1O2MA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2mA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2mA02
1L1JA 2ULLA 2QC2A 2Y5FA 4UFFH 1A2CH 1ABJH 1AKSB 2AS9A 2UWPA 1A0LA 5ETXA 1LVYA 2BDGA 1P06A 4K5ZA 1K1PA 3F9EA 1LMWB 1VITH 4CRBA 1MQ5A 1WTHD 5EGMA 4Y8YA 4X2XA 2H9TH 2KAIB 1SMFE 2LNCA 3RXEA 2PSXA 5DJ7A 3RXVA 4ISLA 5DP7A 2ZDMA 3U1IB 2NU0E 3UPEA 4XBBA 5DKMA 5A0AE 1SL3A 2FIRH 4GCHF 1V2NT 1D3DB 1C2GA 3Q00A 1HXEH 3P95A 3QZRA 1KIGH 2WPIS 4IMQA 3T25A 4JZDH 1WQSA 2PKSC 1BJVA 3S9AA 2GVFA 4A7IB 4D7GA 3SU0A 5FAHA 1HFDA 4DIHH 3DA9B 3WY8A 3QZQA 3RU4T 3UNSA 1C1QA 4NWLA 3M3VA 4B76A 3SNEA 1BRBE 4CREA 1M9UA 2BVSH 2W3IA 3SNAA 2BX3A 3GY7A 1LHDH 1BOQA 3TIUA 1A4WH 1GBIA 4ZKOU 1W0YH 1YPKH 3TK5A 1BHXF 1S81A 1FZZA 4CBOA 2HNTC 3L6PA 1BTXA 2VVUA 1MTUA 1BT7A 4WXVA 2NU1E 3MU0A 1TLDA 3GDUA 3LGYA 3PO1B 1GHZA 4D9QA 4KTSA 1ZHRA 3P92A 4JCNA 1GMDF 5L2ZH 3PMHB 1FN6A 1FJSA 4UD9H 1FIZA 1DWEH 2VNTA 2TPIZ 1F0SA 5C2ZA 4BXWA 1S5SA 1C4Y2 4Y8ZA 4NIYA 1DUAA 4NWKA 4U30A 3SQEE 2R9PA 3PB1E 1UO6A 1S0QA 3LPRA 1H9LB 1PPZA 1J9CH 1TRYA 1RIWB 1IQEA 1AFQB 2Z94A 1N6YA 1P2NA 1S6HA 4Y0ZE 2OUAA 2XCNA 1YC0A 1AHTH 5FBEA 1AQ7A 3LH3A 2FS9A 2BOHB 2FS8A 1EAIA 3H7OA 4IGDA 3U9AH 4E06H 1GBJA 3RXTA 1W2KH 3RM2H 2GMTB 3LH1A 1TB6H 3VFEA 3AW0A 2OC1A 2VB0A 4K2YA 1BRUP 3ZVDA 5HMAA 1EB2A 3KQBA 3SHCH 1BMNH 3LOXA 1T7CA 5LH8A 3U8RH 1L4ZA 1IHTH 4CHAC 3LJJA 4D7FA 1GI9B 5I25A 3ZVBA 1MBQA 4R0IA 1NRQH 1C5ZB 2BXUH 5DGJA 3MH7A 1TNKA 1MQ6A 2GV7A 2QCYA 2ZFTA 2GZ7A 1HAGE 3M36A 1N8OB 2FOBA 2ZWLH 2ALVA 1TNLA 2H1UA 1GI6A 1SHYA 2VWOA 1GHWH 1EXFA 1D6RA 5K0HA 1EPTC 3M5OA 1SFQB 3A7YA 1ZR0A 2ZHQH 2PUQH 4OS6A 1C1SA 1FNIA 2C8XB 1ZYOA 2R3YA 1QBOA 1P2OA 2QV1A 1O3NA 1HBTH 1IQNA 1O2IA 3STJA 2DE8A 2TRMA 3I77A 1MD7A 1TPSA 4XE4A 3SU4A 1QHRB 2J92A 1O5GH 1YCPM 4FVBA 4INKA 5FX5A 1O2KA 2FPZA 3F6UH 3KNXA 1LQDB 3QO6A 5AHGH 1KDQA 2XBWA 3SV6A 4WY3A 2F9PA 4Y8XA 1BBRE 3SUFA 3E91A 1GHAF 4BAMB 1AU8A 3EQ0H 2VGCB 3RC6A 1OS8A 1JRSA 1SG8B 3EAJA 2EI6A 2G5VA 3A7ZA 1MMJN 3A88A 3UY9A 5A2MH 1TPAE 1A0HB 1HJAC 1FONA 3MI4A 1O3EA 1OSSA 3OX7U 2OC8A 1EPTA 1TRNA 2BZAA 1OX1A 5DPAA 5A8YA 4JZ1A 5I46H 3VB4A 1O2UA 1DWDH 2STBE 3QLPH 3LGIA 4UFDH 1B0FA 3AVZA 2NU3E 3E8LA 4UFEH 2ODYB 3UQOA 1C5MD 3EDXB 2PR3A 2PW8H 8LPRA 1GVLA 1NTPA 4XFQA 1K1JA 4X6MA 1O3CA 3HATH 2QXIA 4X0WU 3CS0A 2Z9GA 3CENA 2F91A 2HRVA 2VWNA 4JZFH 4TY7A 1RGQA 3TNTA 2QY0B 2ZU2A 3A80A 3QTVH 1TFXA 4TWWA 1ZSLA 3FZDA 3R3GB 5AVDA 2O8UA 2V3HH 4BTIB 1NPMA 1GHYH 4Q7ZA 1GJCB 1LHCH 2PKAB 5T6DA 3W95A 2Y82A 3CS7A 3T27A 4CRFA 3UIRA 1P0SH 2ZHDA 3V7TA 4DIIH 5ESTE 1AZ8A 1XX9A 2JETB 1W7GH 4I8JA 2AMDA 5L2YH 5E8EH 1EKBB 3TGJE 1C5LH 1C5RA 3LC3A 1GDUA 7GCHF 4TY6A 2GCTB 1GHAG 3SUGA 1P2KA 3RC5A 1HJ8A 2P3UB 1DSTA 1E38B 1TNIA 3K9XB 2GT8A 3RXOA 1P8VC 2AIQA 5FX6A 2FOCA 5GWZA 1CSOE 1TNGA 1DWBH 1PPFE 4VGCC 4NCYA 4B71A 2HPQH 2IJOB 2AIPA 1KLIH 2FOEA 2ZIQH 2VGCC 1AWHB 1SQTA 4MPXA 1MAXA 2CHAC 1P2JA 2FLBH 2R3UA 2SGDE 4HFPB 1OKXA 4X1SU 4ZH8A 3BTKE 1UTMA 3S7HB 2Y81A 1AGJA 2H5DA 2Z9LA 3PMBB 1MKXH 3NPSA 2J34A 5EU8A 2BD2A 1C1PA 5EXNA 2P3FH 2A45B 1D9IA 2I6QA 1DOJA 1YPMH 3GISB 3SBKA 3MNBA 5DP8A 3U69H 2GP9B 1G36A 3MU8A 4DURA 2XWBI 1TQ0B 5HXFA 2RCEA 1C2MA 3GCTG 3UQVA 2AEIH 1V2JT 1NRSH 4Q7YA 1OWIA 3FAOA 3G01A 1O2TA 1ELVA 2C90B 1O5EH 1GMCG 5SGAE 1KYNA 1VCQA 4Y0YE 1KLTA 1EZUC 8GCHG 3UNRA 2PFEA 2FX6A 2ZU3A 2G51A 5HM2A 1QJ6B 3P8FA 4MTBA 1UMAH 5A8XA 1UTKA 1UVUH 3QGJA 1S84A 1OWHA 3TU7H 1AWFH 4ABDA 2SGEE 4ABFA 2K1QA 3BTHE 7GCHG 1PPGE 2O8TA 3T29A 7KMEH 1UTOA 1V2RT 4H42U 1GJBB 2XNIA 3M5MA 1TIOA 2Q6DA 3Q3KA 3BTFE 1DSUA 1SHHB 3LGWA 2AH4X 1WYKA 2GCHF 2A7CA 2A4QA 1Y3WA 3Q76A 1RFNA 1FI8A 3B23B 3Q3XA 1AE5A 1O2LA 5DP9A 1P57B 3OYPA 1O3JA 3MNCA 4X2VA 3GCHC 3KGPA 2ZCHP 1EAXA 2W5EA 4K60A 5DG6A 1EZXC 2ZHWH 1DLEA 4MDSA 1GBHA 1RIWC 3MU5A 2ZC9H 2BM2A 2VIPA 1C5XB 1AY6H 3NCLA 4SGBE 1O3AA 2ZDVH 1GJ7B 3A8CA 3SU6A 1K22H 2EEKA 4YLQH 3A89A 1YPGH 2Q6GA 1XXDA 2ZHFH 1W11U 4FUDA 1SOZA 1GBLA 1ANDA 2BZ6H 5LPEA 2ILNA 3P8OA 4AYVB 1O2ZA 3EGKH 2OXSA 1MCVA 1W12U 3OY6U 3ITIA 3SO3A 3SGQE 1C2JA 2A1DB 4YESB 1SGFG 1A61H 3ATWA 1Y3XA 1QURH 1C1WH 3K6ZA 4A5TS 3M7UA 1GGDB 3ODFA 2A31A 2VJ1A 3A87A 5EXLA 1MTNC 2BTCE 3GY4A 3BTGE 6GCHF 1YYY1 5JPMH 3NKKA 2B5TB 2BQ7B 2H6MA 6ESTA 1ZMLA 2WPLS 2H5CA 2AGIX 5B6OA 2ESTE 3RUOA 4OGXA 1RJXB 1XUKA 4I7YH 1L0ZA 2OBOA 3MMGA 4ABIA 2QF0A 4AZ2B 3SJOA 5DO4H 1G2LA 2ZGJA 1ELDE 1WOFA 1DANH 2ZQ1A 4PROA 1AD8H 5EW2H 1C1RA 5FPTA 4O9VA 4FUBA 3O8DA 3ZV9A 1G3EA 2WUCA 1K21H 4BTTB 2FOHA 1TX7A 4D8NA 1HJ9A 1EB1H 5LPFA 5FPSA 4MVNA 5DK1A 4BXSA 1FPHH 2THFB 1PJPA 1ZTKA 1SGFA 4UONA 3PLPA 1O5FH 1EOLA 1IQFA 1ELEE 2VIQA 2ZU1A 3PTNA 2QAAA 2FODA 4AG1A 4AX9H 1TOMH 1GPZA 2D2DA 3C1KA 4OS2A 4UEHH 1P11E 2ZNKH 1O3FA 1TMBH 4MG3A 4X8TH 2QXHA 2R0KA 1DDJA 4XBDA 1GMHG 5PTPA 4D9RA 1G3CA 3RLWH 1LDTT 3ELAH 3GDSA 1Y3YA 7LPRA 2RA3A 3DFLA 2A32A 1P10A 1SGTA 1HIAB 4AORA 4OS5A 2ANKH 3QK1A 4K8YA 1WCZA 1C4U2 1ZGVA 4KTUA 3SU2A 1ZPBA 1O2WA 2BVXH 3MU1A 4DCDA 1DY9A 3U8TH 2GZ8A 4FUIA 2J2UA 1W0ZU 1FDPA 1V2QT 2A2QH 4X2WA 4YT7H 1BCUH 1GBBA 1O34A 5T6FA 1HYLA 1CGIE 