1O2BA

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and po4 at 2.45 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
213
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 71
structure length 213
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o2bA00
5IOSA 1O26A 3G4AA 3G4CA 1O2BA 1O24A 4GTEA 4P5AA 5IORA 2CFAA 4GTDA 4GTFA 1O2AA 5IOTA 4KARA 4KATA 4P5BA 5JFEA 4FZBA 5IOQA 5CHPA 1O28A 1KQ4A 4GT9A 1O29A 4KASA 4GTBA 1O25A 3N0CA 1O27A 2CFAB 4GTCA 3N3YA 3N0BA 3AH5A 4GTAA 4GTLA
chains in the Genus database with same CATH superfamily
1PJ5A 3I4MC 3S1QK 4P5AA 1XZQB 4BY1C 1X31C 4A3EK 2W7VA 2R93C 1EQRA 1EH1A 1XZPB 3FKIA 4BY1K 4QJVA 2JA7K 3I4MK 5CHPA 4QIWD 2EBBA 5IP7C 2GSNA 1JOEA 1DD5A 3S14K 1ZXOA 1SMYA 4KB2A 4C2MC 2B63C 1I6HK 2XCQA 1O26A 1DCHA 4X6AK 1I50C 3OPFA 1JQWA 5IYBK 3AQOA 3PO3C 2O5IA 3HOVK 1AB4A 5IORA 3GTLA 4BBRC 2JA5A 1TWAC 1B4BA 1IBAA 1I6VA 4KM8A 5C4XK 2NVXC 3HOWK 3HOZC 3HXAA 2NVTC 1RU0A 2V6UA 4MEXA 5C4XC 3RZOC 3T02A 3AD9C 1PJ7A 3PO2K 5FJ8K 2JA6K 2YU9K 1Y1VK 4XLPA 3H3VL 3PO2C 3N0BA 4LJZA 1Y1WC 3FKIC 4LK0A 3GTMK 3G4AA 3MMLB 4MQ9A 1Y1WK 4GFQA 4FM9A 4Y52K 3EQLA 5IYDC 2D6FC 4A3MK 3M3YK 2JA7A 4A3JC 2V6TA 2JA6C 1VGXA 1Y1VA 3AD7C 4YFXA 4KAWX 5IP9K 1KQ4A 1WOOA 2JA8C 1XZPA 3BP8C 2P8TA 1O27A 2CW0A 3RZOK 1XZQA 4GTLA 2JH3A 3S0XA 2B63A 3IPJA 3I4NK 3GTKC 1B4AA 3VA7A 3S1QC 2A6EA 4WILA 2PA8L 3GEIA 3QX3A 2ZUEA 5C3EK 1TWFA 3FOEA 1I50K 4P5BA 4FZBA 4AYBD 3GTLK 3DXJA 2JA7C 2XCOA 1INNA 4BBSK 3L4KA 1F93A 3S16C 1ZVUA 4A93C 4WJ3M 4BXXK 4Q4ZA 4GTAA 2GAHC 5C4JK 2Y3PA 2NVTK 1DCPA 2PMZL 2ZFZA 1UV7A 1K83K 4O2DA 3SZYA 1YX2A 3GTJK 1R9TK 4G0VA 2P5MA 2JA5C 2Y0SL 1O28A 1JVIA 3BP3A 2Y0SD 4C2MK 4A3BK 4A3FK 2B63K 1I6HC 3HOYC 5CJ9A 2R7ZK 4A3DK 3HKZL 5JVOA 3T00A 3HKZD 3GTJA 2PMZD 3FKIK 1TWAK 4NOIA 1I3QC 2GAGC 4KDDA 1F9NA 3GTPC 4XCHA 4AYBL 2E2IC 2VUMC 4PAAA 3S2HK 5C44K 3HOUC 1GE9A 1WQFA 3M4OK 4BBSC 4WJ4A 1USOA 3Q3QA 1XXBA 4GTBA 4KC6A 4PABA 4A93K 1TWGA 3S17C 1EK8A 3AQPA 5M5XK 4A3BC 1ISEA 2PPBA 4Y52C 4KN4A 3S15K 1R9TA 5HL8A 1R9TC 1BJTA 1O2FB 1WQGA 4A3KK 2BE5A 2JA6A 5JFEA 3H0GA 3LAJA 3GTQA 