1O2HA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2hA02
2LPRA 1E34B 1GBHA 3DFLA 1EAWA 3GDUA 3Q77A 3PMAB 1A5HA 1FI8A 1NRQH 5T6DA 4MDSA 4AYVB 1D3TB 1GBLA 2G5VA 2AGGX 4LXBH 5L2ZH 3S9CA 2BQWB 1DXPA 4H42U 1ZGVA 3SZNA 4KTCA 5E2PA 1S83A 1UVUH 1T8LA 1Y3UA 3GCTF 2RA0A 1PJPA 1NTPA 1KTTB 1V2JT 3T62A 4E7RG 3BTDE 4FUHA 3L33A 4FU8A 4UFGH 2BVRH 2NU0E 4B74A 1C2KA 3V7TA 3AASA 2GMTC 3A82A 2UWLA 1S0RA 3ATLA 1HAOH 1HAXB 2WPIS 4NA7A 1G2MA 3D65E 2HPPH 4KELA 4D7FA 2A5KA 1UTQA 1UK2A 3RMLH 2GDDA 2FYQA 1OP2A 2PKAB 1OWDA 4YESB 1FV9A 4ABDA 4NA8A 5LPEA 3RC5A 2B8OH 1GHAG 5J4QA 3HKJB 1W8BH 5A8XA 1O2VA 1KDQB 3RXRA 4FUFA 4YLUA 5B6OA 2ODQA 3M7QA 3VB3A 3PV4A 5JBBS 1O2TA 4AOQA 4BTTB 5TCCA 2P95A 2W7SA 1PPZA 1UO6A 2YOLA 3ODFA 2BY5X 1FZZA 2PTNA 3ITIA 4FU7A 1N8OB 3RXUA 4HGCA 1MD7A 1AFEH 1TBZH 3P17H 3SJ9A 3M3SA 4FUGA 1TGBA 2FI5E 2AS9A 2CHAB 5C67A 2SFAA 1KXFA 1ELEE 2ZA5A 2O8MA 3ZVFA 4FUBA 3U98H 3WY8A 1O2IA 4H4FA 2ZECA 1GMDF 3QO6A 3RMMH 3G01A 1GMCG 1DVAH 2ZHFH 1U6QA 1ZJDA 2V0BA 2HVXA 1GI0A 3SNAA 3AW0A 2RCEA 4JYVH 2PKAA 3UFAA 3V3MA 5HM9A 3F6UH 2ZHDA 4ISLA 1QHRB 1QL7A 1DPOA 1Z6JH 1UVTH 2QXIA 3MYWA 4FUIA 3ZZ3A 1FY5A 1KDQA 3RU4D 2JETB 1JMOH 1BRCE 3F1SB 1C1MA 1DITH 3S69A 2BD7A 4RN6A 3R0FA 3UWJH 1QFKH 3U69H 2ZEBA 2ZGHA 1CSOE 1O2KA 4TPYA 5EGMA 2Z7FE 1XKBC 1O2JA 2NU3E 1GJBB 2ZG0H 4AG2A 5F8XA 4AZ2B 2P8OC 1W3CA 4SGBE 1A1RA 1DFPA 1LPGB 4XSKU 4Y8YA 1ZTKA 1P09A 1JRSA 1LHGH 5T6FA 3HKIB 1DSTA 3LIWA 5EXNA 4ABGA 3EDXB 2ZPRA 1ZTJA 2G55A 1TGNA 5LPFA 1W14U 2BLOA 5FAHA 1VJ9U 1RXPA 1ABJH 2FDAA 4X6MA 2C8XB 2A1DB 4Y79A 1C4U2 4TYDA 3TJOA 2BXTH 6GCHF 2VVCA 2ZTYA 3PLPA 1BMLA 4IMZA 2BDYA 2VIVA 2VWNA 3E6PH 1G3CA 1PPEE 1YCPK 4MLFB 1ZPZA 4IN1A 4BAHB 2Y5GA 1O2GH 4O03A 1PPGE 1K1PA 1UCYK 3GDVA 1O3GA 1DWDH 2A7HA 5JB9S 6ESTA 2UUJB 3QK1A 1UMAH 4X1QU 1ZPBA 1ELTA 1A0LA 1UTNA 1GBKA 2H1UA 2OP9A 3HGPA 2AIPA 3P92A 3A7ZA 5FBIA 1AN1E 2EEKA 2Y7XA 2BQ6B 1KXDA 1VGCC 1PPBH 2FZZA 2XWBI 1G3BA 4NIYA 1KIGH 1ELAA 3MNCA 2A7JA 1P05A 1O5DH 1ZYOA 1MTNB 3VGCB 1IQFA 1NY22 2ANWA 2HRVA 5L30H 4DOQA 1T4VH 2QXJA 1QB6A 4BANB 2ZU3A 3MNXA 3SJIA 1ZGIA 2PUQH 1RJXB 1Q3XA 1YPJH 4B2AA 1TMBH 4CHAB 3SV9A 4UEHH 1D4PB 1B7XB 3RM0H 1O30A 3RXAA 2P3UB 1C1OA 1EJAA 3BTME 5C1YA 5DPAA 2J9NA 2GCTC 3PTNA 2AMDA 4AGKA 5BPEA 2UUFB 1GMHF 4A5TS 1NZQH 1DX5M 1FN6A 1G32B 1T31A 5LPRA 1QBVH 3ESTA 3PO1C 1LCYA 2Y5FA 2ZZUH 4XE4A 1GJ4H 1UVOA 2V3OH 4O3UA 3TGJE 3M5NA 1HCGA 1M9UA 1FMGA 1JOUB 1P8VC 1GI8B 1F92A 2IJOB 2ILNA 5SGAE 2C90B 4AYYB 1O3PB 5GJ4B 2GZ7A 1SQOA 1O3IA 1DICA 4B1TA 3SO3A 1V2ST 2ZU5A 3AW1A 1G37A 2BM2A 2ASUB 2A5AA 1TFXA 2AH4X 3P8OA 3BTFE 2SGDE 3VFEA 1K28D 2H9HA 1PFXC 3ZVCA 4KP0A 5EOKA 4WY3A 1Z1JA 1G3EA 2C8WB 3A83A 5K0HA 1MTSA 2VIQA 3LC5A 2EI8A 1MKWK 1EP6A 5A0CA 2Q6DA 3SOSA 3IITA 2ZQ2A 2VGCC 1LPKB 2VJ1A 2CGAA 3MNBA 2BD8A 4E06H 1SBWA 1UK3A 1EPTB 1FDPA 1MKXH 2H5DA 1GBIA 2A4OA 2VB0A 1NT1A 4Q7YA 3H7TA 1ELVA 1C2DA 1B0EA 2BX3A 3RDZA 4YT6H 4VGCB 1GHBF 1MZDA 2C4FH 1SB1H 2VIWA 1YPHC 4JCNA 3SV2H 2BXUH 2ZTZA 1HJ8A 3SHCH 3S9AA 2Z3EA 2F83A 2P3TB 3ELAH 1ANEA 3PMJA 5FHTA 1AO5A 1AGJA 2STAE 4FU9A 1FY1A 1WUNH 4BAOB 1KXCA 1VCPA 2WPLS 1HAGE 2XW9A 2A5IA 1GJ6A 2FYRA 2JH5D 1G30B 1TX8A 2GMTB 1P02A 3M5LA 1D3QB 1P10A 1WCZA 1Y3WA 1HV7A 1AU8A 4KKDA 5DP7A 6CHAC 2BDIA 4CBNA 1DOJA 1A3BH 1LDTT 1RS0A 4A92A 2R0LA 4MQAA 1EPTA 3HGNA 1KYNA 1N8OC 1S84A 3GY5A 1TLDA 1GHWH 3LH3A 1V6DA 2AYWA 1QRZA 1TNHA 2CHAC 2BHGA 3UUZA 2SGFE 1ZMJA 2AMPA 2EA3A 3W95A 1GGDC 2VU8E 1H9IE 1EJNA 1LMWB 5BRRE 3VXFH 2Y80A 4NA9H 1WBGB 1GI3A 1C5RA 5FPYA 4QT8C 5HXFA 1P3CA 2OUAA 3BTEE 5DP6A 3A81A 1HJAC 2Z9KA 3FVFB 3TJUA 3UPEA 1BTPA 2VIDA 4Y0YE 2HALA 1SGTA 4DURA 2ZC9H 3HK6B 1T8NA 4K8BA 1IHTH 2BDHA 1NM6A 2ANKH 5DO4H 4WVPE 2FO9A 1GBAA 1SLUB 1IQEA 4Z6AH 1KLTA 4BOHA 4Y8XA 3TJNA 1AFQB 5A8ZA 2GT8A 3BEIB 1QB1A 1YBWA 1WTHD 1C9PA 3TU7H 5DP8A 1GHZA 1OWIA 2Z9JA 4CREA 1TQ7B 1O2UA 1UCYH 3U8TH 1HRTH 2YNAA 2H6MA 1CBWB 2F9VA 2F9OA 1K1IA 4NSYA 4NGAH 1IQNA 1HBTH 1IQKA 1JXPA 1MH0A 2CF9H 4D9RA 2WPJS 4ZKNU 4ZXXH 1OYQA 1YLCA 2P8OB 4DY7B 3UWIA 3KHVA 1LKAA 4O97A 2XCFA 4TPIZ 1RD3B 1J8AA 2DE8A 2OBQA 4ISOA 4IN2A 3UREA 2XBXA 4M7GA 3LONA 1V2PT 4AFQA 1TAWA 1O3BA 1D9IA 2Z3DA 2AGIX 4AFUA 1ELCA 1CHOF 4O3TA 3SW2B 2FI4E 3NZIA 4X8UH 3MH5A 4NZQA 3S9BA 4OGYA 3UR9A 3GCHB 5HMAA 4ZXYH 1BOQA 4X8VH 3VPKA 1HAIH 1GBTA 1SVPA 3SV6A 3NCLA 3HK3B 2XXLA 1FPCH 3M3VA 4B75A 1T4UH 1BRAA 4ZHMU 3TVJB 3TGIE 1BBRH 2B7DH 1LQDB 2AGEX 1BJVA 3V13A 2GV7A 4DCDA 2FTMA 1ELFA 2GZ8A 1JBUH 3R3GB 2OC7A 1EP5A 5DK1A 4BTIB 1AHTH 3K9XB 3M36A 3SU5A 2H9EH 4AG1A 2TPIZ 1VGCB 2Z6BD 2GVFA 4CHAC 4CBOA 2CMYA 4MPWA 3DD2H 1O2NA 2FOGA 2FOEA 1TNGA 2W3IA 4ZKSU 4CRBA 2OCVB 3TH2H 1ZHMA 2QGRA 1KXBA 1O3AA 1QBOA 3I77A 1DDJA 1LVYA 2ALPA 2FOMB 4YOGA 1AB9C 1GJ8B 3URDA 1K9OE 1SPJA 5DGJA 3TLOA 5C2ZA 1T8OA 4XBBA 1THRH 5JPMH 1SGFG 1MMJN 1L1JA 1CA8B 2I6QA 1D6WA 1DUAA 1PPHE 1SR5C 2BLWA 2GCTB 4WMDA 2PLXA 2QY0B 5F8TA 2A32A 4R0IA 5HGGA 3EA7A 3BSQA 3E91A 3PO1B 2ZCHP 4F49A 3UQOA 2BVSH 1A0JA 1UTJA 3KN2A 1OS8A 3U1JB 2I6SA 2V6NA 1L4DA 1QGFA 2SNWA 1GJCB 1GBJA 2Q1JA 1C2IA 3GICB 