1ZPCA 1CGHA 2V6NA 1MD8A 1O39A 2BY9X 2XTTB 3M5LA 3PWCA 4AYYB 2FOAA 3MYWA 4B2BA 1VGCB 2FO9A 2XBYA 1GG6B 1H8DH 5F8ZA 2PKAA 2BHGA 1T32A 3HGNA 4X1QU 1GJDB 1QY6A 2A7JA 2CF9H 1MKWH 3P8NA 4BNRA 4A1TA 3TJVA 3BIVH 4AG2A 1SBWA 4ESTE 1UCYK 3SI4H 1GG6C 1E35B 4DGJA 4WH6A 1BDAA 1VGCC 1BTPA 1ZSKA 1S85A 4WH8A 1J16A 2ZDNA 1XKBC 3RC4A 4CRGA 4X8VH 2UUYA 1F5KU 1OWKA 3DFJA 5L30H 3MNSA 2ALPA 4U01A 2ODPA 5IDKA 1SOTA 3ZZBA 4BTUB 3SORA 1OP2A 1ZGIA 1OWJA 3BTQE 3HKJB 1SSXA 4NIWA 4NA8A 2VWLA 3RP2A 2DE9A 1K28D 2Z3EA 2PV9B 3M37A 2XCFA 1TPOA 1P2IA 1BMMH 4A1XA 3DUXH 1J8AA 3U98H 5EPYA 1A1RA 2ZPRA 1CA0C 1TRMA 4AFSA 4DT7B 2SGFE 3VGCC 1FIWA 2ZTYA 1FLEE 1V2LT 1BTHH 2AMPA 2PTCE 5EQSA 1ZMNA 4ABBA 4A92A 1SLXB 1KXDA 8GCHF 2BVRH 2BY8X 2P59A 2ZFSA 1KDQB 3D49H 2QXJA 2VU8E 2ZTZA 5E2OA 2F3CE 2V35A 1AUTC 1ZRBA 3AAVA 3O8BA 1ZZZA 2BDYA 5DP6A 3R0FA 1T31A 1XKAC 1DS2E 3RXUA 2ZPSA 4M7GA 4MNVA 3UREA 1UCYH 4NZQA 1AVGH 1AB9C 4I31A 1FY5A 1V2VT 2JKHA 5AFYH 1ELCA 4H6SB 4XSKU 4IN1A 1T4VH 4JYUH 1EJAA 2ZG0H 2PLXA 3RMMH 1S83A 2RA0A 5C67A 1GI5A 4Y7BA 1SGPE 1G37A 1O2MA 2FXRA 3KN2A 8ESTE 1BITA 2VH0A 1HAXB 2BX4A 4JMYA 3VB3A 1HDTH 4AFUA 3FZZA 2GZ9A 1DWCH 1PQAA 4AGKA 2W26A 3ZVEA 2W7SA 1HAHH 1AE8H 2OQ5A 3VPKA 1QL8A 3HPTB 2VVVA 4GHQA 2BD9A 1IAUA 1NN6A 2P94A 1QCPA 2F9VA 2C93B 3F9FA 4NSVA 3NWUA 3NUMA 3H7TA 2OTVA 2AERH 3QTOH 3BV9B 1GJ9B 1PPCE 1D3TB 2BD8A 2FI4E 2HPPH 1P2QA 5C3NA 1W10U 1EP6A 4DW2U 1YCPH 4Z6AH 3ATMA 4Y79A 2ZA5A 1YM0A 3PLBA 1ID5H 2PHBA 1KLJH 1Q3XA 5GIBA 2QGRA 1YCPK 2PSYA 3V13A 4Y7AA 1W7XH 1FAXA 1O3DA 3SNBA 1NZQH 1C1TA 1V2MT 5GDSH 1FUJA 4DVAU 1V3XA 1VCPA 1Z8RA 2XC4A 3BTDE 1ARCA 1SQOA 1GBEA 1QIXB 2BXTH 2I6SA 3BTTE 1O35A 1BQYA 2CMYA 3TJUA 4LK4A 2FESH 1CHOG 1CHOF 4ABAA 3ESTA 3GCHB 1SLVB 1GCDA 1KTTB 1D4PB 2J9NA 4K1SA 3A7TA 1WU1A 3M7TA 2CF8H 2YOLA 1TA2A 1U6QA 5E0GA 2C8WB 3KF2A 4Z0KA 5K7RA 2H9HA 1NESE 1ESAA 3A8AA 4ZXYH 2XBVA 1G3BA 1BTYA 2BQ6B 3ZVGA 1HV7A 4THNH 3S7KB 2ZZUH 3ZZ7A 3S9CA 3A8BA 2CXVA 2EC9H 1PPEE 1CT0E 1EP5A 3ZVCA 4D76A 3VXFH 1C2EA 3RXMA 4DY7B 1Z8IB 1PYTC 1C5UA 4JYTA 4JYVH 3BG4B 1N1LA 1ELAA 1GI1A 4I8GA 2BLVA 3A85A 3PM3A 3VEQB 2FP7B 1O36A 3MU4A 2WUBA 4Q2KA 1AUJA 2XWAA 3MTYA 1O32A 4OS7A 1HXFH 2FMJA 4XBCA 4FUJA 1O31A 2ZFPH 1O2HA 1H1BA 1NO9H 1Z7KA 1Y59T 3B9FH 1UVSH 1ZSJA 1C2HA 1A0JA 1C2FA 5C20A 1DM4B 3TK9A 4RKOB 5LPRA 1SI5H 1KXAA 2OC0A 5JBTA 3BTME 1C5PA 3ENSB 1UVTH 3Q3YA 3SNCA 4WMDA 1TAWA 1F2SE 2GKVE 2ANMH 1GVKB 5CMXH 4NGAH 3SV7A 2P8OB 3SGBE 1ACBE 2V0BA 2YNAA 4K3JA 3SU5A 1G9IE 3TJOA 4NIXA 1XMNB 1SGIB 1WTGH 1YBWA 3E0NB 1EQ9A 1UTPA 1UHBB 3BEUA 1GHBF 2FOMB 5ESBA 2CHAB 4GVUA 1ZTJA 2ZFQH 1O37A 4FUHA 1DXPA 4FUCA 5EODA 1DPOA 3OU0A 1UK4A 2F9NA 4ZHMU 4GHTA 1E34B 1TPPA 3GY8A 1L2EA 1GCTC 4WXIA 1O2VA 1QJ7B 2GCTC 2VINA 1GDNA 2UUFB 5F03A 4DG4A 5A0BA 1B5GH 1FPCH 1T8MA 2WPJS 1KXCA 3MFJA 4X8SH 1LHGH 2DUCA 4NFFA 1GI4A 3GDVA 3TLOA 2FEQH 1C2IA 1NRRH 1RXPA 2JETC 2PGQB 3RDZA 3TGIE 2Y7ZA 3P8GA 5DP5A 3KQEA 2HWLB 3ZYDA 3A83A 1C5TA 5AF9H 2XXLA 1O3HA 2H2ZA 2TGAA 3RMLH 4MQAA 3QGNB 4Y6DA 2H9EH 1TBQH 1WAYB 1WQVH 1UVOA 1SC8U 1ZHMA 4YOIA 1LHEH 4FU8A 3A7XA 4FUEA 2ZP0H 4KKDA 3KIDU 5HGGA 1B7XB 1ELFA 2FLRH 2B8OH 1KXBA 1XUIA 2GD4B 2CGAA 2A5KA 3E90B 4AFZA 1MH0A 4NFEA 1AZZA 1GBAA 1NU9A 3SU3A 1ETSH 3TITA 3O8RA 3SUEA 4I33A 1EUFA 4UFGH 1GBTA 1C2KA 2C8YB 4IC5A 2OBQA 3T28A 5DP4A 4CR9A 5HM9A 1GHXH 3TPIZ 1TGBA 1DFPA 2OINA 1EASA 3GY5A 3PMAB 1V2ST 3E0PB 1LPGB 4RN6A 2BQWB 3U1JB 2ASUB 1V2WT 2Z3DA 3SOSA 1CU1A 1C1VH 3ZVAA 1F5RA 1V2PT 1DX5M 2ANYA 1SGDE 3E6PH 2TIOA 4YTAA 4X8UH 4B1TA 3FP6E 1K1MA 4BAKB 4BOHA 5JB9S 1W14U 1BA8B 1P04A 3OSYA 4JZIA 1GCTB 3SV2H 2OD3B 1J17T 1C5QA 4DOQA 1XVMA 2BDCA 1ESBA 4OS4A 4Y11E 2C3SA 3S69A 2AFQB 3T5FH 2FI3E 1YKTA 1P3CA 2BY5X 1SGEE 1H8IH 2A0QB 4ISOA 2GCHG 1E37B 1P12E 2TGTA 4O03A 1TMUH 4CRDA 5L6NH 2HLCA 3KQCA 4WMEA 3FP8E 1AFEH 4WVPE 1CA8B 5F8TA 3FANA 4TPIZ 3BSQA 2UWOA 4IW4E 3URDA 5AFZH 5FCRA 3SHAH 1F92A 1ZMJA 2UUKB 1BRCE 3D65E 2NU2E 3MWIU 4I8LA 1O2JA 1O5CB 3EE0B 1QTFA 1QL7A 1TONA 1EOJA 1EPTB 1W3CA 2BYAX 2BB4A 4CHAB 1O2GH 1ZPZA 1P9SA 3GOVB 5FXLA 1C5YB 2O9QA 3RMNH 4R8TB 3KEEA 3GY3A 3Q77A 1W13U 1N8OC 4HGCA 1F5LA 5FHTA 3TH4H 1MKWK 3VB7A 1YF4A 2WYGA 3AW1A 1C5WB 4FU7A 1EJMA 1C5VA 1QRXA 1EX3A 1TBZH 4IN2A 3P70B 4AB9A 3M7QA 2ZEBA 3BG4C 2ZO3H 1LTOA 1BMLA 1K9OE 1SVPA 2P95A 1H4WA 1FMGA 4JK5A 1Z6JH 4K1TA 2KAIA 1VCWA 1N6XA 1PFXC 3OTJE 3RU4E 3TK6A 3RXKA 2OLGA 1K1IA 6CHAC 3STIA 1V2OT 2GMTC 3IG6B 2A4GA 2FTMA 1KY9A 4JZEH 1OWDA 1O2PA 2F9OA 3SU1A 1P09A 2J38A 1NM6A 2HNTF 1P3EA 2HVXA 4YOGA 1DVAH 1SLWB 1A3EH 1QBNA 1GHBG 1RTKA 1CO7E 1MKXK 1PQ8A 4YOJA 1TGSZ 1GBFA 4NSYA 4K69A 2BDAA 1BUIA 3SI3H 3EA8A 1CVWH 2QIQA 2A2XH 4NG9H 1MTWA 1EJNA 2FTLE 1T8NA 1IQJA 5FCKA 1NRPH 1ZOMA 2AMQA 2D26C 1KXEA 3RU4D 3GYLB 4BAOB 1G30B 1NROH 4IBLH 1FY3A 3RXFA 1BMAA 1HNEE 1ANCA 1DLKB 4FUGA 5DP3A 3PO1C 1QRZA 1QR3E 2ZCKP 1T8LA 2OP9A 3ZZ3A 3UUZA 3ZZ9A 1IQIA 4Q80A 4NA7A 4RKJB 2HALA 3LGVA 1VR1H 5JDUB 1SLUB 4FUFA 4HI3A 1C5SA 1X7AC 3MO6A 5J4QA 2F9BH 2ZECA 5EOKA 3SJKA 5BPEA 2QF3A 2ZPQA 2B7DH 3ZVFA 1HIAA 1D3QB 1OP8A 1Z6EA 1SGYE 