3CQZC 3S1RK 3GSIA 3ERED 3PO3K 1Y1WA 2JA8K 2R7ZA 3GEEA 1ZYRA 3FOFA 4BY7K 1IL2A 5C3EC 3ADAC 4LOWA 1ZBSA 4XSZA 3H0GK 1TWAA 4KATA 4C3HK 1TWGK 1TWFC 1SFOK 1J6WA 3GTMC 3LAPA 3BUEA 3GDZA 4C3HC 1XXAA 3N0CA 1Y1VC 2R92A 4ILDA 4KM9A 3HOXC 5M3FK 1YCLA 5IYBC 4A3GK 1O2BA 4KMAA 1TWFK 1TWGC 2FQTA 1V5VA 2KWAA 3S17K 1BDFA 3M3YC 3SZZA 3S1MC 1J6XA 4GTDA 4A3FC 3GIRA 3I4NC 5E68A 1WCMA 2E2HA 2NVYC 4KMUA 4G0WA 4M1XA 4OIPA 3TFJA 3GTGA 2R93K 2NVYK 3AD8C 1K83A 5IOSA 3HOZK 4RMFA 3K7AK 3S15C 3CQZA 1WIHA 4OINA 3GEHA 4BLAA 1TWHK 5C44C 4KMDA 1WOPA 1YNNA 3FHZA 4OIRA 1WCMK 2NVXA 4P9SA 3HOVC 4AH6A 3T01A 3CAGA 2R92C 1IQ0A 5FLMK 2A6HA 5EGEA 1F7UA 2O5JA 4A3CC 2E2JK 4A3LC 4DDQA 1YNJA 4C3IC 4XSXA 3CQZK 4G0UA 4KMHA 1IW7A 3S14C 4C3JK 1DCOA 3OEPA 2R92K 5TMCA 4C3JC 2NVXK 2WB1D 2FQOA 4LR2A 2E2IK 4YFKA 4A3KC 2VUMK 1HQMA 3H0GC 3GTJC 4ZH4A 1C0AA 5IOQA 2A69A 3A8IA 2R93A 1F7VA 4OIOA 3TFHA 1BGWA 1O25A 4A3CK 3TFIA 3L4JA 1K83C 3K7AC 4G7HA 1WQHA 3G4CA 3OREA 1O24A 1WSRA 4Q5SA 1L0WA 1WSVA 2NVYA 3A8JA 4BKWA 2GSUA 2NVQK 5C4JC 2WAQL 4A3EC 5M3MK 4MEYA 3GTQK 1J98A 4OIQA 4A3IK 4Y7NK 3M4OC 1TWCK 4Y7NC 4KASA 3RZDK 3A8KA 3N3YA 3S16K 4KN7A 1EFWA 2WB1L 1XXCA 4BY7C 3S1NC 4X6AC 1WORA 4G7ZA 2CFAA 1SFOA 2RGRA 1TWCA 5TMFA 5M5YK 1TWHC 2WAQD 3S1RC 1O2AA 4KB4A 4KARA 3WODA 5IP7K 3S2DK 1SFOC 1VH2A 3HOWC 2GSOA 4BLBA 4A3IC 5EGHA 3S2DC 1O29A 5IYCK 1G51A 3GTKA 4A3LK 2E2JC 5IYCC 1HI9A 3GTGC 3LPXA 2YU9A 5D4DA 3GTPA 1WCMC 4GTEA 2PHCB 3S1MK 4A3JK 4JK1A 4LLGA 2R7ZC 3HOYK 4A3DC 5IYDK 3GTOA 4A3MC 4GTFA 2E2HK 3GTKK 3GTOC 3GTGK 1WOSA 3TTGA 1EI6A 2V6SA 4A3GC 3HOUK 4GT9A 5L46A 4LQYA 4GTCA 3GTPK 3AH5A 1VJEA 1TWHA 1TWCC 2A68A 3NUHA 4XLNA 2ZUFA 3GTOK 4GZYA 4C45A 4J3NA 4BXXC 1ZQ1C 4BBRK 2NVQC 1I3QK 4YG2A 5IOTA 3JSTA 3S1NK 5FLMC 3GTLC 2E2HC 1J6VA 3S2HC 4YFNA 3H3VD 1I50A 4QIWL 2CFAB 3RZDC 2VUMA 2E2IA 4LK1A 1BS2A 2PA8D 1XPPA 1PJ6A 1I3QA 3GTQC 1VRQC 3HOXK 5TJ3A 1IE0A 2YU9C 4C3IK 5IP9C 1USMA 3V4GA 4G7OA 1IS1A 2JA5K 2RH6A 4QJVB 3GTMA 1VLOA 5M5WK 2XCRB
chains in the Genus database with same CATH topology
