1O28A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fdump at 2.1 a resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
b'HHHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 79
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o28A00
5JFEA 4KARA 4GTBA 4GTDA 5IOQA 2CFAB 1O25A 5CHPA 4KATA 4GTLA 1KQ4A 3G4AA 4FZBA 4KASA 4GTAA 3N0BA 1O2AA 1O2BA 4GTCA 3N3YA 3AH5A 1O28A 3G4CA 1O29A 1O26A 4GTEA 3N0CA 4P5AA 4P5BA 5IOTA 5IORA 4GTFA 1O27A 5IOSA 1O24A 2CFAA 4GT9A
chains in the Genus database with same CATH superfamily
2JA7A 4Q5SA 2WAQL 1R9TK 3S1QK 3GIRA 4A3CK 3S2DK 3GTJK 1SMYA 1O25A 1WCMK 3GTMA 4A93C 2A69A 1IE0A 1KQ4A 2PMZL 1BS2A 2D6FC 3EQLA 3HOWC 3S16C 4G7OA 1XZPA 4A3DK 3OEPA 1I3QK 4GZYA 2JA7K 1IL2A 2R92A 2W7VA 2P8TA 4A3IK 1F7VA 2V6TA 1DCHA 2O5JA 3GTMK 5HL8A 1PJ6A 3H3VD 1TWHC 3LAPA 3AD7C 4A3FC 2B63A 4C3JK 1VH2A 3TTGA 3I4MK 1I6HC 4KARA 3FKIK 5FLMK 4BLAA 3OREA 2R92K 2PHCB 1TWAA 1INNA 2GSUA 1IS1A 2WB1D 3S2HK 3HOVC 3T00A 1BGWA 1XXAA 1J98A 2A6HA 4GTAA 4A3LK 2R93A 5M5WK 1F7UA 2B63K 3PO2C 4YFNA 4WJ4A 1XXCA 1ZYRA 4A3BK 5IYBC 5M3FK 3GTGC 4YFKA 5C4XC 4KB4A 1JQWA 2R93K 2NVYA 2NVTK 4GTBA 2YU9A 1TWCK 2E2HC 4BY1C 3FOEA 1TWGC 3GEIA 5IYCK 4AYBL 4PABA 5M3MK 2JA5A 4DDQA 2NVYK 3HOZK 1WIHA 2E2JC 2YU9K 2VUMA 2CW0A 4RMFA 3M4OC 1I50C 4QJVB 3S17C 4A3GK 5IP7K 3M3YC 5TMCA 4AH6A 2CFAA 1SFOA 3AQOA 3TFJA 1IW7A 4A3DC 1I3QC 1AB4A 2JA7C 2E2IA 2VUMK 4WJ3M 1WQFA 3GTPA 3GTMC 1VJEA 1HI9A 2P5MA 3A8KA 1G51A 3HOUK 1EH1A 4M1XA 1O28A 4C3JC 1SFOK 4BBSK 1J6VA 1XZQB 1DCPA 4LK1A 2JA6K 1O26A 1YCLA 2E2IK 3S1RK 3S2HC 5IOSA 4P9SA 4G0VA 2XCQA 2B63C 2Y0SL 3TFHA 4KMHA 1DD5A 1ZQ1C 1TWAC 2GAHC 3S15C 3HOYK 4Y7NK 3CQZA 3S14K 3GTLA 2XCOA 4LJZA 3LPXA 3I4NK 4X6AK 1EFWA 4WILA 2R93C 2NVTC 1TWFA 1WOPA 5IYDC 5CJ9A 3GTJA 1WCMA 5IOTA 5IORA 1EQRA 3S1MC 5C3EC 5IYCC 1IQ0A 3GTLK 5TJ3A 2O5IA 4GT9A 2NVYC 1TWFK 1F9NA 3K7AK 4OIPA 4A3KC 5IP9K 4C3IK 2R7ZK 3N0BA 1O2AA 2JA5C 3FKIA 2V6SA 4A3EC 3N0CA 4P5AA 1YNJA 2VUMC 2NVXA 4XLPA 3A8IA 3H3VL 2XCRB 1EI6A 4KM9A 4KM8A 5D4DA 2NVQK 4KMDA 1SFOC 1B4BA 4O2DA 4C45A 2WB1L 1Y1WK 1WSRA 