1O2HA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2hA02
2ANYA 2XBWA 1QRZA 2BZAA 1GGDC 4YOIA 2ZFSA 3F1SB 3F9GA 4CRAA 3M3VA 1C2EA 4JK6A 4NWKA 1PPGE 1BMNH 2AYWA 3TK9A 1KXEA 1G30B 4ISOA 3M5NA 4NIXA 4AN7A 2BB4A 3FZDA 1AVXA 1FJSA 3BV9B 3STIA 4XSKU 4ZROA 3LJOA 3TJUA 1CSOE 4IMQA 3RXBA 3KQCA 3O8CA 1T7CA 2B0FA 2AGIX 3T27A 3ZV9A 4GUXA 1A61H 2J2UA 3V3MA 3UQVA 1CO7E 2FODA 1TA6A 4NIWA 1BIOA 2BZ6H 1MH0A 3BG4B 4GHQA 5LPEA 1BJVA 1TFXA 1GHYH 3RXRA 2O8MA 2WINI 4BAHB 1UVSH 1BTXA 1Z6JH 1EAIA 4INKA 3SV6A 2A45B 3OU0A 1FI8A 3MU5A 3A8DA 1C4Y2 5C1UA 1AFEH 2ZCLP 3M36A 3E0NB 2ZFPH 1QRWA 4X6OA 4MPXA 1OP8A 1A7SA 1GCTB 2ULLA 4YO9A 2BD8A 4YOGA 1D3QB 1FPCH 2OBQA 1AZZA 1TLDA 1AB9B 1O3FA 3FVFB 2R0KA 4JZEH 1JWTA 1C5TA 1KXAA 3A80A 1Z1IA 3EAJA 3ODFA 2Z9LA 4DJZB 2F9NA 4Q7ZA 2V6NA 2YNAA 1TGBA 5A8YA 1D6RA 1G3BA 1ZTLA 1ESAA 1MMJN 2PR3A 1ESBA 2VWNA 3H7OA 3KQBA 4J1YA 1F0RA 1HAIH 1LKBA 2HGTH 1PYTC 3SUGA 1O2HA 1ZHMA 1P2KA 1O3GA 3S7HB 2G4TA 4H6TA 2STAE 3SNEA 1C1RA 1GMDF 1T8NA 1W13U 1L0ZA 4NWLA 2BDGA 4LK4A 1EPTB 3KQDA 3RMOH 3RMNH 3RC5A 3DFLA 2AERH 4IGDA 5J4SA 1SGFG 1ZZZA 1LCYA 4WJG2 2ZQ2A 3P6ZB 5IDKA 1BTYA 1G9IE 3UR9A 3MNXA 2ANKH 4OGXA 3BEFB 1V2RT 1TMBH 1GI9B 1DSTA 1HAVA 3M5LA 1J14A 1QJ6B 4AG2A 1UCYE 2CJIA 4XDEA 4XOJA 2ASUB 1RTLA 3VB6A 1KIGH 1RGQA 1ZPBA 5EW2H 5C1XA 1CGHA 4ASHA 2HPPH 1SQOA 1DANH 1K1MA 1V2PT 1XXFA 1NFXA 1QURH 1LVYA 3LGTA 1GCDA 2VVVA 1BHXB 2H9TH 1SR5C 1MU8B 1ZPZA 2NU4E 5FBEA 5AHGH 5F6MA 3OY6U 2P94A 2FZZA 3ZYEA 1HAZB 2QCYA 1SGNE 2GZ7A 1HJ8A 1C2FA 3L6PA 3ZVEA 1N8OC 3UOPA 2BD2A 2TIOA 3F6UH 5LGOA 1S6HA 1E38B 4B1TA 2ZPSA 1RTKA 3UUZA 4X1SU 3SNAA 2JH5D 2QXHA 1C5ZB 2EI7A 2BD9A 1GBMA 2ZDLA 1CBWC 3LGIA 3V13A 3BTEE 3V7TA 1UCYH 3LGVA 4OS1A 1SOZA 2FS8A 2HRVA 2BXTH 4MNWA 1BA8B 1SLUB 2NU1E 4ABGA 1P04A 4SGAE 2VWLA 2FI3E 4FU8A 1BT7A 5EPNA 1BMLA 2BD5A 1C2KA 2WPMS 3QDZB 1A3BH 1JBUH 1UTKA 1IQEA 2VIQA 3TIUA 2OQUA 2IOTA 2C8YB 1SFIA 2XC0A 3MFJA 3QUMP 1GI8B 1L1NA 1AFQC 1XM1A 4UDWH 1VCPA 2XYAA 1DWEH 1GI1A 1O2XA 2QAAA 1C5SA 1CT4E 2BLOA 2FOMB 2VIOA 1B5GH 1LVOA 3LKWA 2UUKB 4AFQA 2FI5E 1J16A 1GJ6A 3DT0H 3ENSB 1VR1H 2PHBA 4GSOA 5C5OA 1HYLA 1KXCA 1O3JA 5JB9S 3RC4A 2WPJS 2QF3A 3BTME 5HMAA 4TWYA 2BD4A 2ZDKA 1MD8A 5LPFA 4TPIZ 4X2XA 1LPZB 3RM0H 2A5AA 3KHVA 3LOXA 1ZPCA 3SU6A 2SGAA 3V12A 1O5BB 5EW1H 3SUFA 5JYIA 4JCNA 3UY9A 1DUAA 1SQAA 1Z8JB 2QY0B 3SJKA 1BTPA 4BAMB 1B0EA 4ZUHA 1EX3A 1K1LA 2XC5A 1EJNA 1DT2A 4WMEA 3RUOA 1WSSH 2FOFA 3SNBA 1BJUA 2H1UA 2G5VA 2GDEH 4BTUB 4ISIH 1GL0E 1GHAG 3CS0A 4Y79A 1BMAA 2PV9B 1GJDB 2BLWA 3A8BA 2R0LA 1OPHB 4NGAH 4X6MA 1V2TT 1U6QA 3QWCH 2CF8H 1EAXA 4B71A 2PUXB 5DJ7A 4A1XA 2FPZA 1GBBA 4FUIA 2ZCHP 4X8VH 3Q77A 1MAYA 1C5LH 1RS0A 1C5NH 3Q00A 1VITG 3PMJA 1DOJA 4QT8C 4Y71A 2XTTB 2FO9A 1N6XA 2D1JA 2Z3DA 2BY8X 1IHSH 1CBWB 1FNIA 3GY2A 4LXBH 3SW2B 1OWKA 2C90B 2WPIS 5EOKA 1PQAA 3E8LA 1SGPE 4KKDA 4AZ2B 3NUMA 1ANDA 1BRBE 1QL9A 1TX8A 2A5IA 1GI0A 4M7GA 3SJOA 1MBMA 1C1VH 1G3EA 1O35A 1EZSC 2W26A 3MO6A 3SI3H 1C1MA 2ZF0H 1C5UA 1V2UT 4UFGH 3E0PB 1UJ1A 2CMYA 1KLTA 3D49H 5FBIA 4GPGA 1HGTH 1GJ8B 4GAWA 1YC0A 4BTTB 1IQIA 2GZ9A 6CHAC 1C9TA 1NM6A 3LPRA 4JYVH 1PPHE 1XXDA 6LPRA 3AASA 1S84A 3LIWA 1AFQB 1O2JA 1Y59T 1P57B 4D76A 3PLPA 5C20A 3MWIU 2ZDMA 4A1VA 1G3CA 1O5EH 5K0HA 1Z1JA 1SGEE 3AAVA 1WOFA 1S5SA 1GBFA 1N1LA 5GJ4B 2NU2E 1NRPH 5A0CA 2TPIZ 2V35A 1QY6A 4UFDH 1IQLA 2ZGCA 3NPSA 4TWWA 2A7CA 4RKJB 1OXGA 4BOHA 1EASA 3A89A 1SQTA 2OBOA 4TPYA 1SLVB 2C8XB 3P8OA 1YPLH 1L2EA 2SNWA 3QGJA 3DUXH 1UK4A 2J4IA 1SLXB 2FEQH 1LHFH 1A4WH 1Q2WA 2GV6A 2VJ1A 3F68H 2BQ7B 3M37A 1W8BH 4Q7YA 4CRBA 4AORA 3SI4H 1PYTD 1W3CA 3AW0A 1O3OA 1KTTB 4ZH8A 1O3LA 1YBWA 2A4GA 2P3TB 3RP2A 4B76A 1PQ8A 3E1XB 1O37A 1AE8H 3NCLA 1HAYB 1C2MA 1ELFA 5ESBA 3BG8A 2PKSC 2D2DA 2G8TA 3KIDU 1GI4A 1L1GA 1ETTH 4AGJA 1AO5A 2D26C 5IYTA 4KTUA 1YPHC 3SNDA 1O33A 1GBEA 1TX7A 2J94A 4ESTE 4O3UA 1Y3XA 1ELAA 3S0NA 1UTPA 3TJVA 1CHOG 3TGKE 4AYVB 4E7NA 1ZR0A 1YCPK 1H8DH 3BIUH 5T6FA 3ZZ5A 1GHAF 1BITA 1QJ7B 1TPSA 3E91A 5F8XA 1TGNA 1TRYA 1GI2A 1C5RA 2G55A 2ZWLH 1O2SA 1FLEE 1GDQA 3AVZA 2GMTC 1T8OA 2J38A 1Z8IB 4OS6A 1GDUA 1ARCA 4E06H 1UO6A 3MU1A 1HAXB 3GICB 3F9HA 1QL8A 1IAUA 1P2QA 1VITF 4FUBA 2O8LA 2J9NA 1ZYOA 4K1EA 2CHAB 1WCZA 2G52A 1EP6A 5EG4A 2F9VA 5A8ZA 3C27B 4GLYA 4K8YA 2A4OA 4XBDA 3T62A 1P11E 3M35A 5E0GA 5JPMH 2HNTC 2ZP0H 2JKHA 2BDAA 1FY8E 1ORFA 3K65B 1Z71A 1P02A 1KXBA 1TNHA 1GCTC 1BOQA 2XBVA 3ATIA 5A09A 1GBKA 1LQEA 6CHAB 2QYIA 1TX6A 3RXMA 5L30H 1TRMA 3FAOA 3NK8A 5CE1A 1OWJA 1ZSLA 3GCOA 2KAIA 1BQYA 4CRDA 2G4UA 3SV7A 1QRXA 5I46H 1ZSJA 1ANCA 1S85A 1UTNA 1AN1E 1MAXA 2F9PA 3P8FA 2PFEA 3JZ2B 4I31A 4BANB 4AB8A 5EPYA 3ZZ4A 3QLPH 1Y3VA 1P09A 2NWNA 1LPGB 3RU4D 8LPRA 2GDDA 3BN9A 3LJJA 1LVMA 3PWBA 2IJOB 1TQ7B 1Z7KA 4IS5A 3GCNA 5F03A 2FX6A 3KGPA 3SV8A 4DURA 1Y5BT 4XE4A 3L33A 4X8TH 3VB4A 2GX4A 1A0LA 1EXFA 1DITH 2ZFQH 3SU4A 1ZTJA 2ZKSA 3EDXB 4YZUA 1AWHB 2FLRH 1GVZA 4ZAEA 3RXLA 2BQWB 3W94A 1MKWK 1YF4A 2VB0A 1BDAA 3PMBB 3PWCA 4KGAA 1T8MA 2OD3B 3SV9A 4B2BA 1NRQH 1ANBA 1TE0A 3AAUA 1C5VA 1D4PB 1BCUH 1W7GH 2ESTE 2FLBH 2PKSB 