1O2SA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2sA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2sA02
3Q3YA 4JK6A 1AVGH 2XCFA 3ZVBA 3PROA 4XOJA 1TNJA 1FUJA 3RXGA 3URCA 1QCPA 3JZ2B 2XNIA 2XCNA 1D3DB 3ZVGA 1MD8A 1V2ST 4U32A 1O2HA 1C5RA 2ODYB 2I6QA 3ZZ5A 1GI5A 1VCWA 4NA7A 1F5KU 2CJIA 4K5ZA 1V2UT 1CT4E 4FUHA 3BTEE 4GHQA 4WMEA 1LPGB 5CHAC 1GMCF 1O2PA 4FVDA 4WMDA 4CH2B 5IDKA 4X1PU 1LHGH 3BN9A 3P70B 3RLWH 3T26A 1UO6A 1NRRH 3ITIA 2EEKA 4J2YB 3UOUA 3FVFB 3RXLA 4INHA 8ESTE 1GJDB 2QC2A 1Q3XA 4JMYA 1GBJA 1DX5M 1ZYOA 3EYDA 1UVSH 1FIZA 1EB1H 2WPMS 2GMTB 1GGDB 3ZZ7A 4ZMAH 1C2IA 2BYAX 1P12E 3V12A 1XUHA 4WJG2 2EI6A 4O3UA 2PFEA 1BMLA 3T29A 1HAZB 2F91A 3PYHA 3UWIA 1MAYA 4D7GA 4DIHH 1BRAA 1QBVH 4AB8A 1TAWA 2Z3CA 3LGTA 2ZFFH 3T5FH 2BD2A 4DT7B 2G00A 4ABDA 1BUIA 4Y0ZE 3UFAA 1FNIA 1L4ZA 1RTLA 3GCTG 3VB3A 1A46H 2PKAB 5SGAE 2NU1E 1A5HA 1SSXA 1G9IE 3V3MA 4YOIA 1GHBF 4IW4E 4CHAC 1YP9A 3U1JB 1EQ9A 3F9FA 4I8LA 2OXSA 1J8AA 1ZTJA 3OX7U 3SNDA 1C9PA 3MMGA 1V2PT 4NIWA 1YPKH 2R0KA 2HRVA 3S9AA 1DFPA 5K7RA 2WPLS 3VEQB 2H2ZA 1OKXA 4CBNA 5JPMH 4BAOB 4RSPA 1UTLM 2BD8A 2BM2A 3QO6A 1KYNA 4ABJA 1P2NA 2G55A 3SN8A 1BT7A 2SGEE 3UR9A 3GOVB 2FIRH 2CF8H 5J4SA 3OYPA 1G2MA 4B2AA 2OTVA 1IQHA 1NC6A 1O37A 1UTJA 1EKBB 2BXTH 3UREA 1B0EA 2OC0A 4WH6A 1Z8JB 1NRNH 1YF4A 1BTWA 1SVPA 2ZTXA 2C4FH 3L3TA 1TA2A 3SV6A 1MBMA 2CV3A 1WAYB 4GHTA 1F5LA 4BANB 4K8BA 3R0FA 1BMMH 1UTKA 1E35B 4I32A 1MTUA 1G2LA 3VXEH 5L6NH 2HNTE 2OC7A 2Z7FE 2ZP0H 1PPFE 3TK9A 3VB5A 2D26C 2ZECA 1IQMA 1FY3A 1GMCG 4AN7A 2J95A 1SGRE 2J92A 4HTCH 1TGSZ 2NU3E 2Q6FA 3ZZBA 3AASA 3MNBA 4B1TA 1SLXB 4B73A 1K21H 4D9RA 4GSOA 3IITA 1HGTH 4YOJA 3UIRA 5DPAA 1UK4A 2AGIX 3BTFE 1DLKB 3NXPA 1O3IA 1L1GA 1OWEA 3CS7A 2GZ7A 4U2WA 4MNYA 3GCNA 4GCHF 5ETXA 3GDUA 2HNTC 1KSNA 4B74A 4MDSA 2FOCA 4CH8B 3VB7A 1ELGA 3D62A 1WQVH 1BTUA 1C1UH 3FZZA 4RN6A 1S81A 3A85A 1O34A 1ETRH 3SQEE 2BY5X 2XBWA 4NG9H 2Z9KA 2OINA 3F6UH 1O3BA 1C5VA 1BMNH 2P94A 1DITH 3BTTE 2QCYA 4DGJA 5C2ZA 2J38A 6ESTA 3QX5H 3HGPA 1JIMA 1AWHB 1Z7KA 1EP6A 1SC8U 3L6PA 1IQNA 1P02A 1EZSC 1WTHD 1NESE 2F9VA 5C1UA 3RU4E 1CSOE 1O3NA 4IC6A 4NIYA 3EQ0H 2LPRA 2A0QB 3GY6A 1C2EA 1YLDA 1NRPH 3P92A 4XE4A 3RXQA 1S83A 3NUMA 4IMZA 2CMYA 1PQ8A 1C2GA 4K1TA 2BD4A 1EJNA 3UNQA 2W7SA 1AB9C 1SQAA 3LPRA 4ZKOU 1O33A 3UPEA 3SHAH 1AO5A 1V2WT 3FZDA 2A4OA 1YPMH 5DP9A 2PR3A 1DM4B 3RXBA 3VGCB 1TPPA 1MAXA 1C2KA 1HB0B 5EPNA 2PLXA 1G3BA 1FAKH 3ATKA 4RKJB 3RXFA 5A0BA 3Q3KA 3LH3A 1TMTH 3FFGA 2BLVA 1Y3UA 1EAIA 2ZDVH 8LPRA 1AKSA 2QF0A 3ZVFA 1JIRA 4I8HA 1H9HE 1C1NA 2HOBA 1SGCA 3UOPA 3UNSA 1QJ1B 1ZSJA 2D2DA 4YOGA 1TQ7B 2ZCHP 2ZGBH 1CE5A 1UK2A 2FDAA 1QGFA 4KELA 5ABWA 2ZDLA 1CO7E 1AFQC 1ZMJA 4IN2A 5FHTA 2JH0D 