1O2BA

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and po4 at 2.45 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
213
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 71
structure length 213
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o2bA00
1O26A 4GTDA 5JFEA 4GTFA 4GTBA 1O25A 4KASA 5IOTA 2CFAB 4GTEA 3N3YA 5IOSA 4GT9A 4P5BA 1O24A 4GTAA 4KATA 1O27A 3G4CA 4P5AA 3AH5A 1O28A 1KQ4A 4GTCA 4GTLA 4FZBA 3N0CA 1O2BA 5IOQA 1O29A 5CHPA 1O2AA 3G4AA 2CFAA 3N0BA 4KARA 5IORA
chains in the Genus database with same CATH superfamily
2YU9A 3GTPK 3L4KA 1XZPA 2GSOA 1K83C 3T01A 4A3KC 3HOZK 1EK8A 2XCRB 1JQWA 4YFKA 5M5WK 3GDZA 1INNA 5IP9C 2GAHC 3EQLA 4BY7C 1IW7A 1TWHK 5IOQA 4KMHA 4J3NA 3AD9C 1Y1VK 1TWCA 3RZOC 4AYBL 3VA7A 4C2MC 3GTGC 3HOVK 4X6AC 4XLPA 1XXBA 5FJ8K 3GTGA 1WCMK 2E2HC 3H3VD 4GT9A 4A3GC 1Y1VA 1I6HC 3S14K 4BY1C 3GEIA 3HKZD 4BKWA 1PJ6A 3GTJC 4GTCA 2WB1L 5M3FK 4LK0A 3LAJA 1B4AA 1G51A 1VRQC 4A93K 4LQYA 2O5JA 2PMZD 2XCOA 4QIWL 4GTDA 1TWAC 1TWGA 3FKIC 4PAAA 4GFQA 1K83A 2YU9C 3GIRA 1WCMA 4KC6A 4GZYA 4QJVB 1SFOK 1XXCA 5IYDC 1USMA 1J6WA 2R92C 4XLNA 3RZDC 3CQZA 3S2DK 1TWCC 1BGWA 4Y52K 4BBRC 3HOWC 1SFOC 3SZZA 3V4GA 3BP8C 1J6VA 3LPXA 4GTBA 3ADAC 1IBAA 3TFJA 3HOUK 1YNJA 3K7AK 4LK1A 3S2HK 1PJ5A 2B63A 4KB4A 2VUMK 4Q5SA 2B63C 4YFNA 3TTGA 3I4MC 4A3KK 3CQZK 5C3EK 3N0CA 3FOFA 2JA5K 4A3IK 1XXAA 4WJ4A 3S2HC 2V6SA 3S16K 1O2AA 4MEXA 3S15C 3WODA 4LOWA 4YG2A 4A3MK 1XPPA 3L4JA 1WCMC 2E2HK 4A3EK 1O25A 4KASA 4P9SA 4C2MK 4QIWD 3NUHA 5FLMK 4BBRK 3HOWK 2E2JK 2FQOA 3S1RK 2JA5A 2R7ZA 3FHZA 2NVTC 3M3YK 5JVOA 5E68A 3A8JA 4AH6A 2NVXK 1RU0A 3S15K 4A3BK 4OIPA 2V6UA 1I50K 1YX2A 3HOZC 1O26A 3FKIK 2JA7A 1TWGK 1TWAK 3T02A 4LR2A 2NVXC 3AQPA 4GTAA 4A3EC 1Y1VC 3G4CA 4C3IK 3PO2C 4QJVA 3GTGK 2CFAA 1F7VA 1I50A 2JA7K 2PMZL 3S2DC 2PA8L 4X6AK 1TWGC 1TWAA 5M3MK 2Y3PA 1YCLA 3N3YA 2Y0SL 3S1NC 1I6HK 2GSUA 4KMAA 1J98A 3GTOC 2EBBA 2VUMA 4KATA 2JA5C 3GTQK 1K83K 2W7VA 3M4OC 2NVQC 1ZQ1C 4G0UA 1EFWA 3Q3QA 3S17K 1SFOA 4A3LK 5TMFA 3OEPA 3DXJA 2E2HA 3GTQA 3PO3K 4C45A 1XZPB 4C3JC 2NVQK 3S1NK 4P5BA 1TWFA 4PABA 