1O28A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fdump at 2.1 a resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
HHHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 79
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o28A00
3N0CA 5IOSA 4GTCA 5IOQA 2CFAB 1O2BA 4GTAA 4P5BA 5CHPA 2CFAA 4KATA 4KASA 1O2AA 4GTLA 1O26A 1O27A 4GTFA 1KQ4A 1O29A 1O25A 1O24A 4GTBA 4GTEA 4P5AA 5IOTA 3G4AA 3AH5A 1O28A 4FZBA 4KARA 3N3YA 4GTDA 5IORA 4GT9A 5JFEA 3N0BA 3G4CA
chains in the Genus database with same CATH superfamily
3GTMC 1WCMK 3LPXA 4BBRC 3JSTA 3RZDK 2NVQK 3S15C 4C3JK 3M3YC 4A93C 3S1NK 4A3CK 3FHZA 5IP9K 2CFAA 3GDZA 3CQZC 2O5JA 4C45A 1I50K 3GTOA 1TWFC 4BKWA 3H3VL 3GEHA 2JA5C 4KB4A 5IYBK 3HOYC 3S17C 3K7AC 2YU9A 1XZPA 2KWAA 5JFEA 1BJTA 5IORA 2E2HK 3M4OK 1SFOK 3S2HC 2RH6A 3BP3A 1WSRA 2JA8K 1I3QK 1AB4A 3GTKK 3TFHA 3S14C 1XPPA 1Y1WK 1BDFA 1I6HK 3GEEA 3AD8C 3AQOA 1O25A 4XCHA 1O2FB 3GTOC 4C2MK 4A3GK 3GTPK 4LQYA 4YFXA 2JA6K 2V6UA 4AYBL 1INNA 1SMYA 3PO2K 1UV7A 1EQRA 2YU9C 5IOSA 3ADAC 1XXBA 4DDQA 1Y1VC 5CHPA 4OIQA 4O2DA 4BY1K 4WJ3M 3HOUC 1VGXA 2FQTA 4A3JC 1O27A 2A6HA 4A3DC 1R9TA 4GTFA 2NVTK 1O29A 3HOVC 4GTEA 5CJ9A 3I4MC 1F93A 3I4NK 4MQ9A 3T00A 4XLPA 2ZUEA 4BY7C 3S1QC 4GT9A 4G0UA 1BS2A 5IYDK 2JA7K 2E2IK 3LAJA 4WJ4A 4LOWA 3GEIA 4C3IC 3GTGA 4GZYA 4A3EC 3TFIA 1K83C 3T01A 2RGRA 4G7ZA 4RMFA 3RZOC 4MEYA 3VA7A 1EI6A 1YCLA 4A3IK 5C4JC 1R9TC 4A3LK 4KM8A 4PABA 4BXXK 1DCPA 5FJ8K 2R93A 3H0GA 4G7HA 4QJVB 1ZXOA 3OEPA 5L46A 2NVXA 3SZZA 2CW0A 3GTGC 3HOXC 1F7VA 1J6WA 2W7VA 1TWFA 3A8IA 4Y7NC 4LK0A 3HOWK 5HL8A 1BGWA 1IE0A 3FKIK 1WSVA 3S1RC 1ZBSA 2WAQL 1TWHC 4OIOA 2A6EA 5C44K 2WB1L 4KN7A 1IS1A 1JOEA 3HOZC 4BBSK 2PMZL 3NUHA 4KMHA 3H0GC 1YX2A 1XZQB 3GTQA 1TWCK 5E68A 2NVXC 1TWAK 1ISEA 2P5MA 2NVYC 1YNNA 2R7ZK 1ZVUA 4GTBA 1YNJA 5C4XK 4KC6A 3Q3QA 3GTJK 1B4BA 3N3YA 4LR2A 2R92K 4X6AC 4AYBD 5JVOA 1Y1VA 1WIHA 3MMLB 4A3KK 1HQMA 2GAGC 4QIWD 3S16C 3GTQC 4KN4A 1VJEA 3IPJA 2B63K 4XSZA 4KAWX 3L4JA 1VLOA 3G4AA 2BE5A 2E2HA 4NOIA 2P8TA 4GTDA 5FLMK 4P9SA 1TWGK 1WCMC 5C3EK 5M3FK 3RZDC 2NVQC 3GTKA 4C3JC 