1ZPZA 2TIOA 4AG2A 7GCHF 1TFXA 1MU8B 3PM3A 4GCHG 2RA0A 1FQ3A 1G37A 3RLYH 5JBBS 1GI6A 3MNCA 1D3QB 5LPEA 4FUGA 3K6ZA 1TONA 1HAPH 1QL7A 3CP7A 1A3BH 1K1JA 1T32A 1LKBA 1GHAF 1GBAA 1BJVA 1GHXH 4ISOA 1SFIA 1MQ6A 1C5MD 3ZVEA 1ZPCA 3GCHC 1ZMLA 4ZHAA 1N1LA 2BLOA 2BB4A 4H6SB 3SV9A 1QY6A 1LKAA 3LT3A 5G4BA 1GPZA 3LJJA 4Z0KA 1F92A 1XXDA 2V3OH 2J2UA 5C1YA 2ZNKH 1C5YB 1GMHF 1ZRBA 1P9SA 2A7HA 4XFQA 1LTOA 4IBLH 2SGFE 2Z94A 1QR3E 4X8VH 5DP7A 3SOSA 1LQEA 2DE8A 2GCHF 3SNAA 2Y6TA 1LCYA 1GBCA 2D1JA 4DJZB 1MTNC 4DOQA 1C5NH 1EPTA 4WXIA 1BCUH 1W11U 2OC1A 4NFFA 3TJNA 2F9BH 4E06H 3TLOA 3SJKA 5A8ZA 1FLEE 1JRSA 1AFEH 2O8TA 4K69A 2ZO3H 1V2JT 4XBDA 4BAQB 3AAVA 1NU7B 3BIUH 5DP3A 2FOAA 1ORFA 2V0BA 1V6DA 4FXGH 3HKIB 3PWBA 2RA3A 1PPBH 3TNTA 2PKSB 2BX3A 1XVMA 1O35A 1IAUA 4WWYA 4BXSA 1A1RA 4ABHA 1S6FA 2VIQA 3MH5A 1LMWB 4H6TA 2ZQ2A 4UONA 1P0SH 4YT6H 4KTCA 1JMOH 4YM9A 3GY2A 1GCTB 1ETSH 1KXFA 1FV9A 3TIUA 2VJ1A 1E37B 2ZHFH 2ZG0H 3SU3A 3GDSA 2DE9A 1D9IA 5HM9A 4Q7YA 1FIWA 3SUGA 1SQOA 4MQAA 1V2QT 2JETC 1U6QA 1OP0A 4A1TA 2AMQA 2VIWA 1CT2E 2TBSA 1GBDA 4NCYA 2BVSH 9ESTA 2CGAA 3D49H 5JB9S 1DDJA 3A8DA 2VWNA 1Y5BT 3P8GA 1XXFA 3RXRA 2BMGB 3LONA 3TH2H 2A4QA 2TGAA 3SZNA 3ZVAA 4DIIH 2R9PA 3A8BA 2FWWA 2HWLB 1C4V2 2CXVA 2FYRA 2ZGJA 5DJ7A 4O3TA 2BY6X 4QT8C 1UK3A 1GHYH 1C2FA 4ISLA 2ZC9H 1H1BA 2FPZA 4MPUA 5C1XA 1C2LA 1MZAA 5PTPA 3M3SA 2QYIA 1HAGE 1ZJKA 4X6MA 3UQVA 1X7AC 3BTGE 3SI4H 2A2XH 2XXLA 3HK3B 1ACBE 4FU8A 4A1XA 2VIDA 3Q00A 3GY7A 1C2HA 1GMHG 4D76A 1WTGH 4FUBA 4YTAA 1EAWA 4JYUH 2FEQH 1AMHA 1BBRE 2BVRH 1GBBA 3O8RA 1TNIA 4BAKB 1QL8A 1KXBA 1DWDH 2GCHG 1L1JA 2PGBB 4CRGA 3NKKA 3TNSA 4MPXA 1O3FA 3QDZB 2P3TB 1A3EH 5FXLA 3PB1E 5C20A 2ZU2A 3GY4A 4OS1A 2BTCE 2R3UA 3HATH 2C8XB 1IQGA 4HGCA 2HNTF 2TRMA 1PPCE 1QRWA 1B7XB 2UUYA 1XUJA 4X2VA 4CRAA 1GMDG 1ARCA 1W14U 2BD7A 2ANMH 3T62A 1UCYE 1FJSA 2BD5A 2P93A 1FONA 1GL1A 1BA8B 3MU8A 3SJ8A 5A8YA 2PUXB 3SU0A 3LGUA 2ZQ1A 1EZUC 1PPHE 3LGWA 4ABIA 1TGNA 4Y8XA 3U8RH 3LH1A 1UTNA 3RU4D 1K9OE 1CA0B 1L2EA 3BTWE 1LVMA 2FS8A 3RXCA 1P09A 4X6PA 2VVCA 4X2XA 2ZPSA 2AGGX 1SGFG 2GCTB 4FUIA 4HFPB 3RXKA 3PLBA 3A87A 1XKAC 1QTFA 2ZI2H 3E90B 2W3IA 3GCTF 2YNAA 1GJ4H 1CU1A 1XUKA 1GI4A 1MTVA 1D6RA 2P8OC 4M7GA 1XX9A 1OSSA 3RXVA 1G30B 3M35A 1GL0E 4BNRA 2ZHEH 4AFUA 2VVVA 5AF9H 1UVPA 4DW2U 1ESBA 5F8XA 1ELCA 1FI8A 2ZDKA 2A7JA 1FDPA 3BSQA 4CRDA 1RGQA 4K1EA 1GDNA 4X6NA 5GDSH 4JZEH 4GAWA 1NO9H 1UTOA 1K22H 2QXJA 2WV4A 1O38A 1P06A 4ABFA 2GV7A 5EG4A 5LPFA 1C1OA 1BMAA 1DY8A 1O3AA 2STBE 2CHAC 4IS5A 1QA7A 1O2JA 2TGTA 3FAOA 3KIDU 1O2TA 3MU5A 1O5GH 5T6FA 4A92A 1K1MA 1DT2A 5A0CA 3SJ9A 1DWCH 3M7UA 2G51A 2AH4X 2ANYA 2ULLA 1C1SA 3A7YA 3DHKH 3PWCA 1O2LA 1A0HB 1TBQH 3OY5U 4Y79A 1O2QA 1ANBA 2Q6GA 