1O2BA

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and po4 at 2.45 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
213
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 71
structure length 213
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o2bA00
3AH5A 4P5AA 3G4AA 5IOQA 1O27A 3G4CA 4GTLA 4KARA 1O2BA 1O28A 4GTDA 5IOTA 4GTCA 2CFAB 4FZBA 4GTFA 3N3YA 4GTEA 4GT9A 3N0BA 4KASA 4GTAA 1KQ4A 1O25A 5IORA 1O2AA 5JFEA 4P5BA 1O24A 1O29A 4GTBA 5IOSA 3N0CA 5CHPA 2CFAA 1O26A 4KATA
chains in the Genus database with same CATH superfamily
3CAGA 4C3HC 1USOA 1WOOA 2VUMK 1O28A 4XSXA 4FZBA 4GTFA 1YX2A 3S0XA 4KMHA 4A3DK 3S14K 1R9TK 3HOVC 4Y7NK 1TWGA 3HOUC 2R92C 4MEYA 4G7HA 4WJ4A 5C4XC 4BKWA 4A3JC 1F7UA 3I4MK 2V6UA 1SFOA 4YFKA 5CJ9A 2P5MA 3GTOA 2NVTK 1F93A 2YU9K 1PJ7A 4BBRK 3S17C 4XLPA 1IE0A 3M4OC 2FQOA 4A3LC 1I6HC 3HKZD 4GTAA 2R7ZC 1XXBA 1O25A 4GFQA 1VJEA 3S1RK 5C3EC 3S15C 1O2AA 1DCHA 4OIQA 4P5BA 3T02A 4GZYA 3SZYA 2PPBA 3N0CA 3GTJK 2VUMC 4BBSK 2B63A 1Y1VK 1J6VA 4A3DC 1R9TC 3SZZA 1WCMC 4KC6A 2JA6K 1USMA 1WORA 2A6HA 4QIWD 3A8IA 2JH3A 2NVXK 3I4NK 3GTJA 1XXAA 3H0GK 1Y1VA 4KAWX 3FHZA 1HI9A 1TWFA 3GTMK 5IYCC 2YU9C 4C45A 3GTQK 4G7ZA 3RZOK 2O5IA 3PO2K 3S2HC 4Y52K 1PJ6A 2NVXA 4YG2A 1K83K 4AYBL 2JA5K 3GTLA 2PHCB 4GTCA 1BDFA 5IYDK 4C3HK 1J6WA 3BP8C 5JVOA 4BBSC 1WQGA 3ERED 2R93C 1INNA 3H3VL 3T01A 2JA6C 4KMAA 3OPFA 1C0AA 3BUEA 3L4JA 3DXJA 5C4XK 3I4NC 1I3QK 1XZPB 5M3FK 3H0GC 1XZQA 4A3IC 1YNJA 3GTMC 4GTEA 2GSOA 3M3YK 3GTQC 3GDZA 2R92A 3RZOC 4Q4ZA 3EQLA 2NVQK 1K83C 1PJ5A 2E2HC 1BGWA 2JA5C 3RZDK 3HOYK 5CHPA 4C3JK 5C3EK 3S15K 5IYDC 1O27A 3ADAC 4BLBA 2ZFZA 1XPPA 2CFAB 3S2DK 2W7VA 1WSVA 3AD8C 1WCMK 5IORA 4A3BK 2R7ZA 1DCPA 2O5JA 1WQFA 3A8KA 3WODA 1I3QC 4OIOA 4O2DA 2VUMA 4OINA 5FLMK 2WAQD 3M3YC 5IYCK 1TWHK 1R9TA 1EH1A 1WCMA 1RU0A 1YNNA 4A3EK 3JSTA 5IOTA 2GSNA 3HOZC 1TWAK 2NVYC 4G0WA 2GSUA 4KASA 2NVQC 3S2HK 4NOIA 3GEHA 1JQWA 2GAHC 1I6VA 3GTPK 3RZDC 3HOYC 4C3JC 4X6AK 4Q5SA 2ZUFA 5M5YK 2YU9A 1F9NA 3S2DC 5L46A 3LAPA 3GSIA 3AH5A 2R93K 3G4AA 4GTLA 5TMFA 4A3BC 1I50K 1ZQ1C 1DD5A 4G7OA 2JA7K 