3SN8A 3ATIA 2ZGBH 1HPGA 4K1EA 2A5AA 2PKSB 3ODDA 3TNSA 1BTUA 1YLDA 3SW2B 4Y10E 3NK8A 1NY22 2FI5E 2XC0A 2G81E 4ZROA 3T2NA 4QT8C 2J94A 2UUJB 5C5OA 3ATLA 1MU6B 3PYHA 4CRAA 3V12A 4BAQB 4Y71A 2BD5A 2GGVB 3ZZAA 1V2TT 2P93A 4OS1A 4ZUHA 2YNBA 1KXFA 1AI8H 1AN1E 4TYDA 1RTLA 3ATKA 1AB9B 3PMJA 5T3HA 4FU9A 2ZFFH 1CBWC 1JIMA 3KCGH 3P17H 1TGCA 1K1LA 1O3GA 1D3PB 1C1UH 1KSNA 2LPRA 3QWCH 3M3SA 1UK2A 1UTNA 2VVCA 1B0EA 3K2UA 3I78A 2OC7A 2Z3CA 3E1XB 2Z6BD 1YP9A 1L4DA 1AO5A 2SNVA 1QB6A 3PWBA 2XC5A 1K2I1 2J95A 4YO9A 1S6FA 5C5NA 1O3BA 6CHAB 3UTUH 1NU7B 2AGGX 3SV8A 1HUTH 2RG3A 5GJ4B 4GLYA 3RXQA 3VGCB 4IMZA 1L1NA 1TQ7B 4X1NU 3BTEE 1GBMA 1GWAA 1O5DH 4WWYA 1HRTH 4E05H 2C8ZB 4ABGA 3TVJB 1LHFH 2FDAA 2ZF0H 5H4IB 1BB0B 1AKSA 4ASHA 3MH6A 4B73A 1F0RA 1A3BH 4WMFA 1XVOA 4X1RU 5E0HA 1SFIA 3ZZ8A 1GHVH 4ZMAH 5HYOA 1PPHE 4MLFB 3NXPA 5EQRA 5JBBS 1E36B 1OYQA 4SGAE 2JH6D 4ZAEA 3BN9A 1YPJH 1GMDG 1IQGA 1Z1JA 2BD7A 3LJOA 3K6YA 1CHGA 3PROA 1DY8A 3HK3B 1ARBA 1XUGA 3BG8A 1LKBA 4ISNA 2C4FH 3RXPA 2BD3A 3JZ1B 1SQAA 1HB0B 1TGNA 5J4SA 3A82A 2BDIA 3M61U 1WSSH 1ZHPA 3K65B 1PYTD 2GDDA 1FAKH 3UOPA 1DUEA 1C1OA 2VH6A 2HNTE 3LC5A 1NC6A 3SZNA 1GDQA 5CHAC 1FY1A 3FP7E 3RXHA 2O8WA 1O3KA 1P02A 4B74A 1VJ9U 1W8BH 2RDLA 3ZV8A 2CJIA 1SR5C 3T62A 4A6LA 1O0DH 1SGRE 4RSPA 1A46H 2M5TA 3ZZ4A 1NFWA 5F8XA 2ODQA 4I32A 4FVDA 3VXEH 1IHSH 1LO6A 1XUFA 5A0CA 4B75A 4H4FA 4O3TA 1E0FD 3UWJH 3LIWA 4BANB 1HAOH 2PUXB 1QB1A 1TALA 1V2UT 1C5NH 4I8KA 1XM1A 1A5GH 1ORFA 1GI2A 1LPZB 3RMOH 3SGAE 4BAHB 1HCGA 1HGTH 1H9HE 2HOBA 3OY5U 2Y6TA 4CH8B 1GL1A 1Y8TA 1P9UA 1WBGB 2GV6A 2ZU5A 4B2AA 1V2KT 4I8HA 1DICA 2PTNA 3A86A 1O3OA 2Z9KA 1TNHA 2Q6FA 4KP0A 4KELA 4AGJA 2F9UA 1LVBA 1P05A 3LKWA 1P01A 3GY2A 2O8LA 1ELTA 3JZ2B 1SGCA 2TGDA 4UE7H 3A7VA 1ELGA 1UVPA 2Z9JA 3URCA 1GMHF 3UR9A 2EI7A 2SFAA 4X2YA 1RS0A 1Y5AT 1HAZB 1YGCH 2Y5HA 1L1GA 3CP7A 4CBNA 3MOCA 1O2RA 1K1NA 4LXBH 1RTFB 2A4OA 4O97A 5FPYA 1J14A 5A8ZA 2VIOA 2Y7XA 1XUHA 1LKAA 1V6DA 3UOUA 1ETRH 4K8BA 1Z1IA 4XDEA 4ZXXH 1AMHA 1TNJA 5EXMA 4H6TA 1SB1H 1O2XA 1KTSB 1O2QA 2FWWA 1TYNA 2G00A 1PQ5A 3KQDA 3QUMP 3BIUH 1TABE 4YM9A 2GDEH 2FYRA 4INLA 1DE7H 2ZGCA 3TH2H 2D1JA 3PV4A 1NT1A 2GTBA 4LZ4B 1C2LA 1GJ8B 1NRNH 4A1VA 1MTVA 1MCTA 1MTNB 2WYJA 2BLQA 3C27B 4MNWA 2XW9A 1GGDC 1HAIH 2BLOA 2FM2A 4YT6H 4NA9H 1QNJA 5BRRE 1IQHA 1VITG 3RXSA 2JH0D 6GCHG 3M35A 1J15A 3TJNA 5JB8S 3W94A 1CQQA 4U32A 2P8OC 3LT3A 3MNXA 4DJZB 2QXGA 1JRTA 2FOFA 4ZHAA 1HLTH 1VJAU 1Y5UT 1C1MA 2SGQE 3ZZCA 2Y5GA 1YPLH 1ZJDA 3A81A 2G5NA 5C1UA 3ZZ5A 5JYIA 1OWEA 3SQHE 4ABJA 2R2WU 1H9IE 1EAUA 1SGNE 2AYWA 4U2WA 3TH3H 2Q1JA 1LVOA 3GY6A 1BTZA 2W7UA 2ZHEH 4IC6A 2FYQA 1TX8A 1ABIH 3O8CA 3QN7A 2VWMA 3NZIA 2BLWA 4F49A 4KTCA 2BDHA 1MAYA 4ABHA 1A5IA 1JBUH 1FQ3A 1O3IA 2AGEX 2P3TB 4YZUA 1IOEA 2ZI2H 5EQQA 1FV9A 1Y3VA 4CR5A 3QX5H 4OGYA 1TMTH 2BOKA 5GCHF 3AASA 1NFXA 1AIXH 2VIVA 3MH4A 4NZLA 3UFAA 5FBIA 1QL9A 3EYDA 3GCNA 1YPHE 1AVXA 1MUEB 1QA7A 2WV4A 2P16A 1ANEA 1MBMA 1S0RA 4LOYH 1TOCB 1TGTA 1BTWA 1ZRKA 1CT4E 3HKIB 3UNQA 1OYTH 3L33A 1JOUB 4FXGH 1YLCA 1P2MA 4TWYA 4X6PA 8KME2 1GI0A 1CGJE 2GT7A 3IITA 1GJ4H 2TBSA 3LONA 1O33A 2W3KA 4ISHH 5E2PA 1Y5BT 3SNDA 1JXPA 2B9LA 1RD3B 5GXPA 1UTLM 3MHWU 2NU4E 1THPB 3M3TA 3RXCA 1O30A 1TBRH 1C9PA 1QQ4A 2IOTA 1PPBH 2ZDKA 3DHKH 1BBRH 2ZDAH 4MPWA 1INCA 1K1OA 5JBAS 1Q31A 1MTSA 2O8MA 3V3MA 1BJUA 1GMCF 1FY8E 2QA9E 5G4BA 1CE5A 2G8TA 2QYIA 3H5CB 3E16B 1BIOA 3GCTF 3DT0H 2ZCLP 3RM0H 1GVZA 1LVMA 1JMOH 3D62A 5GCHG 3T26A 2ZQ2A 3FFGA 3HGPA 3FVFB 2BD4A 3SJ8A 4MPVA 3DD2H 1DT2A 1TA6A 3MH5A 3UWIA 1TE0A 1EATA 1G32B 2J4IA 3LGUA 1ZLRA 2FOGA 2HGTH 5T6GA 1OP0A 2ZFRH 3VB5A 2A5IA 1SGQE 4IS5A 1ZJKA 4VGCB 5F6MA 1ELBA 3QDZB 5C1XA 2SGAA 4UDWH 1JIRA 2VIDA 1MZAA 1F0UA 1O2YA 1FY4A 4E7NA 3KHVA 2STAE 3GICB 1HAPH 1O2NA 9ESTA 3MO3A 5GPIB 2B0FA 3SJIA 1C2DA 3SV9A 2G4UA 1WUNH 2WV5A 1C9TA 1UJ1A 3MO9A 1SPJA 1F7ZA 1OOKB 1UHBA 1OPHB 2A7HA 3P6ZB 4AFQA 1Z8JB 3ZZ6A 1O5BB 3F9HA 1A5HA 1VZQH 1EZSC 1UCYE 3LU9B 3VB6A 2BY6X 1GBDA 4O3UA 4Y76A 3RXRA 1NS3A 3BEIB 3ZYEA 2IPHA 3EA7A 3BEFB 1FN8A 4WJG2 1C4V2 3RXIA 1DXWA 3RXLA 1Y3UA 5C1YA 2WPHS 3A7WA 1QBVH 4WF8A 1LPKB 3LGTA 2A4RA 3GYMA 5IYTA 3N7OA 1GJAB 5TCAA 4J1YA 3S9BA 1CT2E 2WINI 2G52A 2PGBB 4E7RG 2UWLA 3A8DA 1ZTLA 5JBCS 1GI8B 1JWTA 3RXGA 3SJ9A 1GJ5H 2WPMS 2EI8A 4CRCA 4J2YB 1D6WA 1O2SA 1QGFA 2G55A 1BZXE 4MPUA 1EAWA 1A7SA 2GX4A 1FXYA 1YPHC 2TGPZ 1TX6A 2OQUA 1BHXB 2R0LA 3BF6H 3ZZDA 2JH5D 1HJAB 2PWXA 1QRWA 2XBXA 1CA0B 1AVWA 2IN2A 2OCVB 3D23A 1UTQA 4ZKSU 2BDBA 3M5NA 2XYAA 2Z7FE 5LGOA 1PQ7A 4GAWA 3F1SB 2BY7X 1Z71A 4GUXA 5CHAB 3F68H 1MU8B 1F0TA 5E0JA 3A84A 3V0XA 5TCCA 3BTWE 3RXJA 4CH2B 1UTJA 6LPRA 5CE1A 2CV3A 1O3PB 1XXFA 5EG4A 1MZDA 1GBCA 2EA3A 3TGKE 1C5OH 1TWXB 1ETTH 4X1PU 1GJ6A 2ZKSA 3PTBA 4AOQA 1NFUA 3SUDA 1UK3A 5A09A 9LPRA 1ESTA 1IQKA 4HZHA 4AB8A 1GI3A 2V3OH 1YPEH 3I29A 1S82A 4X6NA 1NFYA 1GI7B 4GPGA 2FX4A 4X6OA 2CN0H 2ZU4A 3E3TA 1G2MA 1WV7H 7ESTE 4AN7A 1THRH 1O5AB 3EA9A 1XUJA 4TPYA 1EZQA 3RXAA 2SGPE 4GCHG 4NIVA 1IQLA 3IWMA 3F9GA 1P03A 1O38A 1T4UH 3LDXH 2ZDLA 1G3DA 4XOJA 1Z8GA 2ANWA 1HAVB 1LCYA 1VITF 3RLYH 1QFKH 1BBRK 3RXDA 4JK6A 4GSOA 4ZKNU 2ZTXA 1ANBA 4MNXA 1GL0E 5TJXA 2D8WA 3U8OH 3PLKA 3RXBA 2NWNA 4ZHLU 2ZGHA 1BRAA 2XRCA 3L3TA 1DITH 4LZ1H 2Z9IA 2QN5T 3KL6A 1Q2WA 1O3MA 2Y80A 1C1NA 1HAVA 1QA0A 4ZKRU 1T8OA 3UR6A 3GCOA 4F4OC 1IQMA 5EW1H 4ABEA 2ZGXH 2WPKS 4YLUA 1O2OA 1LQEA 4B2CA 2BMGB 1THSH 1AFQC 1GBKA 1HAYB 1OXGA 1CBWB 3B8JA 4MNYA 3S0NA 2R2MB 2F83A 4HTCH 3AAUA 4INHA 5ABWA 1QB9A 2SNWA 1QQUA 1QJ1B 4KGAA 1RRKA 3HK6B 2FZZA 4Q7XA 5EPNA 2VIWA 2G4TA 4ISIH 1O3LA