1DCOA 2R92K 3RZDK 5IYDK 5IYCK 2A69A 2ZUFA 2R7ZK 4C3JK 4KM9A 1EH1A 3GTOK 1B4BA 3AD7C 3S14C 5D4DA 3HXAA 4BBSC 3S1RC 1TWFK 2CW0A 4A3LC 4GTFA 3JSTA 4G7OA 3FKIA 5M5XK 1Y1WA 3GTMK 4KDDA 4WILA 4NOIA 1IE0A 1WOOA 4KN7A 3GTOA 4XSXA 1EI6A 3I4MK 3AQOA 2R92A 1DCPA 5TMCA 4C3IC 3PO2K 2VUMC 1KQ4A 4A3MC 2RH6A 3TFHA 1I6VA 2A6HA 2Y0SD 4RMFA 3S1MK 1UV7A 4O2DA 4G7HA 2XCQA 4DDQA 3GTMA 5FLMC 4Y52C 3GTMC 4KAWX 4Y7NC 1I3QC 1DCHA 3S1MC 2NVXA 1F93A 5IP7K 4A3FK 1ZYRA 1TWFC 3CAGA 4P5AA 2R93A 1X31C 5TJ3A 4KM8A 1ZBSA 3TFIA 2NVYK 2NVTK 3IPJA 1C0AA 1O29A 3M4OK 4M1XA 3GSIA 4XCHA 2E2IA 3GTKC 3HOYK 4JK1A 3FOEA 1BJTA 3S1QC 3GEEA 5C4JK 2NVYC 3A8IA 2P8TA 2NVYA 1WQFA 1YNNA 4KMDA 4BLBA 4G7ZA 1HI9A 1BS2A 3CQZC 1JOEA 4GTLA 4KB2A 3OPFA 5C4JC 3GTLK 1L0WA 1IS1A 4A3IC 2JA6A 1O2BA 2R7ZC 4A3DC 2E2IK 5IYCC 1HQMA 1XZQA 3K7AC 4OIRA 3GTJK 3SZYA 2JA8C 4YFXA 1ZVUA 4C3HC 4OIQA 3S1QK 2PHCB 3GTPC 1XZQB 1I3QA 1Y1WK 2PPBA 3M3YC 4Q4ZA 2ZUEA 1WQGA 5IYBK 1O24A 1VH2A 5EGEA 3T00A 4BXXC 4AYBD 1J6XA 4LLGA 1WIHA 1PJ7A 1SMYA 5IYBC 5CHPA 3HKZL 3H3VL 3GTKA 2A6EA 3I4NK 2JA8K 1DD5A 3S0XA 1I3QK 3ERED 2CFAB 4GTEA 4A3GK 1WSRA 1TWCK 1R9TC 4A3DK 4A3CK 1R9TA 1WOPA 3QX3A 3HOVC 3HOXC 1O28A 4WJ3M 5C4XK 1VJEA 4C3HK 3GTKK 3HOYC 4KARA 1IQ0A 1F7UA 2YU9K 4MEYA 4BLAA 1WORA 2JA7C 3AD8C 3BUEA 4KMUA 4KN4A 1WQHA 4A93C 2WAQL 3GTQC 2PA8D 1EQRA 4A3JC 2JH3A 1JVIA 1TWHC 5M5YK 2BE5A 3HOXK 1TWHA 2KWAA 5HL8A 5IP9K 3GTLA 4FM9A 4A3JK 3BP3A 4BY7K 2E2JC 4G0WA 5EGHA 4A3BC 3H0GA 2E2IC 5JFEA 3H0GC 1VGXA 1Y1WC 3RZOK 2R93K 2GSNA 5IOTA 3HOUC 5C44K 5IP7C 4A3FC 4BBSK 4LJZA 4OINA 4Y7NK 3A8KA 2P5MA 3S17C 1O27A 3H0GK 3AH5A 4BXXK 1ZXOA 4BY1K 1ISEA 3S16C 1USOA 1IL2A 4XSZA 1WSVA 5C3EC 2JA6C 2B63K 3G4AA 1O2FB 3GEHA 1F9NA 4MQ9A 2A68A 2V6TA 1VLOA 3GTPA 3LAPA 1BDFA 1WOSA 2FQTA 4ILDA 3I4NC 2ZFZA 2JA6K 5IOSA 2WB1D 2GAGC 1GE9A 5C4XC 2R93C 1R9TK 4G0VA 3MMLB 4OIOA 5CJ9A 2D6FC 3GTJA 3OREA 3GTLC 4FZBA 3PO3C 4A3CC 2RGRA 1AB4A 2O5IA 5L46A 1I50C 4ZH4A 5C44C 3N0BA 2WAQD 1V5VA 5IORA
chains in the Genus database with same CATH topology