2NVXK 4KAWX 4KASA 3GTPC 4G0UA 1USMA 4LLGA 3RZDK 3GTKA 4Y52K 5C44C 4G7ZA 1TWCA 2JA8K 4KN7A 3ERED 1XXBA 4GTFA 3S1NC 3PO3K 1O27A 3GTKK 3I4NC 4X6AC 2BE5A 3GTQC 5JVOA 2A68A 4MQ9A 4FZBA 1PJ5A 3AD9C 3CQZC 3GTLC 1BJTA 4QJVA 1GE9A 1TWFC 1R9TC 3S1QC 4A3CC 5C4JK 1UV7A 2KWAA 3GTJC 3S2DC 5IP9C 3H0GK 1WCMC 3MMLB 4J3NA 4KMUA 3HOXK 4PAAA 4BBRK 1USOA 3S0XA 2GSNA 3GDZA 2FQOA 2JA6A 4A3IC 4KMAA 3TFIA 1XZQA 3HKZD 1EK8A 4KDDA 4BXXK 4C2MK 1JOEA 3I4MC 2ZFZA 4A93K 3T01A 3FKIC 5FLMC 3HOWK 4A3JK 1J6XA 2R92C 1XPPA 3GEHA 3L4JA 1F93A 4OIQA 4QIWL 1PJ7A 4A3LC 1HQMA 4BY7K 4GFQA 2JA8C 1TWHK 1YNNA 4A3BC 1K83A 4A3FK 3QX3A 2RGRA 5EGHA 1I6HK 4C3HK 1IBAA 4MEXA 4XCHA 5M5YK 3HOVK 1O29A 2PA8D 1ZVUA 1TWCC 3IPJA 3SZYA 4BKWA 1K83K 4LR2A 3PO2K 2R7ZA 4OIOA 4A3MK 1Y1VA 3L4KA 1VLOA 3GTGK 4LOWA 3HOZC 2YU9C 5C4XK 4FM9A 3OPFA 1O2BA 1WQGA 4A3GC 5IP7C 3AH5A 2E2HK 1RU0A 3HXAA 3SZZA 1Y1VK 1I50A 1Y1WA 4G7HA 2PPBA 3BUEA 2E2JK 3NUHA 2WAQD 3HOUC 3FHZA 1C0AA 4BBSC 3M4OK 1I50K 4C2MC 5IOQA 4XSXA 3S17K 4BXXC 4XSZA 3M3YK 2JH3A 2JA6C 2PMZD 1WOSA 4A3JC 2E2IC 3BP8C 3S1RC 1YX2A 2ZUEA 4LQYA 1WQHA 3T02A 1XZPB 4GTEA 4BY7C 4P5BA 4BLBA 1JVIA 2EBBA 3JSTA 3GTOA 3HOYC 3CAGA 4Y7NC 4C3HC 3S14C 3BP3A 2RH6A 3A8JA 4KATA 3G4AA 2GSOA 3H0GA 4XLNA 1L0WA 1K83C 3GTOK 4KB2A 3N3YA 2FQTA 1TWAK 3RZOK 3S15K 4A3MC 2V6UA 4OINA 1B4AA 1V5VA 3K7AC 1BDFA 4C3IC 1O24A 2R7ZC 5IYDK 4G0WA 5TMFA 3AQPA 5FJ8K 3S1MK 3DXJA 1ZBSA 3FOFA 5CHPA 1Y1VC 5C3EK 5M5XK 4AYBD 4ILDA 4LK0A 1ISEA 3HKZL 4KC6A 2NVQC 4A3KK 3AD8C 3S16K 1TWHA 4NOIA 4Q4ZA 1Y1WC 1VRQC 2JA5K 2NVXC 4A3EK 5JFEA 1I6VA 3RZDC 4GTDA 2CFAB 1O2FB 4GTLA 4Y52C 5EGEA 1WOOA 5L46A 4YFXA 3PO3C 4GTCA 3GEEA 3LAJA 1DCOA 3GTKC 1ZXOA 3GTGA 2PA8L 3V4GA 3GTPK 4MEYA 3GSIA 2A6EA 3VA7A 4QIWD 1X31C 3GTQA 3GTOC 5C44K 3WODA 1WSVA 2Y0SD 2E2HA 5IYBK 1TWGA 3S1NK 3RZOC 1J6WA 2ZUFA 3Q3QA 4KN4A 5C4JC 3ADAC 1VGXA 3H0GC 4JK1A 3GTQK 1WORA 1R9TA 3G4CA 3HOXC 4BY1K 4ZH4A 1TWGK 4BBRC 4OIRA 2GAGC 4YG2A 3CQZK 2Y3PA 5E68A 1I3QA
chains in the Genus database with same CATH topology