1TBQH 3BTTE 3RLWH 1O0DH 2Y7ZA 3E90B 1QRXA 1K22H 3A80A 2VH0A 4FUJA 3SNDA 4KTUA 5ABWA 2J95A 4ASHA 2WPHS 2Z9LA 3U8RH 1F0UA 2NU1E 1MAYA 4ABHA 2JKHA 2ZDKA 2ZDAH 3EQ0H 3F9EA 4NIWA 4Y8ZA 3A89A 3ZZ5A 3P8NA 1BTYA 1DANH 2FODA 4TY7A 3QTVH 1XUHA 1W7GH 4VGCC 2A4QA 1FAXA 4GUXA 5HYOA 2A2QH 2ZDMA 1OSSA 4DJZB 1AD8H 5AFZH 2VGCB 2SGQE 4NWLA 1G9IE 2F9NA 1WTGH 3RXDA 1ZSKA 5E0HA 2V3HH 1O37A 3FANA 1UTLM 4YOJA 1IQHA 9LPRA 3A87A 3HPTB 1VITF 1K1LA 3KGPA 5GXPA 1WSSH 5G4BA 3UY9A 1O34A 1OXGA 4MNWA 2A0QB 7ESTE 1JRTA 2HWLB 1SLVB 4MVNA 1ZHPA 3MU8A 1BMNH 1JIRA 4FVDA 1FY8E 5GCHG 1ZZZA 3FP7E 4X1RU 4UDWH 2ZFSA 8GCHG 1XM1A 3KQCA 4B73A 2AMQA 4DG4A 3BIVH 1W2KH 3P6ZB 1MKXK 2ANMH 1ESAA 1GBEA 1K2I1 2GTBA 2VNTA 1ZR0A 3TK5A 1A4WH 1O2WA 4LZ1H 2UWOA 3ZZ6A 1NPMA 3Q3YA 2GDEH 1NS3A 2G52A 4OS6A 1V2QT 5JBTA 4R8TB 1PYTD 6CHAB 1SHHB 1RTKA 2WUCA 2XTTB 1NN6A 1KLIH 5EG4A 3SI3H 2SGEE 2GCHG 5ETXA 2ANYA 3VB7A 2A31A 1TNLA 3EAJA 1ELDE 1VR1H 2C8YB 2PTCE 3E8LA 4A1XA 3S7HB 5T3HA 1MU6B 2RG3A 1L1GA 1GI6A 2TGDA 1GGDB 1GJ9B 1TX6A 3A7YA 1DLKB 1C5WB 2THFB 2Y82A 1V2RT 1O3MA 1HPGA 1J16A 1FIZA 2C8ZB 4YZUA 1VCWA 1HIAB 4H6TA 1AFQC 3QGNB 1SGYE 1K1OA 4ZKRU 5C20A 1HJAB 4OS2A 1PYTC 4I8GA 5L6NH 3QUMP 2ZKSA 1GWAA 1G3DA 1O3DA 3E0NB 3MO6A 1UJ1A 3BTQE 3RXJA 1UTMA 3ZZAA 3SV7A 3V0XA 1XKAC 3GY6A 4INKA 1ELBA 1P9UA 1CBWC 1DS2E 1GJDB 5FX5A 4NIVA 2OLGA 3PMHB 4D76A 2M5TA 1DUEA 1MU8B 2BLVA 2QXHA 3AAVA 3F9GA 1NFUA 3PWCA 2XC4A 4AGJA 1BZXE 1O3FA 2RDLA 3UOUA 1YPHE 1HB0B 2R9PA 2ZU1A 4K8YA 1K1MA 1BMMH 1A2CH 3EA8A 3E0PB 2ZIQH 2FX6A 3B23B 4Y76A 1FONA 2W3KA 1UK4A 1TA2A 3SI4H 1H8IH 2ZPSA 3GCHC 3PROA 1BDAA 1ZOMA 1P11E 3BTGE 1H1BA 1O3CA 1P2MA 1LVOA 1SC8U 3MO9A 1T8MA 1GCDA 3OY5U 4X2XA 4DGJA 3QWCH 4MNYA 2OQUA 2TIOA 4NFEA 1AMHA 7GCHG 1P57B 1TNIA 1SGIB 1LHEH 1YPLH 4I7YH 2CJIA 1CQQA 2F9PA 2XBVA 3FP8E 4I8KA 4WMEA 3T26A 4GAWA 1FY3A 2BZ6H 5GDSH 1FXYA 1QNJA 3RXLA 1YPEH 1TQ0B 1LKBA 4MPUA 4WWYA 2FPZA 3OX7U 3SGBE 3UR6A 1P12E 2ZHWH 1EZSC 1S0QA 2HNTC 3GISB 3NXPA 4NG9H 3MH4A 3MI4A 2FLRH 3M37A 1C5LH 2XNIA 1BT7A 1SL3A 1SHYA 3ZVDA 3IWMA 5F8ZA 4ABJA 1TOCB 2FP7B 1SFQB 2G81E 4PROA 3SGQE 3Q00A 4X0WU 3H7OA 1EAIA 1YPMH 2GD4B 2QYIA 1J9CH 1F7ZA 3LDXH 1GBDA 3AVZA 3LPRA 4CH2B 1P2QA 1AZZA 1OP8A 4YT7H 1LVBA 4D7GA 1W7XH 2ZPQA 2BMGB 1ESTA 1UTPA 1BBRK 4ABIA 3UOPA 4Y71A 1AB9B 3SUFA 1FAKH 1ORFA 1BRUP 1YGCH 2FS9A 4HTCH 3VB4A 3EA9A 3QZRA 3M35A 4X6PA 4UE7H 1LO6A 4E7NA 1GI5A 1C5NH 3NUMA 5AHGH 3U1IB 1EX3A 2GP9B 1UCYE 3P95A 3ZV9A 1OWEA 2BDGA 2ZGJA 3O8BA 4FUDA 1O3JA 1SGDE 1EZXC 3LU9B 1W11U 2G4TA 1YC0A 1FNIA 2P16A 4X6OA 1ZSJA 1OX1A 3JZ2B 1ABIH 2ZFQH 1C1WH 3RXGA 1THPB 3QTOH 1TNKA 1Y3XA 3QX5H 3PLBA 5GPIB 1F5KU 2FOFA 3GCTG 1TYNA 3SJKA 1S82A 3BN9A 2D8WA 1O36A 1HJ9A 1BJUA 3KEEA 5E0GA 3TNTA 4BAKB 4RKJB 1O3OA 3A86A 3QN7A 1UVSH 2ZU2A 1O2XA 3PMBB 4AFZA 1ZMNA 1S6HA 2WYJA 4NWKA 4X6NA 1KSNA 1CT4E 2WPKS 3UIRA 1SGRE 1TPAE 4X2YA 4GCHF 4JZ1A 2VIOA 1RIWB 1ZRKA 5A09A 4I8JA 3LGTA 1LPZB 3FZZA 3TH3H 1NRSH 1O2SA 1HAPH 1TA6A 3SNEA 1F5RA 1V2LT 3TJVA 1VJAU 2QF3A 2ALVA 1AWFH 3M61U 1Y5BT 3LGUA 2XWAA 4U01A 2VWOA 3EE0B 1ARBA 1DE7H 2ZCLP 4ZAEA 5EPNA 1TE0A 5C1UA 4WF8A 3RXTA 1UHBB 4B2CA 1SQAA 4SGAE 4ISIH 1BRBE 2FMJA 2TRMA 4CR9A 1P01A 2GX4A 1YCPM 3A84A 5E8EH 1GCTB 2LNCA 3O8CA 5EXLA 3OTJE 1GG6B 5EW1H 1GMDG 4XFQA 1NRNH 1CGIE 1XVMA 3A8DA 3EGKH 3O8DA 1IOEA 1BHXF 3RM2H 1O5BB 1HYLA 2Q6FA 2P94A 2QA9E 5FXLA 3SU0A 4GVUA 1CGJE 5DJ7A 3EYDA 1GDNA 4JYUH 1ACBE 2ZDVH 1O2HA 4LK4A 2NU4E 2BX4A 1H4WA 4NZLA 1QJ1B 3BTHE 1MAXA 2BOKA 3E16B 1GHYH 5DP3A 1HUTH 5AVDA 1GHAF 5H4IB 1NRRH 3SHAH 1XVOA 2F9UA 4J1YA 2GZ9A 1DXWA 2Z3CA 1Z8JB 1AIXH 1QCPA 2HLCA 1NFXA 3UNRA 4JZEH 1GDUA 1WU1A 5C1XA 2FIRH 1OWJA 1UHBA 3A8AA 1ZLRA 1CHGA 1NC6A 1GBCA 3T29A 3QZQA 2C3SA 1C5ZB 1UVPA 1QY6A 2Y6TA 5IDKA 2R3YA 1ARCA 1RTLA 6GCHG 2STBE 2D26C 3RXVA 1AUTC 2TBSA 1FLEE 1E36B 5LGOA 1P04A 3LKWA 1QTFA 2FI3E 2TGTA 4WXIA 1GMCF 3RUOA 2XC5A 2BY7X 3SU6A 2A4GA 1SGFA 1EOJA 1OPHB 5EW2H 1A5GH 1Y5UT 2OC8A 3U9AH 1EAUA 1HDTH 1C2FA 2P3FH 3SORA 1QL9A 5E0JA 1C2GA 8KME2 2HGTH 1XXDA 1SOTA 3KCGH 3W94A 1GL1A 2C93B 4ZUHA 1F0RA 1W0YH 4LOYH 1PQAA 4I8HA 2Z94A 1A5IA 1ETSH 3RC6A 1BHXB 1GI7B 3RP2A 1HAVB 9ESTA 4E05H 1EKBB 2ZFTA 2QV1A 2ZGBH 4D9QA 2GKVE 4A1TA 1V2UT 1ZRBA 3PYHA 4Y7AA 3FZDA 1HAZB 1V2OT 4FVBA 1HGTH 2YNBA 1RRKA 3T5FH 3SBKA 7LPRA 5CHAC 1TRYA 2CV3A 3D23A 1C2JA 1C2HA 1DY8A 2F91A 3GY4A 2R2WU 1GBMA 1LQEA 2NU2E 2ZHEH 1BTWA 1SGQE 2B0FA 2WINI 1EJMA 1WQSA 1P06A 2ZI2H 1GMHG 1GBFA 4B2BA 1FY4A 3LGYA 1LHDH 4TWWA 1C5PA 4X1PU 4K5ZA 3MU5A 1C1UH 3TK6A 1Z8RA 3NK8A 4I32A 1IQJA 2ZO3H 3LC3A 1NRPH 3ZVBA 2PUXB 5DP4A 5C5NA 4ESTE 2FM2A 1LHCH 4X2VA 1O2MA 4Q7ZA 1GVZA 4O9VA 3M5MA 2A4RA 3MOCA 5LH8A 2UWPA 3RXOA 1P03A 3C27B 1EASA 1Z1IA 4FUCA 3MH7A 3K6ZA 5ESTE 1MCVA 3S7KB 4ZHAA 1DWBH 5CMXH 1XMNB 3BEFB 1O5CB 3LGIA 2OC0A 1GVLA 1TPPA 1W12U 2O9QA 2BD5A 3ZVAA 4MPXA 4IC6A 1ETTH 3TITA 2AIQA 1C5MD 1DM4B 3ZZDA 3ZZ8A 2SGPE 1J15A 3SQHE 1XUJA 2VH6A 3KF2A 1EUFA 3BTKE 4DIIH 3ZZ4A 1GDQA 2EI6A 4GHQA 3N7OA 3RXQA 1SQTA 1GHVH 1SI5H 1LTOA 4IGDA 1QR3E 3A8CA 4IW4E 3Q3KA 1OYTH 4ZHLU 