1Y1WA 3S1NC 2CFAB 4A3CC 1K83A 4QIWL 5IP9C 1EK8A 1I50C 2E2JK 1O26A 5M3MK 4G7OA 1IQ0A 3BP8C 3GTPA 4AH6A 5M5WK 4A3MK 4A3FK 3S1MK 3TTGA 2JA6A 1O24A 3T02A 5IYBC 3AH5A 2Y0SD 4C3HK 4A3BK 1XZPB 3S2DK 3HXAA 2D6FC 2VUMK 2E2HC 3M4OC 1SFOC 1B4AA 1IL2A 2GAHC 2JA8C 1I3QC 3GTKC 4OIPA 1DCHA 1DCOA 1Y1WC 1I6HC 2PHCB 3GTLK 4ZH4A 3BUEA 1PJ7A 2Y0SL 1VH2A 3FOFA 4LLGA 4C2MC 4A3GC 3GTPC 1J6XA 3PO3K 2JA6C 1TWHA 3PO2C 4ILDA 2JA7A 2E2IA 5IYCK 4Y52K 1I6VA 3WODA 5IP7K 4GTAA 2WAQD 2R93K 3GTMK 1ZQ1C 2PA8L 2WB1D 3AD9C 4BBRK 5IOQA 3QX3A 3S15K 4YG2A 3M3YK 5EGHA 4BY1C 2PPBA 4A93K 2V6SA 2PMZD 3CQZK 2NVTC 4KM9A 1X31C 2NVYA 4XLNA 1TWFK 5IOTA 2JA5K 3I4NC 3HOYK 3S17K 1WQGA 3K7AK 5IYDC 2JA7C 1J98A 2E2IC 3ERED 1RU0A 3G4CA 3S2HK 2XCRB 3S14K 2JH3A 3A8KA 1J6VA 4A3IC 3EQLA 4A3LC 3GTOK 4BXXC 1O28A 4LJZA 4G0WA 1WCMA 1C0AA 3AD7C 2YU9K 1TWCA 1TWAA 1Y1VK 2ZUFA 1I50A 3SZYA 3HOUK 3V4GA 2R7ZA 3HOWC 4OIRA 4A3JK 4A3DK 3GTJA 1EFWA 4M1XA 4YFNA 1ZYRA 3HOVK 3FKIC 2V6TA 3L4KA 4LK1A 2R92A 4KB2A 5C44C 3I4MK 4KARA 1VRQC 5EGEA 1SFOA 4BY7K 5TMCA 1PJ5A 3S1QK 3GIRA 4BBSC 4MEXA 4YFKA 1I3QA 4XSXA 4GTCA 4C3IK 4P5BA 4A3EK 4GFQA 1TWCC 1K83K 2B63A 1TWAC 4JK1A 3RZOK 1F9NA 2R7ZC 4FM9A 3AQPA 5C4XC 5C4JK 3GTJC 1R9TK 1HI9A 4KDDA 1IW7A 1TWGA 2A68A 2R92C 3LAPA 3HKZD 4WILA 3TFJA 5M5XK 2GSOA 3N0CA 1L0WA 5TMFA 1USMA 4QJVA 1O2BA 4A3KC 1DD5A 5TJ3A 2PA8D 4GTLA 3GTGK 3HOXK 4G0VA 2EBBA 2XCOA 1WOOA 4KMUA 2B63C 3GSIA 4Y7NK 2FQOA 4KMDA 3S0XA 4P5AA 5M5YK 1JQWA 2VUMA 3HKZL 3S1RK 3OREA 5FLMC 1TWHK 1XXCA 3OPFA 1TWGC 5C3EC 5D4DA 4PAAA 4J3NA 1WQFA 3HOZK 3GTLA 3H0GK 2A69A 2O5IA 1IBAA 2XCQA 2E2JC 3A8JA 1F7UA 1XZQA 4KASA 2NVXK 4Q4ZA 1G51A 4A3MC 1KQ4A 4A3FC 3S1MC 1JVIA 1GE9A 2NVYK 4BLAA 4C3HC 3FOEA 4A3BC 3S2DC 4OINA 2VUMC 1USOA 3GTMA 1WOSA 2Y3PA 1WQHA 4X6AK 3CQZA 2GSNA 4BLBA 1WOPA 3GTLC 4KATA 1O2AA 1EH1A 1XXAA 3S16K 3GTQK 2GSUA 1V5VA 3CAGA 2JA5A 3DXJA 3FKIA 3PO3C 4FZBA 2ZFZA 3H3VD 5IYCC 4Y52C 4KMAA 5IP7C 1PJ6A 4Q5SA 3N0BA 2R93C 1WORA
chains in the Genus database with same CATH topology