2WUBA 3TGIE 2P59A 1CT2E 4Y8XA 3GY5A 3DA9B 4D9QA 6GCHG 5E0HA 1T8LA 3P70B 3RXCA 4PROA 4X1QU 1JIRA 4U01A 2OUAA 2IN2A 4AB9A 3TLOA 1HAGE 4K3JA 4ZHMU 2W3KA 3IG6B 4MQAA 1C2LA 1CHOF 1SFQB 2NU0E 1CGJE 3MYWA 2FX4A 2BTCE 1NC6A 2GTBA 2GMTB 5FX6A 3SU5A 4UFEH 3I78A 2I6QA 2BDYA 2ZU2A 3AW1A 3UIRA 1IOEA 1C1PA 1RJXB 1RIWC 2A1DB 2PKAA 3FZZA 1G32B 3QTVH 2BOKA 3KCGH 1K28D 1Y3UA 1ESTA 3LT3A 4KP0A 1C1NA 4E7RG 1GBTA 1SGTA 5GXPA 4DGJA 1CA0C 1S0QA 3RDZA 2ZHQH 5ETXA 2QXGA 9LPRA 1GMHG 1A3EH 1SHHB 1W10U 3HGNA 1PPBH 1T4VH 3D62A 4I8KA 4JZIA 3CS7A 1FY5A 4A5TS 1ELEE 4BXWA 1UHBB 1TAWA 2ZGJA 3HKJB 3O8DA 4IC5A 1UCYK 4VGCB 3E3TA 1V2JT 1H1BA 4IW4E 2Y5GA 1HAPH 1OYTH 1O3NA 2HALA 4ABDA 1DM4B 2AH4X 4ABFA 2B7DH 1WQVH 1DWDH 2P3FH 1P8VC 4B74A 4WXVA 3ZV8A 1WQSA 3E16B 3Q3YA 1MQ5A 1DPOA 2ZNKH 3A82A 1TBQH 3RXEA 4RN6A 1PQ5A 4SGBE 4AFUA 1CE5A 1QBVH 2BY7X 1FQ3A 1FY3A 1YPKH 4X2WA 1NRRH 1KDQB 2GP9B 1NTPA 2BDCA 1OWDA 2Z9JA 4YT6H 1EPTA 1M9UA 1W0YH 1THPB 1ZJKA 4WMFA 3RLYH 1GJ9B 5AFYH 1MQ6A 1UVOA 2UWPA 3GDUA 4AGKA 3T2NA 4F4OC 1C1SA 4I8LA 3UTUH 4JYTA 1K1OA 2FMJA 1HLTH 2ZDVH 1GBJA 4ZKRU 4DG4A 3BTKE 4Y8YA 5HYOA 3H5CB 4ZXYH 4ABHA 1F0SA 2EC9H 3D23A 2FS9A 3U1IB 1EQ9A 1MCVA 4UEHH 3RXUA 5GWZA 1TNIA 1JIMA 2ZFRH 3LC3A 3MOCA 1AUTC 3EGKH 1EP5A 2F3CE 2PLXA 1IQHA 1O2PA 1IQKA 4Q2KA 1V2KT 5TCAA 3A8AA 3SJIA 3RXSA 2AS9A 2ZGHA 4ABBA 6GCHF 5GPIB 2OINA 4Y0YE 1BTHH 1FPHH 5HXFA 1TOCB 4MPUA 1UK3A 1GJAB 2WPHS 1NPMA 1O32A 1GHBG 3SBKA 4MNYA 4I32A 3UR6A 1HIAB 2P8OC 4WVPE 3MHWU 1O31A 1ETRH 1JOUB 2BY9X 1ZMNA 2BLVA 1AIXH 2H5DA 1H8IH 1RIWB 3QZRA 1P01A 2FDAA 5A0AE 1MCTA 2FIRH 1V2MT 1V2OT 3KN2A 1F92A 2AGEX 1V3XA 1O34A 1YYY1 2SGPE 5BRRE 2RA3A 2FTLE 1BBRE 3RXJA 3CENA 1CA0B 2JH6D 5F8ZA 4INHA 2QV1A 1CT0E 3K9XB 4JZ1A 3MH7A 4UE7H 4Y7BA 4Y6DA 2F9UA 1D3PB 1ZLRA 1XUHA 1TOMH 5I25A 3F9EA 3ZVGA 2Q6GA 2UUYA 2O8UA 5HM9A 1F5RA 1GMHF 1W2KH 3KF2A 1ELGA 1AWFH 1RTFB 1QB1A 1MKXH 2ODQA 1V2QT 3P8GA 2VNTA 3SU2A 1HJAB 1GI6A 1VCQA 2SGQE 4ISLA 3MU0A 5DPAA 4I7YH 4CRFA 4LZ1H 2YNBA 5EODA 1UMAH 1TPOA 3B8JA 3PMAB 5A2MH 3HGPA 2ZFFH 1HV7A 5F8TA 1P2NA 1HXEH 5GDSH 3ZZ9A 3TK6A 3LDXH 1O2VA 2ANMH 1BBRH 5L6NH 4DOQA 1QB6A 4RSPA 4MLFB 3UQOA 2J95A 1GBHA 1V2WT 3N7OA 1J15A 4THNH 2ZHEH 2XW9A 2GCHG 3A7WA 4MVNA 1AQ7A 4X1NU 1L4ZA 1F5LA 1P12E 4XBCA 3SO3A 3BF6H 2Y82A 4UD9H 1O3KA 4DIIH 1J17T 1YLCA 3K6YA 4FUHA 2Y7XA 3SN8A 3SGQE 4XBBA 2BVXH 2A2QH 5DP7A 2AEIH 2XNIA 4NZLA 2XBXA 3QX5H 2FOAA 3ZZDA 4UFFH 4YM9A 2HLCA 2Z9GA 3R3GB 1SGFA 1GHZA 1S81A 4MPWA 1MTWA 2ALVA 5FPSA 3Q3KA 1C5OH 1QQUA 4JYUH 4O97A 1P0SH 1THSH 1O2WA 1GVKB 1TPAE 3ITIA 1N6YA 1P9SA 4BTIB 1D9IA 4ABEA 1EB1H 3A8CA 1ZHRA 3VB7A 2UWLA 1GBIA 1WAYB 2WPKS 5EQQA 2Q6DA 1K1JA 2P8OB 1GHBF 1H9HE 3ATKA 2CHAC 2BOHB 2P16A 2AMDA 2O8WA 1RD3B 2H5CA 4GCHF 1HXFH 1GHVH 5ESTE 4CBNA 2GKVE 3U8TH 1F2SE 3LH1A 2SGDE 5JB8S 1BTZA 1EJMA 1YPMH 3PTBA 3SQHE 1ABIH 3GDVA 3UNRA 1J8AA 3RXDA 1C2GA 5DKMA 2G51A 1FDPA 4HI3A 2QA9E 2STBE 9ESTA 3PTNA 1MZAA 2Z3EA 1FN8A 1O2MA 2GVFA 2UUFB 4MTBA 1D3TB 1FIZA 3RM2H 1DX5M 2SGFE 3MNCA 4HTCH 3GY3A 2LPRA 4DCDA 2ZHFH 1O3AA 1QIXB 1Q31A 4A92A 4X6PA 1A5GH 1T32A 2BX3A 2QGRA 2TRMA 4X0WU 3TJNA 3M3SA 2PUQH 1BUIA 2ZDAH 1NZQH 1O2GH 2THFB 1MU6B 2A7JA 4R8TB 2BY6X 2VIPA 3P95A 1O2UA 1O5GH 2OC0A 4H4FA 1G3DA 2F9BH 3NWUA 1HNEE 2ZTYA 3RLWH 3EE0B 4WXIA 2Y80A 4ZMAH 1UTQA 1EKBB 2NU3E 3MMGA 3LONA 3B23B 2VINA 4K8BA 4BAOB 3IITA 1TGCA 2GGVB 3F9FA 3S69A 1VZQH 1UK2A 1AU8A 3EA9A 1AKSB 1O3DA 3ZYDA 1GMCG 1LHEH 2GCHF 3OYPA 2BVSH 3RXFA 2ALPA 4AFSA 1C4U2 5FXLA 4ZXXH 4Y7AA 2TGPZ 1K1IA 5EGMA 2RCEA 1MBQA 4ISHH 2JH0D 1ELTA 4K1SA 5FHTA 4NFFA 4LOYH 4NFEA 1MD7A 2BMGB 1KXFA 1O5CB 4U32A 1HJ9A 3GYLB 2K1QA 1BRAA 2BDIA 3EYDA 5FX5A 1EAWA 1W0ZU 2AMPA 4NA7A 3SQEE 2WV5A 3TJOA 1FY1A 1BZXE 1DXPA 1P2OA 1E37B 3BIVH 1CA8B 2O9QA 1AD8H 2BQ6B 3BTWE 5BPEA 1QB9A 2AFQB 5PTPA 3KNXA 1RXPA 5EXMA 1PFXC 2Z3CA 1C5YB 1C1WH 3MO9A 3A83A 1C5MD 1YP9A 1AE5A 1NFUA 2OCVB 1TNGA 3H7TA 1GBDA 1YCPM 1ABJH 3URDA 1AVGH 4WF8A 5FPTA 1DWCH 1C5XB 2GZ8A 3OX7U 4ABIA 2VIDA 2OLGA 3VFEA 2B5TB 1W7XH 5JBCS 2GT8A 2ZEBA 1O0DH 4MNXA 1H4WA 2FXRA 1FN6A 1O2ZA 3RMMH 3U69H 4AG1A 4YT7H 1GJ4H 2W7UA 1SVPA 2OTVA 2A2XH 3C1KA 2VVUA 3U98H 3MU4A 1CU1A 1NO9H 1TNJA 1P03A 2G00A 8GCHG 1E0FD 2WYGA 1HCGA 2UWOA 3NKKA 1OWHA 5TJXA 2ZPRA 1NFWA 1TRNA 4I33A 4VGCC 3BTFE 1S0RA 2AIQA 3PLKA 1D6WA 1NFYA 1F7ZA 2ZC9H 1K1PA 2XRCA 5E0JA 3O8RA 4X8UH 1TPPA 3ZZAA 1HBTH 4FUDA 4NSVA 1Y8TA 1SGRE 1SGQE 4TY6A 1S6FA 2ZIQH 3ZZ8A 2F91A 1SMFE 4DW2U 5JDUB 4A6LA 1GDNA 1EZQA 4NSYA 3T5FH 2BX4A 3UOUA 1DY9A 2RDLA 2VWMA 1O2KA 2XCNA 3K2UA 3WY8A 1IQMA 2ZA5A 1QCPA 1J9CH 1TNKA 1KSNA 1L4DA 3M61U 5DO4H 5HM2A 3VB5A 4H6SB 3ZVFA 2TGAA 2Z6BD 2Y5HA 3ZZ3A 3T29A 1V2NT 2W3IA 2C8WB 4CREA 1BRUP 3GCTG 1GG6C 1ELCA 1Q3XA 3ODDA 4RKOB 1DXWA 1C1OA 2QXJA 1ZMJA 1XKBC 3GCHC 2XWBI 3P17H 1FIWA 2RG3A 3JZ1B 1P3EA 1ARBA 1LVBA 1OKXA 1MUEB 3K6ZA 4NA9H 1K22H 4BAQB 1JRTA 4TY7A 1IQFA 1ELDE 2R2MB 1XMNB 3BTQE 1DDJA 1GMCF 1GI7B 4OGYA 3T28A 2AIPA 1MTVA 4OS7A 3ZZ7A 2FOCA 3IWMA 3SU0A 1DLKB 1NN6A 2IPHA 1AHTH 2DE9A 1AY6H 2C4FH 1OWIA 3TPIZ 1ZSKA 5CHAC 