3P8GA 1GHBG 1HXFH 3H5CB 2ZP0H 2BY6X 4WMFA 1P2OA 3CENA 3Q76A 2AERH 2BDCA 2FS8A 1ANBA 3RMNH 1UTOA 4UD9H 1C2EA 1WV7H 1HAHH 1CGHA 3KQBA 1CE5A 1Y3VA 4YO9A 5TCAA 2P93A 1D6RA 3KL6A 1QB9A 3RMOH 2Y5HA 4AB8A 2OBOA 2FX4A 1O2RA 2QAAA 3VB6A 3RU4E 3SU1A 1RIWC 5CE1A 1N6YA 1TRNA 1ZTLA 4D8NA 5JDUB 1ZPCA 1D3DB 1V2WT 3GYLB 1C5UA 2J38A 3MMGA 1NU7B 4NSVA 4IC5A 5A8YA 1GI2A 1GJAB 1BTUA 3U8OH 4Q80A 3ENSB 1EATA 1EXFA 4CRFA 1O2ZA 2HNTE 5AFYH 3BF6H 1S81A 2BD9A 2BZAA 4A1VA 3QLPH 3SQEE 5JBAS 2GGVB 1GJ5H 1N1LA 1AKSB 3OY6U 1EOLA 1O5GH 5F6MA 1ZSLA 1XX9A 3RXIA 1L2EA 1YM0A 2OD3B 4JMYA 4BXSA 3ATMA 1O2YA 1SGCA 1THSH 4AX9H 2J4IA 4MPVA 1QQ4A 2IPHA 4F4OC 1T32A 1GCTC 3T2NA 1CU1A 2G8TA 1GG6C 1INCA 2HOBA 1VZQH 2IN2A 2BB4A 1O5FH 1C1SA 1O2OA 3LT3A 4KGAA 5I25A 1Z8GA 4DIHH 1GL0E 3K6YA 4I8LA 2G51A 5F03A 1TB6H 1TOMH 1XUIA 1AQ7A 1PPFE 4OGXA 4RSPA 4DVAU 1TONA 3SNBA 1NESE 1QURH 3FFGA 1XUGA 3ODDA 5IYTA 3M5OA 1CVWH 2Z9IA 1GBBA 4BXWA 4JZDH 1E38B 3MU0A 5FBEA 1AI8H 1L1NA 4CRGA 4ISNA 3K65B 4FUEA 3PWBA 1WYKA 1AKSA 5ESBA 4FXGH 1S85A 3MFJA 1S6FA 1SLXB 1C5SA 1MZAA 3F9FA 4XBCA 1OP0A 2CF8H 1YPKH 1MD8A 3SUGA 1AY6H 2BLQA 2KAIB 4K3JA 1O38A 3TH4H 1QJ6B 4TY6A 2FTLE 3GCOA 1NU9A 2XC0A 3D49H 4YOIA 4A6LA 1HAYB 5EQQA 2PW8H 1HXEH 5FPTA 4X8TH 4THNH 4Y0ZE 1QIXB 2H5CA 1KXEA 1T7CA 3TGKE 2JH6D 1BUIA 2H9TH 1ANCA 2ZFRH 3DUXH 4BAQB 2WUBA 3L6PA 5EQRA 5T6GA 3E3TA 4XOJA 4ABBA 2QXGA 2W5EA 4Q2KA 3M7TA 2ZFFH 3MU4A 1L0ZA 1SGPE 1CHOG 2O8UA 5GWZA 2SGAA 1ESBA 1BTHH 2BDAA 1CT0E 1BIOA 2TGPZ 3RXEA 3BG4B 1Y59T 1O2LA 1IQIA 1C4Y2 1TABE 1ZHRA 1O31A 2FWWA 3QGJA 5E2OA 1BCUH 1GVKB 2FOBA 1XUFA 2NWNA 1HIAA 2F3CE 1WQVH 1NFYA 3GOVB 4UFEH 3RXCA 3O8RA 3CS7A 3UNSA 3UNQA 3UQVA 2DUCA 4KTSA 3RXHA 4X2WA 2KAIA 1AE5A 3ATWA 1O32A 1C5XB 1E37B 3RU4T 3T25A 1DLEA 1AVXA 1C1QA 3A7TA 2VWLA 4GHTA 1GI9B 2UUKB 1H8DH 1ID5H 1P3EA 1L4ZA 2PSYA 4I33A 4K69A 1A7SA 1MTWA 1V2NT 5GIBA 1BQYA 2QIQA 2RA3A 1MQ5A 1MTUA 4INLA 1V3XA 4JZFH 4IMQA 1C4V2 2BY9X 3PM3A 3AAUA 1SOZA 2ZDLA 3KQDA 1QJ7B 4YLQH 4DW2U 5CHAB 3SGAE 1BMAA 3A85A 2VINA 3BG8A 1IQMA 2W26A 2B5TB 2PFEA 2FEQH 1IQGA 1C5QA 5K7RA 1KXAA 4WH8A 4XDEA 5EPYA 1SLWB 3I78A 4RKOB 3P70B 3BTWE 1Y5AT 4XBDA 3GDSA 1C1PA 4BAMB 2WV4A 2VWMA 4CRAA 1Z8IB 1A61H 1NROH 4B76A 2BOHB 5FCRA 1EZQA 1O39A 4AB9A 1C2LA 2O8LA 3V12A 4WXVA 1TGTA 2OQ5A 3SUEA 1ELGA 1YPGH 1TGCA 2QN5T 1G2LA 4MNXA 3GY8A 2EI7A 1TWXB 2W7UA 1AE8H 4MTBA 3SJ8A 3CS0A 4X1NU 3A7XA 1BTXA 3ATIA 3A7VA 5EU8A 3CP7A 3TPIZ 1CO7E 3GY3A 1TX7A 1HNEE 1TMTH 2XBYA 1DY9A 2QC2A 1TRMA 1P2JA 4U30A 4Y11E 4NIXA 3RXBA 2Q6GA 1P0SH 4K60A 2EC9H 1YP9A 2HPQH 3ATKA 4X8SH 1O5EH 3MTYA 1V2MT 1E35B 1RTFB 3ZVEA 2AFQB 2UUYA 3BEUA 1TBRH 1VITG 3VB5A 4Q7XA 2WPMS 1F5LA 1RGQA 2J34A 3JZ1B 4K1EA 4Z0KA 1DT2A 1AVWA 1GJ7B 4JZIA 1CA0C 1Q2WA 1LVMA 2WV5A 1EZUC 3RC4A 1RFNA 2GV6A 2PHBA 1K1JA 1VCQA 1ZJKA 2FESH 3T28A 4AFSA 3MWIU 1C2MA 1KY9A 1W10U 1XXFA 4GPGA 1W0ZU 3LH1A 5DG6A 2J94A 4HZHA 3A88A 1YF4A 1BTZA 4JK5A 3DA9B 1BBRE 2PKSB 1O3KA 4MG3A 1DWEH 3RLYH 5L2YH 1X7AC 6LPRA 3RXMA 4BTUB 3GCNA 1MCTA 1FIWA 1P2IA 3OU0A 1QBNA 2BY8X 7KMEH 2BD4A 2BYAX 1TPOA 1Q31A 2FXRA 3PB1E 3K2UA 1WAYB 2FOAA 2H2ZA 1YYY1 2ZCKP 5JB8S 1IQLA 1O3NA 4LZ4B 1O2PA 3Q3XA 1OWHA 2D2DA 3PLKA 1AVGH 1P2NA 5TJXA 3I29A 1F0TA 3RXKA 5DP9A 2ZWLH 1DSUA 1TIOA 4YTAA 5FCKA 1BA8B 2XRCA 5FX6A 3MO3A 1FN8A 1Z71A 2ZHQH 1P9SA 3A8BA 2BQ7B 4J2YB 1PPCE 2ZFPH 3KNXA 1WOFA 2ZNKH 1Y3YA 1Y8TA 2TGAA 2XYAA 3E1XB 3GY2A 3ZV8A 4B71A 4X1SU 1S5SA 2A45B 4U32A 2ZU4A 5EODA 1YLDA 1NO9H 5GCHF 1FPHH 2R2MB 5FPSA 3SN8A 1JWTA 8GCHF 1YKTA 1O3HA 1C5OH 1DWCH 3OYPA 2J92A 3T27A 4YM9A 2QF0A 3QDZB 1HLTH 3MHWU 3D62A 1AWHB 2ZF0H 2XCNA 4OS1A 3RXSA 5A0BA 4K1TA 4GLYA 1SG8B 4ZMAH 2BD3A 1TPSA 4I31A 1GI4A 1A3EH 2HNTF 2V35A 5DP5A 4ZKOU 4IS5A 3P8FA 2BTCE 4Y7BA 1C1TA 1MQ6A 3URCA 4MNVA 4JK6A 2SNVA 1G36A 1GI1A 1ETRH 2K1QA 1BITA 2GCHF 2XBWA 2OC1A 3FAOA 4NCYA 2O8TA 2JETC 2G5NA 1VITH 1CT2E 3SNCA 4INHA 1J14A 2OTVA 2IOTA 3TK9A 4UFFH 3RXFA 1TNJA 3KIDU 1H9LB 3BG4C 3ZZCA 1J17T 2O8WA 1SGEE 3VXEH 1O3EA 5J4SA 1B5GH 4OS7A 3IG6B 1YCPH 2PGQB 1EB2A 2QCYA 1QRWA 1EQ9A 4UONA 1SFIA 3FP6E 2BVXH 3DHKH 2G00A 3VEQB 1V2VT 2BDBA 4ABFA 3RXPA 4OS5A 4TWYA 2PR3A 2P59A 1GHXH 1KLJH 1XUKA 3S0NA 1SGNE 1TMUH 2FLBH 4CR5A 4U2WA 3ZYDA 1MBQA 5PTPA 1O5AB 3KQEA 5A2MH 2ZDNA 3HATH 4ISHH 4A7IB 1IAUA 4HFPB 4H6SB 1PQ8A 1V2KT 1PQ5A 3GY7A 1LHFH 1AUJA 2ZGCA 3LOXA 4JYTA 3M7UA 1E0FD 4ABAA 1AZ8A 1Z6EA 1A0HB 2OXSA 4ZH8A 3B9FH 1IHSH 1B0FA 1EB1H 2ZTXA 2J2UA 1OKXA 1MTVA 2PV9B 2WYGA 1F0SA 4IBLH 3SV8A 1NFWA 3MH6A 3STIA 4UFDH 1Z7KA 1W13U 2R0KA 2FOCA 1MTNC 1OWKA 3VGCC 4ABEA 4OS4A 3ZZ7A 4GSOA 3NPSA 1O2QA 3OSYA 4WH6A 7GCHF 3TIUA 1ZMLA 2AEIH 2ULLA 4CRDA 2ODPA 2Z9GA 2D1JA 1P2KA 3GYMA 3SUDA 4CRCA 3DFJA 1A46H 1TGSZ 3MU1A 4DT7B 1FJSA 1QA0A 8LPRA 3C1KA 1HAVA 2ODYB 3LGVA 3M3TA 1PQ7A 3BIUH 4NFFA 3ZYEA 1C5TA 3LGWA 3NKKA 2PWXA 5DKMA 2CN0H 3MNSA 3L3TA 1KTSB 4ZROA 1V2TT 4K1SA 3ZVGA 1K21H 1H9HE 2GT7A 5HM2A 1SMFE 3SU3A 2VVVA 1BB0B 4HI3A 4Y6DA 1MKWH 1C1VH 1O35A 1C9TA 5I46H 1C1RA 1OOKB 3UTUH 4AORA 2DE9A 2OINA 1EAXA 1ANDA 2ZQ1A 5JBCS 5JYIA 5EQSA 3BV9B 1HFDA 2ZGXH 1TALA 3ZZBA 1C5YB 1C5VA 1QL8A 2BD2A 2FOHA 3B8JA 3LJOA 3TNSA 2ESTE 2JH0D 1JIMA 1K1NA 1C1NA 3SJOA 3DT0H 1N6XA 4BNRA 1QQUA 3SU2A 4K2YA 1O33A 4AN7A 2VIPA 5C3NA 3SU4A 5C5OA 5A0AE 5EXMA 3PTBA 4GCHG 1SSXA 2Y81A 2CXVA 1MBMA 3STJA 4WJG2 5AF9H 2PGBB 2A7CA 2B9LA 2R3UA 3NWUA 1O3LA 2VVUA 4Y10E 1GPZA 2F9BH 1EPTC 3A7WA 4CH8B 2G4UA 3F9HA 1MUEB 2PKSC 1QA7A 2PSXA 1D3PB 3ZZ9A 1F2SE 8ESTE 3F68H 1FUJA 1FQ3A 1UTKA 1CA0B 2A2XH 3LJJA