2WB1L 1KQ4A 4C3IK 2E2IC 5M5XK 3AQOA 1WQHA 3TTGA 1SMYA 5FLMC 4A3IK 2R93A 2BE5A 4BXXK 1TWHC 4BY7K 3PO3C 4A3EC 2JA6A 2V6SA 3GEIA 3AD7C 1TWAC 2Y3PA 1YCLA 2PA8L 1V5VA 2P8TA 3GTPC 1DCOA 3H0GA 2E2HK 4QJVB 2EBBA 4X6AC 1WOPA 3GTMA 3HOWK 3T00A 3GTQA 4LOWA 3GIRA 5JFEA 3AQPA 1TWCK 4A93K 3S16C 2XCRB 4ILDA 1IQ0A 2PMZL 5IYBC 1K83A 1L0WA 1I50C 3BP3A 2JA5A 1O26A 2JA7C 3GTKK 3S1QC 4BY1K 4XSZA 4C3IC 4ZH4A 3FOEA 4KDDA 5HL8A 1AB4A 3L4KA 4MQ9A 4BXXC 4BY7C 3HOXC 3CQZK 4AYBD 1G51A 1EQRA 2A6EA 3HXAA 4KB4A 2Y0SL 1Y1WK 4LK0A 4FM9A 3HOZK 2NVYK 3NUHA 1XZPA 5TMCA 1I3QA 3FKIC 4YFXA 3A8JA 4A3MK 3HOWC 3S1NK 5IOQA 3H3VD 1B4BA 4KM9A 4BLAA 2RH6A 1TWCC 4A93C 4JK1A 3LPXA 4GT9A 2NVYA 1VRQC 1BJTA 1EFWA 4A3KC 2E2JK 2CW0A 4DDQA 4XLNA 3OEPA 3GTKC 4BY1C 1O2FB 1TWGK 4C2MK 5IOSA 3Q3QA 2E2IK 2CFAA 4PAAA 1J6XA 3CQZC 2A69A 2JA8K 1WOSA 3HKZL 5C4JK 1SFOK 3PO3K 1Y1WC 4OIRA 3GTOK 1GE9A 3GTGC 4A3FK 1ZBSA 4KN7A 3QX3A 1HQMA 2E2IA 2ZUEA 1UV7A 4A3MC 3S1MC 3S1NC 1TWHA 4A3GC 4AH6A 4QIWL 4LLGA 1TWAA 4A3CK 4XCHA 1B4AA 3VA7A 3S16K 5IP9K 2GAGC 1O2BA 2E2JC 2B63K 4GTDA 3GTPA 5IYBK 3TFIA 1J98A 4LQYA 3N3YA 1ZVUA 3N0BA 1TWGC 4C2MC 2D6FC 3S1QK 5C44K 4LK1A 3OREA 4WJ3M 1X31C 2XCOA 4GTBA 5EGEA 5TJ3A 5C4JC 3HOXK 1SFOC 2JA8C 1ZXOA 1WSRA 1TWFK 1I50A 3GTOC 2XCQA 3S14C 4YFNA 4Y7NC 2JA7A 4A3FC 4MEXA 5IP7K 1IL2A 1IS1A 5D4DA 1JVIA 4G0UA 3FKIK 4OIPA 2V6TA 4PABA 3I4MC 3V4GA 1IBAA 5E68A 3GTLK 2NVTC 1IW7A 4A3CC 1O29A 4BBRC 2WB1D 5IP9C 4KB2A 3TFHA 2B63C 4A3KK 2E2HA 4QJVA 1JOEA 2FQTA 4KN4A 4KATA 2A68A 3FKIA 4P5AA 4KMUA 3S1RC 5C44C 4KMDA 2KWAA 4RMFA 3K7AK 5M3MK 3TFJA 4WILA 1VGXA 1WIHA 1VH2A 5FJ8K 1TWCA 2PA8D 4LR2A 3GTJC 3MMLB 1Y1VC 1ISEA 1XZQB 4J3NA 1TWFC 1O24A 3GTKA 5IP7C 3HOVK 2RGRA 3HOUK 3GTGK 2R92K 3AD9C 1EK8A 5M5WK 3FOFA 2NVXC 2PMZD 3S1MK 3G4CA 4G0VA 4A3JK 3CQZA 4KARA 3GTLC 1EI6A 4A3GK 4P9SA 1Y1WA 3GTGA 5EGHA 1ZYRA 1XXCA 3PO2C 4Y52C 3S17K 1BS2A 3LAJA 4KM8A 3M4OK 2WAQL 4A3LK 1VLOA 3IPJA 1I6HK 4M1XA 3K7AC 2R7ZK 2Y0SD 4LJZA 3GEEA 1F7VA
chains in the Genus database with same CATH topology