2Y3PA 1XXCA 1O2BA 2ZFZA 4KMAA 2KWAA 4P5AA 2CFAA 1SFOA 2RGRA 1TWCA 4GTDA 1EH1A 4G0VA 2P5MA 3FKIA 1O2AA 4KB4A 4KARA 5CHPA 1O28A 2GSOA 4BLBA 1WCMA 5EGHA 1O29A 2E2HA 2GSNA 1DD5A 5CJ9A 3GTKA 4G0WA 1ZXOA 5JVOA 4M1XA 3GTGA 4KB2A 4C2MC 1K83A 2XCQA 5IOSA 1O26A 3LPXA 2YU9A 3GTJA 3OPFA 3CQZA 3GTPA 1WIHA 4GTEA 4BLAA 4KDDA 3AQOA 2PHCB 4KMDA 1F9NA 3GTLA 1AB4A 5IORA 3FHZA 2JA5A 3GTOA 2NVXA 1B4BA 4GTFA 4KM8A 3CAGA 1GE9A 1WQFA 5EGEA 3Q3QA 4GT9A 1XXBA 4GTBA 4KC6A 4LQYA 4DDQA 1TWGA 4C3IC 1EK8A 3AQPA 4GTCA 3N0BA 3AH5A 4G0UA 1ISEA 4KMHA 1TWHA 3G4AA 3MMLB 3OEPA 1R9TA 3NUHA 4C3JC 4GFQA 4FM9A 4LR2A 4J3NA 2JA7A 1BJTA 1WQGA 5IOTA 2JA6A 5JFEA 1Y1VA 5IOQA 3H0GA 4KAWX 3LAJA 2R93A 1KQ4A 3GTQA 1BGWA 1O25A 1I50A 1O27A 3ERED 2CFAB 1Y1WA 4GTLA 2VUMA 2JH3A 2E2IA 3L4JA 3S0XA 2B63A 2R7ZA 1WQHA 3G4CA 3FOFA 1B4AA 1O24A 3OREA 3VA7A 1I3QA 2NVYA 4BKWA 2GSUA 3QX3A 1ZBSA 5TJ3A 1TWFA 1TWAA 3FOEA 4KATA 4P5BA 3V4GA 4FZBA 1IS1A 2XCOA 2RH6A 3LAPA 3BUEA 4C3HC 4KASA 3L4KA 1XXAA 3GTMA 1ZVUA 3N0CA 2R92A 4ILDA 2XCRB 4KM9A 3N3YA 4GTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOS A;  1O26 A;  3G4A A;  3G4C A;  1O2B A;  1O24 A;  4GTE A;  4P5A A;  5IOR A;  2CFA A;  4GTD A;  4GTF A;  1O2A A;  5IOT A;  4KAR A;  4KAT A;  4P5B A;  5JFE A;  4FZB A;  5IOQ A;  5CHP A;  1O28 A;  1KQ4 A;  4GT9 A;  1O29 A;  4KAS A;  4GTB A;  1O25 A;  3N0C A;  1O27 A;  2CFA B;  4GTC A;  3N3Y A;  3N0B A;  3AH5 A;  4GTA A;  4GTL A; 
#chains in the Genus database with same CATH topology
 1PJ5 A;  3I4M C;  3S1Q K;  4P5A A;  1XZQ B;  4BY1 C;  1X31 C;  4A3E K;  2W7V A;  2R93 C;  1EQR A;  1EH1 A;  1XZP B;  3FKI A;  4BY1 K;  4QJV A;  2JA7 K;  3I4M K;  5CHP A;  4QIW D;  2EBB A;  5IP7 C;  2GSN A;  1JOE A;  1DD5 A;  3S14 K;  1ZXO A;  1SMY A;  4KB2 A;  4C2M C;  2B63 C;  1I6H K;  2XCQ A;  1O26 A;  1DCH A;  4X6A K;  1I50 C;  3OPF A;  1JQW A;  5IYB K;  3AQO A;  3PO3 C;  2O5I A;  3HOV K;  1AB4 A;  5IOR A;  3GTL A;  4BBR C;  2JA5 A;  1TWA C;  1B4B A;  1IBA A;  1I6V A;  4KM8 A;  5C4X K;  2NVX C;  3HOW K;  3HOZ C;  3HXA A;  2NVT C;  1RU0 A;  2V6U A;  4MEX A;  5C4X C;  3RZO C;  3T02 A;  3AD9 C;  1PJ7 A;  