2VH6A 4GVUA 1GBMA 1QFKH 1AKSB 3RXOA 2FM2A 2IJOB 3RXUA 4WF8A 2RG3A 1GG6B 1V3XA 2FS9A 2R3YA 5E0GA 1ANEA 1TPOA 3QLPH 2UWOA 1LHCH 1NY22 3W95A 2P59A 3MH6A 4LZ1H 3U69H 3DFLA 3B9FH 3BG4C 3QTVH 3I29A 4I33A 1V2VT 1VR1H 3RXAA 3TK5A 2HLCA 3ENSB 4MLFB 4VGCC 5ESBA 3V0XA 3QZQA 3VPKA 1EX3A 3PMJA 3IWMA 1N8OC 2G81E 1ELTA 2G52A 4TWYA 1GJCB 4TY6A 4CR5A 2VINA 3NPSA 1OP8A 4B71A 1QB6A 1YM0A 1QURH 3SU2A 3LC5A 4E7RG 4UE7H 3BTKE 1V2NT 1UTQA 3MFJA 2SFAA 3SUDA 4H4FA 2XBXA 4FVBA 3E0PB 2WPKS 3ZZ4A 1TALA 3STIA 3LIWA 1ZHPA 2FOGA 4DURA 1RFNA 1Q31A 5DG6A 4HI3A 1A2CH 1QJ6B 1GVZA 2Z9JA 1C2JA 4ZXYH 4BTTB 3PO1C 4Y6DA 2ZTZA 2FI5E 3KHVA 1V2OT 4WXVA 1WQSA 2Z9LA 1S0QA 1ELVA 1HAHH 2ZKSA 3PTBA 1WBGB 2AIPA 1NROH 1KDQA 1JBUH 3P6ZB 1OYTH 3SUEA 5GIBA 1F0TA 1WOFA 2ZIQH 2UUFB 1MKXH 3LC3A 3TVJB 4ABAA 1DANH 2NWNA 3R3GB 1O32A 1EPTB 3AW0A 1M9UA 5EODA 5TJXA 3RU4T 2Y80A 2BOKA 2Y5FA 3MO6A 1D3PB 3OSYA 1O5CB 1MKXK 2TPIZ 4AFSA 3MNSA 1YBWA 1ZOMA 5GXPA 1RTKA 2AGEX 3Q76A 1C5TA 3PLPA 2VIVA 2ZA5A 2O9QA 3KNXA 3A8AA 3EA8A 4Q80A 2C8YB 2Y7ZA 4AOQA 2H6MA 3RXJA 2XYAA 1O2NA 2A5KA 4AZ2B 5EGMA 1EP5A 3TK6A 5EXLA 1IHSH 4R8TB 2VWOA 1W12U 4ZKRU 1GI0A 3SGAE 1FN8A 4Y0YE 5I25A 3SUFA 3HK6B 1G3DA 1Z1JA 5JDUB 1O2UA 1VJ9U 1Z6EA 4B2CA 5FX5A 1O2SA 3MHWU 4X1NU 1W0YH 3TJVA 2FODA 3SNEA 1B0FA 3M61U 1E34B 3GDVA 2EI8A 5E8EH 1KXEA 3NK8A 3GISB 1BTXA 3TGIE 3RC5A 1W0ZU 4FU9A 4ISNA 2RCEA 1C9TA 1YKTA 2XW9A 1HBTH 5BRRE 3GY3A 2AFQB 4ZHLU 1ELAA 3PMAB 1S85A 1P2MA 3KGPA 1P2KA 1EATA 4D7FA 4IN1A 3ATMA 1BDAA 4BTUB 2PWXA 2ZWLH 1O3JA 1O30A 2LNCA 2ILNA 2BHGA 3BV9B 4ZAEA 1IQFA 7LPRA 4U30A 1Z8RA 3A86A 4FUFA 4XSKU 1KY9A 1DPOA 5E2OA 2ZHWH 3TGJE 4UEHH 2A4RA 3K6YA 3UQOA 1HAVB 4XBCA 4ZXXH 1O2OA 1Z71A 1Y5AT 2FOMB 3KQBA 1GI9B 5DO4H 2ZU5A 3UUZA 3O8BA 1GBTA 3SV8A 1NFXA 2O8UA 4WY3A 3MH4A 2XBYA 1H8IH 2HGTH 1LVBA 1J17T 2SGAA 4A5TS 2GD4B 2THFB 1HPGA 2BD9A 1Y3VA 4K1SA 2B9LA 1CBWB 1ESTA 1MKWK 3ZZ8A 4MTBA 4ZKSU 1TGBA 1O5BB 2BZAA 1QNJA 3M5OA 4BAMB 3KQDA 1AN1E 1O2YA 3QGJA 4CRCA 1O39A 2BQWB 2V3HH 1NU9A 4TPIZ 4B76A 1KXAA 4OGYA 7KMEH 3SJOA 1TOCB 5AVDA 2Y7XA 3L33A 1CHOF 3FP7E 4NA8A 1XUGA 1SPJA 1Z6JH 1UVUH 1HAOH 1AVXA 1AI8H 1HJAB 2ZDAH 5EQRA 2GGVB 1A5IA 1FPHH 1ZGVA 3RUOA 1P05A 3K9XB 3PLKA 2O8LA 2ZF0H 4I8GA 1EOLA 3M3VA 1ZJDA 4I31A 2VIPA 3S69A 2C3SA 4LZ4B 1K1NA 5C5OA 3ESTA 5DKMA 1EAXA 4K2YA 4X2WA 3RDZA 2VU8E 2QF3A 1HIAA 1V2KT 4MPWA 2YNBA 4I8KA 1NT1A 4Y71A 1GDQA 1SR5C 1FN6A 4U01A 2A32A 2C93B 5F8ZA 1FZZA 2F9UA 5LPRA 1T31A 1SLUB 2P3UB 2Y82A 3BEIB 3TJUA 1KLJH 3RMOH 2A5AA 1O3EA 3GCOA 1O3PB 3RC4A 3F9HA 1AGJA 3E1XB 5JB8S 2STAE 1AZZA 1TBZH 1LHDH 1JOUB 2AMDA 4X1QU 1BZXE 1GDUA 3KQEA 1C4U2 2SGDE 2FI3E 1PYTC 5F03A 3VXFH 3SORA 1TX8A 3STJA 1UMAH 1B5GH 2AMPA 1GHWH 