2JA7A 4C3HC 2XCQA 4KMHA 1DD5A 3S0XA 2GSNA 2JA6A 1O25A 3GTMA 2RH6A 4KATA 4KMAA 1KQ4A 3G4AA 2GSOA 3H0GA 1EK8A 3CQZA 4KB2A 2XCOA 3GTLA 3N3YA 3LPXA 4KDDA 3OEPA 1TWFA 2R92A 2ZFZA 5CJ9A 3GTJA 1WCMA 5IOTA 5IORA 1B4AA 3LAPA 4C3IC 2B63A 5TJ3A 3L4JA 1O24A 4GT9A 4KARA 4BLAA 3OREA 4G0WA 1F9NA 2PHCB 1TWAA 3AQPA 4GFQA 2GSUA 1ZBSA 1IS1A 3FOFA 5CHPA 1BGWA 1K83A 1XXAA 4ILDA 2RGRA 3QX3A 5EGHA 1ISEA 4GTAA 3N0BA 1O2AA 2R93A 3FKIA 4KC6A 1XXCA 1O29A 1ZVUA 3N0CA 4P5AA 4BKWA 2NVXA 1TWHA 4LR2A 2R7ZA 2XCRB 4KB4A 4KM9A 4KM8A 2NVYA 5JFEA 4KMDA 4GTBA 2YU9A 1B4BA 1Y1VA 4GTDA 3L4KA 2CFAB 3FOEA 4GTLA 5EGEA 4FM9A 4KAWX 4KASA 3OPFA 4G0UA 4GTCA 1O2BA 2JA5A 1WQGA 4DDQA 3GTKA 3AH5A 3LAJA 1WIHA 1TWCA 1I50A 1ZXOA 3GTGA 2VUMA 3ERED 3V4GA 1XXBA 4GTFA 1O27A 1Y1WA 3VA7A 3BUEA 3GTQA 2CFAA 1SFOA 3AQOA 3NUHA 2E2HA 1AB4A 3FHZA 1TWGA 2E2IA 4C2MC 5IOQA 5JVOA 2JH3A 1WQFA 3GTPA 4FZBA 3Q3QA 2P5MA 1EH1A 4M1XA 1O28A 1BJTA 4LQYA 4C3JC 1R9TA 3G4CA 1WQHA 1GE9A 1O26A 4GTEA 4P5BA 2KWAA 4BLBA 5IOSA 3MMLB 3GTOA 4J3NA 2Y3PA 3CAGA 1I3QA 4G0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JFE A;  4KAR A;  4GTB A;  4GTD A;  5IOQ A;  2CFA B;  1O25 A;  5CHP A;  4KAT A;  4GTL A;  1KQ4 A;  3G4A A;  4FZB A;  4KAS A;  4GTA A;  3N0B A;  1O2A A;  1O2B A;  4GTC A;  3N3Y A;  3AH5 A;  1O28 A;  3G4C A;  1O29 A;  1O26 A;  4GTE A;  3N0C A;  4P5A A;  4P5B A;  5IOT A;  5IOR A;  4GTF A;  1O27 A;  5IOS A;  1O24 A;  2CFA A;  4GT9 A; 
#chains in the Genus database with same CATH topology
 2JA7 A;  4Q5S A;  2WAQ L;  1R9T K;  3S1Q K;  3GIR A;  4A3C K;  3S2D K;  3GTJ K;  1SMY A;  1O25 A;  1WCM K;  3GTM A;  4A93 C;  2A69 A;  1IE0 A;  1KQ4 A;  2PMZ L;  1BS2 A;  2D6F C;  3EQL A;  3HOW C;  3S16 C;  4G7O A;  1XZP A;  4A3D K;  3OEP A;  1I3Q K;  4GZY A;  2JA7 K;  1IL2 A;  2R92 A;  2W7V A;  2P8T A;  4A3I K;  1F7V A;  2V6T A;  1DCH A;  2O5J A;  3GTM K;  5HL8 A;  1PJ6 A;  3H3V D;  1TWH C;  3LAP A;  3AD7 C;  4A3F C;  2B63 A;  4C3J K;  1VH2 A;  3TTG A;  3I4M K;  1I6H C;  4KAR A;  3FKI K;  5FLM K;  4BLA A;  3ORE A;  2R92 K;  2PHC B;  1TWA A;  1INN A;  2GSU A;  1IS1 A;  2WB1 D;  3S2H K;  3HOV C;  3T00 A;  1BGW A;  1XXA