1TWAA 3CAGA 4C3HC 1B4AA 3VA7A 1O2BA 3GTPA 1O28A 4GTDA 3H0GA 4LQYA 4FZBA 4GTFA 3GTMA 3N3YA 4GTEA 4KMHA 2GSOA 1ZVUA 3N0BA 3S0XA 4C2MC 1TWGA 3GTQA 2R92A 5JFEA 3AQPA 2XCRB 3OREA 4ILDA 4BKWA 2XCOA 4GTBA 5EGEA 5TJ3A 1K83A 1BGWA 1ZXOA 1SFOA 5CJ9A 2P5MA 2JA5A 5CHPA 1I50A 1O26A 2XCQA 3GTOA 2JA7A 1O27A 1IS1A 4C3IC 4BLBA 3FOEA 2ZFZA 4KDDA 4G0UA 1AB4A 2CFAB 3L4KA 3V4GA 4GTAA 1XXBA 1O25A 4GFQA 5IORA 2R7ZA 4KB4A 1O2AA 4P5BA 1WQFA 1O29A 4FM9A 4KB2A 3NUHA 3N0CA 1I3QA 2B63A 2VUMA 2E2HA 4KATA 3FKIA 4P5AA 5IOQA 1B4BA 1R9TA 1EH1A 4KMDA 2KWAA 4KC6A 1WCMA 4KM9A 5IOTA 4BLAA 2RH6A 2GSNA 1WIHA 3LPXA 4G0WA 1TWCA 2GSUA 2NVYA 4GT9A 2JH3A 4KASA 4LR2A 1BJTA 3GTJA 1XXAA 3MMLB 1ISEA 1Y1VA 4KAWX 4J3NA 4C3JC 3FHZA 4DDQA 1TWFA 1O24A 3OEPA 3GTKA 2YU9A 2RGRA 5IOSA 1EK8A 1F9NA 3Q3QA 2CFAA 3LAPA 3FOFA 3AH5A 3G4AA 2NVXA 3G4CA 4G0VA 3CQZA 4GTLA 4KARA 3GTLA 2PHCB 4GTCA 1DD5A 1Y1WA 1GE9A 1ZBSA 3GTGA 5EGHA 3QX3A 1KQ4A 5JVOA 1XXCA 1WQGA 3AQOA 1WQHA 2E2IA 3ERED 3LAJA 2R93A 4KM8A 1TWHA 4M1XA 4KMAA 2JA6A 3OPFA 3BUEA 3L4JA 2Y3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AH5 A;  4P5A A;  3G4A A;  5IOQ A;  1O27 A;  3G4C A;  4GTL A;  4KAR A;  1O2B A;  1O28 A;  4GTD A;  5IOT A;  4GTC A;  2CFA B;  4FZB A;  4GTF A;  3N3Y A;  4GTE A;  4GT9 A;  3N0B A;  4KAS A;  4GTA A;  1KQ4 A;  1O25 A;  5IOR A;  1O2A A;  5JFE A;  4P5B A;  1O24 A;  1O29 A;  4GTB A;  5IOS A;  3N0C A;  5CHP A;  2CFA A;  1O26 A;  4KAT A; 
#chains in the Genus database with same CATH topology
 3CAG A;  4C3H C;  1USO A;  1WOO A;  2VUM K;  1O28 A;  4XSX A;  4FZB A;  4GTF A;  1YX2 A;  3S0X A;  4KMH A;  4A3D K;  3S14 K;  1R9T K;  3HOV C;  4Y7N K;  1TWG A;  3HOU C;  2R92 C;  4MEY A;  4G7H A;  4WJ4 A;  5C4X C;  4BKW A;  4A3J C;  1F7U A;  3I4M K;  2V6U A;  1SFO A;  4YFK A;  5CJ9 A;  2P5M A;  3GTO A;  2NVT K;  1F93 A;  2YU9 K;  1PJ7 A;  4BBR K;  3S17 C;  4XLP A;  1IE0 A;  3M4O C;  2FQO A;  4A3L C;  1I6H C;  3HKZ D;  4GTA A;  2R7Z C;  1XXB A;  1O25 A;  4GFQ A;  1VJE A;  3S1R K;  5C3E C;  3S15 C;  1O2A A;  1DCH A;  4OIQ A;  4P5B A;  3T02 A;  4GZY A;  3SZY A;  2PPB A;  3N0C A;  3GTJ K;  2VUM C;  4BBS K;  