chains in the Genus database with same CATH superfamily
2LPRA 1E34B 1GBHA 3DFLA 1EAWA 3GDUA 3Q77A 3PMAB 1A5HA 1FI8A 1NRQH 5T6DA 4MDSA 4AYVB 1D3TB 5HIYA 1GBLA 2G5VA 2AGGX 4LXBH 5L2ZH 3S9CA 2BQWB 1DXPA 4H42U 1ZGVA 3SZNA 4KTCA 5E2PA 1S83A 1UVUH 1T8LA 1Y3UA 3GCTF 2RA0A 1PJPA 1NTPA 1KTTB 1V2JT 3H09A 3T62A 4E7RG 3BTDE 4FUHA 3L33A 4FU8A 4UFGH 2BVRH 2NU0E 4B74A 1C2KA 3V7TA 3AASA 2GMTC 3A82A 2UWLA 1S0RA 3ATLA 1HAOH 3SZEA 1HAXB 2WPIS 4NA7A 1G2MA 3OEED 3D65E 2HPPH 4KELA 4D7FA 2A5KA 1UTQA 1UK2A 3RMLH 2GDDA 2FYQA 1OP2A 2PKAB 1OWDA 3PRBA 4YESB 1FV9A 3F2HA 4ABDA 4NA8A 5LPEA 3RC5A 2LP6A 2B8OH 2OK5A 3F0PA 1GHAG 5J4QA 3HKJB 1W8BH 5A8XA 1O2VA 1KDQB 3RXRA 3KYGA 4FUFA 4YLUA 5B6OA 2ODQA 3M7QA 3VB3A 3PV4A 5JBBS 1O2TA 4ASUD 4AOQA 4BTTB 5TCCA 2P95A 2W7SA 1PPZA 1UO6A 2YOLA 3ODFA 2BY5X 1FZZA 2KZ4A 2PTNA 3ITIA 4FU7A 1N8OB 3RXUA 4HGCA 1MD7A 1AFEH 1TBZH 3P17H 3SJ9A 3M3SA 4FUGA 1TGBA 2FI5E 2AS9A 2CHAB 5C67A 2SFAA 1KXFA 1ELEE 2ZA5A 2O8MA 3ZVFA 4FUBA 3U98H 3WY8A 1O2IA 4H4FA 2ZECA 1GMDF 3QO6A 3RMMH 3F0OA 3G01A 1GMCG 1DVAH 2ZHFH 5KGOA 1U6QA 1ZJDA 2V0BA 2HVXA 1GI0A 2XOKD 3SNAA 3AW0A 2RCEA 4JYVH 2PKAA 3UFAA 3V3MA 5HM9A 3F6UH 2ZHDA 4ISLA 1QHRB 1QL7A 1DPOA 1Z6JH 1UVTH 3N99A 2QXIA 3MYWA 4FUIA 3ZZ3A 1FY5A 1KDQA 3RU4D 4TT3D 4F48B 2JETB 1JMOH 1BRCE 3F1SB 1C1MA 1DITH 3S69A 2BD7A 4RN6A 3R0FA 3UWJH 1QFKH 3U69H 2ZEBA 4ACAA 2ZGHA 1CSOE 1O2KA 2AHME 4TPYA 5EGMA 2Z7FE 1XKBC 1O2JA 2NU3E 1GJBB 2ZG0H 4AG2A 5F8XA 4AZ2B 2P8OC 1W3CA 4SGBE 1A1RA 1DFPA 1LPGB 4XSKU 4Y8YA 1ZTKA 1P09A 1JRSA 1LHGH 5T6FA 3HKIB 1DSTA 3LIWA 5EXNA 4ABGA 3EDXB 2ZPRA 1ZTJA 2G55A 1TGNA 5LPFA 1W14U 2BLOA 5FAHA 1VJ9U 1RXPA 1ABJH 2FDAA 4X6MA 2C8XB 2A1DB 4Y79A 1C4U2 4TYDA 3TJOA 2BXTH 3FO8D 6GCHF 2VVCA 2ZTYA 3PLPA 1BMLA 3SYJA 4IMZA 2BDYA 2VIVA 2VWNA 3E6PH 1G3CA 1PPEE 1YCPK 4MLFB 3U28C 1ZPZA 4IN1A 4BAHB 2Y5GA 1O2GH 4O03A 1PPGE 1K1PA 1UCYK 3GDVA 1O3GA 1DWDH 2A7HA 5JB9S 6ESTA 2UUJB 3QK1A 1UMAH 4X1QU 1ZPBA 1ELTA 1A0LA 1UTNA 1GBKA 2H1UA 2OP9A 3HGPA 2AIPA 3P92A 3A7ZA 5EJLA 5FBIA 1AN1E 2EEKA 2Y7XA 2BQ6B 1KXDA 1VGCC 1PPBH 2FZZA 2XWBI 1G3BA 4NIYA 1KIGH 1ELAA 3MNCA 2A7JA 1P05A 1O5DH 1ZYOA 1MTNB 3VGCB 1IQFA 1NY22 2ANWA 2HRVA 5L30H 4DOQA 1T4VH 2QXJA 1QB6A 4BANB 2ZU3A 3MNXA 3SJIA 1ZGIA 2PUQH 1RJXB 1Q3XA 1YPJH 4I86A 4B2AA 1TMBH 4CHAB 3SV9A 3KQ5A 4UEHH 1D4PB 1B7XB 4P00A 3RM0H 1O30A 3RXAA 2P3UB 1C1OA 1EJAA 3BTME 5C1YA 5DPAA 2J9NA 2GCTC 3PTNA 2AMDA 4AGKA 5BPEA 2UUFB 1GMHF 4A5TS 1NZQH 1DX5M 1FN6A 1G32B 2QE7D 1T31A 5LPRA 1QBVH 3ESTA 3PO1C 5C0TA 1LCYA 2Y5FA 2ZZUH 4XE4A 1GJ4H 1UVOA 2V3OH 4O3UA 3TGJE 3M5NA 1HCGA 1M9UA 2WV9A 1FMGA 1JOUB 1P8VC 1GI8B 1F92A 2IJOB 2ILNA 5EJZA 5SGAE 2C90B 4AYYB 1O3PB 5GJ4B 2GZ7A 1SQOA 1O3IA 1DICA 4B1TA 3SO3A 1V2ST 2ZU5A 3AW1A 1G37A 2BM2A 2ASUB 2A5AA 1TFXA 2AH4X 3P8OA 3BTFE 2SGDE 3VFEA 1K28D 2H9HA 1PFXC 3ZVCA 4KP0A 5EOKA 4WY3A 2WHXA 1Z1JA 1G3EA 2C8WB 3A83A 4YXWD 5K0HA 1MTSA 2VIQA 3LC5A 3WW7A 2EI8A 1MKWK 1EP6A 5A0CA 2Q6DA 3SOSA 3IITA 2ZQ2A 2VGCC 2YMSC 1LPKB 2VJ1A 2CGAA 3MNBA 2BD8A 4E06H 1SBWA 1UK3A 1EPTB 1FDPA 1MKXH 2H5DA 1GBIA 2A4OA 2VB0A 1NT1A 4Q7YA 3H7TA 1ELVA 1C2DA 1B0EA 2BX3A 3RDZA 4YT6H 4VGCB 1GHBF 1MZDA 2C4FH 1SB1H 2VIWA 1YPHC 4JCNA 3SV2H 2BXUH 2ZTZA 1HJ8A 3SHCH 3S9AA 2Z3EA 2F83A 2P3TB 3ELAH 5HIZA 1ANEA 3PMJA 5FHTA 1AO5A 2W6JD 1AGJA 2STAE 4FU9A 1FY1A 1WUNH 4BAOB 1KXCA 1VCPA 2LELA 2WPLS 1HAGE 2XW9A 2A5IA 1GJ6A 2FYRA 2JH5D 1G30B 1TX8A 2GMTB 1P02A 3M5LA 1D3QB 2L6OA 4RT0A 1P10A 1WCZA 1Y3WA 1HV7A 1AU8A 4KKDA 5DP7A 6CHAC 2BDIA 4CBNA 1DOJA 1A3BH 1LDTT 1RS0A 4A92A 2R0LA 4MQAA 1EPTA 3HGNA 1KYNA 4B6FA 1N8OC 1S84A 3GY5A 1TLDA 1GHWH 3LH3A 1V6DA 2AYWA 1QRZA 1TNHA 2CHAC 2BHGA 3UUZA 2SGFE 1ZMJA 2AMPA 4HG6A 2EA3A 3W95A 1GGDC 1SQRA 2VU8E 1H9IE 1EJNA 1LMWB 5BRRE 3VXFH 2Y80A 4NA9H 1WBGB 1GI3A 1C5RA 5FPYA 4QT8C 5HXFA 4DT4A 1P3CA 2OUAA 3BTEE 5DP6A 3A81A 1HJAC 2Z9KA 3FVFB 3TJUA 3UPEA 1BTPA 2VIDA 4Y0YE 2HALA 1SGTA 4DURA 2ZC9H 3HK6B 1S6LA 1T8NA 4K8BA 1IHTH 2BDHA 1NM6A 2ANKH 5DO4H 4WVPE 2FO9A 1GBAA 1SLUB 1IQEA 4Z6AH 1KLTA 4BOHA 4Y8XA 3TJNA 1H8ED 1AFQB 5A8ZA 2GT8A 3BEIB 1QB1A 1YBWA 1WTHD 1C9PA 3TU7H 5DP8A 1GHZA 1OWIA 2Z9JA 4CREA 1TQ7B 2RFKC 1O2UA 1UCYH 3PV2A 3U8TH 1HRTH 2YNAA 2H6MA 1CBWB 2F9VA 2F9OA 1K1IA 4NSYA 4NGAH 1IQNA 1HBTH 1IQKA 1JXPA 1MH0A 2CF9H 4RT1A 2WPJS 4D9RA 4ZKNU 4ZXXH 1OYQA 1YLCA 2P8OB 4DY7B 3UWIA 3KHVA 2V3MA 1LKAA 4O97A 2XCFA 4TPIZ 1RD3B 1J8AA 2DE8A 2OBQA 4ISOA 4IN2A 3AK5A 3UREA 2XBXA 4M7GA 3LONA 1V2PT 4AFQA 1TAWA 1O3BA 1D9IA 2Z3DA 2JJ2D 2AGIX 4AFUA 1ELCA 1CHOF 4O3TA 3SW2B 2FI4E 3NZIA 4X8UH 3MH5A 4NZQA 3S9BA 4OGYA 3UR9A 3GCHB 5HMAA 4ZXYH 1BOQA 