chains in the Genus database with same CATH superfamily
1L1JA 2ULLA 2QC2A 2Y5FA 4UFFH 1A2CH 1ABJH 1AKSB 2AS9A 2UWPA 3PV2A 1A0LA 5ETXA 1LVYA 2BDGA 1P06A 4K5ZA 1K1PA 3F9EA 1LMWB 1VITH 3N7DA 4CRBA 1MQ5A 1WTHD 5EGMA 4Y8YA 4X2XA 2H9TH 2KAIB 1SMFE 2LNCA 3RXEA 2KX4A 4RT1A 2PSXA 2KM0A 5DJ7A 3RXVA 4ISLA 5DP7A 2ZDMA 3U1IB 2NU0E 3UPEA 4XBBA 5DKMA 5A0AE 1SL3A 2FIRH 4GCHF 1V2NT 1D3DB 1C2GA 3Q00A 1HXEH 3P95A 3QZRA 1KIGH 2WPIS 4IMQA 3T25A 4JZDH 1WQSA 2PKSC 1BJVA 3S9AA 2GVFA 4A7IB 4D7GA 3SU0A 5FAHA 1HFDA 4DIHH 3DA9B 3WY8A 3QZQA 3RU4T 3UNSA 1C1QA 4NWLA 3M3VA 4B76A 3SNEA 1BRBE 4CREA 1M9UA 4Q4LA 2BVSH 2W3IA 3SNAA 2BX3A 3GY7A 1LHDH 1BOQA 3TIUA 1A4WH 1GBIA 4ZKOU 1W0YH 1YPKH 3TK5A 1BHXF 1S81A 1FZZA 4CBOA 2HNTC 3L6PA 1BTXA 2VVUA 1MTUA 1BT7A 3SYJA 4WXVA 2NU1E 3MU0A 1TLDA 3GDUA 3LGYA 3PO1B 1GHZA 4D9QA 4KTSA 1ZHRA 1E1QD 3P92A 4JCNA 1GMDF 5L2ZH 3PMHB 1FN6A 1FJSA 4UD9H 1FIZA 1DWEH 2VNTA 2TPIZ 1F0SA 5C2ZA 4BXWA 1S5SA 1C4Y2 4Y8ZA 2KZ4A 4NIYA 1DUAA 2IJD1 4NWKA 4U30A 3SQEE 2PP6A 2R9PA 3PB1E 1UO6A 1S0QA 3LPRA 1H9LB 1PPZA 1J9CH 1TRYA 1RIWB 1IQEA 1AFQB 2Z94A 1N6YA 1P2NA 1S6HA 4Y0ZE 2OUAA 4RI0A 2XCNA 1YC0A 1AHTH 5FBEA 1AQ7A 3LH3A 2FS9A 2BOHB 2FS8A 1EAIA 3H7OA 4IGDA 3U9AH 4E06H 1GBJA 3RXTA 1W2KH 3RM2H 2GMTB 3F0PA 5KECA 3LH1A 1TB6H 3VFEA 3AW0A 2OC1A 2YMSB 2VB0A 4K2YA 1BRUP 3ZVDA 5HMAA 1EB2A 3F2GA 3KQBA 3SHCH 1BMNH 3LOXA 1T7CA 5LH8A 3U8RH 1L4ZA 1IHTH 4CHAC 3LJJA 4D7FA 1GI9B 5I25A 3ZVBA 1MBQA 4P00A 4R0IA 1NRQH 1C5ZB 2BXUH 5DGJA 3MH7A 1TNKA 1MQ6A 2GV7A 2QCYA 2ZFTA 2GZ7A 1HAGE 2M2AA 3M36A 1N8OB 2FOBA 2ZWLH 2ALVA 1TNLA 2H1UA 1GI6A 1SHYA 2VWOA 1GHWH 1EXFA 1D6RA 5K0HA 1EPTC 3M5OA 1SFQB 3A7YA 1ZR0A 2ZHQH 2PUQH 4OS6A 1C1SA 1FNIA 2C8XB 1ZYOA 2R3YA 1QBOA 1P2OA 2QV1A 1O3NA 1HBTH 1IQNA 1O2IA 3STJA 2DE8A 2TRMA 3I77A 1MD7A 1TPSA 4XE4A 3SU4A 1QHRB 2J92A 1O5GH 1YCPM 4FVBA 4INKA 5FX5A 1O2KA 2FPZA 3F6UH 3KNXA 1LQDB 3QO6A 5AHGH 1KDQA 2XBWA 3SV6A 3EE7A 4WY3A 2F9PA 4Y8XA 1BBRE 3SUFA 3E91A 1GHAF 4BAMB 1AU8A 3EQ0H 2VGCB 2J5UA 3RC6A 1OS8A 1JRSA 1SG8B 3EAJA 2EI6A 2G5VA 3A7ZA 1MMJN 3A88A 3UY9A 5A2MH 1TPAE 1A0HB 1HJAC 1FONA 3MI4A 1O3EA 1OSSA 3OX7U 2OC8A 1EPTA 1TRNA 2BZAA 1OX1A 5DPAA 5A8YA 4JZ1A 5I46H 3VB4A 1O2UA 1DWDH 2STBE 3QLPH 3LGIA 4UFDH 1B0FA 3AVZA 2NU3E 3E8LA 4UFEH 2ODYB 3UQOA 2WV9A 3WW7A 1UW7A 1C5MD 3EDXB 2PR3A 4FETA 2PW8H 8LPRA 1GVLA 1NTPA 4XFQA 1K1JA 4X6MA 1O3CA 3HATH 2QXIA 4X0WU 3CS0A 2Z9GA 3CENA 2F91A 2HRVA 2VWNA 4JZFH 4TY7A 1RGQA 3TNTA 2QY0B 2ZU2A 3A80A 3QTVH 1TFXA 4TWWA 1ZSLA 1YY3A 3FZDA 3R3GB 1VKYA 5AVDA 2O8UA 2V3HH 4BTIB 1NPMA 1GHYH 4Q7ZA 1GJCB 1LHCH 2PKAB 5T6DA 3W95A 2Y82A 3CS7A 3T27A 2WZQA 4CRFA 3UIRA 1P0SH 2ZHDA 1H8HD 3V7TA 4DIIH 5ESTE 1AZ8A 1XX9A 2JETB 1W7GH 4I8JA 2AMDA 5L2YH 5E8EH 3N99A 1EKBB 3TGJE 1C5LH 1C5RA 3LC3A 1GDUA 7GCHF 4TY6A 2GCTB 1GHAG 3SUGA 1P2KA 3RC5A 1HJ8A 2P3UB 1DSTA 1E38B 4Z1MD 2QF5A 1TNIA 3K9XB 2GT8A 3RXOA 1P8VC 2AIQA 5FX6A 4M9FA 2FOCA 5GWZA 1CSOE 1TNGA 1DWBH 4FOUC 1PPFE 4VGCC 4NCYA 4B71A 2HPQH 2IJOB 2AIPA 1KLIH 2FOEA 2ZIQH 2VGCC 1AWHB 1SQTA 4MPXA 1MAXA 2CHAC 1P2JA 2FLBH 2R3UA 2SGDE 4HFPB 1OKXA 4X1SU 4ZH8A 3BTKE 1UTMA 3S7HB 2Y81A 1AGJA 2H5DA 2Z9LA 3PMBB 1MKXH 3NPSA 2J34A 5EU8A 2BD2A 1C1PA 5EXNA 2P3FH 2A45B 1D9IA 2I6QA 1DOJA 1YPMH 3GISB 3SBKA 3MNBA 5DP8A 3U69H 2GP9B 1G36A 1EFRD 3MU8A 4DURA 2XWBI 1TQ0B 5HXFA 2RCEA 1C2MA 3GCTG 3UQVA 2AEIH 1V2JT 1NRSH 4Q7YA 1OWIA 3FAOA 3KYFA 3G01A 1O2TA 1ELVA 2C90B 1O5EH 1GMCG 5SGAE 1KYNA 3DSOA 1VCQA 4Y0YE 1KLTA 1EZUC 8GCHG 3UNRA 2PFEA 2FX6A 2ZU3A 2G51A 5HM2A 4TSFD 1QJ6B 3P8FA 4MTBA 1UMAH 5A8XA 1UTKA 1UVUH 3QGJA 1S84A 1OWHA 3TU7H 1AWFH 4ABDA 2SGEE 4ABFA 2K1QA 2V3MA 3BTHE 7GCHG 1PPGE 2O8TA 3T29A 7KMEH 1UTOA 1V2RT 4H42U 1GJBB 2YMSC 2XNIA 3M5MA 1TIOA 2Q6DA 2L6OA 3Q3KA 1MABB 3BTFE 1DSUA 1SHHB 3LGWA 2AH4X 1WYKA 2LP6A 2GCHF 2A7CA 2A4QA 1Y3WA 3Q76A 1RFNA 1FI8A 3B23B 3Q3XA 1AE5A 5C94A 1O2LA 5DP9A 4B6EA 1P57B 3OYPA 1O3JA 3MNCA 4X2VA 3GCHC 3KGPA 2ZCHP 1EAXA 2W5EA 4K60A 5DG6A 1EZXC 2ZHWH 1DLEA 4MDSA 1GBHA 1RIWC 3MU5A 2ZC9H 2BM2A 2VIPA 1C5XB 4HG6A 1AY6H 3NCLA 2K8IA 4SGBE 1O3AA 2ZDVH 1GJ7B 3A8CA 3SU6A 1K22H 2EEKA 4YLQH 3A89A 1YPGH 2Q6GA 1XXDA 2ZHFH 1W11U 4FUDA 1SOZA 1GBLA 1ANDA 2BZ6H 5LPEA 2ILNA 3P8OA 4AYVB 1O2ZA 3EGKH 2OXSA 1MCVA 1W12U 3OY6U 3ITIA 3SO3A 3SGQE 1C2JA 2A1DB 4YESB 1SGFG 1A61H 3ATWA 1Y3XA 1QURH 1C1WH 3K6ZA 4A5TS 3M7UA 1GGDB 3ODFA 2A31A 2VJ1A 3A87A 5EXLA 1MTNC 2BTCE 3GY4A 3BTGE 6GCHF 1YYY1 5JPMH 3NKKA 2B5TB 2BQ7B 2H6MA 6ESTA 1ZMLA 2WPLS 2H5CA 2AGIX 5B6OA 2ESTE 3RUOA 1SKYE 1RJXB 4OGXA 1XUKA 4I7YH 1L0ZA 2OBOA 4I86A 3MMGA 4ABIA 