5FPTA 3A84A 4FUJA 4ISHH 1GJ6A 1KLIH 1WYKA 4INLA 5JBCS 2PTCE 3GYMA 1VCQA 2ANWA 2GZ8A 1LPZB 1P2OA 2K1QA 2BOHB 1MCTA 4D9QA 1LVYA 3MO9A 3S9BA 4NA9H 1CVWH 1RTFB 4I8JA 5BPEA 1EXFA 4NZLA 3SV7A 3M7QA 1G32B 2VWLA 3P95A 1H9LB 2BZ6H 1LHFH 1PQAA 2PW8H 5CMXH 1KLTA 3UY9A 2HPQH 2ZHDA 1E38B 3KQCA 5DP5A 1HAIH 1GMDF 1YPJH 4LOYH 4X2YA 1KXDA 1EB2A 4B2BA 1YCPM 2FYQA 2WPIS 1MMJN 1P3EA 1GI8B 2RDLA 1CHOG 1S5SA 1DXWA 1YGCH 2BQ6B 3ATLA 4Y8YA 3C27B 1EUFA 3P17H 3FP8E 5EXNA 3H7OA 3O8CA 1SGYE 3SU6A 1ARBA 1C5PA 2GP9B 5L30H 1VZQH 1XVOA 1YPHE 4GPGA 1QB1A 2ZHQH 3QZRA 4TY7A 1FAXA 1IHTH 4UFDH 3U98H 1OP2A 1Y8TA 3AAUA 4X8TH 1BBRH 1NRSH 4YO9A 5EPYA 1SOZA 1HLTH 1DY9A 5B6OA 1E36B 1DE7H 3E8LA 4E7NA 1O0DH 2P95A 1EJAA 4O03A 1GJ9B 2GZ9A 2G5NA 1ZGIA 3HPTB 1BBRK 1T8NA 5EW2H 1TNHA 2VGCB 4O9VA 4X6OA 1NZQH 2SNVA 1UTMA 1YPHC 3D23A 1D6WA 1FXYA 3TJOA 1KDQB 3SI3H 3MU4A 1FY1A 1HAVA 1RXPA 1SGTA 1V2LT 1UVOA 4OGXA 5DK1A 1O2ZA 3ZV9A 2QA9E 1O2GH 1VGCB 1W3CA 1HNEE 5TCCA 4X8UH 1ETTH 2FLBH 4THNH 1H9IE 3RXIA 1FPCH 2R0LA 2ZFTA 1MCVA 6CHAC 1TE0A 2O8WA 1UCYK 3BTQE 1C5SA 4HZHA 5EW1H 1QQUA 1IQEA 4ESTE 3SGQE 2OUAA 3H7TA 5DP4A 1GJ8B 2PKSC 2BLQA 2AIQA 4BAHB 1MTSA 1L4DA 1P10A 2ALVA 1OS8A 5E0HA 4MG3A 5FAHA 1P2JA 1SGNE 1AE8H 1PFXC 1YYY1 3LOXA 4JCNA 2HPPH 1IQKA 1ZSLA 3TH4H 1N6XA 1RRKA 1GCTC 2B5TB 1GBFA 2I6SA 2B0FA 2FOEA 1MH0A 3U8TH 2J94A 3M5LA 3SGBE 2BD3A 3GY5A 3NWUA 3EA9A 5EQSA 1YPLH 2W5EA 1TX6A 4Y10E 1C1WH 5EOKA 2UUKB 1RIWC 3BF6H 2VIOA 4NIVA 1HJ9A 5EU8A 1CGJE 1ZRKA 1QBNA 2BDBA 2ASUB 3MU0A 4ISIH 1JXPA 2OBOA 4Q7ZA 1GBLA 1BQYA 3PMHB 2C90B 1P3CA 2GVFA 3GICB 4YT7H 1FMGA 3BTHE 2NU4E 2WUCA 3ZVCA 1P03A 2GT8A 3M3TA 1VJAU 5FBIA 3RM0H 4CRBA 3JZ1B 2BY8X 2XWAA 2ZCLP 5CHAB 5C67A 4J1YA 1GJBB 5DGJA 1MU6B 3S7KB 5FCKA 1IQLA 4A7IB 2GKVE 1AQ7A 4CREA 1O2XA 2IOTA 1QRXA 4WMFA 3BTME 4JK5A 2QV1A 1F2SE 1O2IA 2FOBA 4YLUA 4LK4A 1NPMA 2JKHA 3PMBB 5LGOA 3M7TA 3LU9B 2XBVA 3E6PH 3MOCA 3QK1A 4BXWA 1SL3A 1O5FH 1SI5H 1ZR0A 4ZH8A 1Y59T 3HGNA 4ASHA 1O3OA 1IOEA 2CN0H 4A1VA 1NFYA 2EC9H 3MH7A 3W94A 5A8XA 3A88A 9LPRA 1GHVH 1WU1A 1TQ0B 3HKJB 3A89A 3MWIU 2J9NA 3RXHA 6GCHF 1P04A 3LKWA 3QWCH 5AFYH 2FI4E 3QGNB 1ANCA 1DWBH 1C1VH 4JYTA 5F6MA 2BQ7B 5L2YH 1Y5UT 1OOKB 3UR6A 1SHYA 1HCGA 2GT7A 1QQ4A 1Z8GA 4CHAB 1BRBE 1HUTH 1A4WH 1Y3YA 1W10U 2PGQB 5IYTA 2WUBA 4X1RU 2VVUA 4OS5A 4AYVB 1AUJA 3LGYA 1H4WA 5GWZA 4XBBA 5JBTA 1RD3B 1SGEE 1QIXB 1AHTH 2A5IA 2ZEBA 1K1OA 1OX1A 1L1NA 1ZHMA 4YZUA 1YCPK 3M5NA 1O2RA 3A81A 2F83A 3F9EA 7ESTE 3P8FA 1C1TA 1CA0C 1UJ1A 2F9NA 4DCDA 1O5DH 4GUXA 4CR9A 1TGCA 5EQQA 4LXBH 1TOMH 5T6GA 2GCTC 3SU4A 4A6LA 4ABEA 1HIAB 1OYQA 2IPHA 3LDXH 4MNWA 1GVKB 1S84A 2G8TA 3V7TA 1K28D 1NFWA 3BIVH 3T25A 1GWAA 1TYNA 1WV7H 1C5UA 1P2QA 5I46H 1IQJA 