3OEHD 2J97A 3PV5A 1HAIH 1GBTA 1SVPA 4X8VH 3VPKA 3SV6A 3NCLA 3HK3B 2KM0A 2XXLA 3PRDA 1FPCH 3M3VA 4B75A 1T4UH 1BRAA 4ZHMU 3TVJB 3TGIE 1BBRH 2B7DH 1LQDB 2AGEX 1BJVA 3V13A 2GV7A 4DCDA 2FTMA 1ELFA 2GZ8A 1JBUH 3OE7D 3R3GB 2OC7A 1EP5A 5DK1A 4BTIB 4ZCNA 1AHTH 3K9XB 3M36A 3SU5A 2H9EH 4AG1A 2TPIZ 1VGCB 2Z6BD 2GVFA 4CHAC 4CBOA 2CMYA 4MPWA 3DD2H 1O2NA 2FOGA 2FOEA 1TNGA 2W3IA 4ZKSU 4CRBA 2OCVB 3TH2H 3MQKC 5CHBA 1ZHMA 2QGRA 1KXBA 1O3AA 1QBOA 3I77A 1DDJA 1LVYA 2ALPA 2FOMB 4YOGA 1AB9C 1GJ8B 3URDA 1K9OE 1SPJA 5DGJA 3FKSD 3TLOA 5C2ZA 1T8OA 4XBBA 1THRH 5JPMH 1SGFG 1MMJN 1L1JA 1CA8B 4OM9A 2I6QA 1D6WA 1DUAA 1PPHE 1SR5C 2BLWA 2GCTB 4WMDA 2PLXA 2QY0B 5F8TA 2A32A 4R0IA 5HGGA 3EA7A 1NBME 3BSQA 3E91A 3PO1B 2ZCHP 4F49A 3UQOA 2BVSH 1A0JA 1UTJA 3KN2A 1OS8A 3U1JB 2I6SA 2V6NA 1L4DA 1QGFA 2SNWA 1GJCB 1GBJA 2Q1JA 1C2IA 3GICB 1TBQH 3BTTE 3RLWH 1O0DH 2Y7ZA 3E90B 3F2FA 1QRXA 1K22H 3A80A 2VH0A 4FUJA 3SNDA 4KTUA 5ABWA 2J95A 1W0KD 4ASHA 2WPHS 2Z9LA 3U8RH 1F0UA 2NU1E 5T1VA 5FL7D 1MAYA 4ABHA 2JKHA 2ZDKA 2ZDAH 3EQ0H 3F9EA 2K0QA 4NIWA 4Y8ZA 3A89A 3ZZ5A 3P8NA 1BTYA 1DANH 2FODA 4TY7A 3QTVH 1XUHA 1W7GH 4VGCC 2A4QA 1FAXA 4GUXA 5HYOA 2A2QH 2ZDMA 1YWUA 1OSSA 1W0JD 4DJZB 1AD8H 5AFZH 2VGCB 2SGQE 2YMSB 4NWLA 1G9IE 2F9NA 1WTGH 3RXDA 1ZSKA 5E0HA 2V3HH 1O37A 3FANA 1UTLM 4YOJA 1IQHA 9LPRA 3A87A 3HPTB 1KMHB 1K1LA 1VITF 1K0HA 3KGPA 5GXPA 1WSSH 5G4BA 3UY9A 1O34A 1OXGA 4MNWA 2A0QB 7ESTE 1JRTA 2HWLB 1SLVB 4MVNA 1ZHPA 3MU8A 1BMNH 1JIRA 4FVDA 1FY8E 5GCHG 1ZZZA 3FP7E 4X1RU 4UDWH 2ZFSA 8GCHG 1XM1A 1YLNA 3KQCA 4B73A 2AMQA 4DG4A 3BIVH 1W2KH 3P6ZB 1MKXK 2ANMH 1ESAA 3DCLA 1GBEA 1K2I1 2GTBA 2VNTA 3WWBA 1ZR0A 3TK5A 1A4WH 1O2WA 4LZ1H 2UWOA 5B6LA 3ZZ6A 1NPMA 3Q3YA 2GDEH 1NS3A 2G52A 4OS6A 1V2QT 5JBTA 4R8TB 4Q63A 1PYTD 6CHAB 1SHHB 1RTKA 2WUCA 2XTTB 1NN6A 1KLIH 5EG4A 3SI3H 2SGEE 2GCHG 5ETXA 2ANYA 3VB7A 2A31A 1TNLA 3EAJA 1ELDE 1VR1H 2C8YB 2PTCE 3E8LA 4A1XA 3S7HB 5T3HA 1MU6B 2RG3A 1MABB 1L1GA 2PP6A 1GI6A 2TGDA 1GGDB 1GJ9B 1TX6A 3A7YA 1DLKB 1C5WB 2THFB 2Y82A 1V2RT 1O3MA 1HPGA 1J16A 1FIZA 2C8ZB 4YZUA 1VCWA 1HIAB 4H6TA 1AFQC 3QGNB 1SGYE 1K1OA 4ZKRU 5C20A 1HJAB 4OS2A 1PYTC 4I8GA 5L6NH 3QUMP 2ZKSA 1GWAA 1G3DA 1O3DA 3E0NB 3MO6A 1UJ1A 3BTQE 3RXJA 1UTMA 3ZZAA 3SV7A 3V0XA 1XKAC 4P02A 3GY6A 4INKA 1ELBA 1P9UA 1CBWC 1DS2E 1GJDB 5FX5A 4NIVA 2OLGA 3PMHB 4D76A 2M5TA 1DUEA 1MU8B 2BLVA 2EY4C 2QXHA 3AAVA 3F9GA 1NFUA 3PWCA 2XC4A 4AGJA 1BZXE 3W1EA 1O3FA 2RDLA 3UOUA 1YPHE 1HB0B 2R9PA 2ZU1A 4K8YA 1K1MA 1BMMH 1A2CH 3EA8A 3E0PB 2ZIQH 2FX6A 4TSFD 3B23B 4Y76A 1FONA 2W3KA 1UK4A 1TA2A 3SI4H 1H8IH 2ZPSA 3GCHC 3PROA 4XRNA 1BDAA 1ZOMA 1P11E 3BTGE 1H1BA 1O3CA 1P2MA 1LVOA 1SC8U 3MO9A 1T8MA 1GCDA 3OY5U 4X2XA 4DGJA 3QWCH 4MNYA 2OQUA 2TIOA 4NFEA 1AMHA 7GCHG 1P57B 1TNIA 1SGIB 4XD7D 1LHEH 1YPLH 4I7YH 2CJIA 1CQQA 2F9PA 2XBVA 3FP8E 4I8KA 4WMEA 3T26A 4GAWA 1FY3A 2BZ6H 5GDSH 1FXYA 1QNJA 3RXLA 1YPEH 1TQ0B 1LKBA 4MPUA 4WWYA 2FPZA 3OX7U 3SGBE 3UR6A 1P12E 2ZHWH 2F4LA 1EZSC 1S0QA 2HNTC 3GISB 3NXPA 4NG9H 3MH4A 3MI4A 2FLRH 3M37A 1C5LH 2XNIA 2KR7A 1BT7A 1SL3A 1SHYA 3ZVDA 3IWMA 5F8ZA 4ABJA 1TOCB 2FP7B 1SFQB 2G81E 4PROA 3SGQE 3Q00A 4X0WU 3H7OA 1EAIA 1YPMH 2GD4B 2QYIA 1J9CH 1F7ZA 3LDXH 1GBDA 3AVZA 3LPRA 4CH2B 1P2QA 1AZZA 1OP8A 4YT7H 1LVBA 4D7GA 3N7EA 1W7XH 2ZPQA 2BMGB 1ESTA 1UTPA 1BBRK 4ABIA 3UOPA 4Y71A 5C0UA 1AB9B 3SUFA 1FAKH 1ORFA 1BRUP 1YGCH 2FS9A 4HTCH 3VB4A 1WXRA 3DSGA 1EFRD 3EA9A 3QZRA 2KCYA 2YMSD 3M35A 4X6PA 4UE7H 1LO6A 4E7NA 1GI5A 1C5NH 3NUMA 5AHGH 3U1IB 1EX3A 3DSPA 2GP9B 1UCYE 3P95A 3ZV9A 1OWEA 2BDGA 2ZGJA 3O8BA 4FUDA 1O3JA 1SGDE 3CNRA 1EZXC 3LU9B 1W11U 2G4TA 1YC0A 1FNIA 2P16A 4X6OA 1ZSJA 1OX1A 3JZ2B 1ABIH 2ZFQH 1C1WH 3RXGA 1THPB 3QTOH 1TNKA 1Y3XA 3QX5H 3PLBA 5GPIB 1F5KU 2FOFA 3GCTG 1TYNA 3SJKA 1S82A 3BN9A 2D8WA 1O36A 1HJ9A 1BJUA 3KEEA 5E0GA 3TNTA 4BAKB 4RKJB 1O3OA 3A86A 3QN7A 1UVSH 2ZU2A 1O2XA 3PMBB 2M2AA 4AFZA 1ZMNA 1S6HA 2WYJA 4NWKA 4X6NA 1KSNA 1CT4E 2WPKS 3UIRA 1SGRE 1TPAE 4X2YA 4GCHF 4JZ1A 2VIOA 1RIWB 1ZRKA 5A09A 4I8JA 3LGTA 1LPZB 3FZZA 3TH3H 1NRSH 1O2SA 1HAPH 1TA6A 3SNEA 1F5RA 1V2LT 3TJVA 1VJAU 2QF3A 2ALVA 1AWFH 3M61U 1Y5BT 3LGUA 2XWAA 4U01A 2VWOA 3EE0B 1ARBA 1DE7H 2ZCLP 4ZAEA 2IJD1 5EPNA 1TE0A 5C1UA 4WF8A 5F53A 3RXTA 1UHBB 4B2CA 1SQAA 1E1QD 4SGAE 4ISIH 1BRBE 2FMJA 2TRMA 4CR9A 1P01A 2GX4A 1YCPM 3A84A 5E8EH 5EIYA 1GCTB 2LNCA 3O8CA 5EXLA 3OTJE 1GG6B 5EW1H 1GMDG 4XFQA 1NRNH 3UB0A 1CGIE 1XVMA 3A8DA 3EGKH 3EE7A 3O8DA 1IOEA 1BHXF 3RM2H 1O5BB 1HYLA 2KCAA 2Q6FA 2P94A 2QA9E 5FXLA 3SU0A 4GVUA 1CGJE 5DJ7A 3EYDA 1GDNA 4JYUH 1ACBE 2ZDVH 1O2HA 4LK4A 2NU4E 4AC9A 2BX4A 1H4WA 3FOAA 4NZLA 1QJ1B 3BTHE 1MAXA 2BOKA 3E16B 1GHYH 5DP3A 1HUTH 5AVDA 1GHAF 5H4IB 1NRRH 3SHAH 1XVOA 2F9UA 4J1YA 2GZ9A 1DXWA 2Z3CA 1Z8JB 1AIXH 1QCPA 2HLCA 1NFXA 3UNRA 4JZEH 1GDUA 1WU1A 5C1XA 2FIRH 1OWJA 1UHBA 1WDIA 3A8AA 3WWFA 1ZLRA 1CHGA 1NC6A 1GBCA 3T29A 3QZQA 2C3SA 1C5ZB 1UVPA 1QY6A 2Y6TA 3VG8A 5IDKA 2R3YA 1ARCA 1RTLA 6GCHG 2STBE 2D26C 3RXVA 1AUTC 2TBSA 2WPDD 1FLEE 2WSSD 1E36B 5LGOA 1P04A 3LKWA 1QTFA 2FI3E 2TGTA 4WXIA 1GMCF 3RUOA 2XC5A 