2FESH 3M3TA 1QTFA 1XUIA 3SJ8A 2DE8A 3BTHE 3GY8A 4B2AA 1C5QA 1S82A 2QIQA 2PGBB 2ZO3H 1YPGH 5JBAS 3SHAH 1VJ9U 4WMDA 1UTOA 4KTCA 4IC6A 1P10A 1T31A 5ABWA 3HATH 3SU3A 1OS8A 2VH6A 2J34A 3QZQA 4MNVA 7LPRA 1Y3YA 2SFAA 1AI8H 4F49A 1QFKH 4CRCA 1LDTT 2B9LA 3RXTA 1WBGB 2QN5T 1YPJH 1SSXA 3MTYA 3EA7A 1DSUA 1B7XB 1OP0A 3PLBA 2W5EA 3FP8E 2OQ5A 3SV2H 4NIVA 3A88A 1RFNA 3OY5U 2HNTE 3BTTE 4AX9H 5GCHF 1NU9A 1O3PB 2BVRH 1XUJA 2HNTF 4K1TA 2ZGBH 2CN0H 2WUCA 1K9OE 3VGCC 1SB1H 1GHWH 1C2JA 1EB2A 1PPCE 1Y5AT 6ESTA 1Z8GA 3GY6A 1UHBA 5EXNA 4YOJA 2PKAB 1A2CH 7GCHF 1MTSA 2BY5X 1FAXA 8GCHF 4MDSA 4MPVA 1GI5A 3QK1A 1GJ7B 1HJAC 3QGNB 4ABAA 3DD2H 4OS4A 4B2CA 4YTAA 2H2ZA 4K69A 1O5FH 1EATA 2EA3A 1A5IA 1ETSH 3A86A 3PM3A 1C5PA 4BAKB 3UREA 5DP9A 1AZ8A 2XXLA 4I8JA 4NIYA 3KQEA 3M5MA 2I6SA 1V2VT 4O9VA 1Y5UT 3SZNA 3MO3A 1LTOA 1ACBE 1FZZA 2YOLA 1GPZA 2B8OH 2P95A 1QHRB 1GVLA 1KDQA 1MKXK 1GBCA 3DHKH 4FU9A 2BD3A 1A1RA 4CBOA 2V3OH 1ELVA 1QL7A 3A85A 4DVAU 1KXDA 1YLDA 2ZGXH 2Q6FA 1GG6B 2FYRA 2R3YA 2ZU1A 1F5KU 4ZKOU 4FXGH 3KL6A 1LHGH 1QGFA 5E2PA 1W12U 3RXGA 4ISNA 1K2I1 3GCTF 2ZHWH 2PTNA 3GCHB 1MKWH 1O2NA 1WYKA 3UNSA 2JETB 1E34B 2TGTA 4IN2A 4NA8A 5DP4A 1DICA 1EZUC 2TBSA 4I8HA 1YPEH 3RXIA 2FM2A 1BBRK 3MH6A 2QC2A 1ZHPA 1GJ5H 5DP5A 1ID5H 1O39A 4X1RU 3URCA 1AUJA 1TONA 4D7FA 5SGAE 1FXYA 1MZDA 5DP3A 8ESTE 1UVUH 2ZTXA 4HGCA 5CHAB 1BHXF 3E90B 1SI5H 4DIHH 1C2DA 3ESTA 1EZXC 3M7TA 2HOBA 2EI6A 4IBLH 4GVUA 1H9LB 1O2QA 1HAVB 2C8ZB 1JRSA 3NZIA 1GI3A 3UWJH 1HFDA 1KLIH 3EQ0H 2A0QB 4X6NA 4YLUA 1GGDB 1O3HA 5FPYA 3SJ9A 4K2YA 1SC8U 1XUFA 5FCKA 2A7HA 1WTHD 1OX1A 2Y5FA 3FP7E 1HIAA 5AFZH 3RXAA 2ZU4A 1TB6H 3FP6E 1H9IE 5FAHA 1K1NA 3PYHA 3RU4T 4CHAC 4GCHG 1W14U 1OP2A 1HRTH 1QJ1B 1OWEA 3SUEA 1AVWA 2BDBA 1PJPA 3T26A 2XCFA 3VXFH 1A0JA 1G36A 4B75A 3TGJE 4YLQH 3SHCH 1TGTA 1XUGA 2R3UA 4KELA 1YKTA 1SG8B 5TCCA 1O2OA 2BHGA 2BM2A 1P3CA 3VGCB 2W7SA 2FOBA 2F83A 5A0BA 1SBWA 1LHDH 2VIVA 1V2LT 1GJBB 3A7VA 3A7YA 1SGDE 5L2YH 1FV9A 1HUTH 4JK5A 3RXKA 4U30A 3VPKA 4TYDA 5CMXH 1DVAH 4IN1A 2VH0A 2ZU5A 2R9PA 4JZFH 2CGAA 5T6DA 3UPEA 1S83A 1TALA 4CH2B 1QQ4A 3RXPA 2FOGA 1F0UA 5B6OA 5DK1A 1O36A 1OOKB 5LPRA 3ZZCA 2J92A 3MH4A 2FOEA 3M7UA 1WV7H 3HK6B 4GHTA 4LZ4B 4FUEA 4X8SH 3ZVCA 2ZI2H 3Q76A 3BTGE 1GJCB 4J2YB 1ELBA 2FTMA 4X2VA 1KY9A 2P93A 1LMWB 3MH5A 1RRKA 4BNRA 4D8NA 3HPTB 2OP9A 3PMHB 1XUKA 2AGGX 1KYNA 2Y7ZA 4Q7XA 1NRSH 3U8RH 1P2MA 1TMTH 4JZDH 1QA0A 1TNLA 5DP8A 1Z8RA 1TYNA 3ELAH 3GY4A 1QA7A 3SUDA 4HZHA 3RXOA 1O2TA 1Y3WA 1O3IA 1KLJH 5C3NA 3RC6A 4OS2A 1GBLA 2C93B 3S9AA 4WH8A 1NU7B 3A7ZA 1BB0B 2OC1A 1OSSA 1NY22 1PPZA 4Z0KA 2H9HA 4CR5A 1O2LA 4ABJA 1HAOH 2Z7FE 1C1TA 1ZMLA 1O38A 3PV4A 3ZVDA 4Q80A 3I77A 1WU1A 3SOSA 1FY4A 2ZECA 3VEQB 1O3BA 3SORA 5E2OA 2GCTC 1C4V2 3LC5A 2WYJA 5DGJA 3V0XA 1O3MA 4INLA 1A0HB 1A5HA 1CHGA 1SL3A 3D65E 1B0FA 4K60A 4ZHLU 1AGJA 3A87A 1W11U 1UVTH 3UNQA 1QR3E 1HAHH 1QBOA 2TGDA 1UVPA 2M5TA 1ZTKA 1GBAA 4E05H 2G5NA 4O3TA 2VGCC 3TITA 1D3DB 2CXVA 3PO1C 2CV3A 1C9PA 1WUNH 4CHAB 3SGBE 2Z9IA 1FUJA 1O5AB 3HK3B 7ESTE 2HWLB 2RA0A 1IQGA 3O8BA 3TK5A 2P3UB 1N8OB 1VJAU 4YESB 2A31A 2VIWA 2A4RA 4R0IA 2C3SA 2WV4A 1TMUH 3P92A 3OSYA 8KME2 1P05A 1C2HA 2FP7B 1TA2A 3I29A 3G01A 2SNVA 1MTUA 4CH8B 4MG3A 1LPKB 1DFPA 4NZQA 5H4IB 5AVDA 1P2IA 3TH3H 4AFZA 1EOJA 4K5ZA 4ZHAA 5LH8A 1LHCH 3BSQA 2PSXA 1T4UH 1BTWA 3LGWA 5C2ZA 1K21H 4Y8ZA 3RU4E 2UUJB 1TWXB 1SLWB 2ANWA 2QXIA 4WY3A 1LO6A 1DS2E 1C1UH 1VGCC 3QTOH 1SPJA 1NESE 1DLEA 1KTSB 1GHXH 3VXEH 1HDTH 2V3HH 4AOQA 1ZOMA 4HFPB 2ODPA 5T3HA 3EA8A 2Q1JA 5EQSA 3U8OH 2PGQB 3RXHA 2EI8A 1WTGH 1MTNC 4OS5A 1G37A 1QNJA 1ZGIA 1JMOH 4FU7A 4FVDA 3RXVA 4Y76A 3S7KB 3BTDE 4D7GA 2H9EH 1NS3A 3ZZBA 2QF0A 3U9AH 1NROH 4O03A 2FOHA 1ZRBA 1SHYA 1SGYE 1V2ST 2Z9KA 2PSYA 1UTLM 1IQNA 2EEKA 1F0TA 3ATMA 1OYQA 3KEEA 2HPQH 2G81E 4FVBA 1AKSA 1CVWH 2Y6TA 5EU8A 4Y0ZE 3MU8A 4BXSA 2H6MA 4ZKSU 3UFAA 1ANEA 1XKAC 4FUGA 4FUCA 2FYQA 5A8XA 2Y81A 1C5WB 4H42U 1ZJDA 1XVOA 1DY8A 3OTJE 1TBZH 2SGEE 3RMLH 3BEUA 3TU7H 1LQDB 1EUFA 5G4BA 3ATWA 3CP7A 3ATLA 1SGCA 1XVMA 1GWAA 4DY7B 1CGIE 1PPFE 2GCTB 3PROA 4A1TA 3L3TA 4FUFA 3LH3A 1TQ0B 1IQJA 1V6DA 3S9CA 5DG6A 3LGYA 3M5OA 5DP6A 4Z6AH 2ZU3A 2ZCKP 3GISB 1INCA 1FMGA 2ZTZA 1PQ7A 5EXLA 2XC4A 4IMZA 2VGCB 2A5KA 3PO1B 2BXUH 1L1JA 2OXSA 4CR9A 2DUCA 5GCHG 1THRH 2ZHDA 2BYAX 1UTMA 2R2WU 3A7XA 3B9FH 4WWYA 1G2LA 3QO6A 4NCYA 2HVXA 1TGSZ 2FWWA 1TBRH 3RXQA 1EOLA 4Y11E 2ZDNA 3GYMA 1BMMH 1E36B 3BG4C 3SU1A 3E6PH 1C2IA 2PTCE 1P2JA 7GCHG 2PWXA 4NG9H 1DUEA 1JXPA 3MNBA 1XX9A 3FANA 4CRGA 2F9OA 5K7RA 2ODYB 1DE7H 2BDHA 2LNCA 3UWIA 3A7TA 3MI4A 5T6GA 4WH6A 5HGGA 3LGUA 5JBTA 3S9BA 2VVCA 3FFGA 2A32A 3R0FA 4KTSA 4D9RA 3ZZ6A 2ILNA 3QN7A 5JBBS 1VGCB 2XBYA 1O2IA 3TNTA 1O3EA 3STJA 2VWOA 4FUJA 1O30A 3GY7A 3PB1E 1EAUA 1PPEE 1AB9C 1SOTA 3MNSA 3ZVBA 3ZVAA 1A46H 2BLQA 2FI4E 4I8GA 3TNSA 4XFQA 1FONA 1MTNB 5C5NA 1E35B 3P8NA 2V0BA 2O8TA 2D8WA 1FAKH 7KMEH 1G2MA 1ZGVA 4JMYA 2KAIB 1VITH 1AMHA 4DT7B 3W95A 1UTJA 1BTUA 1O2RA 5J4QA 1YGCH 1QBNA 4U2WA 5EQRA 1P9UA 1DWBH 3GDSA 4AYYB 1IHTH 1O3CA 4ZKNU 4Y10E 4X2YA 1HPGA 1C1QA 2XWAA 3HKIB 1VCWA 1NRNH 2PW8H 1HB0B 2JETC 4A7IB 3GOVB 2GT7A 5GIBA 1TABE 3VB3A 2ZG0H 3BEIB 5C67A 1GMDG 1Z6EA 1TIOA 1P06A 1ZRKA 3LU9B 4UONA 3DFJA 1BRCE 5FCRA 3A84A 3TVJB 5E8EH 1LKAA 1O2YA 3NXPA 1EPTC 3U1JB 1YM0A 2ZFTA 2VU8E 3A81A 1NT1A 4X1PU 1O5DH 1GL1A 1X7AC 3SNCA 2ZPQA 1CQQA 2OC8A 2WPLS 3T25A 2CF9H 1YPHE 2ZZUH 2Z94A 2GD4B 2GV7A 1SGIB 1EJAA 5L2ZH 3M7QA 1YCPH 5C1YA 2OC7A 3SGAE 4B73A 5AF9H 2ZQ1A 2A4QA 2BD7A 3TH2H 2AMQA 3Q3XA 3TH4H