2YU9A 3L4KA 4GTFA 3L4JA 1DD5A 1O25A 2GSOA 3FKIA 3S0XA 4KASA 1Y1WA 3ERED 2CFAB 4GTEA 4KDDA 3NUHA 3GTOA 1EK8A 2XCRB 1R9TA 3QX3A 3AQOA 2R92A 1O28A 4C3IC 1KQ4A 2JA5A 2R7ZA 2RH6A 5IOQA 3FHZA 4KMHA 5JVOA 4J3NA 1TWCA 4KARA 4BLAA 3VA7A 1O26A 3BUEA 2XCQA 4C2MC 2JA7A 1XXBA 4DDQA 3GTMA 1WQHA 3GTGA 4LR2A 4KAWX 4GT9A 1Y1VA 3AQPA 4GTAA 2JH3A 2NVXA 3CAGA 3G4CA 4P5AA 4BKWA 2R93A 4KM8A 5TJ3A 4GTCA 1TWHA 1ZBSA 2KWAA 3LAJA 1B4AA 3GTLA 4FM9A 1O29A 4M1XA 2CFAA 4LQYA 4G0WA 2E2IA 1I50A 5EGHA 2XCOA 3H0GA 4GTDA 1TWGA 5JFEA 3FOEA 1BJTA 4GFQA 1K83A 2GSNA 1TWAA 1WCMA 5IOTA 2Y3PA 4KC6A 3N3YA 2NVYA 1WQFA 4KMDA 2GSUA 4KMAA 4BLBA 1XXCA 2P5MA 4KATA 2VUMA 1O27A 3AH5A 1ZXOA 4KB2A 4GTLA 1ISEA 3OPFA 3CQZA 1IS1A 2JA6A 1O2BA 1BGWA 3G4AA 4G0UA 1F9NA 3Q3QA 1SFOA 3V4GA 3LPXA 4GTBA 3OEPA 3GTPA 1ZVUA 4C3HC 3LAPA 2E2HA 3GTQA 2PHCB 4ILDA 1I3QA 2ZFZA 4C3JC 5IOSA 1WQGA 4P5BA 1GE9A 2B63A 1TWFA 4KB4A 1O24A 5EGEA 4G0VA 3MMLB 5CJ9A 3GTJA 3OREA 4FZBA 3N0CA 1WIHA 3FOFA 2RGRA 4KM9A 1XXAA 1AB4A 1EH1A 5CHPA 1B4BA 1O2AA 3N0BA 3GTKA 5IORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O26 A;  4GTD A;  5JFE A;  4GTF A;  4GTB A;  1O25 A;  4KAS A;  5IOT A;  2CFA B;  4GTE A;  3N3Y A;  5IOS A;  4GT9 A;  4P5B A;  1O24 A;  4GTA A;  4KAT A;  1O27 A;  3G4C A;  4P5A A;  3AH5 A;  1O28 A;  1KQ4 A;  4GTC A;  4GTL A;  4FZB A;  3N0C A;  1O2B A;  5IOQ A;  1O29 A;  5CHP A;  1O2A A;  3G4A A;  2CFA A;  3N0B A;  4KAR A;  5IOR A; 
#chains in the Genus database with same CATH topology
 2YU9 A;  3GTP K;  3L4K A;  1XZP A;  2GSO A;  1K83 C;  3T01 A;  4A3K C;  3HOZ K;  1EK8 A;  2XCR B;  1JQW A;  4YFK A;  5M5W K;  3GDZ A;  1INN A;  5IP9 C;  2GAH C;  3EQL A;  4BY7 C;  1IW7 A;  1TWH K;  5IOQ A;  4KMH A;  4J3N A;  3AD9 C;  1Y1V K;  1TWC A;  3RZO C;  4AYB L;  3VA7 A;  4C2M C;  3GTG C;  3HOV K;  4X6A C;  4XLP A;  1XXB A;  5FJ8 K;  3GTG A;  1WCM K;  2E2H C;  3H3V D;  4GT9 A;  4A3G C;  1Y1V A;  1I6H C;  3S14 K;  4BY1 C;  3GEI A;  3HKZ D;  4BKW A;  1PJ6 A;  3GTJ C;  4GTC A;  2WB1 L;  5M3F K;  4LK0 A;  3LAJ A;  1B4A A;  1G51 A;  1VRQ C;  4A93 K;  4LQY A;  2O5J A;  2PMZ D;  2XCO A;  4QIW L;  4GTD A;  