2BY7X 3SU6A 2A4GA 1SGFA 1EOJA 1OPHB 5EW2H 1A5GH 1Y5UT 2OC8A 3U9AH 1EAUA 1HDTH 1C2FA 2P3FH 3SORA 1QL9A 5E0JA 1C2GA 8KME2 2JJ1D 2HGTH 2F43B 1XXDA 1SOTA 3KCGH 3W94A 1GL1A 2C93B 4ZUHA 1F0RA 1W0YH 4LOYH 1PQAA 4I8HA 2Z94A 1A5IA 1ETSH 3RC6A 1BHXB 1GI7B 3RP2A 1HAVB 9ESTA 4E05H 1EKBB 2ZFTA 2QV1A 2ZGBH 4D9QA 2GKVE 4A1TA 1V2UT 1ZRBA 3PYHA 4Y7AA 3FZDA 1HAZB 2J98B 1V2OT 4FVBA 1HGTH 2YNBA 1RRKA 3T5FH 3SBKA 7LPRA 5CHAC 1TRYA 2CV3A 3D23A 1C2JA 1C2HA 1DY8A 2F91A 3GY4A 2R2WU 1GBMA 1LQEA 2NU2E 2ZHEH 1BTWA 1SGQE 2B0FA 2WINI 1EJMA 1WQSA 1P06A 2ZI2H 1GMHG 1GBFA 4B2BA 1FY4A 3LGYA 1LHDH 4TWWA 1C5PA 4X1PU 2L74A 3MU5A 1C1UH 4K5ZA 3TK6A 1Z8RA 2JDID 3NK8A 4I32A 1IQJA 2ZO3H 3LC3A 1NRPH 3ZVBA 2PUXB 5DP4A 5C5NA 4ESTE 2FM2A 1LHCH 4X2VA 1O2MA 4Q7ZA 1GVZA 1YY3A 4O9VA 3M5MA 2A4RA 3MOCA 5LH8A 2UWPA 3RXOA 1P03A 3C27B 1EASA 1Z1IA 4FUCA 3MH7A 3K6ZA 5ESTE 1MCVA 4ACBA 3S7KB 4RI0A 4ZHAA 4FOUC 1DWBH 5CMXH 1XMNB 3BEFB 1O5CB 3LGIA 2OC0A 1GVLA 1TPPA 1W12U 2O9QA 1VKYA 2BD5A 3ZVAA 4MPXA 4IC6A 1ETTH 5C17A 3TITA 2AIQA 1C5MD 1DM4B 3ZZDA 3ZZ8A 2SGPE 1J15A 3SQHE 1XUJA 2VH6A 3KF2A 1EUFA 3BTKE 4DIIH 3ZZ4A 1GDQA 2EI6A 4GHQA 3N7OA 3RXQA 1SQTA 1GHVH 1SI5H 1LTOA 4IGDA 1QR3E 3A8CA 4IW4E 3Q3KA 1OYTH 4ZHLU 3P8GA 1GHBG 1HXFH 3H5CB 2ZP0H 2BY6X 4WMFA 1P2OA 3CENA 3Q76A 2AERH 2BDCA 2FS8A 1ANBA 3RMNH 1UTOA 4UD9H 1C2EA 1WV7H 1HAHH 1CGHA 3KQBA 1CE5A 1Y3VA 4YO9A 5TCAA 4Z1MD 2P93A 1D6RA 3KL6A 1QB9A 3RMOH 2Y5HA 4AB8A 2OBOA 2FX4A 1O2RA 2QAAA 1H8HD 3RU4E 3VB6A 4Q4LA 3SU1A 1RIWC 5CE1A 1N6YA 1TRNA 1ZTLA 4D8NA 3FN8A 1ZPCA 5JDUB 1D3DB 1V2WT 3GYLB 1C5UA 2J38A 3MMGA 1NU7B 4NSVA 4IC5A 5A8YA 1GI2A 1GJAB 1BTUA 3U8OH 4Q80A 3ENSB 1EATA 1EXFA 4CRFA 1O2ZA 2HNTE 5AFYH 3BF6H 1S81A 2BD9A 2BZAA 4A1VA 3QLPH 3SQEE 5JBAS 2GGVB 2IPQX 1UW7A 1GJ5H 1N1LA 1AKSB 3OY6U 1EOLA 1O5GH 5F6MA 1ZSLA 1XX9A 3RXIA 1L2EA 1YM0A 2OD3B 4JMYA 4BXSA 3ATMA 1O2YA 1SGCA 1THSH 4AX9H 2J4IA 4MPVA 1QQ4A 3F3BA 2IPHA 4F4OC 1T32A 1GCTC 3T2NA 1CU1A 2G8TA 1GG6C 1INCA 5DN6D 2HOBA 1VZQH 2IN2A 2BB4A 1O5FH 1C1SA 1O2OA 3LT3A 4KGAA 5I25A 1Z8GA 4DIHH 1GL0E 3K6YA 4I8LA 2G51A 5HKKD 5F03A 1TB6H 1TOMH 1XUIA 1AQ7A 1PPFE 4OGXA 4RSPA 4DVAU 1TONA 3SNBA 1NESE 1QURH 3FFGA 1XUGA 3ODDA 5IYTA 3M5OA 1CVWH 2Z9IA 1GBBA 4BXWA 4JZDH 1E38B 3MU0A 1NBMD 5FBEA 1FX0B 1AI8H 1L1NA 4CRGA 4ISNA 3K65B 4FUEA 3PWBA 1WYKA 1AKSA 5ESBA 4FXGH 1S85A 3MFJA 1S6FA 1SLXB 1C5SA 1MZAA 3F9FA 4XBCA 1OP0A 2CF8H 1YPKH 1MD8A 3SUGA 1AY6H 2BLQA 2KAIB 4K3JA 4F55A 1O38A 3TH4H 1QJ6B 4TY6A 3ZIAD 2FTLE 3GCOA 1NU9A 2XC0A 3D49H 4YOIA 4A6LA 1HAYB 5EQQA 2PW8H 1HXEH 5FPTA 4X8TH 4THNH 4Y0ZE 1QIXB 2H5CA 1KXEA 1T7CA 3TGKE 2JH6D 1BUIA 2H9TH 1ANCA 2ZFRH 3DUXH 4BAQB 2WUBA 3L6PA 5EQRA 5T6GA 3E3TA 4XOJA 4ABBA 2QXGA 2W5EA 4Q2KA 3M7TA 2ZFFH 3MU4A 1L0ZA 1SGPE 1CHOG 2O8UA 5GWZA 2SGAA 1ESBA 1BTHH 2BDAA 1CT0E 1BIOA 2TGPZ 3RXEA 3BG4B 1Y59T 1O2LA 1IQIA 1C4Y2 1TABE 1ZHRA 1O31A 2FWWA 3QGJA 5E2OA 1BCUH 1GVKB 2FOBA 1XUFA 2NWNA 1HIAA 2F3CE 1WQVH 1NFYA 3GOVB 4UFEH 3RXCA 3O8RA 3CS7A 3UNSA 3UNQA 3UQVA 2DUCA 4KTSA 3RXHA 4X2WA 2KAIA 1AE5A 3ATWA 1O32A 1C5XB 1E37B 3RU4T 3T25A 1DLEA 2KFWA 1AVXA 1C1QA 3A7TA 2VWLA 4GHTA 1GI9B 2UUKB 1H8DH 2QF5A 2RDEA 1ID5H 1P3EA 1L4ZA 2PSYA 4I33A 4K69A 1A7SA 1MTWA 1V2NT 5GIBA 1BQYA 2QIQA 2RA3A 1MQ5A 1MTUA 3OTPA 1V3XA 4INLA 4JZFH 4IMQA 1C4V2 2BY9X 3PM3A 1SKYE 3AAUA 1SOZA 2ZDLA 3KQDA 1QJ7B 4YLQH 4DW2U 5CHAB 3SGAE 1BMAA 3A85A 2VINA 3BG8A 1IQMA 2W26A 2B5TB 2PFEA 2FEQH 1IQGA 1C5QA 5K7RA 1KXAA 4WH8A 4XDEA 5EPYA 1SLWB 3I78A 4RKOB 3P70B 2WZQA 3BTWE 1Y5AT 4XBDA 3GDSA 1C1PA 4BAMB 2WV4A 2VWMA 4CRAA 1Z8IB 1A61H 1NROH 2K8IA 4B76A 2BOHB 1E1RD 5FCRA 1EZQA 1O39A 4AB9A 1C2LA 2O8LA 3V12A 5KEDA 4WXVA 1TGTA 2OQ5A 3SUEA 4FETA 1ELGA 1YPGH 1TGCA 2QN5T 1G2LA 4MNXA 3GY8A 4B6EA 2EI7A 1TWXB 2W7UA 1AE8H 4MTBA 3SJ8A 3CS0A 3N7DA 4X1NU 3A7XA 1BTXA 3ATIA 3A7VA 5EU8A 3CP7A 3TPIZ 1CO7E 3GY3A 1TX7A 1HNEE 1TMTH 2XBYA 1DY9A 2QC2A 1TRMA 1P2JA 2CK3D 4U30A 4Y11E 4NIXA 3RXBA 2Q6GA 1P0SH 4K60A 2EC9H 1YP9A 2HPQH 3ATKA 5DSFA 4X8SH 1O5EH 1COWD 3MTYA 1V2MT 2XNDD 5IK2D 1E35B 1RTFB 3ZVEA 2AFQB 3OAAD 2UUYA 3BEUA 1TBRH 1VITG 3VB5A 4Q7XA 2WPMS 1F5LA 1RGQA 2J34A 3JZ1B 4K1EA 4Z0KA 1DT2A 1AVWA 1GJ7B 4JZIA 1CA0C 1Q2WA 1LVMA 2WV5A 1EZUC 3RC4A 1RFNA 2GV6A 2PHBA 1K1JA 1VCQA 1ZJKA 2FESH 3T28A 4AFSA 2HVYB 3MWIU 1C2MA 1KY9A 1W10U 1XXFA 4GPGA 1W0ZU 3LH1A 5DG6A 2J94A 4HZHA 2JIZD 3A88A 1YF4A 1BTZA 4JK5A 3DA9B 1BBRE 2PKSB 1O3KA 4MG3A 1DWEH 3RLYH 5L2YH 1X7AC 6LPRA 3RXMA 4BTUB 3GCNA 2W6ID 1MCTA 1FIWA 1P2IA 3OU0A 1QBNA 2BY8X 7KMEH 2BD4A 2BYAX 1TPOA 2KCOA 1Q31A 2FXRA 3PB1E 3K2UA 1WAYB 2FOAA 2H2ZA 1YYY1 2QF4A 2ZCKP 5JB8S 1IQLA 1O3NA 4LZ4B 1O2PA 3Q3XA 1OWHA 2D2DA 3PLKA 1AVGH 1P2NA 5TJXA 3I29A 1F0TA 3RXKA 5DP9A 2ZWLH 1DSUA 1TIOA 4YTAA 5FCKA 1BA8B 2XRCA 5FX6A 3MO3A 1FN8A 1Z71A 2ZHQH 1P9SA 3A8BA 2BQ7B 4J2YB 1PPCE 2ZFPH 3KNXA 1WOFA 2ZNKH 1Y3YA 1Y8TA 2TGAA 2XYAA 3E1XB 3GY2A 3ZV8A 4B71A 4X1SU 1S5SA 2A45B 4U32A 2ZU4A 5EODA 1YLDA 1NO9H 5GCHF 1FPHH 2R2MB 5FPSA 3SN8A 1JWTA 8GCHF 1YKTA 1O3HA 1C5OH 1DWCH 3OYPA 2J92A 2GJGA 3T27A 4YM9A 2QF0A 3QDZB 