chains in the Genus database with same CATH superfamily
2ANYA 2XBWA 1QRZA 1EFRD 2BZAA 1GGDC 4YOIA 2ZFSA 3F1SB 3F9GA 4CRAA 3M3VA 1C2EA 4JK6A 1QZ8A 1PPGE 4NWKA 1BMNH 2AYWA 3TK9A 1KXEA 1G30B 4ISOA 3M5NA 4NIXA 4AN7A 2BB4A 3FZDA 1AVXA 1FJSA 3BV9B 3STIA 4XSKU 4ZROA 3LJOA 3TJUA 1CSOE 2RFKC 4IMQA 3RXBA 3KQCA 3O8CA 1T7CA 2B0FA 1COWD 2AGIX 3T27A 3ZV9A 4GUXA 1A61H 2J2UA 3V3MA 3UQVA 1CO7E 2FODA 1TA6A 2YMSD 4NIWA 1BIOA 2BZ6H 1MH0A 3BG4B 4GHQA 5LPEA 1BJVA 1TFXA 1GHYH 3RXRA 2O8MA 2WINI 4BAHB 1UVSH 4RT0A 1BTXA 1Z6JH 1EAIA 4INKA 3SV6A 2A45B 3OU0A 1FI8A 3MU5A 3A8DA 1C4Y2 5C1UA 5HIZA 1AFEH 2ZCLP 3M36A 4Q63A 3E0NB 2ZFPH 1QRWA 4X6OA 4MPXA 1OP8A 1A7SA 1E1RD 1GCTB 2ULLA 4YO9A 2BD8A 4YOGA 1D3QB 1FPCH 2OBQA 1AZZA 1TLDA 3ZIAD 2F43B 1AB9B 1O3FA 3FVFB 2R0KA 4JZEH 1JWTA 1C5TA 1KXAA 3A80A 1Z1IA 3EAJA 3ODFA 2KCOA 2Z9LA 4DJZB 3OTPA 2F9NA 4Q7ZA 1NBME 2V6NA 2YNAA 1TGBA 3EE7A 5A8YA 1D6RA 1G3BA 1ZTLA 1ESAA 1MMJN 2PR3A 1ESBA 2VWNA 3H7OA 3KQBA 4J1YA 1F0RA 1HAIH 1LKBA 2HGTH 1PYTC 3SUGA 1O2HA 1ZHMA 1P2KA 1O3GA 3S7HB 2G4TA 4H6TA 2STAE 3SNEA 1C1RA 1GMDF 1T8NA 1W13U 1L0ZA 4NWLA 2BDGA 4LK4A 1EPTB 3KQDA 3RMOH 3RMNH 3RC5A 3DFLA 2AERH 4IGDA 5J4SA 2KX4A 1SGFG 1ZZZA 1LCYA 4WJG2 2ZQ2A 3P6ZB 5IDKA 1BTYA 1G9IE 3UR9A 4TSFD 2KCPA 3MNXA 5EJZA 2ANKH 4OGXA 3BEFB 1V2RT 1TMBH 1GI9B 1DSTA 1HAVA 3M5LA 1J14A 1QJ6B 4AG2A 1UCYE 2CJIA 4XDEA 4XOJA 2ASUB 1RTLA 3VB6A 1KIGH 1RGQA 1ZPBA 5EW2H 5C1XA 1CGHA 4ASHA 2HPPH 1SQOA 1DANH 1K1MA 1V2PT 1XXFA 1NFXA 1QURH 1LVYA 3LGTA 1GCDA 2VVVA 1BHXB 2H9TH 1SR5C 1MU8B 1ZPZA 2NU4E 5FBEA 5AHGH 5F6MA 3OY6U 2FZZA 2P94A 3ZYEA 1HAZB 2QCYA 1SGNE 2GZ7A 1HJ8A 1C2FA 3L6PA 3ZVEA 1N8OC 3UOPA 2BD2A 2TIOA 3F6UH 5LGOA 1S6HA 1E38B 4B1TA 2ZPSA 1RTKA 3UUZA 4X1SU 3SNAA 2JH5D 2QXHA 1C5ZB 2EI7A 2BD9A 1GBMA 2ZDLA 1CBWC 3LGIA 3V13A 3BTEE 3V7TA 1UCYH 3LGVA 4OS1A 1SOZA 2FS8A 2HRVA 2BXTH 4MNWA 1BA8B 1SLUB 2NU1E 4XD7D 4ABGA 1P04A 4SGAE 2VWLA 2FI3E 4FU8A 1BT7A 5EPNA 1BMLA 2BD5A 5DN6D 1C2KA 2WPMS 3DCLA 3QDZB 1A3BH 1JBUH 1UTKA 1IQEA 2VIQA 3TIUA 2OQUA 2IOTA 2C8YB 1SFIA 2XC0A 3MFJA 3QUMP 1GI8B 1L1NA 1AFQC 1XM1A 2J98A 4UDWH 1VCPA 2XYAA 1DWEH 1GI1A 1O2XA 2QAAA 1C5SA 1CT4E 2BLOA 2FOMB 2VIOA 1B5GH 1LVOA 3LKWA 2UUKB 4AFQA 2FI5E 1J16A 1GJ6A 3DT0H 3ENSB 1VR1H 2PHBA 4GSOA 5C5OA 1HYLA 1KXCA 1O3JA 5JB9S 3RC4A 2WPJS 4Z1MD 2QF3A 3BTME 5HMAA 4TWYA 2BD4A 3KYFA 2ZDKA 1MD8A 5LPFA 3PV5A 5EJLA 4TPIZ 4X2XA 1LPZB 3RM0H 2A5AA 3KHVA 3LOXA 1ZPCA 3SU6A 2SGAA 3V12A 1O5BB 5EW1H 3SUFA 5JYIA 4JCNA 3UY9A 1DUAA 1SQAA 1Z8JB 2QY0B 3SJKA 1BTPA 4BAMB 1B0EA 4ZUHA 1EX3A 1K1LA 2XC5A 1EJNA 1DT2A 4WMEA 3RUOA 1WSSH 2FOFA 3SNBA 1BJUA 2H1UA 2G5VA 2GDEH 4BTUB 4ISIH 1GL0E 1GHAG 3CS0A 4Y79A 1BMAA 2PV9B 1GJDB 2BLWA 3A8BA 2R0LA 1OPHB 4NGAH 4X6MA 1V2TT 1U6QA 3QWCH 2CF8H 1EAXA 4B71A 2PUXB 5DJ7A 4A1XA 2FPZA 1GBBA 4FUIA 2ZCHP 4X8VH 3Q77A 1MAYA 1C5LH 1RS0A 1C5NH 3Q00A 1VITG 3PMJA 1DOJA 4QT8C 4Y71A 2XTTB 1H8ED 2FO9A 1N6XA 2D1JA 2Z3DA 2BY8X 1IHSH 1CBWB 1FNIA 3GY2A 4LXBH 3SW2B 1OWKA 2C90B 2WPIS 5EOKA 3CNRA 1PQAA 3E8LA 1SGPE 4KKDA 4AZ2B 3NUMA 1ANDA 1YLNA 1BRBE 1QL9A 1TX8A 2A5IA 1GI0A 4M7GA 3SJOA 3UAIC 1MBMA 1C1VH 1G3EA 1O35A 1EZSC 2W26A 3MO6A 3SI3H 2QF4A 1C1MA 2ZF0H 1C5UA 1V2UT 4UFGH 2L74A 3E0PB 1UJ1A 2CMYA 1KLTA 3D49H 5FBIA 4GPGA 1HGTH 1GJ8B 4GAWA 1YC0A 4BTTB 1IQIA 2GZ9A 6CHAC 1C9TA 1NM6A 3LPRA 4JYVH 1PPHE 1XXDA 6LPRA 3AASA 1S84A 3LIWA 1AFQB 1O2JA 1Y59T 1P57B 3F0PA 4D76A 3PLPA 5C20A 3MWIU 2ZDMA 4A1VA 1G3CA 1O5EH 5K0HA 1Z1JA 1SGEE 3AAVA 1WOFA 1S5SA 1GBFA 1N1LA 5GJ4B 2NU2E 1NRPH 2JIZD 5A0CA 2TPIZ 2V35A 1QY6A 4UFDH 1IQLA 2ZGCA 3NPSA 4TWWA 2A7CA 4RKJB 1OXGA 1BMFD 4BOHA 1EASA 3A89A 1SQTA 2OBOA 4TPYA 1SLVB 2C8XB 3P8OA 1YPLH 1L2EA 2SNWA 3QGJA 3DUXH 1UK4A 2J4IA 1SLXB 2HVYB 2FEQH 2KR7A 1LHFH 1A4WH 1Q2WA 2GV6A 2VJ1A 3F68H 2BQ7B 3M37A 1W8BH 4Q7YA 4CRBA 4AORA 3SI4H 1PYTD 1W3CA 3AW0A 1O3OA 1KTTB 4ZH8A 1O3LA 1YBWA 2A4GA 2P3TB 3RP2A 4B76A 1PQ8A 3E1XB 1O37A 1AE8H 3NCLA 1HAYB 1C2MA 1ELFA 5ESBA 3BG8A 2PKSC 2D2DA 2G8TA 3KIDU 1GI4A 1L1GA 1ETTH 4AGJA 1AO5A 2D26C 5IYTA 2WV9A 4KTUA 3OFND 1YPHC 3SNDA 1O33A 1GBEA 1TX7A 2J94A 4ESTE 4O3UA 1Y3XA 1ELAA 3S0NA 1UTPA 3F2GA 3TJVA 1CHOG 3TGKE 4AYVB 4E7NA 1ZR0A 1YCPK 1H8DH 1E1QD 3BIUH 5T6FA 3ZZ5A 1GHAF 1BITA 1QJ7B 1TPSA 3E91A 5F8XA 1TGNA 1TRYA 1GI2A 1C5RA 2G55A 2ZWLH 1O2SA 1FLEE 1GDQA 3AVZA 2GMTC 1T8OA 2J38A 1Z8IB 4OS6A 1GDUA 1ARCA 4E06H 4DT4A 1UO6A 3MU1A 1HAXB 3GICB 3F9HA 1QL8A 1IAUA 1P2QA 1VITF 4FUBA 2O8LA 2J9NA 1ZYOA 4K1EA 2CHAB 1WCZA 2G52A 1EP6A 5EG4A 2F9VA 5A8ZA 3C27B 4GLYA 4K8YA 2A4OA 4XBDA 3T62A 1P11E 3M35A 5E0GA 5JPMH 2HNTC 2ZP0H 2JKHA 2XNDD 1SQRA 