1TWA C;  1TWG A;  3FKI C;  4PAA A;  4GFQ A;  1K83 A;  2YU9 C;  3GIR A;  1WCM A;  4KC6 A;  4GZY A;  4QJV B;  1SFO K;  1XXC A;  5IYD C;  1USM A;  1J6W A;  2R92 C;  4XLN A;  3RZD C;  3CQZ A;  3S2D K;  1TWC C;  1BGW A;  4Y52 K;  4BBR C;  3HOW C;  1SFO C;  3SZZ A;  3V4G A;  3BP8 C;  1J6V A;  3LPX A;  4GTB A;  3ADA C;  1IBA A;  3TFJ A;  3HOU K;  1YNJ A;  3K7A K;  4LK1 A;  3S2H K;  1PJ5 A;  2B63 A;  4KB4 A;  2VUM K;  4Q5S A;  2B63 C;  4YFN A;  3TTG A;  3I4M C;  4A3K K;  3CQZ K;  5C3E K;  3N0C A;  3FOF A;  2JA5 K;  4A3I K;  1XXA A;  4WJ4 A;  3S2H C;  2V6S A;  3S16 K;  1O2A A;  4MEX A;  3S15 C;  3WOD A;  4LOW A;  4YG2 A;  4A3M K;  1XPP A;  3L4J A;  1WCM C;  2E2H K;  4A3E K;  1O25 A;  4KAS A;  4P9S A;  4C2M K;  4QIW D;  3NUH A;  5FLM K;  4BBR K;  3HOW K;  2E2J K;  2FQO A;  3S1R K;  2JA5 A;  2R7Z A;  3FHZ A;  2NVT C;  3M3Y K;  5JVO A;  5E68 A;  3A8J A;  4AH6 A;  2NVX K;  1RU0 A;  3S15 K;  4A3B K;  4OIP A;  2V6U A;  1I50 K;  1YX2 A;  3HOZ C;  1O26 A;  3FKI K;  2JA7 A;  1TWG K;  1TWA K;  3T02 A;  4LR2 A;  2NVX C;  3AQP A;  4GTA A;  4A3E C;  1Y1V C;  3G4C A;  4C3I K;  3PO2 C;  4QJV A;  3GTG K;  2CFA A;  1F7V A;  1I50 A;  2JA7 K;  2PMZ L;  3S2D C;  2PA8 L;  4X6A K;  1TWG C;  1TWA A;  5M3M K;  2Y3P A;  1YCL A;  3N3Y A;  2Y0S L;  3S1N C;  1I6H K;  2GSU A;  4KMA A;  1J98 A;  3GTO C;  2EBB A;  2VUM A;  4KAT A;  2JA5 C;  3GTQ K;  1K83 K;  2W7V A;  3M4O C;  2NVQ C;  1ZQ1 C;  4G0U A;  1EFW A;  3Q3Q A;  3S17 K;  1SFO A;  4A3L K;  5TMF A;  3OEP A;  3DXJ A;  2E2H A;  3GTQ A;  3PO3 K;  4C45 A;  1XZP B;  4C3J C;  2NVQ K;  3S1N K;  4P5B A;  1TWF A;  4PAB A;  1DCO A;  2R92 K;  3RZD K;  5IYD K;  5IYC K;  2A69 A;  2ZUF A;  2R7Z K;  4C3J K;  4KM9 A;  1EH1 A;  3GTO K;  1B4B A;  3AD7 C;  3S14 C;  5D4D A;  3HXA A;  4BBS C;  3S1R C;  1TWF K;  2CW0 A;  4A3L C;  4GTF A;  3JST A;  4G7O A;  3FKI A;  5M5X K;  1Y1W A;  3GTM K;  4KDD A;  4WIL A;  4NOI A;  1IE0 A;  1WOO A;  4KN7 A;  3GTO A;  4XSX A;  1EI6 A;  3I4M K;  3AQO A;  2R92 A;  1DCP A;  5TMC A;  4C3I C;  3PO2 K;  2VUM C;  1KQ4 A;  4A3M C;  2RH6 