3LPXA 1I3QA 4GTCA 1ZXOA 3OEPA 2NVXA 3FHZA 4P5BA 4GFQA 2CFAA 2PHCB 2B63A 3BUEA 1TWFA 1F9NA 3GTOA 4BKWA 3FOFA 4C2MC 4FM9A 3AQPA 1BGWA 4KDDA 1TWHA 4KB4A 1ZBSA 1TWGA 4ILDA 2JA7A 2E2IA 2YU9A 3LAPA 2KWAA 5JFEA 1BJTA 1IS1A 5IORA 4GTAA 2GSOA 3N0CA 2RH6A 3NUHA 4KMHA 3QX3A 5IOQA 1O2BA 1AB4A 5EGHA 1DD5A 5TJ3A 3GTQA 4GTLA 4G0VA 1ISEA 2XCOA 4KM9A 2NVYA 3AQOA 1O25A 2P5MA 4KMDA 3S0XA 4P5AA 1ZVUA 4GTBA 5IOTA 4KC6A 3Q3QA 4LQYA 2VUMA 1B4BA 3OREA 3N3YA 1XXCA 4LR2A 3OPFA 1WQGA 4J3NA 3ERED 3G4CA 1WQFA 5JVOA 5IOSA 1Y1VA 4DDQA 1XXBA 3GTLA 1WIHA 3MMLB 5CHPA 2XCQA 2XCRB 2JH3A 4KASA 1O27A 1R9TA 4GTFA 1KQ4A 1O29A 1GE9A 4KAWX 3L4JA 4GTEA 4BLAA 3G4AA 4C3HC 3FOEA 5CJ9A 1O28A 2E2HA 4GTDA 4G0WA 3GTMA 1WCMA 2Y3PA 4GT9A 4G0UA 1WQHA 3LAJA 3GTKA 4C3JC 1Y1WA 1TWCA 2CFAB 3CQZA 4C3IC 1K83A 3GTGA 1EK8A 1TWAA 2GSNA 4BLBA 1I50A 2RGRA 4KATA 1O2AA 3VA7A 1O26A 3V4GA 1EH1A 2R7ZA 1XXAA 3GTPA 2GSUA 3CAGA 3GTJA 4M1XA 2JA5A 3FKIA 2JA6A 1O24A 4KM8A 3L4KA 3AH5A 2R92A 4KB2A 4FZBA 2ZFZA 4KARA 5EGEA 4KMAA 1SFOA 2R93A 1B4AA 3H0GA 3N0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N0C A;  5IOS A;  4GTC A;  5IOQ A;  2CFA B;  1O2B A;  4GTA A;  4P5B A;  5CHP A;  2CFA A;  4KAT A;  4KAS A;  1O2A A;  4GTL A;  1O26 A;  1O27 A;  4GTF A;  1KQ4 A;  1O29 A;  1O25 A;  1O24 A;  4GTB A;  4GTE A;  4P5A A;  5IOT A;  3G4A A;  3AH5 A;  1O28 A;  4FZB A;  4KAR A;  3N3Y A;  4GTD A;  5IOR A;  4GT9 A;  5JFE A;  3N0B A;  3G4C A; 
#chains in the Genus database with same CATH topology
 3GTM C;  1WCM K;  3LPX A;  4BBR C;  3JST A;  3RZD K;  2NVQ K;  3S15 C;  4C3J K;  3M3Y C;  4A93 C;  3S1N K;  4A3C K;  3FHZ A;  5IP9 K;  2CFA A;  3GDZ A;  3CQZ C;  2O5J A;  4C45 A;  1I50 K;  3GTO A;  1TWF C;  4BKW A;  3H3V L;  3GEH A;  2JA5 C;  4KB4 A;  5IYB K;  3HOY C;  3S17 C;  3K7A C;  2YU9 A;  1XZP A;  2KWA A;  5JFE A;  1BJT A;  5IOR A;  2E2H K;  3M4O K;  1SFO K;  3S2H C;  2RH6 A;  3BP3 A;  1WSR A;  2JA8 K;  1I3Q K;  1AB4 A;  3GTK K;  3TFH A;  3S14 C;  1XPP A;  1Y1W K;  1BDF A;  1I6H K;  3GEE A;  3AD8 C;  3AQO A;  1O25 A;  4XCH A;  1O2F B;  3GTO C;  4C2M K;  4A3G K;  3GTP K;  4LQY A;  4YFX A;  2JA6 K;  2V6U A;  4AYB