2BDAA 1FY8E 1ORFA 3K65B 4OM9A 1Z71A 1P02A 1KXBA 1TNHA 1GCTC 1BOQA 2XBVA 3ATIA 5A09A 1GBKA 1LQEA 4B6FA 2QYIA 6CHAB 1TX6A 3RXMA 5L30H 1TRMA 3FAOA 3NK8A 5CE1A 1OWJA 1ZSLA 3GCOA 2KAIA 1BQYA 4CRDA 2G4UA 3SV7A 1QRXA 5I46H 1ZSJA 1ANCA 1S85A 1UTNA 1AN1E 1MAXA 2F9PA 4M9FA 3P8FA 4ZCNA 2PFEA 3JZ2B 4I31A 4BANB 4AB8A 2PP6A 5EPYA 3ZZ4A 3QLPH 1Y3VA 1P09A 2NWNA 1LPGB 3RU4D 8LPRA 2GDDA 3BN9A 3LJJA 1LVMA 3PWBA 2IJOB 1TQ7B 1Z7KA 4IS5A 3GCNA 5F03A 2FX6A 3KGPA 3SV8A 4DURA 1Y5BT 4XE4A 3L33A 4X8TH 3VB4A 2GX4A 1A0LA 1EXFA 2J5UA 1DITH 2ZFQH 3SU4A 1ZTJA 2ZKSA 3EDXB 4YZUA 1AWHB 2FLRH 1GVZA 4ZAEA 3RXLA 2BQWB 3W94A 1MKWK 1YF4A 2VB0A 1BDAA 2LP6A 3PMBB 3PWCA 4KGAA 1T8MA 2AHME 3WWFA 2OD3B 3SV9A 4B2BA 1NRQH 1ANBA 1TE0A 3AAUA 1C5VA 1D4PB 5B6LA 1BCUH 1W7GH 2ESTE 2FLBH 2PKSB 2WUBA 3TGIE 2P59A 1CT2E 4Y8XA 3GY5A 3DA9B 4D9QA 6GCHG 5E0HA 1T8LA 3VG8A 3P70B 3RXCA 2WZQA 4PROA 4X1QU 1JIRA 4U01A 2OUAA 2IN2A 4AB9A 3TLOA 1HAGE 4K3JA 4ZHMU 2F4LA 2W3KA 3IG6B 4MQAA 1C2LA 1CHOF 1SFQB 2NU0E 1CGJE 3MYWA 2FX4A 2BTCE 1NC6A 2GTBA 2GMTB 2W6JD 5FX6A 3SU5A 4UFEH 3I78A 2I6QA 2BDYA 2ZU2A 3AW1A 3UIRA 1IOEA 1C1PA 1RJXB 1RIWC 1OHHD 2A1DB 2PKAA 3DSPA 3FZZA 1G32B 3QTVH 2BOKA 3KCGH 1K28D 1Y3UA 1ESTA 3LT3A 4KP0A 1C1NA 4E7RG 2WHXA 1GBTA 1SGTA 5GXPA 4DGJA 1CA0C 1S0QA 3RDZA 2ZHQH 5ETXA 2QXGA 9LPRA 1GMHG 1A3EH 2VBCA 1SHHB 1W10U 3HGNA 1PPBH 1T4VH 3D62A 4I8KA 4JZIA 3CS7A 1FY5A 1UW7A 4A5TS 1ELEE 4BXWA 1UHBB 1TAWA 2ZGJA 3HKJB 3O8DA 2WSSD 4IC5A 1UCYK 4VGCB 3E3TA 1V2JT 1H1BA 4IW4E 2Y5GA 1HAPH 1OYTH 1O3NA 2HALA 4ABDA 1DM4B 2AH4X 4ABFA 2B7DH 1WQVH 1DWDH 2P3FH 1P8VC 4B74A 4WXVA 3ZV8A 1WQSA 3E16B 3Q3YA 1MQ5A 1DPOA 2ZNKH 3A82A 1TBQH 3RXEA 4RN6A 1PQ5A 4SGBE 4AFUA 1CE5A 1QBVH 2BY7X 1FQ3A 1FY3A 1YPKH 4X2WA 3WW7A 1NRRH 1KDQB 2GP9B 1NTPA 2BDCA 1OWDA 2Z9JA 4YT6H 1EPTA 1M9UA 1W0YH 1THPB 1ZJKA 4WMFA 3RLYH 1GJ9B 5AFYH 1MQ6A 2J97A 1UVOA 2UWPA 3GDUA 4AGKA 3T2NA 4F4OC 1C1SA 4I8LA 3UTUH 4JYTA 1K1OA 2FMJA 1HLTH 2ZDVH 1GBJA 4ZKRU 4DG4A 3BTKE 4Y8YA 5HYOA 3H5CB 4ZXYH 4ABHA 5CDFE 1F0SA 2EC9H 3D23A 2FS9A 3U1IB 1EQ9A 1MCVA 1SKYE 4UEHH 3RXUA 5GWZA 1TNIA 1JIMA 2ZFRH 3LC3A 3MOCA 5FL7D 1AUTC 3EGKH 1EP5A 2F3CE 2PLXA 1IQHA 1O2PA 1IQKA 4Q2KA 2KCYA 1V2KT 5TCAA 5HIYA 3A8AA 3SJIA 1MABB 3RXSA 2AS9A 2ZGHA 4ABBA 6GCHF 5GPIB 2OINA 4I86A 4Y0YE 1BTHH 1FPHH 5HXFA 1TOCB 5C94A 4MPUA 1UK3A 1GJAB 2WPHS 1NPMA 1O32A 1GHBG 3SBKA 4MNYA 4I32A 1FX0B 1K0HA 3UR6A 1HIAB 2P8OC 4WVPE 3MHWU 1O31A 1ETRH 1JOUB 2BY9X 1ZMNA 2BLVA 1AIXH 5DSFA 2H5DA 1H8IH 1RIWB 3QZRA 1P01A 2FDAA 5A0AE 1MCTA 2FIRH 1V2MT 1V2OT 3KN2A 1F92A 2AGEX 4TT3D 1V3XA 2V3MA 1O34A 1YYY1 2SGPE 5BRRE 2RA3A 2FTLE 1BBRE 3RXJA 3CENA 4F55A 1CA0B 2JH6D 5F8ZA 4INHA 2LELA 2QV1A 1CT0E 3K9XB 4JZ1A 3MH7A 4UE7H 4Y7BA 4Y6DA 2F9UA 1D3PB 1ZLRA 1XUHA 1TOMH 5I25A 3F9EA 3ZVGA 2Q6GA 2UUYA 2O8UA 5HM9A 1F5RA 1GMHF 1W2KH 3KF2A 1ELGA 1AWFH 1RTFB 1QB1A 1MKXH 2ODQA 1V2QT 3P8GA 2VNTA 3SU2A 1HJAB 1GI6A 1VCQA 2SGQE 4ISLA 5C17A 3MU0A 5DPAA 4I7YH 4CRFA 4LZ1H 2YNBA 5EODA 1UMAH 1TPOA 3B8JA 3PMAB 3NRLA 5A2MH 3HGPA 2ZFFH 1HV7A 5F8TA 1P2NA 1HXEH 5GDSH 3ZZ9A 3TK6A 2CK3D 2EY4C 1O2VA 3LDXH 2ANMH 1BBRH 5L6NH 4DOQA 1QB6A 4RSPA 4MLFB 3UQOA 2J95A 1GBHA 1V2WT 3N7OA 1J15A 4THNH 2ZHEH 2XW9A 2GCHG 3A7WA 4MVNA 1AQ7A 4X1NU 1L4ZA 1F5LA 2M2AA 1P12E 3PRBA 4XBCA 3SO3A 3BF6H 1WXRA 2Y82A 4UD9H 1O3KA 4DIIH 1J17T 1YLCA 3FN8A 3K6YA 4FUHA 3F2FA 2Y7XA 3SN8A 3SGQE 1NBMD 4XBBA 2BVXH 2A2QH 5DP7A 2AEIH 2XNIA 4NZLA 2XBXA 3QX5H 2FOAA 3ZZDA 4UFFH 4YM9A 2HLCA 2Z9GA 3R3GB 1SGFA 1GHZA 1H8HD 1S81A 4MPWA 1MTWA 2ALVA 5FPSA 4FOUC 3Q3KA 1C5OH 1QQUA 4JYUH 2V7QD 4O97A 4B6EA 1P0SH 1THSH 1O2WA 1GVKB 1TPAE 3ITIA 1N6YA 1P9SA 4BTIB 1D9IA 3U28C 4ABEA 1EB1H 3FOAA 3A8CA 1ZHRA 3VB7A 2UWLA 1GBIA 1WAYB 2WPKS 5EQQA 2Q6DA 1K1JA 2P8OB 1GHBF 1H9HE 3ATKA 2CHAC 2BOHB 2P16A 2AMDA 2O8WA 1RD3B 2H5CA 4GCHF 1HXFH 1GHVH 5ESTE 4CBNA 2GKVE 3U8TH 1F2SE 3LH1A 2SGDE 5JB8S 1BTZA 1EJMA 1YPMH 3PTBA 3SQHE 1ABIH 3GDVA 3UNRA 1J8AA 3RXDA 1C2GA 5DKMA 2G51A 1FDPA 4HI3A 2RDEA 2QA9E 2STBE 9ESTA 3PTNA 1MZAA 2Z3EA 1FN8A 1O2MA 2GVFA 2UUFB 4MTBA 1D3TB 1FIZA 3RM2H 1DX5M 2SGFE 3MNCA 4HTCH 3GY3A 2LPRA 4DCDA 2ZHFH 1O3AA 1QIXB 1Q31A 4A92A 4X6PA 1A5GH 1T32A 2BX3A 2QGRA 2TRMA 4X0WU 3TJNA 3M3SA 2PUQH 1BUIA 2ZDAH 1NZQH 1O2GH 2THFB 3SYJA 1MU6B 2A7JA 4R8TB 2BY6X 2VIPA 3P95A 1O2UA 1O5GH 2OC0A 4H4FA 1G3DA 2F9BH 3NWUA 5KECA 1HNEE 2ZTYA 3RLWH 3EE0B 4WXIA 2Y80A 4ZMAH 1UTQA 1EKBB 2NU3E 5C0TA 3MMGA 3LONA 3B23B 2KCAA 2VINA 4K8BA 4BAOB 3IITA 1TGCA 2GGVB 3F9FA 3S69A 4ASUD 1VZQH 1UK2A 1AU8A 3EA9A 3F3BA 1AKSB 1O3DA 3ZYDA 1GMCG 1LHEH 2GCHF 2QF5A 3OYPA 2BVSH 3RXFA 2ALPA 4AFSA 1C4U2 3F2HA 5FXLA 4ZXXH 4Y7AA 2TGPZ 1K1IA 5EGMA 2RCEA 1MBQA 4ISHH 2JH0D 1ELTA 4K1SA 5FHTA 4NFFA 4LOYH 4NFEA 2OK5A 1MD7A 2BMGB 1KXFA 1O5CB 4U32A 1HJ9A 3UB0A 3W1EA 3GYLB 2K1QA 1BRAA 2BDIA 3EYDA 5FX5A 1EAWA 5F53A 1W0ZU 2HLDD 2AMPA 4NA7A 3SQEE 2WV5A 3TJOA 1FY1A 1BZXE 1DXPA 1P2OA 1E37B 3BIVH 1CA8B 1AD8H 2KZ4A 2BQ6B 2O9QA 3BTWE 5BPEA 1QB9A 2AFQB 5PTPA 3KNXA 1RXPA 5EXMA 1PFXC 2Z3CA 4FETA 1C5YB 1C1WH 3MO9A 3A83A 1C5MD 1YP9A 