIL A;  1YNJ A;  1USO A;  1TWG A;  4DDQ A;  2XCQ A;  2PMZ L;  1ZXO A;  3I4M K;  4KN4 A;  2JA5 K;  4BXX K;  3M3Y C;  1WQG A;  1XXA A;  2ZFZ A;  4Q5S A;  1J6X A;  3T01 A;  1Y1V C;  2VUM K;  2WB1 D;  3EQL A;  3GIR A;  3HOZ K;  5L46 A;  4YFN A;  4WJ4 A;  3GTM A;  4GT9 A;  5D4D A;  4C3I C;  2P8T A;  2V6T A;  5C44 K;  5IYB C;  3HOW K;  3GTK A;  2R7Z A;  1TWG K;  4G0V A;  1O2A A;  2YU9 A;  3FKI C;  3I4N K;  1EFW A;  2R93 A;  4GTL A;  4LOW A;  5C4J K;  4KB2 A;  4BLB A;  1USM A;  3S1M K;  4NOI A;  3AD7 C;  4AYB D;  3SZZ A;  3V4G A;  3SZY A;  3N3Y A;  1XZP B;  4C2M C;  2NVQ K;  5TMF A;  1TWH C;  2A6H A;  4KMU A;  4KAR A;  2O5J A;  4BY7 C;  4OIR A;  4KAT A;  1XZQ A;  4MQ9 A;  2PA8 L;  4PAA A;  1WCM K;  4BLA A;  3GTK K;  2R7Z K;  1SFO K;  3PO2 K;  1UV7 A;  4A3L K;  2YU9 K;  3S15 K;  3S14 K;  2CFA A;  4BXX C;  2R93 K;  3FOF A;  3DXJ A;  4A3I C;  3S16 K;  5C3E K;  4BY1 K;  2JA8 C;  1TWC C;  1BDF A;  4ILD A;  2WAQ L;  5HL8 A;  3HKZ L;  2NVT C;  5M3M K;  4KC6 A;  2NVY A;  2ZUF A;  3FKI A;  2KWA A;  3S2D C;  4A3F K;  4A3G C;  3M3Y K;  1DD5 A;  3PO3 C;  2EBB A;  3TFH A;  2FQT A;  4XSX A;  1PJ6 A;  4G7H A;  1Y1V K;  3OEP A;  5TJ3 A;  3ORE A;  1YX2 A;  3S1M C;  4C3I K;  2JA7 A;  4MEY A;  3GTP C;  1SMY A;  5IYB K;  3HXA A;  1WSV A;  1O2F B;  1I3Q C;  2GAH C;  4LR2 A;  3FKI K;  4XLP A;  2JA5 A;  5IOQ A;  2CW0 A;  1JVI A;  4A3J C;  3GTJ C;  4G0U A;  1TWF C;  4A3M C;  3GTQ C;  1WCM C;  1TWC A;  5IP9 C;  1SFO C;  1GE9 A;  1IBA A;  4WJ3 M;  2Y3P A;  1XPP A;  4OIN A;  4KMD A;  4GTF A;  4C2M K;  1TWH K;  1Y1W C;  4BKW A;  4BY1 C;  4BY7 K;  1YNN A;  1XZQ B;  4AH6 A;  4KAS A;  3CAG A;  2B63 C;  1ZYR A;  3BP3 A;  4GTC A;  3HOX C;  1B4A A;  3QX3 A;  4OIO A;  3Q3Q A;  2PHC B;  1ISE A;  2CFA B;  4A3F C;  3ADA C;  4OIP A;  4A3I K;  4A93 K;  2JA8 K;  1F7U A;  1TWC K;  2RH6 A;  4KM9 A;  2NVT K;  1J6W A;  1I3Q A;  3AQO A;  1I6V A;  1VJE A;  2E2J C;  5IP7 C;  2GSN A;  3S2D K;  3T00 A;  3GTJ A;  3M4O C;  1K83 C;  3G4A A;  4A3G K;  1RU0 A;  1WCM A;  3PO3 K;  1X31 C;  1IW7 A;  4LLG A;  2ZUE A;  1SFO A;  1O27 A;  1F9N A;  4M1X A;  3BP8 C;  3H3V D;  