A;  1J98 A;  2A6H A;  4GTA A;  4A3L K;  2R93 A;  5M5W K;  1F7U A;  2B63 K;  3PO2 C;  4YFN A;  4WJ4 A;  1XXC A;  1ZYR A;  4A3B K;  5IYB C;  5M3F K;  3GTG C;  4YFK A;  5C4X C;  4KB4 A;  1JQW A;  2R93 K;  2NVY A;  2NVT K;  4GTB A;  2YU9 A;  1TWC K;  2E2H C;  4BY1 C;  3FOE A;  1TWG C;  3GEI A;  5IYC K;  4AYB L;  4PAB A;  5M3M K;  2JA5 A;  4DDQ A;  2NVY K;  3HOZ K;  1WIH A;  2E2J C;  2YU9 K;  2VUM A;  2CW0 A;  4RMF A;  3M4O C;  1I50 C;  4QJV B;  3S17 C;  4A3G K;  5IP7 K;  3M3Y C;  5TMC A;  4AH6 A;  2CFA A;  1SFO A;  3AQO A;  3TFJ A;  1IW7 A;  4A3D C;  1I3Q C;  1AB4 A;  2JA7 C;  2E2I A;  2VUM K;  4WJ3 M;  1WQF A;  3GTP A;  3GTM C;  1VJE A;  1HI9 A;  2P5M A;  3A8K A;  1G51 A;  3HOU K;  1EH1 A;  4M1X A;  1O28 A;  4C3J C;  1SFO K;  4BBS K;  1J6V A;  1XZQ B;  1DCP A;  4LK1 A;  2JA6 K;  1O26 A;  1YCL A;  2E2I K;  3S1R K;  3S2H C;  5IOS A;  4P9S A;  4G0V A;  2XCQ A;  2B63 C;  2Y0S L;  3TFH A;  4KMH A;  1DD5 A;  1ZQ1 C;  1TWA C;  2GAH C;  3S15 C;  3HOY K;  4Y7N K;  3CQZ A;  3S14 K;  3GTL A;  2XCO A;  4LJZ A;  3LPX A;  3I4N K;  4X6A K;  1EFW A;  4WIL A;  2R93 C;  2NVT C;  1TWF A;  1WOP A;  5IYD C;  5CJ9 A;  3GTJ A;  1WCM A;  5IOT A;  5IOR A;  1EQR A;  3S1M C;  5C3E C;  5IYC C;  1IQ0 A;  3GTL K;  5TJ3 A;  2O5I A;  4GT9 A;  2NVY C;  1TWF K;  1F9N A;  3K7A K;  4OIP A;  4A3K C;  5IP9 K;  4C3I K;  2R7Z K;  3N0B A;  1O2A A;  2JA5 C;  3FKI A;  2V6S A;  4A3E C;  3N0C A;  4P5A A;  1YNJ A;  2VUM C;  2NVX A;  4XLP A;  3A8I A;  3H3V L;  2XCR B;  1EI6 A;  4KM9 A;  4KM8 A;  5D4D A;  2NVQ K;  4KMD A;  1SFO C;  1B4B A;  4O2D A;  4C45 A;  2WB1 L;  1Y1W K;  1WSR A;  2NVX K;  4KAW X;  4KAS A;  3GTP C;  4G0U A;  1USM A;  4LLG A;  3RZD K;  3GTK A;  4Y52 K;  5C44 C;  4G7Z A;  1TWC A;  2JA8 K;  4KN7 A;  3ERE D;  1XXB A;  4GTF A;  3S1N C;  3PO3 K;  1O27 A;  3GTK K;  3I4N C;  4X6A C;  2BE5 A;  3GTQ C;  5JVO A;  2A68 A;  4MQ9 A;  4FZB A;  1PJ5 A;  3AD9 C;  3CQZ C;  3GTL C;  1BJT A;  4QJV A;  1GE9 A;  1TWF C;  1R9T C;  3S1Q C;  4A3C C;  5C4J K;  1UV7 A;  2KWA A;  3GTJ C;  3S2D C;  5IP9 C;  3H0G