1AE5A 1NFUA 2OCVB 1TNGA 3H7TA 1GBDA 1YCPM 5HKKD 1ABJH 3URDA 1AVGH 4WF8A 5FPTA 1DWCH 3DSOA 1C5XB 2KM0A 4P00A 2GZ8A 2IJD1 3OX7U 4ABIA 2VIDA 2OLGA 3VFEA 2B5TB 1W7XH 5JBCS 2GT8A 2ZEBA 1O0DH 4MNXA 1H4WA 2L6OA 2FXRA 1FN6A 1O2ZA 3RMMH 3U69H 4AG1A 4YT7H 1GJ4H 2W7UA 1SVPA 2OTVA 2A2XH 3C1KA 2VVUA 3U98H 3MU4A 1CU1A 1NO9H 1TNJA 4P02A 1P03A 2G00A 8GCHG 1E0FD 2WYGA 1HCGA 2UWOA 3NKKA 1OWHA 5TJXA 5KEDA 2ZPRA 1NFWA 1TRNA 4I33A 4VGCC 3BTFE 1S0RA 2AIQA 3PLKA 1D6WA 1NFYA 1F7ZA 5EIYA 2ZC9H 1K1PA 2WPDD 2XRCA 5E0JA 3O8RA 4X8UH 1TPPA 3ZZAA 1HBTH 4FUDA 4NSVA 1Y8TA 1SGRE 1SGQE 4TY6A 1S6FA 2ZIQH 3ZZ8A 2F91A 1SMFE 4DW2U 5JDUB 4A6LA 1GDNA 1EZQA 4NSYA 3T5FH 2BX4A 3UOUA 1DY9A 2RDLA 2VWMA 1O2KA 2XCNA 3K2UA 3WY8A 1IQMA 2ZA5A 1QCPA 1J9CH 1TNKA 5T1VA 1KSNA 1L4DA 3M61U 5DO4H 5HM2A 3VB5A 4H6SB 3ZVFA 2TGAA 2Z6BD 2Y5HA 3ZZ3A 3T29A 1V2NT 2W3IA 2C8WB 4CREA 1BRUP 3GCTG 1GG6C 1ELCA 1Q3XA 3ODDA 4RKOB 3SZEA 1C1OA 1DXWA 2QXJA 1ZMJA 1XKBC 3GCHC 2XWBI 3P17H 1FIWA 2RG3A 3JZ1B 1P3EA 1ARBA 1LVBA 1OKXA 1MUEB 3K6ZA 4NA9H 1K22H 4BAQB 1JRTA 4TY7A 1IQFA 1ELDE 2R2MB 1XMNB 3BTQE 1DDJA 1GMCF 1GI7B 4OGYA 3T28A 2AIPA 1MTVA 4OS7A 3ZZ7A 2FOCA 3IWMA 3SU0A 1DLKB 1NN6A 2IPHA 1AHTH 2DE9A 1AY6H 2C4FH 1OWIA 3TPIZ 1ZSKA 5CHAC 2FESH 3M3TA 1QTFA 1XUIA 3SJ8A 2DE8A 3BTHE 3GY8A 4B2AA 1YY3A 1C5QA 1S82A 2QIQA 2PGBB 2ZO3H 1YPGH 5JBAS 3SHAH 1VJ9U 4WMDA 1UTOA 4KTCA 4IC6A 1P10A 1T31A 5ABWA 3HATH 3SU3A 1OS8A 2VH6A 2J34A 3QZQA 4MNVA 7LPRA 1Y3YA 2SFAA 1AI8H 3OAAD 1QFKH 4F49A 4CRCA 4Q4LA 1LDTT 2B9LA 3RXTA 1WBGB 2QN5T 1YPJH 1SSXA 3MTYA 3EA7A 1DSUA 1B7XB 1OP0A 3PLBA 2W5EA 3FP8E 2OQ5A 5GNDA 3SV2H 4NIVA 3A88A 1RFNA 3OY5U 2HNTE 3WWBA 3BTTE 4AX9H 4HG6A 5GCHF 1NU9A 1O3PB 2BVRH 1XUJA 2HNTF 4K1TA 2ZGBH 2CN0H 2K0QA 2WUCA 1K9OE 3VGCC 1SB1H 1GHWH 1C2JA 1EB2A 1PPCE 1Y5AT 6ESTA 1Z8GA 3GY6A 1UHBA 5EXNA 4YOJA 2PKAB 1A2CH 7GCHF 1MTSA 2BY5X 1FAXA 8GCHF 4MDSA 4MPVA 2JJ1D 1GI5A 3QK1A 1GJ7B 1HJAC 3QGNB 4ABAA 3DD2H 4OS4A 4B2CA 4YTAA 2H2ZA 4K69A 1O5FH 1EATA 2EA3A 1A5IA 1ETSH 3A86A 3PM3A 1C5PA 4BAKB 3UREA 5DP9A 1AZ8A 2XXLA 4RI0A 4I8JA 4NIYA 3KQEA 3M5MA 2I6SA 1V2VT 4O9VA 1Y5UT 3SZNA 3MO3A 1LTOA 1ACBE 1FZZA 1W0JD 2YOLA 1GPZA 2B8OH 2P95A 1QHRB 1GVLA 1KDQA 1MKXK 1GBCA 3DHKH 4FU9A 2BD3A 1A1RA 4CBOA 2V3OH 1ELVA 1QL7A 3A85A 4DVAU 1KXDA 1YLDA 2ZGXH 2Q6FA 1GG6B 2FYRA 2R3YA 2ZU1A 1F5KU 4ZKOU 4FXGH 3KL6A 1LHGH 1QGFA 5E2PA 1W12U 3RXGA 4ISNA 1K2I1 3GCTF 2ZHWH 2PTNA 4YXWD 3GCHB 1MKWH 1O2NA 1WYKA 3UNSA 2JETB 1E34B 2TGTA 4IN2A 4NA8A 5DP4A 1DICA 1EZUC 2TBSA 4I8HA 1YPEH 2KFWA 3RXIA 2FM2A 1BBRK 3MH6A 2QC2A 1ZHPA 1GJ5H 5DP5A 1ID5H 1O39A 4X1RU 3URCA 3OEED 4XRNA 1AUJA 1TONA 4D7FA 5SGAE 3AK5A 1FXYA 1MZDA 5DP3A 8ESTE 1UVUH 2ZTXA 4HGCA 5CHAB 1BHXF 3E90B 1SI5H 4DIHH 1C2DA 3ESTA 1EZXC 3M7TA 2HOBA 2EI6A 4IBLH 4GVUA 1H9LB 1O2QA 1HAVB 2C8ZB 1E79D 1JRSA 3NZIA 1GI3A 3UWJH 1HFDA 1KLIH 3EQ0H 2A0QB 4X6NA 4YLUA 1GGDB 1O3HA 5FPYA 3SJ9A 4K2YA 1SC8U 1XUFA 5FCKA 2A7HA 1WTHD 1OX1A 2Y5FA 3FP7E 1HIAA 5AFZH 3RXAA 2ZU4A 2JDID 1TB6H 3FP6E 1H9IE 5FAHA 1K1NA 3PYHA 3RU4T 4CHAC 4GCHG 1W14U 1OP2A 1HRTH 1QJ1B 1OWEA 3SUEA 1AVWA 2BDBA 1PJPA 3T26A 2XCFA 3VXFH 1A0JA 1G36A 4B75A 3TGJE 4YLQH 3SHCH 1TGTA 1XUGA 2R3UA 4KELA 1YKTA 1SG8B 5TCCA 1O2OA 2BHGA 2BM2A 1P3CA 3VGCB 3OEHD 2W7SA 2FOBA 2F83A 5A0BA 1SBWA 1LHDH 2VIVA 1V2LT 1GJBB 3A7VA 3A7YA 1SGDE 5L2YH 1FV9A 1WDIA 4JK5A 3RXKA 4U30A 1HUTH 3VPKA 4TYDA 5CMXH 1DVAH 4IN1A 2VH0A 2ZU5A 2R9PA 4JZFH 2CGAA 5T6DA 3UPEA 1S83A 1TALA 4CH2B 1QQ4A 3RXPA 2FOGA 1F0UA 5B6OA 5DK1A 1O36A 1OOKB 5LPRA 3ZZCA 2J92A 3MH4A 2FOEA 3M7UA 1WV7H 3HK6B 4GHTA 3F0OA 4LZ4B 4FUEA 4X8SH 1VKYA 3ZVCA 2ZI2H 3Q76A 2J98B 2IPQX 3BTGE 1GJCB 4J2YB 1ELBA 2FTMA 4X2VA 1KY9A 2P93A 1LMWB 3MH5A 1RRKA 4BNRA 4D8NA 3HPTB 2OP9A 3PMHB 1XUKA 2AGGX 1KYNA 2Y7ZA 4Q7XA 1NRSH 3U8RH 1P2MA 1TMTH 4JZDH 1QA0A 1TNLA 5DP8A 1Z8RA 1TYNA 3ELAH 3GY4A 1QA7A 3SUDA 4HZHA 3RXOA 1O2TA 1Y3WA 1O3IA 1KLJH 5C3NA 3RC6A 4OS2A 1GBLA 4ACAA 2C93B 3S9AA 4WH8A 1NU7B 3A7ZA 1BB0B 2OC1A 1OSSA 1NY22 1PPZA 4Z0KA 2H9HA 4CR5A 1O2LA 4ABJA 1HAOH 2Z7FE 1C1TA 4AC9A 1ZMLA 1O38A 3PV4A 1KMHB 3PV2A 4Q80A 3ZVDA 3I77A 1WU1A 3SOSA 1FY4A 2ZECA 3VEQB 1O3BA 2XOKD 5E2OA 2GCTC 3SORA 1C4V2 3LC5A 2WYJA 5DGJA 3V0XA 1O3MA 4INLA 1A0HB 1A5HA 1CHGA 1SL3A 3D65E 1B0FA 4K60A 4ZHLU 1AGJA 3A87A 1W11U 1UVTH 4RT1A 1QR3E 1HAHH 1QBOA 3UNQA 2TGDA 1UVPA 2YMSC 2M5TA 1ZTKA 1GBAA 4E05H 2G5NA 4O3TA 2VGCC 3TITA 1D3DB 2CXVA 3PO1C 2CV3A 1C9PA 1WUNH 4CHAB 3SGBE 2Z9IA 1FUJA 3DSGA 3MQKC 1O5AB 3HK3B 7ESTE 2HWLB 2RA0A 1IQGA 3O8BA 3TK5A 2P3UB 1N8OB 2EQNA 1VJAU 4YESB 2A31A 2VIWA 2A4RA 3N7EA 4R0IA 2C3SA 2WV4A 2K8IA 1TMUH 3FKSD 3P92A 3OSYA 8KME2 1P05A 1C2HA 2FP7B 3PRDA 5C0UA 1TA2A 3I29A 3G01A 2SNVA 1MTUA 4CH8B 4MG3A 3N7DA 1LPKB 1DFPA 4NZQA 5H4IB 5AVDA 1P2IA 3TH3H 4AFZA 1EOJA 4K5ZA 4ZHAA 5LH8A 1LHCH 3BSQA 2JJ2D 2PSXA 1T4UH 1BTWA 3LGWA 5C2ZA 1K21H 1W0KD 4Y8ZA 3RU4E 5IK2D 2UUJB 1TWXB 1SLWB 2ANWA 2QXIA 4WY3A 1LO6A 1DS2E 1C1UH 1VGCC 3QTOH 1SPJA 1NESE 1DLEA 1KTSB 1GHXH 3VXEH 1HDTH 2V3HH 4AOQA 1ZOMA 4HFPB 2ODPA 5T3HA 3EA8A 2Q1JA 5EQSA 3U8OH 