2QF0A 4AZ2B 3SJOA 5DO4H 1G2LA 4ACBA 2ZGJA 1ELDE 1WOFA 1DANH 2ZQ1A 4PROA 1AD8H 5EW2H 1C1RA 5FPTA 4O9VA 4FUBA 3O8DA 3ZV9A 1G3EA 2WUCA 1WDIA 1K21H 4BTTB 2FOHA 1TX7A 4D8NA 1HJ9A 1EB1H 5LPFA 5FPSA 4MVNA 5DK1A 4BXSA 1FPHH 2THFB 1PJPA 1ZTKA 1SGFA 4UONA 3PLPA 1O5FH 1EOLA 1IQFA 1ELEE 2VIQA 2ZU1A 3PTNA 2QAAA 2FODA 4AG1A 4AX9H 1TOMH 1GPZA 2D2DA 3C1KA 4OS2A 3F0OA 4UEHH 1P11E 2ZNKH 1O3FA 1TMBH 4MG3A 4X8TH 2QXHA 2R0KA 1DDJA 4XBDA 1GMHG 5PTPA 4D9RA 1G3CA 3RLWH 1LDTT 3ELAH 3GDSA 1Y3YA 7LPRA 2RA3A 3DFLA 2A32A 1P10A 3PRDA 1SGTA 1HIAB 4AORA 4OS5A 2ANKH 3QK1A 4K8YA 1NBMD 1WCZA 1C4U2 1ZGVA 4KTUA 3SU2A 1ZPBA 1O2WA 2BVXH 3MU1A 4DCDA 1DY9A 3U8TH 2GZ8A 4FUIA 2J2UA 1W0ZU 1FDPA 1V2QT 2A2QH 4X2WA 4YT7H 1BCUH 1GBBA 1O34A 5T6FA 1HYLA 1CGIE 1ZPCA 1CGHA 2V6NA 1MD8A 5C17A 1O39A 2BY9X 2XTTB 3M5LA 3PWCA 4AYYB 2FOAA 3MYWA 4B2BA 1VGCB 2FO9A 2XBYA 1GG6B 1H8DH 5F8ZA 2EY4C 2PKAA 2BHGA 1T32A 3HGNA 4X1QU 1GJDB 1QY6A 2A7JA 2CF9H 1MKWH 3P8NA 4BNRA 4A1TA 3TJVA 3BIVH 4AG2A 1SBWA 4ESTE 1UCYK 3SI4H 1GG6C 4XRNA 1E35B 4DGJA 4WH6A 1BDAA 1VGCC 1BTPA 1ZSKA 1S85A 3NRLA 4WH8A 1J16A 2ZDNA 1XKBC 3RC4A 4CRGA 2CK3D 4X8VH 2UUYA 1F5KU 1OWKA 3DFJA 5L30H 4ACAA 3MNSA 2ALPA 4U01A 2ODPA 5IDKA 1SOTA 3ZZBA 4BTUB 3SORA 1OP2A 1ZGIA 1OWJA 3BTQE 3HKJB 1SSXA 4NIWA 5CHBA 4NA8A 2VWLA 3RP2A 2DE9A 1K28D 2Z3EA 2PV9B 3M37A 2XCFA 1TPOA 1P2IA 1BMMH 4A1XA 3DUXH 1J8AA 3U98H 3U28C 5EPYA 1A1RA 2ZPRA 1CA0C 1TRMA 4AFSA 2KFWA 4DT7B 2SGFE 3VGCC 1FIWA 2JJ2D 2ZTYA 1FLEE 1V2LT 3OEED 1BTHH 2AMPA 2PTCE 5EQSA 1ZMNA 4ABBA 4A92A 1SLXB 1KXDA 8GCHF 2BVRH 2BY8X 2P59A 2ZFSA 1KDQB 3D49H 2QXJA 2VU8E 2ZTZA 5E2OA 2F3CE 2V35A 1AUTC 1ZRBA 3AAVA 3O8BA 1ZZZA 2BDYA 5DP6A 3R0FA 2V7QD 1T31A 1XKAC 1DS2E 3RXUA 2ZPSA 4M7GA 4MNVA 3UREA 1UCYH 4NZQA 1AVGH 2KR7A 1AB9C 4I31A 1FY5A 1V2VT 2JKHA 5AFYH 1YLNA 1ELCA 4TT3D 4H6SB 4XSKU 4IN1A 1T4VH 4JYUH 1EJAA 2ZG0H 2PLXA 3RMMH 1S83A 2RA0A 5C67A 1GI5A 4Y7BA 1SGPE 1G37A 1O2MA 2FXRA 3KN2A 8ESTE 1BITA 2VH0A 1HAXB 2BX4A 4JMYA 2LELA 3VB3A 1HDTH 4AFUA 3FZZA 2GZ9A 1DWCH 1PQAA 4AGKA 2W26A 3ZVEA 2W7SA 1HAHH 1AE8H 2OQ5A 3VPKA 3OEHD 1QL8A 3HPTB 5EIYA 2VVVA 4GHQA 2BD9A 1IAUA 1NN6A 2P94A 1QCPA 2F9VA 4AC9A 2C93B 3F9FA 4NSVA 3NWUA 3NUMA 3H7TA 2OTVA 2AERH 3QTOH 3BV9B 1GJ9B 1PPCE 1D3TB 2BD8A 2FI4E 2HPPH 1P2QA 5C3NA 1W10U 1EP6A 4DW2U 1YCPH 4YXWD 4Z6AH 1NBME 3ATMA 4Y79A 2ZA5A 1YM0A 3PLBA 1ID5H 2PHBA 5EJLA 1KLJH 1Q3XA 5GIBA 2QGRA 1YCPK 2PSYA 3V13A 4Y7AA 1W7XH 1FAXA 1O3DA 3SNBA 1NZQH 1C1TA 1V2MT 5GDSH 1FUJA 4DVAU 1V3XA 1VCPA 1Z8RA 2XC4A 3BTDE 1ARCA 3OTPA 1SQOA 1GBEA 1QIXB 2BXTH 2I6SA 3BTTE 1O35A 1BQYA 2CMYA 3TJUA 4LK4A 2FESH 1CHOG 1CHOF 3F2HA 4ABAA 3ESTA 3GCHB 1SLVB 1GCDA 1KTTB 1D4PB 2J9NA 4K1SA 3A7TA 4P02A 1WU1A 3M7TA 2CF8H 2YOLA 1TA2A 1U6QA 5E0GA 2C8WB 3KF2A 4Z0KA 5K7RA 2H9HA 1NESE 1ESAA 3A8AA 4ZXYH 5IK2D 2XBVA 1G3BA 1BTYA 2BQ6B 3ZVGA 1HV7A 4THNH 3S7KB 2ZZUH 3ZZ7A 3S9CA 3A8BA 2CXVA 2EC9H 1PPEE 1CT0E 1EP5A 3ZVCA 4D76A 3VXFH 1C2EA 3RXMA 4DY7B 1Z8IB 1PYTC 1C5UA 4JYTA 4JYVH 3BG4B 1N1LA 1ELAA 1GI1A 4I8GA 2BLVA 3A85A 3PM3A 3KQ5A 3VEQB 2FP7B 1O36A 3MU4A 2WUBA 4Q2KA 1AUJA 2XWAA 3MTYA 5C0TA 1O32A 4OS7A 1HXFH 5DN6D 2FMJA 4XBCA 4FUJA 1E1RD 1O31A 2ZFPH 1O2HA 1H1BA 1NO9H 1Z7KA 1Y59T 3B9FH 1UVSH 1ZSJA 1C2HA 1A0JA 1C2FA 5C20A 1DM4B 3TK9A 4RKOB 5LPRA 1SI5H 1KXAA 2OC0A 5JBTA 3BTME 1C5PA 2IPQX 3ENSB 1UVTH 3Q3YA 3SNCA 4WMDA 1TAWA 1F2SE 2GKVE 2ANMH 1GVKB 5CMXH 4NGAH 3SV7A 2P8OB 3SGBE 3PV5A 1ACBE 2V0BA 2YNAA 4K3JA 3SU5A 1G9IE 3TJOA 4NIXA 1XMNB 1SGIB 1WTGH 1YBWA 3E0NB 1EQ9A 1UTPA 4RT0A 1UHBB 3BEUA 1GHBF 2FOMB 3VG8A 5ESBA 2CHAB 4GVUA 1ZTJA 2ZFQH 1O37A 4FUHA 1DXPA 4FUCA 5EODA 1DPOA 3OU0A 1UK4A 2F9NA 4ZHMU 1SQRA 4GHTA 1E34B 1TPPA 3GY8A 1L2EA 1GCTC 4WXIA 1O2VA 1QJ7B 2GCTC 2VINA 1GDNA 2UUFB 5F03A 4DG4A 5A0BA 1B5GH 1FPCH 1T8MA 2WPJS 1KXCA 3MFJA 4X8SH 1LHGH 2DUCA 4NFFA 1GI4A 3GDVA 3TLOA 2FEQH 1C2IA 1NRRH 1RXPA 2JETC 2PGQB 3RDZA 3TGIE 2Y7ZA 3P8GA 5DP5A 3KQEA 2HWLB 3ZYDA 3A83A 1C5TA 5AF9H 2XXLA 1O3HA 2H2ZA 2TGAA 3RMLH 4MQAA 3QGNB 4Y6DA 2H9EH 1TBQH 1WAYB 1WQVH 1UVOA 1SC8U 1ZHMA 4YOIA 1LHEH 4FU8A 3A7XA 4FUEA 2ZP0H 4KKDA 3KIDU 5HGGA 1B7XB 1ELFA 2FLRH 2B8OH 1KXBA 1XUIA 2GD4B 2CGAA 2A5KA 3E90B 4AFZA 1MH0A 4NFEA 1AZZA 1GBAA 1NU9A 3SU3A 1ETSH 3TITA 3O8RA 3SUEA 4I33A 1EUFA 4UFGH 1GBTA 1C2KA 2C8YB 4IC5A 2OBQA 3T28A 5DP4A 4CR9A 5HM9A 5F53A 1GHXH 3TPIZ 5EJZA 1TGBA 1DFPA 3WWBA 2OINA 1EASA 3GY5A 3PMAB 1V2ST 3E0PB 1LPGB 4RN6A 2HVYB 2BQWB 3OE7D 3U1JB 2ASUB 1V2WT 2Z3DA 3SOSA 1CU1A 1C1VH 3ZVAA 1F5RA 1V2PT 1DX5M 2ANYA 1SGDE 3E6PH 2TIOA 4YTAA 4X8UH 1K0HA 4B1TA 3FP6E 1K1MA 4BAKB 4BOHA 5JB9S 1W14U 2VBCA 1BA8B 1P04A 3OSYA 4JZIA 1GCTB 3SV2H 2OD3B 1J17T 1C5QA 4DOQA 1XVMA 2BDCA 4OM9A 1ESBA 4OS4A 4Y11E 1OHHD 2C3SA 3S69A 2AFQB 3T5FH 2FI3E 1YKTA 1P3CA 2BY5X 1SGEE 1H8IH 2A0QB 4ISOA 2GCHG 1E37B 1P12E 2TGTA 4O03A 1TMUH 4CRDA 5L6NH 2HLCA 3KQCA 4WMEA 3FP8E 1AFEH 2JDID 4WVPE 4F55A 1CA8B 5F8TA 3FANA 1E79D 1KMHB 4TPIZ 3BSQA 2UWOA 4IW4E 3URDA 5AFZH 5FCRA 3SHAH 1F92A 1ZMJA 2UUKB 1BRCE 3D65E 2NU2E 3MWIU 4I8LA 1O2JA 1O5CB 3EE0B 1QTFA 1QL7A 2GJGA 