K;  1WCM C;  3MML B;  4J3N A;  4KMU A;  3HOX K;  4PAA A;  4BBR K;  1USO A;  3S0X A;  2GSN A;  3GDZ A;  2FQO A;  2JA6 A;  4A3I C;  4KMA A;  3TFI A;  1XZQ A;  3HKZ D;  1EK8 A;  4KDD A;  4BXX K;  4C2M K;  1JOE A;  3I4M C;  2ZFZ A;  4A93 K;  3T01 A;  3FKI C;  5FLM C;  3HOW K;  4A3J K;  1J6X A;  2R92 C;  1XPP A;  3GEH A;  3L4J A;  1F93 A;  4OIQ A;  4QIW L;  1PJ7 A;  4A3L C;  1HQM A;  4BY7 K;  4GFQ A;  2JA8 C;  1TWH K;  1YNN A;  4A3B C;  1K83 A;  4A3F K;  3QX3 A;  2RGR A;  5EGH A;  1I6H K;  4C3H K;  1IBA A;  4MEX A;  4XCH A;  5M5Y K;  3HOV K;  1O29 A;  2PA8 D;  1ZVU A;  1TWC C;  3IPJ A;  3SZY A;  4BKW A;  1K83 K;  4LR2 A;  3PO2 K;  2R7Z A;  4OIO A;  4A3M K;  1Y1V A;  3L4K A;  1VLO A;  3GTG K;  4LOW A;  3HOZ C;  2YU9 C;  5C4X K;  4FM9 A;  3OPF A;  1O2B A;  1WQG A;  4A3G C;  5IP7 C;  3AH5 A;  2E2H K;  1RU0 A;  3HXA A;  3SZZ A;  1Y1V K;  1I50 A;  1Y1W A;  4G7H A;  2PPB A;  3BUE A;  2E2J K;  3NUH A;  2WAQ D;  3HOU C;  3FHZ A;  1C0A A;  4BBS C;  3M4O K;  1I50 K;  4C2M C;  5IOQ A;  4XSX A;  3S17 K;  4BXX C;  4XSZ A;  3M3Y K;  2JH3 A;  2JA6 C;  2PMZ D;  1WOS A;  4A3J C;  2E2I C;  3BP8 C;  3S1R C;  1YX2 A;  2ZUE A;  4LQY A;  1WQH A;  3T02 A;  1XZP B;  4GTE A;  4BY7 C;  4P5B A;  4BLB A;  1JVI A;  2EBB A;  3JST A;  3GTO A;  3HOY C;  3CAG A;  4Y7N C;  4C3H C;  3S14 C;  3BP3 A;  2RH6 A;  3A8J A;  4KAT A;  3G4A A;  2GSO A;  3H0G A;  4XLN A;  1L0W A;  1K83 C;  3GTO K;  4KB2 A;  3N3Y A;  2FQT A;  1TWA K;  3RZO K;  3S15 K;  4A3M C;  2V6U A;  4OIN A;  1B4A A;  1V5V A;  3K7A C;  1BDF A;  4C3I C;  1O24 A;  2R7Z C;  5IYD K;  4G0W A;  5TMF A;  3AQP A;  5FJ8 K;  3S1M K;  3DXJ A;  1ZBS A;  3FOF A;  5CHP A;  1Y1V C;  5C3E K;  5M5X K;  4AYB D;  4ILD A;  4LK0 A;  1ISE A;  3HKZ L;  4KC6 A;  2NVQ C;  4A3K K;  3AD8 C;  3S16 K;  1TWH A;  4NOI A;  4Q4Z A;  1Y1W C;  1VRQ C;  2JA5 K;  2NVX C;  4A3E K;  5JFE A;  1I6V A;  3RZD C;  4GTD A;  2CFA B;  1O2F B;  4GTL A;  4Y52 C;  5EGE A;  1WOO A;  5L46 A;  4YFX A;  3PO3 C;  4GTC A;  3GEE A;  3LAJ A;  1DCO A;  3GTK C;  1ZXO A;  3GTG A;  2PA8 L;  3V4G