L;  1INN A;  1SMY A;  3PO2 K;  1UV7 A;  1EQR A;  2YU9 C;  5IOS A;  3ADA C;  1XXB A;  4DDQ A;  1Y1V C;  5CHP A;  4OIQ A;  4O2D A;  4BY1 K;  4WJ3 M;  3HOU C;  1VGX A;  2FQT A;  4A3J C;  1O27 A;  2A6H A;  4A3D C;  1R9T A;  4GTF A;  2NVT K;  1O29 A;  3HOV C;  4GTE A;  5CJ9 A;  3I4M C;  1F93 A;  3I4N K;  4MQ9 A;  3T00 A;  4XLP A;  2ZUE A;  4BY7 C;  3S1Q C;  4GT9 A;  4G0U A;  1BS2 A;  5IYD K;  2JA7 K;  2E2I K;  3LAJ A;  4WJ4 A;  4LOW A;  3GEI A;  4C3I C;  3GTG A;  4GZY A;  4A3E C;  3TFI A;  1K83 C;  3T01 A;  2RGR A;  4G7Z A;  4RMF A;  3RZO C;  4MEY A;  3VA7 A;  1EI6 A;  1YCL A;  4A3I K;  5C4J C;  1R9T C;  4A3L K;  4KM8 A;  4PAB A;  4BXX K;  1DCP A;  5FJ8 K;  2R93 A;  3H0G A;  4G7H A;  4QJV B;  1ZXO A;  3OEP A;  5L46 A;  2NVX A;  3SZZ A;  2CW0 A;  3GTG C;  3HOX C;  1F7V A;  1J6W A;  2W7V A;  1TWF A;  3A8I A;  4Y7N C;  4LK0 A;  3HOW K;  5HL8 A;  1BGW A;  1IE0 A;  3FKI K;  1WSV A;  3S1R C;  1ZBS A;  2WAQ L;  1TWH C;  4OIO A;  2A6E A;  5C44 K;  2WB1 L;  4KN7 A;  1IS1 A;  1JOE A;  3HOZ C;  4BBS K;  2PMZ L;  3NUH A;  4KMH A;  3H0G C;  1YX2 A;  1XZQ B;  3GTQ A;  1TWC K;  5E68 A;  2NVX C;  1TWA K;  1ISE A;  2P5M A;  2NVY C;  1YNN A;  2R7Z K;  1ZVU A;  4GTB A;  1YNJ A;  5C4X K;  4KC6 A;  3Q3Q A;  3GTJ K;  1B4B A;  3N3Y A;  4LR2 A;  2R92 K;  4X6A C;  4AYB D;  5JVO A;  1Y1V A;  1WIH A;  3MML B;  4A3K K;  1HQM A;  2GAG C;  4QIW D;  3S16 C;  3GTQ C;  4KN4 A;  1VJE A;  3IPJ A;  2B63 K;  4XSZ A;  4KAW X;  3L4J A;  1VLO A;  3G4A A;  2BE5 A;  2E2H A;  4NOI A;  2P8T A;  4GTD A;  5FLM K;  4P9S A;  1TWG K;  1WCM C;  5C3E K;  5M3F K;  3RZD C;  2NVQ C;  3GTK A;  4C3J C;  1Y1W A;  3S1N C;  2CFA B;  4A3C C;  1K83 A;  4QIW L;  5IP9 C;  1EK8 A;  1I50 C;  2E2J K;  1O26 A;  5M3M K;  4G7O A;  1IQ0 A;  3BP8 C;  3GTP A;  4AH6 A;  5M5W K;  4A3M K;  4A3F K;  3S1M K;  3TTG A;  2JA6 A;  1O24 A;  3T02 A;  5IYB C;  3AH5 A;  2Y0S D;  4C3H K;  4A3B K;  1XZP B;  3S2D K;  3HXA A;  2D6F C;  2VUM K;  2E2H C;  3M4O C;  1SFO C;  1B4A A;  1IL2 A;  2GAH C;  2JA8 C;  1I3Q C;  3GTK C;  4OIP A;  1DCH A;  1DCO