2B63 A;  1Y1V K;  1J6V A;  4A3D C;  1R9T C;  3SZZ A;  1WCM C;  4KC6 A;  2JA6 K;  1USM A;  1WOR A;  2A6H A;  4QIW D;  3A8I A;  2JH3 A;  2NVX K;  3I4N K;  3GTJ A;  1XXA A;  3H0G K;  1Y1V A;  4KAW X;  3FHZ A;  1HI9 A;  1TWF A;  3GTM K;  5IYC C;  2YU9 C;  4C45 A;  3GTQ K;  4G7Z A;  3RZO K;  2O5I A;  3PO2 K;  3S2H C;  4Y52 K;  1PJ6 A;  2NVX A;  4YG2 A;  1K83 K;  4AYB L;  2JA5 K;  3GTL A;  2PHC B;  4GTC A;  1BDF A;  5IYD K;  4C3H K;  1J6W A;  3BP8 C;  5JVO A;  4BBS C;  1WQG A;  3ERE D;  2R93 C;  1INN A;  3H3V L;  3T01 A;  2JA6 C;  4KMA A;  3OPF A;  1C0A A;  3BUE A;  3L4J A;  3DXJ A;  5C4X K;  3I4N C;  1I3Q K;  1XZP B;  5M3F K;  3H0G C;  1XZQ A;  4A3I C;  1YNJ A;  3GTM C;  4GTE A;  2GSO A;  3M3Y K;  3GTQ C;  3GDZ A;  2R92 A;  3RZO C;  4Q4Z A;  3EQL A;  2NVQ K;  1K83 C;  1PJ5 A;  2E2H C;  1BGW A;  2JA5 C;  3RZD K;  3HOY K;  5CHP A;  4C3J K;  5C3E K;  3S15 K;  5IYD C;  1O27 A;  3ADA C;  4BLB A;  2ZFZ A;  1XPP A;  2CFA B;  3S2D K;  2W7V A;  1WSV A;  3AD8 C;  1WCM K;  5IOR A;  4A3B K;  2R7Z A;  1DCP A;  2O5J A;  1WQF A;  3A8K A;  3WOD A;  1I3Q C;  4OIO A;  4O2D A;  2VUM A;  4OIN A;  5FLM K;  2WAQ D;  3M3Y C;  5IYC K;  1TWH K;  1R9T A;  1EH1 A;  1WCM A;  1RU0 A;  1YNN A;  4A3E K;  3JST A;  5IOT A;  2GSN A;  3HOZ C;  1TWA K;  2NVY C;  4G0W A;  2GSU A;  4KAS A;  2NVQ C;  3S2H K;  4NOI A;  3GEH A;  1JQW A;  2GAH C;  1I6V A;  3GTP K;  3RZD C;  3HOY C;  4C3J C;  4X6A K;  4Q5S A;  2ZUF A;  5M5Y K;  2YU9 A;  1F9N A;  3S2D C;  5L46 A;  3LAP A;  3GSI A;  3AH5 A;  2R93 K;  3G4A A;  4GTL A;  5TMF A;  4A3B C;  1I50 K;  1ZQ1 C;  1DD5 A;  4G7O A;  2JA7 K;  2WB1 L;  1KQ4 A;  4C3I K;  2E2I C;  5M5X K;  3AQO A;  1WQH A;  3TTG A;  1SMY A;  5FLM C;  4A3I K;  2R93 A;  2BE5 A;  4BXX K;  1TWH C;  4BY7 K;  3PO3 C;  4A3E C;  2JA6 A;  2V6S A;  3GEI A;  3AD7 C;  1TWA C;  2Y3P A;  1YCL A;  2PA8 L;  1V5V A;  2P8T A;  3GTP C;  1DCO A;  3H0G A;  2E2H K;  4QJV B;  2EBB A;  4X6A C;  1WOP A;  3GTM A;  3HOW K;  3T00 A;  3GTQ A;  4LOW A;  3GIR A;  5JFE A;  3AQP A;  1TWC K;  4A93 K;  3S16 C;  2XCR B;  4ILD