A;  3GTP K;  4MEY A;  3GSI A;  2A6E A;  3VA7 A;  4QIW D;  1X31 C;  3GTQ A;  3GTO C;  5C44 K;  3WOD A;  1WSV A;  2Y0S D;  2E2H A;  5IYB K;  1TWG A;  3S1N K;  3RZO C;  1J6W A;  2ZUF A;  3Q3Q A;  4KN4 A;  5C4J C;  3ADA C;  1VGX A;  3H0G C;  4JK1 A;  3GTQ K;  1WOR A;  1R9T A;  3G4C A;  3HOX C;  4BY1 K;  4ZH4 A;  1TWG K;  4BBR C;  4OIR A;  2GAG C;  4YG2 A;  3CQZ K;  2Y3P A;  5E68 A;  1I3Q A; 
#chains in the Genus database with same CATH homology
 2JA7 A;  4C3H C;  2XCQ A;  4KMH A;  1DD5 A;  3S0X A;  2GSN A;  2JA6 A;  1O25 A;  3GTM A;  2RH6 A;  4KAT A;  4KMA A;  1KQ4 A;  3G4A A;  2GSO A;  3H0G A;  1EK8 A;  3CQZ A;  4KB2 A;  2XCO A;  3GTL A;  3N3Y A;  3LPX A;  4KDD A;  3OEP A;  1TWF A;  2R92 A;  2ZFZ A;  5CJ9 A;  3GTJ A;  1WCM A;  5IOT A;  5IOR A;  1B4A A;  3LAP A;  4C3I C;  2B63 A;  5TJ3 A;  3L4J A;  1O24 A;  4GT9 A;  4KAR A;  4BLA A;  3ORE A;  4G0W A;  1F9N A;  2PHC B;  1TWA A;  3AQP A;  4GFQ A;  2GSU A;  1ZBS A;  1IS1 A;  3FOF A;  5CHP A;  1BGW A;  1K83 A;  1XXA A;  4ILD A;  2RGR A;  3QX3 A;  5EGH A;  1ISE A;  4GTA A;  3N0B A;  1O2A A;  2R93 A;  3FKI A;  4KC6 A;  1XXC A;  1O29 A;  1ZVU A;  3N0C A;  4P5A A;  4BKW A;  2NVX A;  1TWH A;  4LR2 A;  2R7Z A;  2XCR B;  4KB4 A;  4KM9 A;  4KM8 A;  2NVY A;  5JFE A;  4KMD A;  4GTB A;  2YU9 A;  1B4B A;  1Y1V A;  4GTD A;  3L4K A;  2CFA B;  3FOE A;  4GTL A;  5EGE A;  4FM9 A;  4KAW X;  4KAS A;  3OPF A;  4G0U A;  4GTC A;  1O2B A;  2JA5 A;  1WQG A;  4DDQ A;  3GTK A;  3AH5 A;  3LAJ A;  1WIH A;  1TWC A;  1I50 A;  1ZXO A;  3GTG A;  2VUM A;  3ERE D;  3V4G A;  1XXB A;  4GTF A;  1O27 A;  1Y1W A;  3VA7 A;  3BUE A;  3GTQ A;  2CFA A;  1SFO A;  3AQO A;  3NUH A;  2E2H A;  1AB4 A;  3FHZ A;  1TWG A;  2E2I A;  4C2M C;  5IOQ A;  5JVO A;  2JH3 A;  1WQF A;  3GTP A;  4FZB A;  3Q3Q A;  2P5M A;  1EH1 A;  4M1X A;  1O28 A;  1BJT A;  4LQY A;  4C3J C;  1R9T A;  3G4C A;  1WQH A;  1GE9 A;  1O26 A;  4GTE A;  4P5B A;  2KWA A;  4BLB A;  5IOS A;  3MML B;  3GTO A;  4J3N A;  2Y3P A;  3CAG A;  1I3Q A;  4G0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...