A;  1Y1W C;  1I6H C;  2PHC B;  3GTL K;  4ZH4 A;  3BUE A;  1PJ7 A;  2Y0S L;  1VH2 A;  3FOF A;  4LLG A;  4C2M C;  4A3G C;  3GTP C;  1J6X A;  3PO3 K;  2JA6 C;  1TWH A;  3PO2 C;  4ILD A;  2JA7 A;  2E2I A;  5IYC K;  4Y52 K;  1I6V A;  3WOD A;  5IP7 K;  4GTA A;  2WAQ D;  2R93 K;  3GTM K;  1ZQ1 C;  2PA8 L;  2WB1 D;  3AD9 C;  4BBR K;  5IOQ A;  3QX3 A;  3S15 K;  4YG2 A;  3M3Y K;  5EGH A;  4BY1 C;  2PPB A;  4A93 K;  2V6S A;  2PMZ D;  3CQZ K;  2NVT C;  4KM9 A;  1X31 C;  2NVY A;  4XLN A;  1TWF K;  5IOT A;  2JA5 K;  3I4N C;  3HOY K;  3S17 K;  1WQG A;  3K7A K;  5IYD C;  2JA7 C;  1J98 A;  2E2I C;  3ERE D;  1RU0 A;  3G4C A;  3S2H K;  2XCR B;  3S14 K;  2JH3 A;  3A8K A;  1J6V A;  4A3I C;  3EQL A;  4A3L C;  3GTO K;  4BXX C;  1O28 A;  4LJZ A;  4G0W A;  1WCM A;  1C0A A;  3AD7 C;  2YU9 K;  1TWC A;  1TWA A;  1Y1V K;  2ZUF A;  1I50 A;  3SZY A;  3HOU K;  3V4G A;  2R7Z A;  3HOW C;  4OIR A;  4A3J K;  4A3D K;  3GTJ A;  1EFW A;  4M1X A;  4YFN A;  1ZYR A;  3HOV K;  3FKI C;  2V6T A;  3L4K A;  4LK1 A;  2R92 A;  4KB2 A;  5C44 C;  3I4M K;  4KAR A;  1VRQ C;  5EGE A;  1SFO A;  4BY7 K;  5TMC A;  1PJ5 A;  3S1Q K;  3GIR A;  4BBS C;  4MEX A;  4YFK A;  1I3Q A;  4XSX A;  4GTC A;  4C3I K;  4P5B A;  4A3E K;  4GFQ A;  1TWC C;  1K83 K;  2B63 A;  1TWA C;  4JK1 A;  3RZO K;  1F9N A;  2R7Z C;  4FM9 A;  3AQP A;  5C4X C;  5C4J K;  3GTJ C;  1R9T K;  1HI9 A;  4KDD A;  1IW7 A;  1TWG A;  2A68 A;  2R92 C;  3LAP A;  3HKZ D;  4WIL A;  3TFJ A;  5M5X K;  2GSO A;  3N0C A;  1L0W A;  5TMF A;  1USM A;  4QJV A;  1O2B A;  4A3K C;  1DD5 A;  5TJ3 A;  2PA8 D;  4GTL A;  3GTG K;  3HOX K;  4G0V A;  2EBB A;  2XCO A;  1WOO A;  4KMU A;  2B63 C;  3GSI A;  4Y7N K;  2FQO A;  4KMD A;  3S0X A;  4P5A A;  5M5Y K;  1JQW A;  2VUM A;  3HKZ L;  3S1R K;  3ORE A;  5FLM C;  1TWH K;  1XXC A;  3OPF A;  1TWG C;  5C3E C;  5D4D A;  4PAA A;  4J3N A;  1WQF A;  3HOZ K;  3GTL A;  3H0G K;  2A69 A;  2O5I A;  1IBA A;  2XCQ A;  2E2J C;  3A8J A;  1F7U A;  1XZQ A;  4KAS A;  2NVX K;  4Q4Z A;  1G51 A;  4A3M C;  1KQ4 A;  4A3F C;  3S1M C;  1JVI A;  1GE9 A;  2NVY