3KYFA 1HLTH 3MHWU 3D62A 1AWHB 2ZF0H 2XCNA 4OS1A 3RXSA 5A0BA 4K1TA 3NRLA 4GLYA 1SG8B 4ZMAH 2BD3A 1TPSA 4I31A 1GI4A 1A3EH 2HNTF 2V35A 5DP5A 4ZKOU 4IS5A 3P8FA 2BTCE 4Y7BA 1C1TA 1MQ6A 3URCA 4MNVA 4JK6A 2SNVA 1G36A 1GI1A 1ETRH 2K1QA 1BITA 2GCHF 2XBWA 2OC1A 3FAOA 4NCYA 5KECA 2O8TA 2JETC 2G5NA 1VITH 1CT2E 3SNCA 4INHA 1J14A 2OTVA 2IOTA 3TK9A 4UFFH 3RXFA 1TNJA 3KIDU 1BMFD 1H9LB 3BG4C 3ZZCA 1J17T 2O8WA 1SGEE 3VXEH 1O3EA 5J4SA 1B5GH 4OS7A 3IG6B 1YCPH 2PGQB 1QZ8A 1EB2A 2QCYA 5GNDA 1QRWA 1EQ9A 4UONA 1SFIA 3FP6E 2BVXH 3DHKH 2G00A 3VEQB 1V2VT 2BDBA 4ABFA 3RXPA 3F2GA 4OS5A 4TWYA 5C94A 2PR3A 2P59A 1GHXH 1KLJH 1XUKA 3S0NA 1SGNE 1TMUH 2FLBH 4CR5A 4U2WA 3ZYDA 1MBQA 5PTPA 1O5AB 3DSOA 3KQEA 5A2MH 2ZDNA 3HATH 4ISHH 4A7IB 1IAUA 4HFPB 4H6SB 1PQ8A 1V2KT 1PQ5A 3GY7A 1LHFH 1AUJA 2ZGCA 3LOXA 4JYTA 3M7UA 1E0FD 4ABAA 1AZ8A 1Z6EA 1A0HB 2OXSA 2VBCA 4ZH8A 3B9FH 1IHSH 3GS9A 1B0FA 1EB1H 2V7QD 2ZTXA 2EQNA 2J2UA 1OKXA 1MTVA 2PV9B 2WYGA 1F0SA 4IBLH 3SV8A 1NFWA 3MH6A 3STIA 4UFDH 2KX4A 1Z7KA 1W13U 2R0KA 2FOCA 1MTNC 1OWKA 3VGCC 4ABEA 4OS4A 3ZZ7A 4GSOA 3NPSA 1O2QA 3OSYA 4WH6A 7GCHF 2HLDD 3TIUA 1ZMLA 2AEIH 2ULLA 4CRDA 2ODPA 2Z9GA 2D1JA 1P2KA 3GYMA 3SUDA 4CRCA 3DFJA 1A46H 1TGSZ 3MU1A 4DT7B 1FJSA 1QA0A 8LPRA 3C1KA 1HAVA 2ODYB 3LGVA 3M3TA 1PQ7A 3BIUH 4NFFA 5EJ1A 3ZYEA 1E79D 1C5TA 3LGWA 3NKKA 2PWXA 5DKMA 2J98A 2CN0H 3MNSA 3L3TA 1KTSB 2J5UA 4ZROA 1V2TT 4K1SA 3ZVGA 2KCPA 1K21H 1H9HE 2GT7A 5HM2A 1SMFE 3SU3A 2VVVA 1BB0B 4HI3A 4Y6DA 1MKWH 1C1VH 1O35A 1C9TA 5I46H 1C1RA 1OOKB 3UTUH 4AORA 2DE9A 2OINA 1EAXA 1ANDA 2ZQ1A 5JBCS 5JYIA 5EQSA 3BV9B 1HFDA 1OHHD 1TALA 2ZGXH 3ZZBA 3UAIC 1C5YB 1C5VA 1QL8A 2BD2A 2FOHA 3B8JA 3LJOA 3TNSA 2ESTE 2JH0D 1JIMA 1K1NA 1C1NA 3SJOA 3DT0H 1N6XA 4BNRA 1QQUA 3SU2A 4K2YA 5CDFE 1O33A 4AN7A 2VIPA 5C3NA 3SU4A 5C5OA 3OFND 5A0AE 5EXMA 3PTBA 4GCHG 1SSXA 2Y81A 2CXVA 1MBMA 3STJA 4WJG2 4M9FA 5AF9H 2PGBB 2A7CA 2B9LA 2R3UA 3NWUA 1O3LA 2VVUA 4Y10E 1GPZA 2F9BH 1EPTC 3A7WA 4CH8B 2G4UA 3F9HA 1MUEB 2PKSC 1QA7A 2PSXA 1D3PB 3ZZ9A 1F2SE 8ESTE 3F68H 1FUJA 1FQ3A 1UTKA 1CA0B 2A2XH 3LJJA
chains in the Genus database with same CATH topology
2LPRA 1E34B 1GBHA 3DFLA 1EAWA 3GDUA 3Q77A 3PMAB 1A5HA 1FI8A 1NRQH 5T6DA 4MDSA 4AYVB 1D3TB 1GBLA 2G5VA 2AGGX 4LXBH 5L2ZH 3S9CA 2BQWB 1DXPA 4H42U 1ZGVA 3SZNA 4KTCA 5E2PA 1S83A 1UVUH 1T8LA 1Y3UA 3GCTF 2RA0A 1PJPA 1NTPA 1KTTB 1V2JT 3T62A 4E7RG 3BTDE 4FUHA 3L33A 4FU8A 4UFGH 2BVRH 2NU0E 4B74A 1C2KA 3V7TA 3AASA 2GMTC 3A82A 2UWLA 1S0RA 3ATLA 1HAOH 1HAXB 2WPIS 4NA7A 1G2MA 3D65E 2HPPH 4KELA 4D7FA 2A5KA 1UTQA 1UK2A 3RMLH 2GDDA 2FYQA 1OP2A 2PKAB 1OWDA 4YESB 1FV9A 4ABDA 4NA8A 5LPEA 3RC5A 2B8OH 1GHAG 5J4QA 3HKJB 1W8BH 5A8XA 1O2VA 1KDQB 3RXRA 4FUFA 4YLUA 5B6OA 2ODQA 3M7QA 3VB3A 3PV4A 5JBBS 1O2TA 4AOQA 4BTTB 5TCCA 2P95A 2W7SA 1PPZA 1UO6A 2YOLA 3ODFA 2BY5X 1FZZA 2PTNA 3ITIA 4FU7A 1N8OB 3RXUA 4HGCA 1MD7A 1AFEH 1TBZH 3P17H 3SJ9A 3M3SA 4FUGA 1TGBA 2FI5E 2AS9A 2CHAB 5C67A 2SFAA 1KXFA 1ELEE 2ZA5A 2O8MA 3ZVFA 4FUBA 3U98H 3WY8A 1O2IA 4H4FA 2ZECA 1GMDF 3QO6A 3RMMH 3G01A 1GMCG 1DVAH 2ZHFH 1U6QA 1ZJDA 2V0BA 2HVXA 1GI0A 3SNAA 3AW0A 2RCEA 4JYVH 2PKAA 3UFAA 3V3MA 5HM9A 3F6UH 2ZHDA 4ISLA 1QHRB 1QL7A 1DPOA 1Z6JH 1UVTH 2QXIA 3MYWA 4FUIA 3ZZ3A 1FY5A 1KDQA 3RU4D 2JETB 1JMOH 1BRCE 3F1SB 1C1MA 1DITH 3S69A 2BD7A 4RN6A 3R0FA 3UWJH 1QFKH 3U69H 2ZEBA 2ZGHA 1CSOE 1O2KA 4TPYA 5EGMA 2Z7FE 1XKBC 1O2JA 2NU3E 1GJBB 2ZG0H 4AG2A 5F8XA 4AZ2B 2P8OC 1W3CA 4SGBE 1A1RA 1DFPA 1LPGB 4XSKU 4Y8YA 1ZTKA 1P09A 1JRSA 1LHGH 5T6FA 3HKIB 1DSTA 3LIWA 5EXNA 4ABGA 3EDXB 2ZPRA 1ZTJA 2G55A 1TGNA 5LPFA 1W14U 2BLOA 5FAHA 1VJ9U 1RXPA 1ABJH 2FDAA 4X6MA 2C8XB 2A1DB 4Y79A 1C4U2 4TYDA 3TJOA 2BXTH 6GCHF 2VVCA 2ZTYA 3PLPA 1BMLA 4IMZA 2BDYA 2VIVA 2VWNA 3E6PH 1G3CA 1PPEE 1YCPK 4MLFB 1ZPZA 4IN1A 4BAHB 2Y5GA 1O2GH 4O03A 1PPGE 1K1PA 1UCYK 3GDVA 1O3GA 1DWDH 2A7HA 5JB9S 6ESTA 2UUJB 3QK1A 1UMAH 4X1QU 1ZPBA 1ELTA 1A0LA 1UTNA 1GBKA 2H1UA 2OP9A 3HGPA 2AIPA 3P92A 3A7ZA 5FBIA 1AN1E 2EEKA 2Y7XA 2BQ6B 1KXDA 1VGCC 1PPBH 2FZZA 2XWBI 1G3BA 4NIYA 1KIGH 1ELAA 3MNCA 2A7JA 1P05A 1O5DH 1ZYOA 1MTNB 3VGCB 1IQFA 1NY22 2ANWA 2HRVA 5L30H 4DOQA 1T4VH 2QXJA 1QB6A 4BANB 2ZU3A 3MNXA 3SJIA 1ZGIA 2PUQH 1RJXB 1Q3XA 1YPJH 4B2AA 1TMBH 4CHAB 3SV9A 4UEHH 1D4PB 1B7XB 3RM0H 1O30A 3RXAA 2P3UB 1C1OA 1EJAA 3BTME 5C1YA 5DPAA 2J9NA 2GCTC 3PTNA 2AMDA 4AGKA 5BPEA 2UUFB 1GMHF 4A5TS 1NZQH 1DX5M 1FN6A 1G32B 1T31A 5LPRA 1QBVH 3ESTA 3PO1C 1LCYA 2Y5FA 2ZZUH 4XE4A 1GJ4H 1UVOA 2V3OH 4O3UA 3TGJE 3M5NA 1HCGA 1M9UA 1FMGA 1JOUB 1P8VC 1GI8B 1F92A 2IJOB 2ILNA 5SGAE 2C90B 4AYYB 1O3PB 5GJ4B 2GZ7A 1SQOA 1O3IA 1DICA 4B1TA 3SO3A 1V2ST 2ZU5A 3AW1A 1G37A 2BM2A 2ASUB 2A5AA 1TFXA 2AH4X 3P8OA 3BTFE 2SGDE 3VFEA 1K28D 2H9HA 1PFXC 3ZVCA 4KP0A 5EOKA 4WY3A 1Z1JA 1G3EA 2C8WB 3A83A 5K0HA 1MTSA 2VIQA 3LC5A 2EI8A 1MKWK 1EP6A 5A0CA 2Q6DA 3SOSA 3IITA 2ZQ2A 2VGCC 1LPKB 2VJ1A 2CGAA 3MNBA 2BD8A 4E06H 1SBWA 1UK3A 1EPTB 1FDPA 1MKXH 2H5DA 1GBIA 2A4OA 2VB0A 1NT1A 4Q7YA 3H7TA 1ELVA 1C2DA 1B0EA 2BX3A 3RDZA 4YT6H 4VGCB 1GHBF 1MZDA 2C4FH 1SB1H 2VIWA 1YPHC 4JCNA 