1DVAH 3OU0A 1AU8A 1BTZA 1QBOA 2BXUH 1ELEE 4XDEA 1EASA 4ZROA 1GVLA 1C5QA 1HYLA 1DSTA 1L0ZA 1UHBB 5EXMA 4AFZA 6LPRA 1P01A 4AB9A 1SFQB 1GJAB 3TITA 4IMQA 3U9AH 1QB9A 1HXEH 1W7XH 3B8JA 4NSYA 1DXPA 4R0IA 2OCVB 3NCLA 2FO9A 3A7XA 1ELFA 2G5VA 2ZPRA 3MO3A 2TGDA 2QXIA 5L2ZH 5A0AE 4KTSA 4AX9H 1DSUA 2BDIA 1A61H 1O36A 4KGAA 2FLRH 1MTWA 3TH3H 1GBEA 1HFDA 5GPIB 1BOQA 3I77A 1HAXB 2A45B 3ZVDA 1FY4A 1P57B 5H4IB 2UWPA 4UFFH 3CENA 4K60A 2KAIB 1XMNB 2QIQA 1UVTH 2OBQA 1S6HA 5JBAS 6GCHG 4TYDA 1F7ZA 1YLCA 1QJ7B 2OP9A 3E0NB 1O5AB 2IN2A 3V13A 3G01A 3ATIA 1XM1A 2EA3A 1KTSB 2HVXA 1BHXF 1CQQA 4E05H 2FXRA 4CBOA 2FTMA 3ZYEA 3P8NA 4Z6AH 1F0RA 8GCHF 1AIXH 2H9TH 3BG8A 1G3EA 2FX6A 3RP2A 1THRH 4SGBE 1TRMA 1F0SA 1GG6C 1QA0A 4UDWH 3NZIA 1CGIE 3RXSA 1T7CA 1O2KA 5HM2A 2OQ5A 5LH8A 3RXDA 5GCHF 2WINI 3KN2A 3QUMP 1AVWA 1BTPA 1TNKA 2VB0A 2FOHA 1C5WB 1G3CA 3IG6B 4INKA 3RMNH 2GMTC 1GGDC 4WH8A 4YESB 3DT0H 4YLQH 2Z9GA 3GY8A 1RJXB 3SU5A 1V2RT 5J4QA 4WVPE 1E0FD 1DS2E 3RXMA 1BTHH 2AERH 2PSXA 1DLEA 2NU0E 3SV2H 1SGQE 4FUDA 1ZLRA 1V2TT 2R2WU 1INCA 1YPGH 2JH5D 4MNXA 3UTUH 1AB9B 4AORA 1ANDA 5ESTE 5FPYA 1GI2A 5A2MH 4KP0A 5K0HA 3EE0B 5F8TA 4KTUA 1GBKA 2ZU1A 2H5CA 1DUAA 1WCZA 1K1LA 2SGPE 2W7UA 1N6YA 1AD8H 1C5LH 2FESH 4Y8ZA 2QN5T 1ID5H 1PPEE 1AZ8A 1HV7A 1G36A 1NN6A 1LVOA 1GI7B 2FP7B 3MNXA 1A0JA 2PSYA 2WPHS 3M37A 4Y7AA 1RS0A 4Q7XA 4K8YA 1P2IA 1FY8E 5DP8A 1SQTA 3RM2H 1O2VA 1DOJA 1MBQA 2SNWA 1C4Y2 2HALA 3ZZ6A 1SOTA 5FPSA 2AEIH 2ALPA 1W13U 1AFQB 1C5OH 3OTJE 2WPJS 3DUXH 3K65B 1EPTC 4I7YH 1O2WA 1GJ5H 4JZDH 4O97A 1XUIA 1TABE 2BDGA 4MVNA 2M5TA 4KKDA 3MTYA 1MKWH 1ABJH 1TX7A 1OWJA 2ZCKP 2BY9X 4ABGA 1KIGH 1GHBG 4BTIB 3PTNA 3WY8A 1TRNA 3SW2B 2VWMA 1C2DA 3SNCA 2OLGA 4FU7A 3GCHB 4UFEH 1ZTKA 2XC0A 1OXGA 4X1SU 4K3JA 1PQ7A 2YOLA 2FOFA 1EAUA 8GCHG 2A4GA 2QXGA 3TU7H 1SGFA 3ZZ9A 3E91A 1OPHB 3KF2A 4MPVA 5E0JA 3M5MA 1C5XB 1GHZA 5GCHG 1NM6A 1O3MA 2H9HA 1AY6H 2WYJA 1ZHRA 3EGKH 2R2MB 2ESTE 3F68H 3EDXB 1MTNB 1WSSH 4GLYA 1BB0B 1J14A 3E3TA 1IQIA 3Q3XA 2VNTA 2ZPQA 1TLDA 3T28A 4NWKA 1TNGA 2ZTYA 1OWKA 1QRZA 3C1KA 2ZFPH 2BLWA 2P16A 4ZKNU 2P3FH 3MU1A 3ZZDA 2FMJA 2Q6DA 1OWHA 2GTBA 1EZXC 2XWBI 3VFEA 2JH6D 2W26A 3A8CA 1T4VH 2NU2E 5A09A 4TPYA 3SQHE 1AE5A 3ODDA 1O2MA 3KEEA 4NZQA 2QGRA 1P9UA 5HXFA 3K2UA 1ELDE 1Q2WA 2WYGA 1FY5A 1C1PA 1A5GH 3UWJH 2F9OA 1YC0A 4NFEA 4UD9H 1UHBA 1O3HA 3A7TA 2J34A 1H8DH 1BHXB 5HGGA 1LHEH 1MUEB 1PPGE 1VITF 2OQUA 8KME2 3BEFB 1JRTA 3N7OA 1GI3A 1AWFH 3P8OA 1O3CA 1NFUA 2QY0B 4AFQA 4NWLA 2XC4A 4OS2A 1W2KH 2Y5HA 2H5DA 2D8WA 2H9EH 2JETB 1O3GA 3S0NA 1GCDA 2ZGHA 3A82A 1CBWC 3RMMH 4X0WU 3AVZA 2GV6A 1MZDA 2ZZUH 2PKAA 2G4UA 1W8BH 1OWIA 1BITA 3B23B 1K2I1 5E2PA 3S7HB 1TPSA 1CT0E 1TGTA 3VGCC 2KAIA 3FP6E 