A;  3TFH A;  1I6V A;  2A6H A;  2Y0S D;  4RMF A;  3S1M K;  1UV7 A;  4O2D A;  4G7H A;  2XCQ A;  4DDQ A;  3GTM A;  5FLM C;  4Y52 C;  3GTM C;  4KAW X;  4Y7N C;  1I3Q C;  1DCH A;  3S1M C;  2NVX A;  1F93 A;  5IP7 K;  4A3F K;  1ZYR A;  1TWF C;  3CAG A;  4P5A A;  2R93 A;  1X31 C;  5TJ3 A;  4KM8 A;  1ZBS A;  3TFI A;  2NVY K;  2NVT K;  3IPJ A;  1C0A A;  1O29 A;  3M4O K;  4M1X A;  3GSI A;  4XCH A;  2E2I A;  3GTK C;  3HOY K;  4JK1 A;  3FOE A;  1BJT A;  3S1Q C;  3GEE A;  5C4J K;  2NVY C;  3A8I A;  2P8T A;  2NVY A;  1WQF A;  1YNN A;  4KMD A;  4BLB A;  4G7Z A;  1HI9 A;  1BS2 A;  3CQZ C;  1JOE A;  4GTL A;  4KB2 A;  3OPF A;  5C4J C;  3GTL K;  1L0W A;  1IS1 A;  4A3I C;  2JA6 A;  1O2B A;  2R7Z C;  4A3D C;  2E2I K;  5IYC C;  1HQM A;  1XZQ A;  3K7A C;  4OIR A;  3GTJ K;  3SZY A;  2JA8 C;  4YFX A;  1ZVU A;  4C3H C;  4OIQ A;  3S1Q K;  2PHC B;  3GTP C;  1XZQ B;  1I3Q A;  1Y1W K;  2PPB A;  3M3Y C;  4Q4Z A;  2ZUE A;  1WQG A;  5IYB K;  1O24 A;  1VH2 A;  5EGE A;  3T00 A;  4BXX C;  4AYB D;  1J6X A;  4LLG A;  1WIH A;  1PJ7 A;  1SMY A;  5IYB C;  5CHP A;  3HKZ L;  3H3V L;  3GTK A;  2A6E A;  3I4N K;  2JA8 K;  1DD5 A;  3S0X A;  1I3Q K;  3ERE D;  2CFA B;  4GTE A;  4A3G K;  1WSR A;  1TWC K;  1R9T C;  4A3D K;  4A3C K;  1R9T A;  1WOP A;  3QX3 A;  3HOV C;  3HOX C;  1O28 A;  4WJ3 M;  5C4X K;  1VJE A;  4C3H K;  3GTK K;  3HOY C;  4KAR A;  1IQ0 A;  1F7U A;  2YU9 K;  4MEY A;  4BLA A;  1WOR A;  2JA7 C;  3AD8 C;  3BUE A;  4KMU A;  4KN4 A;  1WQH A;  4A93 C;  2WAQ L;  3GTQ C;  2PA8 D;  1EQR A;  4A3J C;  2JH3 A;  1JVI A;  1TWH C;  5M5Y K;  2BE5 A;  3HOX K;  1TWH A;  2KWA A;  5HL8 A;  5IP9 K;  3GTL A;  4FM9 A;  4A3J K;  3BP3 A;  4BY7 K;  2E2J C;  4G0W A;  5EGH A;  4A3B C;  3H0G A;  2E2I C;  5JFE A;  3H0G C;  1VGX A;  1Y1W C;  3RZO K;  2R93 K;  2GSN A;  5IOT A;  3HOU C;  5C44 K;  5IP7 C;  4A3F C;  4BBS K;  4LJZ A;  4OIN A;  4Y7N K;  3A8K A;  2P5M A;  3S17 C;  1O27 A;  3H0G K;  3AH5 A;  4BXX K;  1ZXO A;  4BY1 K;  1ISE A;  3S16 C;  1USO A;  1IL2 A;  4XSZ A;  1WSV A;  5C3E C;  2JA6 C;  2B63 K;  3G4A A;  1O2F B;  