3PO2 K;  5FJ8 K;  2JA6 K;  2YU9 K;  1Y1V K;  4XLP A;  3H3V L;  3PO2 C;  3N0B A;  4LJZ A;  1Y1W C;  3FKI C;  4LK0 A;  3GTM K;  3G4A A;  3MML B;  4MQ9 A;  1Y1W K;  4GFQ A;  4FM9 A;  4Y52 K;  3EQL A;  5IYD C;  2D6F C;  4A3M K;  3M3Y K;  2JA7 A;  4A3J C;  2V6T A;  2JA6 C;  1VGX A;  1Y1V A;  3AD7 C;  4YFX A;  4KAW X;  5IP9 K;  1KQ4 A;  1WOO A;  2JA8 C;  1XZP A;  3BP8 C;  2P8T A;  1O27 A;  2CW0 A;  3RZO K;  1XZQ A;  4GTL A;  2JH3 A;  3S0X A;  2B63 A;  3IPJ A;  3I4N K;  3GTK C;  1B4A A;  3VA7 A;  3S1Q C;  2A6E A;  4WIL A;  2PA8 L;  3GEI A;  3QX3 A;  2ZUE A;  5C3E K;  1TWF A;  3FOE A;  1I50 K;  4P5B A;  4FZB A;  4AYB D;  3GTL K;  3DXJ A;  2JA7 C;  2XCO A;  1INN A;  4BBS K;  3L4K A;  1F93 A;  3S16 C;  1ZVU A;  4A93 C;  4WJ3 M;  4BXX K;  4Q4Z A;  4GTA A;  2GAH C;  5C4J K;  2Y3P A;  2NVT K;  1DCP A;  2PMZ L;  2ZFZ A;  1UV7 A;  1K83 K;  4O2D A;  3SZY A;  1YX2 A;  3GTJ K;  1R9T K;  4G0V A;  2P5M A;  2JA5 C;  2Y0S L;  1O28 A;  1JVI A;  3BP3 A;  2Y0S D;  4C2M K;  4A3B K;  4A3F K;  2B63 K;  1I6H C;  3HOY C;  5CJ9 A;  2R7Z K;  4A3D K;  3HKZ L;  5JVO A;  3T00 A;  3HKZ D;  3GTJ A;  2PMZ D;  3FKI K;  1TWA K;  4NOI A;  1I3Q C;  2GAG C;  4KDD A;  1F9N A;  3GTP C;  4XCH A;  4AYB L;  2E2I C;  2VUM C;  4PAA A;  3S2H K;  5C44 K;  3HOU C;  1GE9 A;  1WQF A;  3M4O K;  4BBS C;  4WJ4 A;  1USO A;  3Q3Q A;  1XXB A;  4GTB A;  4KC6 A;  4PAB A;  4A93 K;  1TWG A;  3S17 C;  1EK8 A;  3AQP A;  5M5X K;  4A3B C;  1ISE A;  2PPB A;  4Y52 C;  4KN4 A;  3S15 K;  1R9T A;  5HL8 A;  1R9T C;  1BJT A;  1O2F B;  1WQG A;  4A3K K;  2BE5 A;  2JA6 A;  5JFE A;  3H0G A;  3LAJ A;  3GTQ A;  3CQZ C;  3S1R K;  3GSI A;  3ERE D;  3PO3 K;  1Y1W A;  2JA8 K;  2R7Z A;  3GEE A;  1ZYR A;  3FOF A;  4BY7 K;  1IL2 A;  5C3E C;  3ADA C;  4LOW A;  1ZBS A;  4XSZ A;  3H0G K;  1TWA A;  4KAT A;  4C3H K;  1TWG K;  1TWF C;  1SFO K;  1J6W A;  3GTM C;  3LAP A;  3BUE A;  3GDZ A;  4C3H C;  1XXA A;  3N0C A;  1Y1V C;  2R92 A;  4ILD A;  4KM9 A;  3HOX C;  5M3F K;  1YCL A;  5IYB C;  4A3G K;  1O2B A;  4KMA A;  1TWF K;  1TWG C;  2FQT A;  1V5V A;  2KWA