3I78A 1DICA 1T8OA 3RMLH 3UNRA 1DWEH 1NTPA 2Z9IA 2AYWA 4JZ1A 2ODQA 4OS7A 2V6NA 2W3KA 2FZZA 1HJAC 1J16A 1VCPA 2C8WB 1GBHA 2Y81A 1K1PA 1HAYB 4NGAH 6CHAB 1THPB 4DY7B 1TBRH 1TMBH 3SO3A 2PV9B 1CGHA 2A2QH 4JYVH 3DD2H 3QTOH 3ZYDA 2ANKH 3E16B 3PV4A 1PQ5A 1C2MA 1TWXB 2XC5A 1BIOA 2XTTB 2Z6BD 2C8ZB 4PROA 1LDTT 1HRTH 3A7VA 4JZIA 4RKOB 1T8MA 3KCGH 5FX6A 3SNBA 3Q77A 1O3DA 3OY6U 1P8VC 4DVAU 2OD3B 1YPEH 4Y76A 1Y3WA 1V2MT 1NS3A 3ODFA 2BDAA 3VB6A 1PPZA 4ABBA 1EZQA 4ZHMU 1UTPA 4B75A 4H42U 2A31A 1RIWB 5GJ4B 2FX4A 1W7GH 3A7ZA 1O31A 2UUJB 2ZDNA 3SU1A 2BVXH 1A7SA 1K1IA 3TGKE 7GCHG 1VITG 1KTTB 2PUQH 1F5RA 5T3HA 3EAJA 3ZZ3A 2J4IA 2G4TA 1SGPE 3TPIZ 5DP6A 3U1IB 1HDTH 1SLWB 4TWWA 4MNVA 1UCYH 4AGKA 4F4OC 1T8LA 4NIXA 2WV5A 2BDYA 3VB4A 3T27A 1C1RA 2ODPA 2OC8A 3S9CA 1GHAG 1THSH 1EOJA 5HMAA 1WUNH 4FUCA 1F0UA 3A80A 2V35A 4FUEA 5C3NA 2P8OB 2PHBA 2GX4A 1GI1A 3MI4A 1D4PB 2ZU4A 1XUFA 2A1DB 2Z3DA 1S0RA 2ZGCA 1BTYA 4SGAE 3RXTA 4IGDA 3SHCH 1SGDE 4Y7BA 1BRUP 1Y3XA 2ZFQH 2BDCA 3BTDE 5HYOA 5TCAA 1GJ7B 4DG4A 2Y5GA 1CHGA 3MYWA 2B8OH 1O5EH 3A83A 3DA9B 2ZDMA 2CHAB 3LGIA 2GDDA 1ZTLA 2Z3EA 5FBEA 1TRYA 4AYYB 2ZU3A 3URDA 1P11E 3D65E 4OS6A 1VITH 3AW1A 5C5NA 1ABIH 1SLVB 4F49A 1TNLA 1KXCA 2SGQE 3LJOA 1GBIA 2B7DH 1T4UH 1ESAA 3ATWA 4IC5A 1HJ8A 2EI7A 1LQDB 1TMUH 1TA6A 2BDHA 4NSVA 1EJMA 1SGIB 2F9PA 2QXHA 2VH0A 2Q1JA 1C1QA 4AG1A 3T2NA 1O3LA 1J15A 1C5ZB 3QN7A 1MD7A 4AGJA 2ZGXH 5FCRA 1TIOA 1SG8B 3ZV8A 2VGCC 2CF9H 3DFJA 1TB6H 1Z8IB 2BX4A 4D8NA 4Q2KA 1PJPA 2PTNA 3F1SB 1AUTC 1S82A 1NRQH 4JZFH 4BOHA 1SMFE 4ZUHA 3ELAH 1ZPBA 3LGVA 1LPKB 3EA7A 1QL9A 3O8DA 3BG4B 4CRFA 2GDEH 5AFZH 2AS9A 4Y11E 5CE1A 3GYLB 1VGCC 3H5CB 4VGCB 2ZFSA 3A7WA 2H1UA 1C1MA 5T6DA 1ZMNA 1HXFH 2QAAA 2TGPZ 1N8OB 1CA8B 3RXEA 1XKBC 4X8SH 1TPAE 1Z1IA 3BEUA 1ZZZA 1BJUA 1O3KA 2ZFRH 1SBWA 1LO6A 3RXPA 1MQ5A 2DUCA 3SJIA 4OS4A 3CS0A 1SB1H 1ELBA 1PYTD 1J9CH 3M36A 3U8OH 3RC6A 2XRCA 2BY7X 3SBKA 1SHHB 5JYIA 1A0LA 3ZZCA 2A7CA 2UWLA 2O8MA 3PO1B 4UFGH 3FANA 3ZZAA 3KL6A 2F3CE 5AHGH 1YCPH 2FTLE 1QHRB 1ZSKA 1D3TB 1OWDA 1DUEA 1JWTA 3F9GA 1BRCE
chains in the Genus database with same CATH superfamily
3Q3YA 4JK6A 1AVGH 2XCFA 3ZVBA 3PROA 4XOJA 1TNJA 1FUJA 3RXGA 3URCA 1QCPA 3JZ2B 2XNIA 2XCNA 1D3DB 3ZVGA 1MD8A 1V2ST 4U32A 1O2HA 1C5RA 2L74A 2ODYB 2I6QA 3ZZ5A 1GI5A 1VCWA 5T1VA 4NA7A 1F5KU 2CJIA 4K5ZA 1V2UT 1CT4E 4FUHA 3BTEE 4GHQA 4WMEA 1LPGB 5CHAC 1GMCF 1O2PA 4FVDA 4WMDA 4CH2B 5IDKA 2YMSD 4X1PU 1LHGH 3BN9A 3P70B 3RLWH 3T26A 1UO6A 1NRRH 3ITIA 2EEKA 4J2YB 3PRBA 3UOUA 3FKSD 3FVFB 4INHA 3RXLA 1GJDB 2QC2A 1Q3XA 8ESTE 4JMYA 1GBJA 1DX5M 1ZYOA 2HVYB 3EYDA 1UVSH 1FIZA 1EB1H 2WPMS 1MABB 2GMTB 1GGDB 3ZZ7A 4ZMAH 1C2IA 2BYAX 1P12E 3V12A 1XUHA 4WJG2 2EI6A 4O3UA 