3UAIC 1TONA 1EOJA 1EPTB 1W3CA 2BYAX 2BB4A 4CHAB 1O2GH 1ZPZA 1P9SA 3GOVB 5FXLA 1C5YB 2O9QA 3RMNH 4R8TB 3KEEA 3GY3A 1QZ8A 3Q77A 1W13U 1N8OC 4HGCA 1F5LA 5FHTA 3TH4H 1MKWK 3VB7A 1YF4A 2WYGA 3AW1A 1C5WB 4FU7A 1EJMA 1C5VA 1QRXA 1EX3A 1TBZH 4IN2A 3P70B 4AB9A 3M7QA 2ZEBA 3BG4C 2ZO3H 1LTOA 1BMLA 1K9OE 1SVPA 2P95A 1H4WA 1FMGA 4JK5A 1Z6JH 4K1TA 5HIYA 2KAIA 1VCWA 1N6XA 1PFXC 3OTJE 3RU4E 3TK6A 3RXKA 2OLGA 1K1IA 6CHAC 3STIA 1V2OT 2GMTC 3IG6B 2A4GA 2FTMA 1KY9A 4JZEH 1OWDA 1O2PA 2F9OA 4DT4A 3SU1A 1P09A 2J38A 1NM6A 2HNTF 1P3EA 2HVXA 4YOGA 1DVAH 1SLWB 1A3EH 1QBNA 1GHBG 1RTKA 1CO7E 1MKXK 1PQ8A 4YOJA 1TGSZ 1GBFA 4NSYA 4K69A 2BDAA 1BUIA 3SI3H 2J98B 3EA8A 1CVWH 2QIQA 2A2XH 4NG9H 1MTWA 1EJNA 2FTLE 1T8NA 1IQJA 5FCKA 1NRPH 1ZOMA 2AMQA 2D26C 1KXEA 3RU4D 3GYLB 4BAOB 1G30B 1NROH 4IBLH 1FY3A 3RXFA 1BMAA 1HNEE 1YWUA 1ANCA 1DLKB 4FUGA 5DP3A 3PO1C 1QRZA 1QR3E 2QF4A 5DSFA 2ZCKP 1T8LA 2OP9A 3ZZ3A 3UUZA 3ZZ9A 1IQIA 4Q80A 4NA7A 4RKJB 2HALA 3LGVA 1VR1H 5JDUB 1SLUB 4FUFA 4HI3A 5FL7D 1C5SA 1X7AC 3MO6A 5J4QA 2F9BH 2ZECA 2W6JD 5EOKA 3SJKA 5BPEA 2QF3A 2ZPQA 2B7DH 3ZVFA 3OAAD 1HIAA 1D3QB 1OP8A 1Z6EA 1SGYE 3SN8A 3ATIA 2ZGBH 1HPGA 4K1EA 2A5AA 2PKSB 3ODDA 3TNSA 1BTUA 1YLDA 3SW2B 4Y10E 3NK8A 1NY22 2FI5E 2XC0A 2G81E 4ZROA 3T2NA 2W6ID 4QT8C 2J94A 2UUJB 5C5OA 3ATLA 1MU6B 3PYHA 4CRAA 3V12A 4BAQB 4Y71A 2F4LA 2KCAA 2BD5A 2GGVB 3ZZAA 1V2TT 2P93A 4OS1A 4ZUHA 2YNBA 1KXFA 1AI8H 3N7EA 1AN1E 4TYDA 1RTLA 3ATKA 1AB9B 3PMJA 5T3HA 4FU9A 2ZFFH 1CBWC 1JIMA 2XNDD 3KCGH 3P17H 1TGCA 1K1LA 1O3GA 1D3PB 1C1UH 1KSNA 2LPRA 3QWCH 3M3SA 1UK2A 1UTNA 2VVCA 1B0EA 3K2UA 3I78A 2OC7A 2Z3CA 3E1XB 2Z6BD 1YP9A 1L4DA 1AO5A 2SNVA 2J97A 1QB6A 3PWBA 1K2I1 2J95A 2XC5A 4YO9A 1S6FA 5C5NA 1O3BA 5B6LA 6CHAB 3UTUH 1NU7B 3ZIAD 4F48B 2AGGX 3SV8A 1HUTH 2RG3A 5GJ4B 4GLYA 3RXQA 3VGCB 2F43B 4IMZA 1L1NA 1TQ7B 4X1NU 3BTEE 1GBMA 1GWAA 3MQKC 1O5DH 4WWYA 1HRTH 4E05H 2C8ZB 4ABGA 3OFND 3TVJB 1LHFH 2FDAA 2ZF0H 5H4IB 1BB0B 1AKSA 4ASHA 3MH6A 4B73A 1F0RA 1A3BH 4WMFA 1XVOA 4X1RU 5E0HA 1SFIA 4Q63A 3ZZ8A 1GHVH 4ZMAH 5HYOA 1PPHE 4MLFB 3NXPA 5EQRA 5JBBS 1E36B 1OYQA 4SGAE 3H09A 2JH6D 4ZAEA 3BN9A 1YPJH 1GMDG 1IQGA 1Z1JA 2BD7A 3LJOA 3K6YA 1CHGA 3PROA 1DY8A 5KEDA 3HK3B 1ARBA 1XUGA 3BG8A 1LKBA 4ISNA 1W0JD 5HKKD 2C4FH 3RXPA 2BD3A 3JZ1B 1SQAA 1HB0B 1TGNA 2JJ1D 5J4SA 3A82A 2BDIA 3M61U 1WSSH 1ZHPA 3K65B 1PYTD 2GDDA 1FAKH 5KGOA 3UOPA 1DUEA 1C1OA 2RFKC 2VH6A 2HNTE 3LC5A 1NC6A 3SZNA 1GDQA 5CHAC 1FY1A 3FP7E 3RXHA 2O8WA 1O3KA 1P02A 4B74A 1VJ9U 1W8BH 2RDLA 3ZV8A 2CJIA 1SR5C 3T62A 4A6LA 1O0DH 1SGRE 4RSPA 1A46H 4XD7D 2M5TA 3ZZ4A 1NFWA 5F8XA 2ODQA 2XOKD 4I32A 4FVDA 3VXEH 1IHSH 1LO6A 1XUFA 5A0CA 4B75A 4H4FA 4O3TA 1E0FD 3UWJH 3LIWA 4BANB 1HAOH 2PUXB 1QB1A 1COWD 1TALA 3DSPA 1V2UT 1C5NH 4I8KA 1XM1A 1A5GH 2WPDD 1ORFA 1GI2A 1LPZB 3RMOH 3SGAE 4BAHB 1HCGA 1HGTH 1H9HE 2HOBA 3DCLA 2Y6TA 3OY5U 4CH8B 1GL1A 1Y8TA 1P9UA 1WBGB 2GV6A 2ZU5A 4B2AA 1V2KT 4I8HA 1FX0B 1DICA 2PTNA 3A86A 1O3OA 2Z9KA 1TNHA 2Q6FA 4KP0A 4KELA 4AGJA 2F9UA 1LVBA 1P05A 3LKWA 1P01A 3GY2A 2O8LA 1ELTA 3JZ2B 1SGCA 2TGDA 4UE7H 3A7VA 1ELGA 1UVPA 3WWFA 2Z9JA 3URCA 1GMHF 3UR9A 2EI7A 2SFAA 4X2YA 1RS0A 1Y5AT 1HAZB 1YGCH 2Y5HA 1L1GA 3CP7A 4CBNA 3MOCA 1O2RA 1K1NA 4LXBH 1RTFB 2A4OA 4B6FA 4O97A 5FPYA 1J14A 5A8ZA 2RDEA 2VIOA 2Y7XA 2AHME 1XUHA 1LKAA 5C0UA 1V6DA 3UOUA 1ETRH 4K8BA 1Z1IA 4XDEA 4ZXXH 1AMHA 1TNJA 5EXMA 4ZCNA 4H6TA 1SB1H 1O2XA 1KTSB 1O2QA 2FWWA 1TYNA 2G00A 1PQ5A 3KQDA 3QUMP 3BIUH 1TABE 4YM9A 2GDEH 2FYRA 4INLA 1DE7H 2ZGCA 3TH2H 2D1JA 3PV4A 1NT1A 2GTBA 4LZ4B 1C2LA 1GJ8B 1NRNH 4A1VA 1MTVA 1MCTA 1MTNB 2WYJA 2BLQA 3C27B 1BMFD 4MNWA 2XW9A 1GGDC 1HAIH 2BLOA 2FM2A 4YT6H 4NA9H 1QNJA 5BRRE 1IQHA 1VITG 3RXSA 2JH0D 6GCHG 3M35A 1J15A 3TJNA 5JB8S 3W94A 1CQQA 3FO8D 4U32A 2P8OC 3LT3A 3MNXA 5GNDA 4DJZB 2QXGA 1JRTA 2FOFA 4ZHAA 1HLTH 1VJAU 1Y5UT 1C1MA 2SGQE 3ZZCA 2K0QA 2Y5GA 1YPLH 1ZJDA 3A81A 2G5NA 5C1UA 3ZZ5A 5JYIA 1OWEA 3SQHE 4ABJA 2R2WU 1H9IE 1EAUA 1SGNE 2AYWA 4U2WA 3TH3H 2Q1JA 3W1EA 1LVOA 3GY6A 1BTZA 2W7UA 2ZHEH 4IC6A 2FYQA 1TX8A 1ABIH 3O8CA 3QN7A 2VWMA 3NZIA 2BLWA 4F49A 4KTCA 2BDHA 1MAYA 4ABHA 1A5IA 1JBUH 1FQ3A 1O3IA 5HIZA 2AGEX 2P3TB 4YZUA 1IOEA 2ZI2H 5EQQA 1FV9A 1Y3VA 4CR5A 3QX5H 4OGYA 1TMTH 2BOKA 5GCHF 3AASA 1NFXA 1AIXH 2VIVA 2JIZD 3MH4A 4NZLA 2KCYA 3UFAA 5FBIA 3FKSD 1QL9A 3EYDA 3GCNA 1YPHE 1AVXA 1MUEB 1QA7A 2WV4A 2P16A 1ANEA 1MBMA 1S0RA 4LOYH 1TOCB 1TGTA 1BTWA 1ZRKA 1CT4E 3HKIB 3UNQA 1OYTH 3L33A 1JOUB 4FXGH 1YLCA 1P2MA 4TWYA 4X6PA 8KME2 1GI0A 4ASUD 1CGJE 2GT7A 3IITA 1GJ4H 2TBSA 3LONA 1O33A 2W3KA 4ISHH 5E2PA 1Y5BT 3SNDA 1JXPA 2B9LA 1RD3B 5GXPA 1UTLM 3MHWU 2NU4E 1THPB 3M3TA 3RXCA 1O30A 1TBRH 1C9PA 1QQ4A 2IOTA 1PPBH 2ZDKA 2J98A 3DHKH 1BBRH 2ZDAH 4MPWA 1INCA 1K1OA 3FOAA 1Q31A 5JBAS 1MTSA 2O8MA 3V3MA 3SZEA 1BJUA 1GMCF 1FY8E 2QA9E 5G4BA 1CE5A 2G8TA 3F2FA 2QYIA 3H5CB 3E16B 1BIOA 3GCTF 3DT0H 2ZCLP 3RM0H 1GVZA 1LVMA 1JMOH 3D62A 5GCHG 3T26A 2ZQ2A 3FFGA 3HGPA 3FVFB 2BD4A 3SJ8A 5EJ1A 4MPVA 3DD2H 1DT2A 1TA6A 3MH5A 3UWIA 1TE0A 1EATA 1G32B 2J4IA 3LGUA 1ZLRA 2FOGA 2HGTH 5T6GA 1OP0A 2ZFRH 