K;  4BLA A;  4C3H C;  3FOE A;  4A3B C;  3S2D C;  4OIN A;  2VUM C;  1USO A;  3GTM A;  1WOS A;  2Y3P A;  1WQH A;  4X6A K;  3CQZ A;  2GSN A;  4BLB A;  1WOP A;  3GTL C;  4KAT A;  1O2A A;  1EH1 A;  1XXA A;  3S16 K;  3GTQ K;  2GSU A;  1V5V A;  3CAG A;  2JA5 A;  3DXJ A;  3FKI A;  3PO3 C;  4FZB A;  2ZFZ A;  3H3V D;  5IYC C;  4Y52 C;  4KMA A;  5IP7 C;  1PJ6 A;  4Q5S A;  3N0B A;  2R93 C;  1WOR A; 
#chains in the Genus database with same CATH homology
 3LPX A;  1I3Q A;  4GTC A;  1ZXO A;  3OEP A;  2NVX A;  3FHZ A;  4P5B A;  4GFQ A;  2CFA A;  2PHC B;  2B63 A;  3BUE A;  1TWF A;  1F9N A;  3GTO A;  4BKW A;  3FOF A;  4C2M C;  4FM9 A;  3AQP A;  1BGW A;  4KDD A;  1TWH A;  4KB4 A;  1ZBS A;  1TWG A;  4ILD A;  2JA7 A;  2E2I A;  2YU9 A;  3LAP A;  2KWA A;  5JFE A;  1BJT A;  1IS1 A;  5IOR A;  4GTA A;  2GSO A;  3N0C A;  2RH6 A;  3NUH A;  4KMH A;  3QX3 A;  5IOQ A;  1O2B A;  1AB4 A;  5EGH A;  1DD5 A;  5TJ3 A;  3GTQ A;  4GTL A;  4G0V A;  1ISE A;  2XCO A;  4KM9 A;  2NVY A;  3AQO A;  1O25 A;  2P5M A;  4KMD A;  3S0X A;  4P5A A;  1ZVU A;  4GTB A;  5IOT A;  4KC6 A;  3Q3Q A;  4LQY A;  2VUM A;  1B4B A;  3ORE A;  3N3Y A;  1XXC A;  4LR2 A;  3OPF A;  1WQG A;  4J3N A;  3ERE D;  3G4C A;  1WQF A;  5JVO A;  5IOS A;  1Y1V A;  4DDQ A;  1XXB A;  3GTL A;  1WIH A;  3MML B;  5CHP A;  2XCQ A;  2XCR B;  2JH3 A;  4KAS A;  1O27 A;  1R9T A;  4GTF A;  1KQ4 A;  1O29 A;  1GE9 A;  4KAW X;  3L4J A;  4GTE A;  4BLA A;  3G4A A;  4C3H C;  3FOE A;  5CJ9 A;  1O28 A;  2E2H A;  4GTD A;  4G0W A;  3GTM A;  1WCM A;  2Y3P A;  4GT9 A;  4G0U A;  1WQH A;  3LAJ A;  3GTK A;  4C3J C;  1Y1W A;  1TWC A;  2CFA B;  3CQZ A;  4C3I C;  1K83 A;  3GTG A;  1EK8 A;  1TWA A;  2GSN A;  4BLB A;  1I50 A;  2RGR A;  4KAT A;  1O2A A;  3VA7 A;  1O26 A;  3V4G A;  1EH1 A;  2R7Z A;  1XXA A;  3GTP A;  2GSU A;  3CAG A;  3GTJ A;  4M1X A;  2JA5 A;  3FKI A;  2JA6 A;  1O24 A;  4KM8 A;  3L4K A;  3AH5 A;  2R92 A;  4KB2 A;  4FZB A;  2ZFZ A;  4KAR A;  5EGE A;  4KMA A;  1SFO A;  2R93 A;  1B4A A;  3H0G A;  3N0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...