3GEH A;  1F9N A;  4MQ9 A;  2A68 A;  2V6T A;  1VLO A;  3GTP A;  3LAP A;  1BDF A;  1WOS A;  2FQT A;  4ILD A;  3I4N C;  2ZFZ A;  2JA6 K;  5IOS A;  2WB1 D;  2GAG C;  1GE9 A;  5C4X C;  2R93 C;  1R9T K;  4G0V A;  3MML B;  4OIO A;  5CJ9 A;  2D6F C;  3GTJ A;  3ORE A;  3GTL C;  4FZB A;  3PO3 C;  4A3C C;  2RGR A;  1AB4 A;  2O5I A;  5L46 A;  1I50 C;  4ZH4 A;  5C44 C;  3N0B A;  2WAQ D;  1V5V A;  5IOR A; 
#chains in the Genus database with same CATH homology
 2YU9 A;  3L4K A;  4GTF A;  3L4J A;  1DD5 A;  1O25 A;  2GSO A;  3FKI A;  3S0X A;  4KAS A;  1Y1W A;  3ERE D;  2CFA B;  4GTE A;  4KDD A;  3NUH A;  3GTO A;  1EK8 A;  2XCR B;  1R9T A;  3QX3 A;  3AQO A;  2R92 A;  1O28 A;  4C3I C;  1KQ4 A;  2JA5 A;  2R7Z A;  2RH6 A;  5IOQ A;  3FHZ A;  4KMH A;  5JVO A;  4J3N A;  1TWC A;  4KAR A;  4BLA A;  3VA7 A;  1O26 A;  3BUE A;  2XCQ A;  4C2M C;  2JA7 A;  1XXB A;  4DDQ A;  3GTM A;  1WQH A;  3GTG A;  4LR2 A;  4KAW X;  4GT9 A;  1Y1V A;  3AQP A;  4GTA A;  2JH3 A;  2NVX A;  3CAG A;  3G4C A;  4P5A A;  4BKW A;  2R93 A;  4KM8 A;  5TJ3 A;  4GTC A;  1TWH A;  1ZBS A;  2KWA A;  3LAJ A;  1B4A A;  3GTL A;  4FM9 A;  1O29 A;  4M1X A;  2CFA A;  4LQY A;  4G0W A;  2E2I A;  1I50 A;  5EGH A;  2XCO A;  3H0G A;  4GTD A;  1TWG A;  5JFE A;  3FOE A;  1BJT A;  4GFQ A;  1K83 A;  2GSN A;  1TWA A;  1WCM A;  5IOT A;  2Y3P A;  4KC6 A;  3N3Y A;  2NVY A;  1WQF A;  4KMD A;  2GSU A;  4KMA A;  4BLB A;  1XXC A;  2P5M A;  4KAT A;  2VUM A;  1O27 A;  3AH5 A;  1ZXO A;  4KB2 A;  4GTL A;  1ISE A;  3OPF A;  3CQZ A;  1IS1 A;  2JA6 A;  1O2B A;  1BGW A;  3G4A A;  4G0U A;  1F9N A;  3Q3Q A;  1SFO A;  3V4G A;  3LPX A;  4GTB A;  3OEP A;  3GTP A;  1ZVU A;  4C3H C;  3LAP A;  2E2H A;  3GTQ A;  2PHC B;  4ILD A;  1I3Q A;  2ZFZ A;  4C3J C;  5IOS A;  1WQG A;  4P5B A;  1GE9 A;  2B63 A;  1TWF A;  4KB4 A;  1O24 A;  5EGE A;  4G0V A;  3MML B;  5CJ9 A;  3GTJ A;  3ORE A;  4FZB A;  3N0C A;  1WIH A;  3FOF A;  2RGR A;  4KM9 A;  1XXA A;  1AB4 A;  1EH1 A;  5CHP A;  1B4B A;  1O2A A;  3N0B A;  3GTK A;  5IOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...