3VB5A 2A5IA 1SGQE 4IS5A 1ZJKA 4VGCB 5F6MA 1ELBA 3QDZB 5C1XA 2SGAA 3CNRA 4UDWH 1JIRA 2VIDA 5CDFE 1MZAA 1F0UA 1O2YA 1FY4A 4E7NA 2HLDD 3KHVA 2STAE 3GICB 3DSGA 1HAPH 1O2NA 9ESTA 3MO3A 5GPIB 2B0FA 3SJIA 1C2DA 3SV9A 2G4UA 1WUNH 2WV5A 1C9TA 1UJ1A 3MO9A 1SPJA 1F7ZA 1OOKB 1UHBA 1OPHB 2A7HA 3P6ZB 4AFQA 1Z8JB 3ZZ6A 1O5BB 3F9HA 1A5HA 1VZQH 1EZSC 2EQNA 5T1VA 1UCYE 3LU9B 3VB6A 2BY6X 1GBDA 4O3UA 4Y76A 3RXRA 1NS3A 3BEIB 3ZYEA 2IPHA 3EA7A 3BEFB 1H8ED 1FN8A 4WJG2 1C4V2 3RXIA 1DXWA 3RXLA 1Y3UA 5C1YA 2WPHS 3A7WA 1QBVH 4WF8A 1LPKB 3LGTA 2A4RA 3GYMA 5IYTA 3N7OA 1GJAB 5TCAA 4J1YA 3S9BA 1CT2E 2WINI 2G52A 2PGBB 4E7RG 2UWLA 3A8DA 1ZTLA 5JBCS 1GI8B 1JWTA 3RXGA 3SJ9A 1GJ5H 2WPMS 2EI8A 4CRCA 4J2YB 1D6WA 1S6LA 1O2SA 1QGFA 2G55A 1BZXE 4MPUA 1EAWA 1A7SA 2WSSD 2GX4A 1FXYA 1YPHC 2TGPZ 1TX6A 2OQUA 3FN8A 1BHXB 2R0LA 3BF6H 3ZZDA 2JH5D 1HJAB 2PWXA 3UB0A 1QRWA 2XBXA 1CA0B 1AVWA 2IN2A 2OCVB 3D23A 2KCPA 1UTQA 4ZKSU 2BDBA 3M5NA 2XYAA 2Z7FE 5LGOA 1PQ7A 4GAWA 3F1SB 2BY7X 1Z71A 4GUXA 5CHAB 3F68H 1MU8B 1F0TA 5E0JA 3A84A 3V0XA 5TCCA 3BTWE 3RXJA 4CH2B 1UTJA 6LPRA 5CE1A 2CV3A 1O3PB 1XXFA 2KCOA 5EG4A 1MZDA 1GBCA 2EA3A 2L74A 3TGKE 1C5OH 1TWXB 1ETTH 2YMSD 4X1PU 1GJ6A 2ZKSA 3PTBA 4AOQA 1NFUA 3SUDA 1UK3A 2WHXA 5A09A 9LPRA 1ESTA 1IQKA 4HZHA 4AB8A 1GI3A 2V3OH 1YPEH 3I29A 1S82A 4X6NA 1NFYA 1GI7B 4GPGA 2FX4A 4X6OA 2CN0H 2ZU4A 3AK5A 3E3TA 1WXRA 1G2MA 1WV7H 7ESTE 4AN7A 1THRH 1O5AB 3EA9A 1XUJA 4TPYA 3F3BA 1EZQA 3RXAA 2SGPE 4GCHG 4NIVA 1IQLA 3GS9A 3IWMA 3F9GA 1P03A 1O38A 1T4UH 3LDXH 2ZDLA 1G3DA 4XOJA 1Z8GA 2ANWA 1HAVB 1LCYA 1VITF 3RLYH 1QFKH 1BBRK 3RXDA 4JK6A 4GSOA 4ZKNU 2ZTXA 1ANBA 4MNXA 1GL0E 5TJXA 2D8WA 3U8OH 2QE7D 3PLKA 3RXBA 2NWNA 4ZHLU 2ZGHA 1BRAA 2XRCA 3L3TA 1DITH 4LZ1H 2Z9IA 2OK5A 2QN5T 3KL6A 1Q2WA 1O3MA 2Y80A 1C1NA 1HAVA 1QA0A 4ZKRU 1T8OA 3UR6A 3GCOA 4F4OC 1IQMA 5EW1H 4ABEA 2ZGXH 2WPKS 4YLUA 1O2OA 1LQEA 1W0KD 2BMGB 4B2CA 1THSH 1AFQC 1GBKA 1HAYB 1OXGA 1CBWB 3B8JA 4MNYA 3PRBA 3S0NA 3KYGA 2R2MB 2F83A 4HTCH 3AAUA 4INHA 5ABWA 1QB9A 2SNWA 1QQUA 1QJ1B 4KGAA 1RRKA 3HK6B 2FZZA 4Q7XA 5EPNA 2VIWA 2G4TA 4ISIH 1O3LA
chains in the Genus database with same CATH topology
1L1JA 2ULLA 2QC2A 2Y5FA 4UFFH 1A2CH 1ABJH 1AKSB 2AS9A 2UWPA 1A0LA 5ETXA 1LVYA 2BDGA 1P06A 4K5ZA 1K1PA 3F9EA 1LMWB 1VITH 4CRBA 1MQ5A 1WTHD 5EGMA 4Y8YA 4X2XA 2H9TH 2KAIB 1SMFE 2LNCA 3RXEA 2PSXA 5DJ7A 3RXVA 4ISLA 5DP7A 2ZDMA 3U1IB 2NU0E 3UPEA 4XBBA 5DKMA 5A0AE 1SL3A 2FIRH 4GCHF 1V2NT 1D3DB 1C2GA 3Q00A 1HXEH 3P95A 3QZRA 1KIGH 2WPIS 4IMQA 3T25A 4JZDH 1WQSA 2PKSC 1BJVA 3S9AA 2GVFA 4A7IB 4D7GA 3SU0A 5FAHA 1HFDA 4DIHH 3DA9B 3WY8A 3QZQA 3RU4T 3UNSA 1C1QA 4NWLA 3M3VA 4B76A 3SNEA 1BRBE 4CREA 1M9UA 2BVSH 2W3IA 3SNAA 2BX3A 3GY7A 1LHDH 1BOQA 3TIUA 1A4WH 1GBIA 4ZKOU 1W0YH 1YPKH 3TK5A 1BHXF 1S81A 1FZZA 4CBOA 2HNTC 3L6PA 1BTXA 2VVUA 1MTUA 1BT7A 4WXVA 2NU1E 3MU0A 1TLDA 3GDUA 3LGYA 3PO1B 1GHZA 4D9QA 4KTSA 1ZHRA 3P92A 4JCNA 1GMDF 5L2ZH 3PMHB 1FN6A 1FJSA 4UD9H 1FIZA 1DWEH 2VNTA 2TPIZ 1F0SA 5C2ZA 4BXWA 1S5SA 1C4Y2 4Y8ZA 4NIYA 1DUAA 4NWKA 4U30A 3SQEE 2R9PA 3PB1E 1UO6A 1S0QA 3LPRA 1H9LB 1PPZA 1J9CH 1TRYA 1RIWB 1IQEA 1AFQB 2Z94A 1N6YA 1P2NA 1S6HA 4Y0ZE 2OUAA 2XCNA 1YC0A 1AHTH 5FBEA 1AQ7A 3LH3A 2FS9A 2BOHB 2FS8A 1EAIA 3H7OA 4IGDA 3U9AH 4E06H 1GBJA 3RXTA 1W2KH 3RM2H 2GMTB 3LH1A 1TB6H 3VFEA 3AW0A 2OC1A 2VB0A 4K2YA 1BRUP 3ZVDA 5HMAA 1EB2A 3KQBA 3SHCH 1BMNH 3LOXA 1T7CA 5LH8A 3U8RH 1L4ZA 1IHTH 4CHAC 3LJJA 4D7FA 1GI9B 5I25A 3ZVBA 1MBQA 4R0IA 1NRQH 1C5ZB 2BXUH 5DGJA 3MH7A 1TNKA 1MQ6A 2GV7A 2QCYA 2ZFTA 2GZ7A 1HAGE 3M36A 1N8OB 2FOBA 2ZWLH 2ALVA 1TNLA 2H1UA 1GI6A 1SHYA 2VWOA 1GHWH 1EXFA 1D6RA 5K0HA 1EPTC 3M5OA 1SFQB 3A7YA 1ZR0A 2ZHQH 2PUQH 4OS6A 1C1SA 1FNIA 2C8XB 1ZYOA 2R3YA 1QBOA 1P2OA 2QV1A 1O3NA 1HBTH 1IQNA 1O2IA 3STJA 2DE8A 2TRMA 3I77A 1MD7A 1TPSA 4XE4A 3SU4A 1QHRB 2J92A 1O5GH 1YCPM 4FVBA 4INKA 5FX5A 1O2KA 2FPZA 3F6UH 3KNXA 1LQDB 3QO6A 5AHGH 1KDQA 2XBWA 3SV6A 4WY3A 2F9PA 4Y8XA 1BBRE 3SUFA 3E91A 1GHAF 4BAMB 1AU8A 3EQ0H 2VGCB 3RC6A 1OS8A 1JRSA 1SG8B 3EAJA 2EI6A 2G5VA 3A7ZA 1MMJN 3A88A 3UY9A 5A2MH 1TPAE 1A0HB 1HJAC 1FONA 3MI4A 1O3EA 1OSSA 3OX7U 2OC8A 1EPTA 1TRNA 2BZAA 1OX1A 5DPAA 5A8YA 4JZ1A 5I46H 3VB4A 1O2UA 1DWDH 2STBE 3QLPH 3LGIA 4UFDH 1B0FA 3AVZA 2NU3E 3E8LA 4UFEH 2ODYB 3UQOA 1C5MD 3EDXB 2PR3A 2PW8H 8LPRA 1GVLA 1NTPA 4XFQA 1K1JA 4X6MA 1O3CA 3HATH 2QXIA 4X0WU 3CS0A 2Z9GA 3CENA 2F91A 2HRVA 2VWNA 4JZFH 4TY7A 1RGQA 3TNTA 2QY0B 2ZU2A 3A80A 3QTVH 1TFXA 4TWWA 1ZSLA 3FZDA 3R3GB 5AVDA 2O8UA 2V3HH 4BTIB 1NPMA 1GHYH 4Q7ZA 1GJCB 1LHCH 2PKAB 5T6DA 3W95A 2Y82A 3CS7A 3T27A 4CRFA 3UIRA 1P0SH 2ZHDA 3V7TA 4DIIH 5ESTE 1AZ8A 1XX9A 2JETB 1W7GH 4I8JA 2AMDA 5L2YH 5E8EH 1EKBB 3TGJE 1C5LH 1C5RA 3LC3A 1GDUA 7GCHF 4TY6A 2GCTB 1GHAG 3SUGA 1P2KA 3RC5A 1HJ8A 2P3UB 1DSTA 1E38B 1TNIA 3K9XB 2GT8A 3RXOA 1P8VC 2AIQA 5FX6A 2FOCA 5GWZA 1CSOE 1TNGA 1DWBH 1PPFE 4VGCC 4NCYA 4B71A 2HPQH 2IJOB 2AIPA 1KLIH 2FOEA 2ZIQH 2VGCC 1AWHB 1SQTA 4MPXA 1MAXA 2CHAC 1P2JA 2FLBH 2R3UA 2SGDE 4HFPB 1OKXA 4X1SU 4ZH8A 3BTKE 1UTMA 3S7HB 2Y81A 1AGJA 2H5DA 2Z9LA 3PMBB 1MKXH 3NPSA 