A;  1IQ0 A;  2PMZ L;  5IYB C;  1K83 A;  1L0W A;  1I50 C;  3BP3 A;  2JA5 A;  1O26 A;  2JA7 C;  3GTK K;  3S1Q C;  4BY1 K;  4XSZ A;  4C3I C;  4ZH4 A;  3FOE A;  4KDD A;  5HL8 A;  1AB4 A;  3L4K A;  4MQ9 A;  4BXX C;  4BY7 C;  3HOX C;  3CQZ K;  4AYB D;  1G51 A;  1EQR A;  2A6E A;  3HXA A;  4KB4 A;  2Y0S L;  1Y1W K;  4LK0 A;  4FM9 A;  3HOZ K;  2NVY K;  3NUH A;  1XZP A;  5TMC A;  1I3Q A;  3FKI C;  4YFX A;  3A8J A;  4A3M K;  3HOW C;  3S1N K;  5IOQ A;  3H3V D;  1B4B A;  4KM9 A;  4BLA A;  2RH6 A;  1TWC C;  4A93 C;  4JK1 A;  3LPX A;  4GT9 A;  2NVY A;  1VRQ C;  1BJT A;  1EFW A;  4A3K C;  2E2J K;  2CW0 A;  4DDQ A;  4XLN A;  3OEP A;  3GTK C;  4BY1 C;  1O2F B;  1TWG K;  4C2M K;  5IOS A;  3Q3Q A;  2E2I K;  2CFA A;  4PAA A;  1J6X A;  3CQZ C;  2A69 A;  2JA8 K;  1WOS A;  3HKZ L;  5C4J K;  1SFO K;  3PO3 K;  1Y1W C;  4OIR A;  3GTO K;  1GE9 A;  3GTG C;  4A3F K;  1ZBS A;  4KN7 A;  3QX3 A;  1HQM A;  2E2I A;  2ZUE A;  1UV7 A;  4A3M C;  3S1M C;  3S1N C;  1TWH A;  4A3G C;  4AH6 A;  4QIW L;  4LLG A;  1TWA A;  4A3C K;  4XCH A;  1B4A A;  3VA7 A;  3S16 K;  5IP9 K;  2GAG C;  1O2B A;  2E2J C;  2B63 K;  4GTD A;  3GTP A;  5IYB K;  3TFI A;  1J98 A;  4LQY A;  3N3Y A;  1ZVU A;  3N0B A;  1TWG C;  4C2M C;  2D6F C;  3S1Q K;  5C44 K;  4LK1 A;  3ORE A;  4WJ3 M;  1X31 C;  2XCO A;  4GTB A;  5EGE A;  5TJ3 A;  5C4J C;  3HOX K;  1SFO C;  2JA8 C;  1ZXO A;  1WSR A;  1TWF K;  1I50 A;  3GTO C;  2XCQ A;  3S14 C;  4YFN A;  4Y7N C;  2JA7 A;  4A3F C;  4MEX A;  5IP7 K;  1IL2 A;  1IS1 A;  5D4D A;  1JVI A;  4G0U A;  3FKI K;  4OIP A;  2V6T A;  4PAB A;  3I4M C;  3V4G A;  1IBA A;  5E68 A;  3GTL K;  2NVT C;  1IW7 A;  4A3C C;  1O29 A;  4BBR C;  2WB1 D;  5IP9 C;  4KB2 A;  3TFH A;  2B63 C;  4A3K K;  2E2H A;  4QJV A;  1JOE A;  2FQT A;  4KN4 A;  4KAT A;  2A68 A;  3FKI A;  4P5A A;  4KMU A;  3S1R C;  5C44 C;  4KMD A;  2KWA A;  4RMF A;  3K7A K;  5M3M K;  3TFJ A;  4WIL A;  1VGX A;  1WIH A;  1VH2 A;  5FJ8 K;  1TWC A;  2PA8 D;  4LR2 A;  3GTJ C;  3MML B;  1Y1V C;  1ISE A;  1XZQ B;  4J3N A;  1TWF C;  1O24 A;  3GTK A;  5IP7 C;  3HOV K;  