2PGQB 3RXHA 2EI8A 1WTGH 1MTNC 4OS5A 1G37A 1QNJA 1ZGIA 1JMOH 4FU7A 4FVDA 3RXVA 4Y76A 3S7KB 3BTDE 4D7GA 2H9EH 1NS3A 3ZZBA 2QF0A 3U9AH 1NROH 4O03A 2FOHA 1ZRBA 1SHYA 1SGYE 1V2ST 2Z9KA 4F48B 2PSYA 1UTLM 1IQNA 2EEKA 1F0TA 3ATMA 1OYQA 3KEEA 2HPQH 2G81E 4FVBA 1AKSA 1CVWH 2Y6TA 5EU8A 4Y0ZE 3MU8A 4BXSA 2H6MA 4ZKSU 3UFAA 1ANEA 1XKAC 4FUGA 4FUCA 2FYQA 5A8XA 2Y81A 1C5WB 4H42U 1S6LA 1ZJDA 1XVOA 1DY8A 5KGOA 3OTJE 1TBZH 2SGEE 3RMLH 3BEUA 3TU7H 1LQDB 1EUFA 5G4BA 3ATWA 3CP7A 3ATLA 3OE7D 1SGCA 5EJ1A 1XVMA 1GWAA 4DY7B 1CGIE 1PPFE 2GCTB 3PROA 4A1TA 3L3TA 4FUFA 3LH3A 1TQ0B 1IQJA 1V6DA 3S9CA 5DG6A 3LGYA 3M5OA 5DP6A 4Z6AH 2ZU3A 2ZCKP 3GISB 1INCA 2YMSB 1FMGA 2ZTZA 1PQ7A 5EXLA 2XC4A 4IMZA 2VGCB 2A5KA 3PO1B 2BXUH 1L1JA 2OXSA 4CR9A 2DUCA 5GCHG 1THRH 2ZHDA 2BYAX 1UTMA 2R2WU 3A7XA 3B9FH 4WWYA 1G2LA 3QO6A 4NCYA 2HVXA 1TGSZ 2FWWA 1TBRH 3RXQA 1EOLA 4Y11E 2ZDNA 3GYMA 1BMMH 1E36B 3BG4C 3SU1A 3E6PH 1C2IA 2PTCE 1P2JA 7GCHG 2PWXA 2GJGA 4NG9H 1DUEA 1JXPA 3MNBA 1XX9A 3FANA 4CRGA 2F9OA 5K7RA 2ODYB 1DE7H 2BDHA 2LNCA 3UWIA 3A7TA 3MI4A 5T6GA 4WH6A 5HGGA 3LGUA 5JBTA 3S9BA 2VVCA 3FFGA 2A32A 3R0FA 4KTSA 4D9RA 3ZZ6A 2ILNA 3QN7A 5JBBS 1VGCB 2XBYA 1O2IA 3TNTA 1O3EA 3STJA 2VWOA 4FUJA 2QE7D 1O30A 3GY7A 3PB1E 3KYGA 1EAUA 1PPEE 1AB9C 1SOTA 3MNSA 3ZVBA 3ZVAA 1A46H 2BLQA 2FI4E 4I8GA 3TNSA 4XFQA 3KQ5A 1FONA 1MTNB 5C5NA 1E35B 3P8NA 2V0BA 2O8TA 2D8WA 1FAKH 7KMEH 1G2MA 1ZGVA 5CHBA 4JMYA 2KAIB 1YWUA 1VITH 1AMHA 4DT7B 3W95A 1UTJA 1BTUA 1O2RA 5J4QA 1YGCH 1QBNA 4U2WA 5EQRA 1P9UA 3FO8D 1DWBH 3GDSA 4AYYB 1IHTH 1O3CA 4ZKNU 4Y10E 4X2YA 1HPGA 1C1QA 2XWAA 3HKIB 1VCWA 3H09A 1NRNH 2PW8H 1HB0B 2JETC 4A7IB 3GOVB 2GT7A 5GIBA 1TABE 3VB3A 2ZG0H 3BEIB 5C67A 1GMDG 1Z6EA 1TIOA 1P06A 1ZRKA 3LU9B 4UONA 3DFJA 1BRCE 5FCRA 3A84A 3TVJB 5E8EH 1LKAA 1O2YA 3NXPA 1EPTC 3U1JB 1YM0A 2ZFTA 2VU8E 3A81A 1NT1A 4X1PU 1O5DH 1GL1A 1X7AC 3SNCA 2W6ID 2ZPQA 1CQQA 2OC8A 3GS9A 2WPLS 3T25A 2CF9H 1YPHE 2ZZUH 2Z94A 2GD4B 2GV7A 4ACBA 1SGIB 3N99A 1EJAA 5L2ZH 3M7QA 1YCPH 5C1YA 2OC7A 3SGAE 4B73A 5AF9H 2ZQ1A 2A4QA 2BD7A 3TH2H 2AMQA 3Q3XA 3TH4H
chains in the Genus database with same CATH topology
2ANYA 2XBWA 1QRZA 2BZAA 1GGDC 4YOIA 2ZFSA 3F1SB 3F9GA 4CRAA 3M3VA 1C2EA 4JK6A 4NWKA 1PPGE 1BMNH 2AYWA 3TK9A 1KXEA 1G30B 4ISOA 3M5NA 4NIXA 4AN7A 2BB4A 3FZDA 1AVXA 1FJSA 3BV9B 3STIA 4XSKU 4ZROA 3LJOA 3TJUA 1CSOE 4IMQA 3RXBA 3KQCA 3O8CA 1T7CA 2B0FA 2AGIX 3T27A 3ZV9A 4GUXA 1A61H 2J2UA 3V3MA 3UQVA 1CO7E 2FODA 1TA6A 4NIWA 1BIOA 2BZ6H 1MH0A 3BG4B 4GHQA 5LPEA 1BJVA 1TFXA 1GHYH 3RXRA 2O8MA 2WINI 4BAHB 1UVSH 1BTXA 1Z6JH 1EAIA 4INKA 3SV6A 2A45B 3OU0A 1FI8A 3MU5A 3A8DA 1C4Y2 5C1UA 1AFEH 2ZCLP 3M36A 3E0NB 2ZFPH 1QRWA 4X6OA 4MPXA 1OP8A 1A7SA 1GCTB 2ULLA 4YO9A 2BD8A 4YOGA 1D3QB 1FPCH 2OBQA 1AZZA 1TLDA 1AB9B 1O3FA 3FVFB 2R0KA 4JZEH 1JWTA 1C5TA 1KXAA 3A80A 1Z1IA 3EAJA 3ODFA 2Z9LA 4DJZB 2F9NA 4Q7ZA 2V6NA 2YNAA 1TGBA 5A8YA 1D6RA 1G3BA 1ZTLA 1ESAA 1MMJN 2PR3A 1ESBA 2VWNA 3H7OA 3KQBA 4J1YA 1F0RA 1HAIH 1LKBA 2HGTH 1PYTC 3SUGA 1O2HA 1ZHMA 1P2KA 1O3GA 3S7HB 2G4TA 4H6TA 2STAE 3SNEA 1C1RA 1GMDF 1T8NA 1W13U 1L0ZA 4NWLA 2BDGA 4LK4A 1EPTB 3KQDA 3RMOH 3RMNH 3RC5A 3DFLA 2AERH 4IGDA 5J4SA 1SGFG 1ZZZA 1LCYA 4WJG2 2ZQ2A 3P6ZB 5IDKA 1BTYA 1G9IE 3UR9A 3MNXA 2ANKH 4OGXA 3BEFB 1V2RT 1TMBH 1GI9B 1DSTA 1HAVA 3M5LA 1J14A 1QJ6B 4AG2A 1UCYE 2CJIA 4XDEA 4XOJA 2ASUB 1RTLA 3VB6A 1KIGH 1RGQA 1ZPBA 5EW2H 5C1XA 1CGHA 4ASHA 2HPPH 1SQOA 1DANH 1K1MA 1V2PT 1XXFA 1NFXA 1QURH 1LVYA 3LGTA 1GCDA 2VVVA 1BHXB 2H9TH 1SR5C 1MU8B 1ZPZA 2NU4E 5FBEA 5AHGH 5F6MA 3OY6U 2P94A 2FZZA 3ZYEA 1HAZB 2QCYA 1SGNE 2GZ7A 1HJ8A 1C2FA 3L6PA 3ZVEA 1N8OC 3UOPA 2BD2A 2TIOA 3F6UH 5LGOA 1S6HA 1E38B 4B1TA 2ZPSA 1RTKA 3UUZA 4X1SU 3SNAA 2JH5D 2QXHA 1C5ZB 2EI7A 2BD9A 1GBMA 2ZDLA 1CBWC 3LGIA 3V13A 3BTEE 3V7TA 1UCYH 3LGVA 4OS1A 1SOZA 2FS8A 2HRVA 2BXTH 4MNWA 1BA8B 1SLUB 2NU1E 4ABGA 1P04A 4SGAE 2VWLA 2FI3E 4FU8A 1BT7A 5EPNA 1BMLA 2BD5A 1C2KA 2WPMS 3QDZB 1A3BH 1JBUH 1UTKA 1IQEA 2VIQA 3TIUA 2OQUA 2IOTA 2C8YB 1SFIA 2XC0A 3MFJA 3QUMP 1GI8B 1L1NA 1AFQC 1XM1A 4UDWH 1VCPA 2XYAA 1DWEH 1GI1A 1O2XA 2QAAA 1C5SA 1CT4E 2BLOA 2FOMB 2VIOA 1B5GH 1LVOA 3LKWA 2UUKB 4AFQA 2FI5E 1J16A 1GJ6A 3DT0H 3ENSB 1VR1H 2PHBA 4GSOA 5C5OA 1HYLA 1KXCA 1O3JA 5JB9S 3RC4A 2WPJS 2QF3A 3BTME 5HMAA 4TWYA 2BD4A 2ZDKA 1MD8A 5LPFA 4TPIZ 4X2XA 1LPZB 3RM0H 2A5AA 3KHVA 3LOXA 1ZPCA 3SU6A 2SGAA 3V12A 1O5BB 5EW1H 3SUFA 5JYIA 4JCNA 3UY9A 1DUAA 1SQAA 1Z8JB 2QY0B 3SJKA 1BTPA 4BAMB 1B0EA 4ZUHA 1EX3A 1K1LA 2XC5A 1EJNA 1DT2A 4WMEA 3RUOA 1WSSH 2FOFA 3SNBA 1BJUA 2H1UA 2G5VA 2GDEH 4BTUB 4ISIH 1GL0E 1GHAG 3CS0A 4Y79A 1BMAA 2PV9B 1GJDB 2BLWA 3A8BA 2R0LA 1OPHB 4NGAH 4X6MA 1V2TT 1U6QA 3QWCH 2CF8H 1EAXA 4B71A 2PUXB 5DJ7A 4A1XA 2FPZA 1GBBA 4FUIA 2ZCHP 4X8VH 3Q77A 1MAYA 1C5LH 1RS0A 1C5NH 3Q00A 1VITG 3PMJA 1DOJA 4QT8C 4Y71A 2XTTB 2FO9A 1N6XA 2D1JA 2Z3DA 2BY8X 1IHSH 1CBWB 1FNIA 3GY2A 4LXBH 3SW2B 1OWKA 2C90B 2WPIS 5EOKA 1PQAA 3E8LA 1SGPE 4KKDA 4AZ2B 3NUMA 1ANDA 1BRBE 1QL9A 1TX8A 2A5IA 1GI0A 4M7GA 3SJOA 1MBMA 1C1VH 1G3EA 1O35A 1EZSC 2W26A 3MO6A 3SI3H 