2J34A 5EU8A 2BD2A 1C1PA 5EXNA 2P3FH 2A45B 1D9IA 2I6QA 1DOJA 1YPMH 3GISB 3SBKA 3MNBA 5DP8A 3U69H 2GP9B 1G36A 3MU8A 4DURA 2XWBI 1TQ0B 5HXFA 2RCEA 1C2MA 3GCTG 3UQVA 2AEIH 1V2JT 1NRSH 4Q7YA 1OWIA 3FAOA 3G01A 1O2TA 1ELVA 2C90B 1O5EH 1GMCG 5SGAE 1KYNA 1VCQA 4Y0YE 1KLTA 1EZUC 8GCHG 3UNRA 2PFEA 2FX6A 2ZU3A 2G51A 5HM2A 1QJ6B 3P8FA 4MTBA 1UMAH 5A8XA 1UTKA 1UVUH 3QGJA 1S84A 1OWHA 3TU7H 1AWFH 4ABDA 2SGEE 4ABFA 2K1QA 3BTHE 7GCHG 1PPGE 2O8TA 3T29A 7KMEH 1UTOA 1V2RT 4H42U 1GJBB 2XNIA 3M5MA 1TIOA 2Q6DA 3Q3KA 3BTFE 1DSUA 1SHHB 3LGWA 2AH4X 1WYKA 2GCHF 2A7CA 2A4QA 1Y3WA 3Q76A 1RFNA 1FI8A 3B23B 3Q3XA 1AE5A 1O2LA 5DP9A 1P57B 3OYPA 1O3JA 3MNCA 4X2VA 3GCHC 3KGPA 2ZCHP 1EAXA 2W5EA 4K60A 5DG6A 1EZXC 2ZHWH 1DLEA 4MDSA 1GBHA 1RIWC 3MU5A 2ZC9H 2BM2A 2VIPA 1C5XB 1AY6H 3NCLA 4SGBE 1O3AA 2ZDVH 1GJ7B 3A8CA 3SU6A 1K22H 2EEKA 4YLQH 3A89A 1YPGH 2Q6GA 1XXDA 2ZHFH 1W11U 4FUDA 1SOZA 1GBLA 1ANDA 2BZ6H 5LPEA 2ILNA 3P8OA 4AYVB 1O2ZA 3EGKH 2OXSA 1MCVA 1W12U 3OY6U 3ITIA 3SO3A 3SGQE 1C2JA 2A1DB 4YESB 1SGFG 1A61H 3ATWA 1Y3XA 1QURH 1C1WH 3K6ZA 4A5TS 3M7UA 1GGDB 3ODFA 2A31A 2VJ1A 3A87A 5EXLA 1MTNC 2BTCE 3GY4A 3BTGE 6GCHF 1YYY1 5JPMH 3NKKA 2B5TB 2BQ7B 2H6MA 6ESTA 1ZMLA 2WPLS 2H5CA 2AGIX 5B6OA 2ESTE 3RUOA 4OGXA 1RJXB 1XUKA 4I7YH 1L0ZA 2OBOA 3MMGA 4ABIA 2QF0A 4AZ2B 3SJOA 5DO4H 1G2LA 2ZGJA 1ELDE 1WOFA 1DANH 2ZQ1A 4PROA 1AD8H 5EW2H 1C1RA 5FPTA 4O9VA 4FUBA 3O8DA 3ZV9A 1G3EA 2WUCA 1K21H 4BTTB 2FOHA 1TX7A 4D8NA 1HJ9A 1EB1H 5LPFA 5FPSA 4MVNA 5DK1A 4BXSA 1FPHH 2THFB 1PJPA 1ZTKA 1SGFA 4UONA 3PLPA 1O5FH 1EOLA 1IQFA 1ELEE 2VIQA 2ZU1A 3PTNA 2QAAA 2FODA 4AG1A 4AX9H 1TOMH 1GPZA 2D2DA 3C1KA 4OS2A 4UEHH 1P11E 2ZNKH 1O3FA 1TMBH 4MG3A 4X8TH 2QXHA 2R0KA 1DDJA 4XBDA 1GMHG 5PTPA 4D9RA 1G3CA 3RLWH 1LDTT 3ELAH 3GDSA 1Y3YA 7LPRA 2RA3A 3DFLA 2A32A 1P10A 1SGTA 1HIAB 4AORA 4OS5A 2ANKH 3QK1A 4K8YA 1WCZA 1C4U2 1ZGVA 4KTUA 3SU2A 1ZPBA 1O2WA 2BVXH 3MU1A 4DCDA 1DY9A 3U8TH 2GZ8A 4FUIA 2J2UA 1W0ZU 1FDPA 1V2QT 2A2QH 4X2WA 4YT7H 1BCUH 1GBBA 1O34A 5T6FA 1HYLA 1CGIE 1ZPCA 1CGHA 2V6NA 1MD8A 1O39A 2BY9X 2XTTB 3M5LA 3PWCA 4AYYB 2FOAA 3MYWA 4B2BA 1VGCB 2FO9A 2XBYA 1GG6B 1H8DH 5F8ZA 2PKAA 2BHGA 1T32A 3HGNA 4X1QU 1GJDB 1QY6A 2A7JA 2CF9H 1MKWH 3P8NA 4BNRA 4A1TA 3TJVA 3BIVH 4AG2A 1SBWA 4ESTE 1UCYK 3SI4H 1GG6C 1E35B 4DGJA 4WH6A 1BDAA 1VGCC 1BTPA 1ZSKA 1S85A 4WH8A 1J16A 2ZDNA 1XKBC 3RC4A 4CRGA 4X8VH 2UUYA 1F5KU 1OWKA 3DFJA 5L30H 3MNSA 2ALPA 4U01A 2ODPA 5IDKA 1SOTA 3ZZBA 4BTUB 3SORA 1OP2A 1ZGIA 1OWJA 3BTQE 3HKJB 1SSXA 4NIWA 4NA8A 2VWLA 3RP2A 2DE9A 1K28D 2Z3EA 2PV9B 3M37A 2XCFA 1TPOA 1P2IA 1BMMH 4A1XA 3DUXH 1J8AA 3U98H 5EPYA 1A1RA 2ZPRA 1CA0C 1TRMA 4AFSA 4DT7B 2SGFE 3VGCC 1FIWA 2ZTYA 1FLEE 1V2LT 1BTHH 2AMPA 2PTCE 5EQSA 1ZMNA 4ABBA 4A92A 1SLXB 1KXDA 8GCHF 2BVRH 2BY8X 2P59A 2ZFSA 1KDQB 3D49H 2QXJA 2VU8E 2ZTZA 5E2OA 2F3CE 2V35A 1AUTC 1ZRBA 3AAVA 3O8BA 1ZZZA 2BDYA 5DP6A 3R0FA 1T31A 1XKAC 1DS2E 3RXUA 2ZPSA 4M7GA 4MNVA 3UREA 1UCYH 4NZQA 1AVGH 1AB9C 4I31A 1FY5A 1V2VT 2JKHA 5AFYH 1ELCA 4H6SB 4XSKU 4IN1A 1T4VH 4JYUH 1EJAA 2ZG0H 2PLXA 3RMMH 1S83A 2RA0A 5C67A 1GI5A 4Y7BA 1SGPE 1G37A 1O2MA 2FXRA 3KN2A 8ESTE 1BITA 2VH0A 1HAXB 2BX4A 4JMYA 3VB3A 1HDTH 4AFUA 3FZZA 2GZ9A 1DWCH 1PQAA 4AGKA 2W26A 3ZVEA 2W7SA 1HAHH 1AE8H 2OQ5A 3VPKA 1QL8A 3HPTB 2VVVA 4GHQA 2BD9A 1IAUA 1NN6A 2P94A 1QCPA 2F9VA 2C93B 3F9FA 4NSVA 3NWUA 3NUMA 3H7TA 2OTVA 2AERH 3QTOH 3BV9B 1GJ9B 1PPCE 1D3TB 2BD8A 2FI4E 2HPPH 1P2QA 5C3NA 1W10U 1EP6A 4DW2U 1YCPH 4Z6AH 3ATMA 4Y79A 2ZA5A 1YM0A 3PLBA 1ID5H 2PHBA 1KLJH 1Q3XA 5GIBA 2QGRA 1YCPK 2PSYA 3V13A 4Y7AA 1W7XH 1FAXA 1O3DA 3SNBA 1NZQH 1C1TA 1V2MT 5GDSH 1FUJA 4DVAU 1V3XA 1VCPA 1Z8RA 2XC4A 3BTDE 1ARCA 1SQOA 1GBEA 1QIXB 2BXTH 2I6SA 3BTTE 1O35A 1BQYA 2CMYA 3TJUA 4LK4A 2FESH 1CHOG 1CHOF 4ABAA 3ESTA 3GCHB 1SLVB 1GCDA 1KTTB 1D4PB 2J9NA 4K1SA 3A7TA 1WU1A 3M7TA 2CF8H 2YOLA 1TA2A 1U6QA 5E0GA 2C8WB 3KF2A 4Z0KA 5K7RA 2H9HA 1NESE 1ESAA 3A8AA 4ZXYH 2XBVA 1G3BA 1BTYA 2BQ6B 3ZVGA 1HV7A 4THNH 3S7KB 2ZZUH 3ZZ7A 3S9CA 3A8BA 2CXVA 2EC9H 1PPEE 1CT0E 1EP5A 3ZVCA 4D76A 3VXFH 1C2EA 3RXMA 4DY7B 1Z8IB 1PYTC 1C5UA 4JYTA 4JYVH 3BG4B 1N1LA 1ELAA 1GI1A 4I8GA 2BLVA 3A85A 3PM3A 3VEQB 2FP7B 1O36A 3MU4A 2WUBA 4Q2KA 1AUJA 2XWAA 3MTYA 1O32A 4OS7A 1HXFH 2FMJA 4XBCA 4FUJA 1O31A 2ZFPH 1O2HA 1H1BA 1NO9H 1Z7KA 1Y59T 3B9FH 1UVSH 1ZSJA 1C2HA 1A0JA 1C2FA 5C20A 1DM4B 3TK9A 4RKOB 5LPRA 1SI5H 1KXAA 2OC0A 5JBTA 3BTME 1C5PA 3ENSB 1UVTH 3Q3YA 3SNCA 4WMDA 1TAWA 1F2SE 2GKVE 2ANMH 1GVKB 5CMXH 4NGAH 3SV7A 2P8OB 3SGBE 1ACBE 2V0BA 2YNAA 4K3JA 3SU5A 1G9IE 3TJOA 4NIXA 1XMNB 1SGIB 1WTGH 1YBWA 3E0NB 1EQ9A 1UTPA 1UHBB 3BEUA 1GHBF 2FOMB 5ESBA 2CHAB 4GVUA 1ZTJA 2ZFQH 1O37A 4FUHA 1DXPA 4FUCA 5EODA 1DPOA 3OU0A 1UK4A 2F9NA 4ZHMU 4GHTA 1E34B 1TPPA 3GY8A 1L2EA 1GCTC 4WXIA 1O2VA 1QJ7B 2GCTC 2VINA 1GDNA 2UUFB 5F03A 4DG4A 5A0BA 1B5GH 1FPCH 1T8MA 2WPJS 1KXCA 3MFJA 4X8SH 1LHGH 2DUCA 4NFFA 1GI4A 3GDVA 3TLOA 2FEQH 1C2IA 1NRRH 1RXPA 2JETC 2PGQB 3RDZA 3TGIE 2Y7ZA 3P8GA 5DP5A 3KQEA 2HWLB 3ZYDA 3A83A 1C5TA 5AF9H 2XXLA 1O3HA 2H2ZA 2TGAA 3RMLH 4MQAA 3QGNB 4Y6DA 2H9EH