2PFEA 1BMLA 3T29A 1HAZB 2F91A 3PYHA 3UWIA 5C0UA 1MAYA 4D7GA 4DIHH 1BRAA 1QBVH 4AB8A 1TAWA 2Z3CA 3LGTA 2ZFFH 3T5FH 2BD2A 4DT7B 2G00A 4ABDA 1BUIA 4Y0ZE 3UFAA 1FNIA 1L4ZA 1RTLA 3GCTG 3VB3A 1A46H 2PKAB 4B6EA 5SGAE 2NU1E 1A5HA 1SSXA 1G9IE 3V3MA 4YOIA 1GHBF 4IW4E 4CHAC 1YP9A 3U1JB 1EQ9A 3F9FA 4I8LA 2OXSA 1J8AA 1ZTJA 3OX7U 3SNDA 1C9PA 3MMGA 1V2PT 4NIWA 1YPKH 2R0KA 2HRVA 3S9AA 1DFPA 5K7RA 2WPLS 3VEQB 2H2ZA 1OKXA 4CBNA 5JPMH 4BAOB 4RSPA 1UTLM 2BD8A 2BM2A 3QO6A 1KYNA 4ABJA 1P2NA 2G55A 3SN8A 1BT7A 2SGEE 3UR9A 3GOVB 2FIRH 2CF8H 5J4SA 3OYPA 1G2MA 4B2AA 2OTVA 1IQHA 1NC6A 1O37A 1UTJA 3VG8A 1EKBB 2BXTH 2JDID 5F53A 3UREA 1B0EA 2OC0A 4WH6A 1Z8JB 1NRNH 1YF4A 1BTWA 1SVPA 2ZTXA 2C4FH 3L3TA 1TA2A 3SV6A 1MBMA 2CV3A 1WAYB 4GHTA 1F5LA 4BANB 4K8BA 3R0FA 1BMMH 1UTKA 1E35B 4I32A 1MTUA 1G2LA 3VXEH 5L6NH 2HNTE 2OC7A 2Z7FE 2ZP0H 1PPFE 3TK9A 3VB5A 2D26C 2ZECA 1IQMA 1FY3A 1GMCG 3SYJA 4AN7A 2J95A 1SGRE 2J92A 4HTCH 3NRLA 2AHME 1TGSZ 2NU3E 2Q6FA 3ZZBA 3AASA 3MNBA 4B1TA 1SLXB 4B73A 1K21H 4D9RA 4GSOA 3IITA 1HGTH 4YOJA 3UIRA 5DPAA 1UK4A 2AGIX 3BTFE 1DLKB 3NXPA 1O3IA 1L1GA 1OWEA 3CS7A 2GZ7A 4U2WA 4MNYA 3GCNA 4GCHF 5ETXA 3GDUA 2HNTC 1KSNA 4B74A 4MDSA 2FOCA 4CH8B 3VB7A 1ELGA 3D62A 1WQVH 1BTUA 1C1UH 3FZZA 4RN6A 1S81A 3A85A 1O34A 1ETRH 3SQEE 2BY5X 2XBWA 4NG9H 2Z9KA 2OINA 3F6UH 1O3BA 1C5VA 1BMNH 2P94A 1DITH 3BTTE 1VKYA 2QCYA 4DGJA 5C2ZA 2J38A 6ESTA 3QX5H 3HGPA 1JIMA 1AWHB 2K8IA 1Z7KA 1EP6A 1SC8U 3L6PA 1IQNA 1P02A 1EZSC 1WTHD 1NESE 2F9VA 5C1UA 3RU4E 4OM9A 1CSOE 1O3NA 4IC6A 4NIYA 3EQ0H 2LPRA 2A0QB 3GY6A 1C2EA 1YLDA 1NRPH 3P92A 4XE4A 3RXQA 1S83A 3CNRA 3NUMA 4IMZA 2CMYA 3N99A 1PQ8A 1C2GA 4K1TA 2BD4A 1EJNA 3UNQA 2W7SA 1AB9C 1SQAA 3LPRA 4ZKOU 1O33A 3UPEA 3SHAH 1AO5A 1V2WT 2JJ2D 2A4OA 1YPMH 3FZDA 2PR3A 5B6LA 5DP9A 1DM4B 3RXBA 3VGCB 1TPPA 1MAXA 2KZ4A 1C2KA 1HB0B 5EPNA 2PLXA 1G3BA 1FAKH 3ATKA 4RKJB 3RXFA 5A0BA 3Q3KA 3LH3A 1TMTH 3FFGA 2BLVA 1Y3UA 1EAIA 2ZDVH 8LPRA 1AKSA 2QF0A 3ZVFA 1JIRA 1SKYE 1H9HE 1YLNA 4I8HA 1C1NA 2HOBA 1SGCA 2WSSD 3UOPA 3UNSA 1QJ1B 1ZSJA 2D2DA 4YOGA 1TQ7B 2ZCHP 2ZGBH 2YMSB 1CE5A 1UK2A 2FDAA 1QGFA 4KELA 5ABWA 2ZDLA 1CO7E 1AFQC 1ZMJA 4IN2A 5FHTA 2JH0D 1ZPZA 2TIOA 4AG2A 7GCHF 1TFXA 1MU8B 3PM3A 4TSFD 4GCHG 2RA0A 1FQ3A 1G37A 3RLYH 5JBBS 1GI6A 3MNCA 1D3QB 5LPEA 4FUGA 3K6ZA 1TONA 3DSPA 4FOUC 1HAPH 1QL7A 3CP7A 1A3BH 1K1JA 1T32A 1LKBA 1GHAF 1GBAA 1BJVA 1GHXH 4ISOA 1SFIA 1MQ6A 1C5MD 3ZVEA 1ZPCA 3GCHC 1ZMLA 4ZHAA 1N1LA 2BLOA 1UW7A 2BB4A 4H6SB 2GJGA 3SV9A 1FX0B 1QY6A 1LKAA 3LT3A 5G4BA 1GPZA 2J98B 3LJJA 4Z0KA 1F92A 1XXDA 2V3OH 2J2UA 5C1YA 2ZNKH 1C5YB 1GMHF 1ZRBA 4M9FA 1P9SA 2A7HA 4XFQA 1LTOA 4IBLH 2SGFE 2Z94A 1QR3E 4X8VH 5DP7A 3SOSA 5KGOA 1LQEA 2DE8A 2GCHF 3SNAA 2Y6TA 