3CQZ C;  3A8J A;  5EGE A;  3GTP K;  3S2H C;  4KMH A;  2B63 A;  2FQO A;  1IL2 A;  1I3Q K;  4KB4 A;  4C3H C;  3AH5 A;  2Y0S D;  1C0A A;  4QIW D;  4A3J K;  4OIQ A;  3GTJ K;  1TWF K;  5E68 A;  2WB1 L;  4A3M K;  2JA6 C;  3GTQ K;  4KAW X;  3L4K A;  3GEH A;  2O5I A;  3MML B;  5IOR A;  5IP9 K;  3TTG A;  1Y1V A;  3A8I A;  2A6E A;  3K7A C;  1G51 A;  4Y52 C;  1Y1W K;  4A93 C;  4LK0 A;  1I50 C;  1WOR A;  2B63 K;  2RGR A;  1O25 A;  3HOX K;  1DCP A; 
#chains in the Genus database with same CATH homology
 1TWA A;  1TWG A;  4DDQ A;  4LR2 A;  2XCQ A;  1ZXO A;  4P5B A;  4J3N A;  2JA5 A;  5IOQ A;  2XCR B;  4G0U A;  1XXB A;  4P5A A;  4G0W A;  1WQG A;  1TWC A;  1XXA A;  3BUE A;  1GE9 A;  2ZFZ A;  1WQH A;  2Y3P A;  3NUH A;  2E2H A;  1TWH A;  4KMD A;  4GTF A;  1K83 A;  1BGW A;  3GTM A;  4BKW A;  2JA6 A;  1EK8 A;  4GT9 A;  4C3I C;  4KAS A;  3CAG A;  5CJ9 A;  5CHP A;  1O26 A;  5EGH A;  4GTC A;  1AB4 A;  3GTK A;  2R7Z A;  4G0V A;  1ZVU A;  1B4A A;  3CQZ A;  3QX3 A;  3Q3Q A;  2PHC B;  1ISE A;  1O2A A;  2CFA B;  4GFQ A;  2YU9 A;  3N0C A;  3AQP A;  2R93 A;  4GTL A;  3GTL A;  4KB2 A;  1O2B A;  4KM8 A;  4BLB A;  3FHZ A;  3VA7 A;  2RH6 A;  5IOT A;  4KM9 A;  3H0G A;  4KDD A;  1O24 A;  1I3Q A;  3AQO A;  3V4G A;  3ERE D;  3N3Y A;  4GTB A;  2JH3 A;  5JFE A;  4C2M C;  5IOS A;  2GSN A;  1KQ4 A;  3GTJ A;  4KAR A;  4GTE A;  3GTG A;  3G4A A;  1WCM A;  3S0X A;  3FOE A;  4KAT A;  4BLA A;  1SFO A;  1O27 A;  1F9N A;  4GTA A;  4GTD A;  4M1X A;  4FM9 A;  1I50 A;  2CFA A;  3G4C A;  1B4B A;  3FOF A;  5EGE A;  3GTP A;  2NVX A;  4KMH A;  2B63 A;  4ILD A;  3LAJ A;  2GSU A;  4KC6 A;  4KB4 A;  2NVY A;  2R92 A;  4C3H C;  1O29 A;  2GSO A;  3AH5 A;  1IS1 A;  3LPX A;  3FKI A;  1TWF A;  2KWA A;  3LAP A;  3GTQ A;  5JVO A;  3GTO A;  1WQF A;  1ZBS A;  2XCO A;  1DD5 A;  4KAW X;  4KMA A;  3L4K A;  4LQY A;  3MML B;  5IOR A;  4FZB A;  2E2I A;  1Y1V A;  2P5M A;  2VUM A;  1O28 A;  3OEP A;  1R9T A;  1Y1W A;  5TJ3 A;  3ORE A;  1EH1 A;  3N0B A;  2JA7 A;  4C3J C;  1BJT A;  1WIH A;  3OPF A;  2RGR A;  1O25 A;  1XXC A;  3L4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...