1C1MA 2ZF0H 1C5UA 1V2UT 4UFGH 3E0PB 1UJ1A 2CMYA 1KLTA 3D49H 5FBIA 4GPGA 1HGTH 1GJ8B 4GAWA 1YC0A 4BTTB 1IQIA 2GZ9A 6CHAC 1C9TA 1NM6A 3LPRA 4JYVH 1PPHE 1XXDA 6LPRA 3AASA 1S84A 3LIWA 1AFQB 1O2JA 1Y59T 1P57B 4D76A 3PLPA 5C20A 3MWIU 2ZDMA 4A1VA 1G3CA 1O5EH 5K0HA 1Z1JA 1SGEE 3AAVA 1WOFA 1S5SA 1GBFA 1N1LA 5GJ4B 2NU2E 1NRPH 5A0CA 2TPIZ 2V35A 1QY6A 4UFDH 1IQLA 2ZGCA 3NPSA 4TWWA 2A7CA 4RKJB 1OXGA 4BOHA 1EASA 3A89A 1SQTA 2OBOA 4TPYA 1SLVB 2C8XB 3P8OA 1YPLH 1L2EA 2SNWA 3QGJA 3DUXH 1UK4A 2J4IA 1SLXB 2FEQH 1LHFH 1A4WH 1Q2WA 2GV6A 2VJ1A 3F68H 2BQ7B 3M37A 1W8BH 4Q7YA 4CRBA 4AORA 3SI4H 1PYTD 1W3CA 3AW0A 1O3OA 1KTTB 4ZH8A 1O3LA 1YBWA 2A4GA 2P3TB 3RP2A 4B76A 1PQ8A 3E1XB 1O37A 1AE8H 3NCLA 1HAYB 1C2MA 1ELFA 5ESBA 3BG8A 2PKSC 2D2DA 2G8TA 3KIDU 1GI4A 1L1GA 1ETTH 4AGJA 1AO5A 2D26C 5IYTA 4KTUA 1YPHC 3SNDA 1O33A 1GBEA 1TX7A 2J94A 4ESTE 4O3UA 1Y3XA 1ELAA 3S0NA 1UTPA 3TJVA 1CHOG 3TGKE 4AYVB 4E7NA 1ZR0A 1YCPK 1H8DH 3BIUH 5T6FA 3ZZ5A 1GHAF 1BITA 1QJ7B 1TPSA 3E91A 5F8XA 1TGNA 1TRYA 1GI2A 1C5RA 2G55A 2ZWLH 1O2SA 1FLEE 1GDQA 3AVZA 2GMTC 1T8OA 2J38A 1Z8IB 4OS6A 1GDUA 1ARCA 4E06H 1UO6A 3MU1A 1HAXB 3GICB 3F9HA 1QL8A 1IAUA 1P2QA 1VITF 4FUBA 2O8LA 2J9NA 1ZYOA 4K1EA 2CHAB 1WCZA 2G52A 1EP6A 5EG4A 2F9VA 5A8ZA 3C27B 4GLYA 4K8YA 2A4OA 4XBDA 3T62A 1P11E 3M35A 5E0GA 5JPMH 2HNTC 2ZP0H 2JKHA 2BDAA 1FY8E 1ORFA 3K65B 1Z71A 1P02A 1KXBA 1TNHA 1GCTC 1BOQA 2XBVA 3ATIA 5A09A 1GBKA 1LQEA 6CHAB 2QYIA 1TX6A 3RXMA 5L30H 1TRMA 3FAOA 3NK8A 5CE1A 1OWJA 1ZSLA 3GCOA 2KAIA 1BQYA 4CRDA 2G4UA 3SV7A 1QRXA 5I46H 1ZSJA 1ANCA 1S85A 1UTNA 1AN1E 1MAXA 2F9PA 3P8FA 2PFEA 3JZ2B 4I31A 4BANB 4AB8A 5EPYA 3ZZ4A 3QLPH 1Y3VA 1P09A 2NWNA 1LPGB 3RU4D 8LPRA 2GDDA 3BN9A 3LJJA 1LVMA 3PWBA 2IJOB 1TQ7B 1Z7KA 4IS5A 3GCNA 5F03A 2FX6A 3KGPA 3SV8A 4DURA 1Y5BT 4XE4A 3L33A 4X8TH 3VB4A 2GX4A 1A0LA 1EXFA 1DITH 2ZFQH 3SU4A 1ZTJA 2ZKSA 3EDXB 4YZUA 1AWHB 2FLRH 1GVZA 4ZAEA 3RXLA 2BQWB 3W94A 1MKWK 1YF4A 2VB0A 1BDAA 3PMBB 3PWCA 4KGAA 1T8MA 2OD3B 3SV9A 4B2BA 1NRQH 1ANBA 1TE0A 3AAUA 1C5VA 1D4PB 1BCUH 1W7GH 2ESTE 2FLBH 2PKSB 2WUBA 3TGIE 2P59A 1CT2E 4Y8XA 3GY5A 3DA9B 4D9QA 6GCHG 5E0HA 1T8LA 3P70B 3RXCA 4PROA 4X1QU 1JIRA 4U01A 2OUAA 2IN2A 4AB9A 3TLOA 1HAGE 4K3JA 4ZHMU 2W3KA 3IG6B 4MQAA 1C2LA 1CHOF 1SFQB 2NU0E 1CGJE 3MYWA 2FX4A 2BTCE 1NC6A 2GTBA 2GMTB 5FX6A 3SU5A 4UFEH 3I78A 2I6QA 2BDYA 2ZU2A 3AW1A 3UIRA 1IOEA 1C1PA 1RJXB 1RIWC 2A1DB 2PKAA 3FZZA 1G32B 3QTVH 2BOKA 3KCGH 1K28D 1Y3UA 1ESTA 3LT3A 4KP0A 1C1NA 4E7RG 1GBTA 1SGTA 5GXPA 4DGJA 1CA0C 1S0QA 3RDZA 2ZHQH 5ETXA 2QXGA 9LPRA 1GMHG 1A3EH 1SHHB 1W10U 3HGNA 1PPBH 1T4VH 3D62A 4I8KA 4JZIA 3CS7A 1FY5A 4A5TS 1ELEE 4BXWA 1UHBB 1TAWA 2ZGJA 3HKJB 3O8DA 4IC5A 1UCYK 4VGCB 3E3TA 1V2JT 1H1BA 4IW4E 2Y5GA 1HAPH 1OYTH 1O3NA 2HALA 4ABDA 1DM4B 2AH4X 4ABFA 2B7DH 1WQVH 1DWDH 2P3FH 1P8VC 4B74A 4WXVA 3ZV8A 1WQSA 3E16B 3Q3YA 1MQ5A 1DPOA 2ZNKH 3A82A 1TBQH 3RXEA 4RN6A 1PQ5A 4SGBE 4AFUA 1CE5A 1QBVH 2BY7X 1FQ3A 1FY3A 1YPKH 4X2WA 1NRRH 1KDQB 2GP9B 1NTPA 2BDCA 1OWDA 2Z9JA 4YT6H 1EPTA 1M9UA 1W0YH 1THPB 1ZJKA 4WMFA 3RLYH 1GJ9B 5AFYH 1MQ6A 1UVOA 2UWPA 3GDUA 4AGKA 3T2NA 4F4OC 1C1SA 4I8LA 3UTUH 4JYTA 1K1OA 2FMJA 1HLTH 2ZDVH 1GBJA 4ZKRU 4DG4A 3BTKE 4Y8YA 5HYOA 3H5CB 4ZXYH 4ABHA 1F0SA 2EC9H 3D23A 2FS9A 3U1IB 1EQ9A 1MCVA 4UEHH 3RXUA 5GWZA 1TNIA 1JIMA 2ZFRH 3LC3A 3MOCA 1AUTC 3EGKH 1EP5A 2F3CE 2PLXA 1IQHA 1O2PA 1IQKA 4Q2KA 1V2KT 5TCAA 3A8AA 3SJIA 3RXSA 2AS9A 2ZGHA 4ABBA 6GCHF 5GPIB 2OINA 4Y0YE 1BTHH 1FPHH 5HXFA 1TOCB 4MPUA 1UK3A 1GJAB 2WPHS 1NPMA 1O32A 1GHBG 3SBKA 4MNYA 4I32A 3UR6A 1HIAB 2P8OC 4WVPE 3MHWU 1O31A 1ETRH 1JOUB 2BY9X 1ZMNA 2BLVA 1AIXH 2H5DA 1H8IH 1RIWB 3QZRA 1P01A 2FDAA 5A0AE 1MCTA 2FIRH 1V2MT 1V2OT 3KN2A 1F92A 2AGEX 1V3XA 1O34A 1YYY1 2SGPE 5BRRE 2RA3A 2FTLE 1BBRE 3RXJA 3CENA 1CA0B 2JH6D 5F8ZA 4INHA 2QV1A 1CT0E 3K9XB 4JZ1A 3MH7A 4UE7H 4Y7BA 4Y6DA 2F9UA 1D3PB 1ZLRA 1XUHA 1TOMH 5I25A 3F9EA 3ZVGA 2Q6GA 2UUYA 2O8UA 5HM9A 1F5RA 1GMHF 1W2KH 3KF2A 1ELGA 1AWFH 1RTFB 1QB1A 1MKXH 2ODQA 1V2QT 3P8GA 2VNTA 3SU2A 1HJAB 1GI6A 1VCQA 2SGQE 4ISLA 3MU0A 5DPAA 4I7YH 4CRFA 4LZ1H 2YNBA 5EODA 1UMAH 1TPOA 3B8JA 3PMAB 5A2MH 3HGPA 2ZFFH 1HV7A 5F8TA 1P2NA 1HXEH 5GDSH 3ZZ9A 3TK6A 3LDXH 1O2VA 2ANMH 1BBRH 5L6NH 4DOQA 1QB6A 4RSPA 4MLFB 3UQOA 2J95A 1GBHA 1V2WT 3N7OA 1J15A 4THNH 2ZHEH 2XW9A 2GCHG 3A7WA 4MVNA 1AQ7A 4X1NU 1L4ZA 1F5LA 1P12E 4XBCA 3SO3A 3BF6H 2Y82A 4UD9H 1O3KA 4DIIH 1J17T 1YLCA 3K6YA 4FUHA 2Y7XA 3SN8A 3SGQE 4XBBA 2BVXH 2A2QH 5DP7A 2AEIH 2XNIA 4NZLA 2XBXA 3QX5H 2FOAA 3ZZDA 4UFFH 4YM9A 2HLCA 2Z9GA 3R3GB 1SGFA 1GHZA 1S81A 4MPWA 1MTWA 2ALVA 5FPSA 3Q3KA 1C5OH 1QQUA 4JYUH 4O97A 1P0SH 1THSH 1O2WA 1GVKB 1TPAE 3ITIA 1N6YA 1P9SA 4BTIB 1D9IA 4ABEA 1EB1H 3A8CA 1ZHRA 3VB7A 2UWLA 1GBIA 1WAYB 2WPKS 5EQQA 2Q6DA 1K1JA 2P8OB 1GHBF 1H9HE 3ATKA 2CHAC 2BOHB 2P16A 2AMDA 2O8WA 1RD3B 2H5CA 4GCHF 1HXFH 1GHVH 5ESTE 4CBNA 2GKVE 3U8TH 1F2SE 3LH1A 2SGDE 5JB8S 1BTZA 1EJMA 1YPMH 3PTBA 3SQHE 1ABIH 3GDVA 3UNRA 1J8AA 3RXDA 1C2GA 5DKMA 2G51A 1FDPA 4HI3A 2QA9E 2STBE 9ESTA 3PTNA 1MZAA 2Z3EA 1FN8A 1O2MA 2GVFA 2UUFB