A;  3S17 K;  1BDF A;  3M3Y C;  3SZZ A;  3S1M C;  1J6X A;  4GTD A;  4A3F C;  3GIR A;  3I4N C;  5E68 A;  1WCM A;  2E2H A;  2NVY C;  4KMU A;  4G0W A;  4M1X A;  4OIP A;  3TFJ A;  3GTG A;  2R93 K;  2NVY K;  3AD8 C;  1K83 A;  5IOS A;  3HOZ K;  4RMF A;  3K7A K;  3S15 C;  3CQZ A;  1WIH A;  4OIN A;  3GEH A;  4BLA A;  1TWH K;  5C44 C;  4KMD A;  1WOP A;  1YNN A;  3FHZ A;  4OIR A;  1WCM K;  2NVX A;  4P9S A;  3HOV C;  4AH6 A;  3T01 A;  3CAG A;  2R92 C;  1IQ0 A;  5FLM K;  2A6H A;  5EGE A;  1F7U A;  2O5J A;  4A3C C;  2E2J K;  4A3L C;  4DDQ A;  1YNJ A;  4C3I C;  4XSX A;  3CQZ K;  4G0U A;  4KMH A;  1IW7 A;  3S14 C;  4C3J K;  1DCO A;  3OEP A;  2R92 K;  5TMC A;  4C3J C;  2NVX K;  2WB1 D;  2FQO A;  4LR2 A;  2E2I K;  4YFK A;  4A3K C;  2VUM K;  1HQM A;  3H0G C;  3GTJ C;  4ZH4 A;  1C0A A;  5IOQ A;  2A69 A;  3A8I A;  2R93 A;  1F7V A;  4OIO A;  3TFH A;  1BGW A;  1O25 A;  4A3C K;  3TFI A;  3L4J A;  1K83 C;  3K7A C;  4G7H A;  1WQH A;  3G4C A;  3ORE A;  1O24 A;  1WSR A;  4Q5S A;  1L0W A;  1WSV A;  2NVY A;  3A8J A;  4BKW A;  2GSU A;  2NVQ K;  5C4J C;  2WAQ L;  4A3E C;  5M3M K;  4MEY A;  3GTQ K;  1J98 A;  4OIQ A;  4A3I K;  4Y7N K;  3M4O C;  1TWC K;  4Y7N C;  4KAS A;  3RZD K;  3A8K A;  3N3Y A;  3S16 K;  4KN7 A;  1EFW A;  2WB1 L;  1XXC A;  4BY7 C;  3S1N C;  4X6A C;  1WOR A;  4G7Z A;  2CFA A;  1SFO A;  2RGR A;  1TWC A;  5TMF A;  5M5Y K;  1TWH C;  2WAQ D;  3S1R C;  1O2A A;  4KB4 A;  4KAR A;  3WOD A;  5IP7 K;  3S2D K;  1SFO C;  1VH2 A;  3HOW C;  2GSO A;  4BLB A;  4A3I C;  5EGH A;  3S2D C;  1O29 A;  5IYC K;  1G51 A;  3GTK A;  4A3L K;  2E2J C;  5IYC C;  1HI9 A;  3GTG C;  3LPX A;  2YU9 A;  5D4D A;  3GTP A;  1WCM C;  4GTE A;  2PHC B;  3S1M K;  4A3J K;  4JK1 A;  4LLG A;  2R7Z C;  3HOY K;  4A3D C;  5IYD K;  3GTO A;  4A3M C;  4GTF A;  2E2H K;  3GTK K;  3GTO C;  3GTG K;  1WOS A;  3TTG A;  1EI6 A;  2V6S A;  4A3G C;  3HOU K;  4GT9 A;  5L46 A;  4LQY A;  4GTC A;  3GTP K;  3AH5 A;  1VJE A;  1TWH A;  1TWC C;  2A68 A;  3NUH A;  4XLN A;  2ZUF A;  3GTO K;  4GZY A;  4C45 A;  4J3N A;  4BXX C;  1ZQ1 C;  4BBR K;  