3SV2H 2BXUH 2ZTZA 1HJ8A 3SHCH 3S9AA 2Z3EA 2F83A 2P3TB 3ELAH 1ANEA 3PMJA 5FHTA 1AO5A 1AGJA 2STAE 4FU9A 1FY1A 1WUNH 4BAOB 1KXCA 1VCPA 2WPLS 1HAGE 2XW9A 2A5IA 1GJ6A 2FYRA 2JH5D 1G30B 1TX8A 2GMTB 1P02A 3M5LA 1D3QB 1P10A 1WCZA 1Y3WA 1HV7A 1AU8A 4KKDA 5DP7A 6CHAC 2BDIA 4CBNA 1DOJA 1A3BH 1LDTT 1RS0A 4A92A 2R0LA 4MQAA 1EPTA 3HGNA 1KYNA 1N8OC 1S84A 3GY5A 1TLDA 1GHWH 3LH3A 1V6DA 2AYWA 1QRZA 1TNHA 2CHAC 2BHGA 3UUZA 2SGFE 1ZMJA 2AMPA 2EA3A 3W95A 1GGDC 2VU8E 1H9IE 1EJNA 1LMWB 5BRRE 3VXFH 2Y80A 4NA9H 1WBGB 1GI3A 1C5RA 5FPYA 4QT8C 5HXFA 1P3CA 2OUAA 3BTEE 5DP6A 3A81A 1HJAC 2Z9KA 3FVFB 3TJUA 3UPEA 1BTPA 2VIDA 4Y0YE 2HALA 1SGTA 4DURA 2ZC9H 3HK6B 1T8NA 4K8BA 1IHTH 2BDHA 1NM6A 2ANKH 5DO4H 4WVPE 2FO9A 1GBAA 1SLUB 1IQEA 4Z6AH 1KLTA 4BOHA 4Y8XA 3TJNA 1AFQB 5A8ZA 2GT8A 3BEIB 1QB1A 1YBWA 1WTHD 1C9PA 3TU7H 5DP8A 1GHZA 1OWIA 2Z9JA 4CREA 1TQ7B 1O2UA 1UCYH 3U8TH 1HRTH 2YNAA 2H6MA 1CBWB 2F9VA 2F9OA 1K1IA 4NSYA 4NGAH 1IQNA 1HBTH 1IQKA 1JXPA 1MH0A 2CF9H 4D9RA 2WPJS 4ZKNU 4ZXXH 1OYQA 1YLCA 2P8OB 4DY7B 3UWIA 3KHVA 1LKAA 4O97A 2XCFA 4TPIZ 1RD3B 1J8AA 2DE8A 2OBQA 4ISOA 4IN2A 3UREA 2XBXA 4M7GA 3LONA 1V2PT 4AFQA 1TAWA 1O3BA 1D9IA 2Z3DA 2AGIX 4AFUA 1ELCA 1CHOF 4O3TA 3SW2B 2FI4E 3NZIA 4X8UH 3MH5A 4NZQA 3S9BA 4OGYA 3UR9A 3GCHB 5HMAA 4ZXYH 1BOQA 4X8VH 3VPKA 1HAIH 1GBTA 1SVPA 3SV6A 3NCLA 3HK3B 2XXLA 1FPCH 3M3VA 4B75A 1T4UH 1BRAA 4ZHMU 3TVJB 3TGIE 1BBRH 2B7DH 1LQDB 2AGEX 1BJVA 3V13A 2GV7A 4DCDA 2FTMA 1ELFA 2GZ8A 1JBUH 3R3GB 2OC7A 1EP5A 5DK1A 4BTIB 1AHTH 3K9XB 3M36A 3SU5A 2H9EH 4AG1A 2TPIZ 1VGCB 2Z6BD 2GVFA 4CHAC 4CBOA 2CMYA 4MPWA 3DD2H 1O2NA 2FOGA 2FOEA 1TNGA 2W3IA 4ZKSU 4CRBA 2OCVB 3TH2H 1ZHMA 2QGRA 1KXBA 1O3AA 1QBOA 3I77A 1DDJA 1LVYA 2ALPA 2FOMB 4YOGA 1AB9C 1GJ8B 3URDA 1K9OE 1SPJA 5DGJA 3TLOA 5C2ZA 1T8OA 4XBBA 1THRH 5JPMH 1SGFG 1MMJN 1L1JA 1CA8B 2I6QA 1D6WA 1DUAA 1PPHE 1SR5C 2BLWA 2GCTB 4WMDA 2PLXA 2QY0B 5F8TA 2A32A 4R0IA 5HGGA 3EA7A 3BSQA 3E91A 3PO1B 2ZCHP 4F49A 3UQOA 2BVSH 1A0JA 1UTJA 3KN2A 1OS8A 3U1JB 2I6SA 2V6NA 1L4DA 1QGFA 2SNWA 1GJCB 1GBJA 2Q1JA 1C2IA 3GICB 1TBQH 3BTTE 3RLWH 1O0DH 2Y7ZA 3E90B 1QRXA 1K22H 3A80A 2VH0A 4FUJA 3SNDA 4KTUA 5ABWA 2J95A 4ASHA 2WPHS 2Z9LA 3U8RH 1F0UA 2NU1E 1MAYA 4ABHA 2JKHA 2ZDKA 2ZDAH 3EQ0H 3F9EA 4NIWA 4Y8ZA 3A89A 3ZZ5A 3P8NA 1BTYA 1DANH 2FODA 4TY7A 3QTVH 1XUHA 1W7GH 4VGCC 2A4QA 1FAXA 4GUXA 5HYOA 2A2QH 2ZDMA 1OSSA 4DJZB 1AD8H 5AFZH 2VGCB 2SGQE 4NWLA 1G9IE 2F9NA 1WTGH 3RXDA 1ZSKA 5E0HA 2V3HH 1O37A 3FANA 1UTLM 4YOJA 1IQHA 9LPRA 3A87A 3HPTB 1VITF 1K1LA 3KGPA 5GXPA 1WSSH 5G4BA 3UY9A 1O34A 1OXGA 4MNWA 2A0QB 7ESTE 1JRTA 2HWLB 1SLVB 4MVNA 1ZHPA 3MU8A 1BMNH 1JIRA 4FVDA 1FY8E 5GCHG 1ZZZA 3FP7E 4X1RU 4UDWH 2ZFSA 8GCHG 1XM1A 3KQCA 4B73A 2AMQA 4DG4A 3BIVH 1W2KH 3P6ZB 1MKXK 2ANMH 1ESAA 1GBEA 1K2I1 2GTBA 2VNTA 1ZR0A 3TK5A 1A4WH 1O2WA 4LZ1H 2UWOA 3ZZ6A 1NPMA 3Q3YA 2GDEH 1NS3A 2G52A 4OS6A 1V2QT 5JBTA 4R8TB 1PYTD 6CHAB 1SHHB 1RTKA 2WUCA 2XTTB 1NN6A 1KLIH 5EG4A 3SI3H 2SGEE 2GCHG 5ETXA 2ANYA 3VB7A 2A31A 1TNLA 3EAJA 1ELDE 1VR1H 2C8YB 2PTCE 3E8LA 4A1XA 3S7HB 5T3HA 1MU6B 2RG3A 1L1GA 1GI6A 2TGDA 1GGDB 1GJ9B 1TX6A 3A7YA 1DLKB 1C5WB 2THFB 2Y82A 1V2RT 1O3MA 1HPGA 1J16A 1FIZA 2C8ZB 4YZUA 1VCWA 1HIAB 4H6TA 1AFQC 3QGNB 1SGYE 1K1OA 4ZKRU 5C20A 1HJAB 4OS2A 1PYTC 4I8GA 5L6NH 3QUMP 2ZKSA 1GWAA 1G3DA 1O3DA 3E0NB 3MO6A 1UJ1A 3BTQE 3RXJA 1UTMA 3ZZAA 3SV7A 3V0XA 1XKAC 3GY6A 4INKA 1ELBA 1P9UA 1CBWC 1DS2E 1GJDB 5FX5A 4NIVA 2OLGA 3PMHB 4D76A 2M5TA 1DUEA 1MU8B 2BLVA 2QXHA 3AAVA 3F9GA 1NFUA 3PWCA 2XC4A 4AGJA 1BZXE 1O3FA 2RDLA 3UOUA 1YPHE 1HB0B 2R9PA 2ZU1A 4K8YA 1K1MA 1BMMH 1A2CH 3EA8A 3E0PB 2ZIQH 2FX6A 3B23B 4Y76A 1FONA 2W3KA 1UK4A 1TA2A 3SI4H 1H8IH 2ZPSA 3GCHC 3PROA 1BDAA 1ZOMA 1P11E 3BTGE 1H1BA 1O3CA 1P2MA 1LVOA 1SC8U 3MO9A 1T8MA 1GCDA 3OY5U 4X2XA 4DGJA 3QWCH 4MNYA 2OQUA 2TIOA 4NFEA 1AMHA 7GCHG 1P57B 1TNIA 1SGIB 1LHEH 1YPLH 4I7YH 2CJIA 1CQQA 2F9PA 2XBVA 3FP8E 4I8KA 4WMEA 3T26A 4GAWA 1FY3A 2BZ6H 5GDSH 1FXYA 1QNJA 3RXLA 1YPEH 1TQ0B 1LKBA 4MPUA 4WWYA 2FPZA 3OX7U 3SGBE 3UR6A 1P12E 2ZHWH 1EZSC 1S0QA 2HNTC 3GISB 3NXPA 4NG9H 3MH4A 3MI4A 2FLRH 3M37A 1C5LH 2XNIA 1BT7A 1SL3A 1SHYA 3ZVDA 3IWMA 5F8ZA 4ABJA 1TOCB 2FP7B 1SFQB 2G81E 4PROA 3SGQE 3Q00A 4X0WU 3H7OA 1EAIA 1YPMH 2GD4B 2QYIA 1J9CH 1F7ZA 3LDXH 1GBDA 3AVZA 3LPRA 4CH2B 1P2QA 1AZZA 1OP8A 4YT7H 1LVBA 4D7GA 1W7XH 2ZPQA 2BMGB 1ESTA 1UTPA 1BBRK 4ABIA 3UOPA 4Y71A 1AB9B 3SUFA 1FAKH 1ORFA 1BRUP 1YGCH 2FS9A 4HTCH 3VB4A 3EA9A 3QZRA 3M35A 4X6PA 4UE7H 1LO6A 4E7NA 1GI5A 1C5NH 3NUMA 5AHGH 3U1IB 1EX3A 2GP9B 1UCYE 3P95A 3ZV9A 1OWEA 2BDGA 2ZGJA 3O8BA 4FUDA 1O3JA 1SGDE 1EZXC 3LU9B 1W11U 2G4TA 1YC0A 1FNIA 2P16A 4X6OA 1ZSJA 1OX1A 3JZ2B 1ABIH 2ZFQH 1C1WH 3RXGA 1THPB 3QTOH 1TNKA 1Y3XA 3QX5H 3PLBA 5GPIB 1F5KU 2FOFA 3GCTG 1TYNA 3SJKA 1S82A 3BN9A 2D8WA 1O36A 1HJ9A 1BJUA 3KEEA 5E0GA 3TNTA 4BAKB 4RKJB 1O3OA 3A86A 3QN7A 1UVSH 2ZU2A 1O2XA 3PMBB 4AFZA 1ZMNA 1S6HA 2WYJA 4NWKA 4X6NA 1KSNA 1CT4E 2WPKS 3UIRA 1SGRE 1TPAE 4X2YA 4GCHF 4JZ1A 2VIOA 1RIWB 1ZRKA 5A09A 4I8JA 3LGTA 1LPZB 3FZZA 3TH3H 1NRSH 1O2SA 1HAPH 1TA6A