2RGR A;  3HOU K;  3GTG K;  2R92 K;  3AD9 C;  1EK8 A;  5M5W K;  3FOF A;  2NVX C;  2PMZ D;  3S1M K;  3G4C A;  4G0V A;  4A3J K;  3CQZ A;  4KAR A;  3GTL C;  1EI6 A;  4A3G K;  4P9S A;  1Y1W A;  3GTG A;  5EGH A;  1ZYR A;  1XXC A;  3PO2 C;  4Y52 C;  3S17 K;  1BS2 A;  3LAJ A;  4KM8 A;  3M4O K;  2WAQ L;  4A3L K;  1VLO A;  3IPJ A;  1I6H K;  4M1X A;  3K7A C;  2R7Z K;  2Y0S D;  4LJZ A;  3GEE A;  1F7V A; 
#chains in the Genus database with same CATH homology
 1TWA A;  3CAG A;  4C3H C;  1B4A A;  3VA7 A;  1O2B A;  3GTP A;  1O28 A;  4GTD A;  3H0G A;  4LQY A;  4FZB A;  4GTF A;  3GTM A;  3N3Y A;  4GTE A;  4KMH A;  2GSO A;  1ZVU A;  3N0B A;  3S0X A;  4C2M C;  1TWG A;  3GTQ A;  2R92 A;  5JFE A;  3AQP A;  2XCR B;  3ORE A;  4ILD A;  4BKW A;  2XCO A;  4GTB A;  5EGE A;  5TJ3 A;  1K83 A;  1BGW A;  1ZXO A;  1SFO A;  5CJ9 A;  2P5M A;  2JA5 A;  5CHP A;  1I50 A;  1O26 A;  2XCQ A;  3GTO A;  2JA7 A;  1O27 A;  1IS1 A;  4C3I C;  4BLB A;  3FOE A;  2ZFZ A;  4KDD A;  4G0U A;  1AB4 A;  2CFA B;  3L4K A;  3V4G A;  4GTA A;  1XXB A;  1O25 A;  4GFQ A;  5IOR A;  2R7Z A;  4KB4 A;  1O2A A;  4P5B A;  1WQF A;  1O29 A;  4FM9 A;  4KB2 A;  3NUH A;  3N0C A;  1I3Q A;  2B63 A;  2VUM A;  2E2H A;  4KAT A;  3FKI A;  4P5A A;  5IOQ A;  1B4B A;  1R9T A;  1EH1 A;  4KMD A;  2KWA A;  4KC6 A;  1WCM A;  4KM9 A;  5IOT A;  4BLA A;  2RH6 A;  2GSN A;  1WIH A;  3LPX A;  4G0W A;  1TWC A;  2GSU A;  2NVY A;  4GT9 A;  2JH3 A;  4KAS A;  4LR2 A;  1BJT A;  3GTJ A;  1XXA A;  3MML B;  1ISE A;  1Y1V A;  4KAW X;  4J3N A;  4C3J C;  3FHZ A;  4DDQ A;  1TWF A;  1O24 A;  3OEP A;  3GTK A;  2YU9 A;  2RGR A;  5IOS A;  1EK8 A;  1F9N A;  3Q3Q A;  2CFA A;  3LAP A;  3FOF A;  3AH5 A;  3G4A A;  2NVX A;  3G4C A;  4G0V A;  3CQZ A;  4GTL A;  4KAR A;  3GTL A;  2PHC B;  4GTC A;  1DD5 A;  1Y1W A;  1GE9 A;  1ZBS A;  3GTG A;  5EGH A;  3QX3 A;  1KQ4 A;  5JVO A;  1XXC A;  1WQG A;  3AQO A;  1WQH A;  2E2I A;  3ERE D;  3LAJ A;  2R93 A;  4KM8 A;  1TWH A;  4M1X A;  4KMA A;  2JA6 A;  3OPF A;  3BUE A;  3L4J A;  2Y3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...