2NVQ C;  1I3Q K;  4YG2 A;  5IOT A;  3JST A;  3S1N K;  5FLM C;  3GTL C;  2E2H C;  1J6V A;  3S2H C;  4YFN A;  3H3V D;  1I50 A;  4QIW L;  2CFA B;  3RZD C;  2VUM A;  2E2I A;  4LK1 A;  1BS2 A;  2PA8 D;  1XPP A;  1PJ6 A;  1I3Q A;  3GTQ C;  1VRQ C;  3HOX K;  5TJ3 A;  1IE0 A;  2YU9 C;  4C3I K;  5IP9 C;  1USM A;  3V4G A;  4G7O A;  1IS1 A;  2JA5 K;  2RH6 A;  4QJV B;  3GTM A;  1VLO A;  5M5W K;  2XCR B; 
#chains in the Genus database with same CATH homology
 2Y3P A;  1XXC A;  1O2B A;  2ZFZ A;  4KMA A;  2KWA A;  4P5A A;  2CFA A;  1SFO A;  2RGR A;  1TWC A;  4GTD A;  1EH1 A;  4G0V A;  2P5M A;  3FKI A;  1O2A A;  4KB4 A;  4KAR A;  5CHP A;  1O28 A;  2GSO A;  4BLB A;  1WCM A;  5EGH A;  1O29 A;  2E2H A;  2GSN A;  1DD5 A;  5CJ9 A;  3GTK A;  4G0W A;  1ZXO A;  5JVO A;  4M1X A;  3GTG A;  4KB2 A;  4C2M C;  1K83 A;  2XCQ A;  5IOS A;  1O26 A;  3LPX A;  2YU9 A;  3GTJ A;  3OPF A;  3CQZ A;  3GTP A;  1WIH A;  4GTE A;  4BLA A;  4KDD A;  3AQO A;  2PHC B;  4KMD A;  1F9N A;  3GTL A;  1AB4 A;  5IOR A;  3FHZ A;  2JA5 A;  3GTO A;  2NVX A;  1B4B A;  4GTF A;  4KM8 A;  3CAG A;  1GE9 A;  1WQF A;  5EGE A;  3Q3Q A;  4GT9 A;  1XXB A;  4GTB A;  4KC6 A;  4LQY A;  4DDQ A;  1TWG A;  4C3I C;  1EK8 A;  3AQP A;  4GTC A;  3N0B A;  3AH5 A;  4G0U A;  1ISE A;  4KMH A;  1TWH A;  3G4A A;  3MML B;  3OEP A;  1R9T A;  3NUH A;  4C3J C;  4GFQ A;  4FM9 A;  4LR2 A;  4J3N A;  2JA7 A;  1BJT A;  1WQG A;  5IOT A;  2JA6 A;  5JFE A;  1Y1V A;  5IOQ A;  3H0G A;  4KAW X;  3LAJ A;  2R93 A;  1KQ4 A;  3GTQ A;  1BGW A;  1O25 A;  1I50 A;  1O27 A;  3ERE D;  2CFA B;  1Y1W A;  4GTL A;  2VUM A;  2JH3 A;  2E2I A;  3L4J A;  3S0X A;  2B63 A;  2R7Z A;  1WQH A;  3G4C A;  3FOF A;  1B4A A;  1O24 A;  3ORE A;  3VA7 A;  1I3Q A;  2NVY A;  4BKW A;  2GSU A;  3QX3 A;  1ZBS A;  5TJ3 A;  1TWF A;  1TWA A;  3FOE A;  4KAT A;  4P5B A;  3V4G A;  4FZB A;  1IS1 A;  2XCO A;  2RH6 A;  3LAP A;  3BUE A;  4C3H C;  4KAS A;  3L4K A;  1XXA A;  3GTM A;  1ZVU A;  3N0C A;  2R92 A;  4ILD A;  2XCR B;  4KM9 A;  3N3Y A;  4GTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...