5EJZA 1LCYA 1GBCA 2D1JA 4DJZB 1MTNC 4DOQA 1C5NH 1EPTA 4WXIA 1BCUH 1W11U 2OC1A 4F55A 4NFFA 3TJNA 2F9BH 4E06H 3TLOA 3SJKA 5A8ZA 1FLEE 1JRSA 1AFEH 2O8TA 3EE7A 5C0TA 4K69A 2ZO3H 1V2JT 4XBDA 4BAQB 3AAVA 1NU7B 3BIUH 5DP3A 2FOAA 1ORFA 2V0BA 3AK5A 1V6DA 4FXGH 3HKIB 3PWBA 1K0HA 2RA3A 1PPBH 3TNTA 2PKSB 2BX3A 1XVMA 1O35A 1IAUA 4WWYA 4BXSA 1A1RA 4ABHA 1S6FA 2VIQA 3MH5A 1LMWB 4H6TA 2ZQ2A 4UONA 1P0SH 4YT6H 4KTCA 1JMOH 4YM9A 3GY2A 1GCTB 1ETSH 1KXFA 1FV9A 3TIUA 2VJ1A 1E37B 2ZHFH 2ZG0H 3SU3A 3GDSA 2DE9A 1D9IA 5HM9A 4Q7YA 1FIWA 3SUGA 1SQOA 4MQAA 1V2QT 2JETC 1U6QA 1OP0A 4A1TA 2AMQA 2VIWA 1CT2E 2TBSA 1GBDA 4NCYA 2BVSH 9ESTA 2CGAA 3D49H 5JB9S 1DDJA 3A8DA 2VWNA 1Y5BT 3P8GA 1WXRA 1XXFA 3RXRA 2BMGB 3LONA 3TH2H 2A4QA 2TGAA 5EJ1A 3SZNA 3ZVAA 4DIIH 2R9PA 3A8BA 2FWWA 2HWLB 2OK5A 1C4V2 2CXVA 2FYRA 2ZGJA 5DJ7A 4O3TA 2BY6X 4QT8C 1UK3A 1GHYH 1C2FA 4ISLA 2ZC9H 1H1BA 2FPZA 4MPUA 5C1XA 1C2LA 1MZAA 3H09A 5PTPA 3M3SA 2QYIA 1HAGE 1ZJKA 4RT1A 4X6MA 3UQVA 1X7AC 3BTGE 3SI4H 2A2XH 2XXLA 3HK3B 1ACBE 4FU8A 4A1XA 2VIDA 3Q00A 3GY7A 1C2HA 1GMHG 3KYFA 4D76A 1WTGH 4FUBA 4YTAA 1EAWA 4JYUH 2FEQH 1AMHA 1BBRE 2BVRH 1GBBA 3O8RA 1TNIA 4BAKB 1QL8A 1KXBA 1DWDH 2GCHG 1L1JA 2PGBB 4CRGA 3NKKA 3TNSA 4MPXA 2KCPA 1O3FA 3QDZB 2P3TB 1A3EH 5FXLA 3PB1E 5C20A 2ZU2A 3GY4A 4OS1A 4F48B 2BTCE 2R3UA 3HATH 2C8XB 1IQGA 4HGCA 2HNTF 2TRMA 1PPCE 1QRWA 1B7XB 2UUYA 1XUJA 4X2VA 4CRAA 1GMDG 1ARCA 1W14U 2BD7A 2ANMH 3T62A 1UCYE 1FJSA 2BD5A 2P93A 1FONA 1GL1A 1BA8B 3MU8A 3SJ8A 5A8YA 2PUXB 3SU0A 3LGUA 2ZQ1A 1EZUC 1PPHE 3LGWA 4ABIA 1TGNA 4Y8XA 3U8RH 3LH1A 1BMFD 1UTNA 3RU4D 1K9OE 1CA0B 1L2EA 3BTWE 1LVMA 2FS8A 3RXCA 1P09A 4X6PA 2VVCA 2WV9A 4X2XA 2ZPSA 2AGGX 1SGFG 2GCTB 5CDFE 4FUIA 4HFPB 2M2AA 2KX4A 3RXKA 3PLBA 3A87A 1XKAC 1QTFA 2ZI2H 3E90B 2W3IA 3GCTF 2YNAA 1GJ4H 1CU1A 1XUKA 1GI4A 1MTVA 1D6RA 2P8OC 4M7GA 1XX9A 1OSSA 3RXVA 1G30B 3M35A 1GL0E 4BNRA 2ZHEH 4AFUA 2VVVA 5AF9H 1UVPA 4DW2U 1ESBA 5F8XA 1ELCA 1FI8A 2ZDKA 2A7JA 1FDPA 3BSQA 4CRDA 2WHXA 1RGQA 4K1EA 1GDNA 4X6NA 5GDSH 4JZEH 4GAWA 1NO9H 1UTOA 1K22H 2QXJA 2WV4A 1O38A 1P06A 4ABFA 2GV7A 5EG4A 5LPFA 1C1OA 1BMAA 1DY8A 1O3AA 2STBE 2CHAC 4IS5A 1QA7A 1O2JA 1OHHD 2TGTA 3FAOA 3KIDU 1O2TA 3MU5A 1O5GH 5T6FA 4A92A 1K1MA 1DT2A 5A0CA 3SJ9A 1DWCH 3M7UA 2G51A 2AH4X 2ANYA 2ULLA 1C1SA 3A7YA 3DHKH 3KYGA 3PWCA 1O2LA 1A0HB 1TBQH 1KMHB 3OAAD 3OY5U 4Y79A 1O2QA 1ANBA 2Q6GA 2VH6A 4GVUA 1GBMA 1QFKH 1AKSB 3RXOA 2FM2A 2IJOB 3RXUA 4WF8A 1E79D 2RG3A 1GG6B 1V3XA 2FS9A 2R3YA 4P02A 5E0GA 1ANEA 1TPOA 3QLPH 2UWOA 1LHCH 1NY22 3FOAA 3W95A 1NBMD 2P59A 3MH6A 4LZ1H 3U69H 3DFLA 3B9FH 3BG4C 3QTVH 3I29A 4I33A 1V2VT 1VR1H 3RXAA 3TK5A 2HLCA 3ENSB 4MLFB 4VGCC 5ESBA 3V0XA 3QZQA 3VPKA 1EX3A 3PMJA 3IWMA 1N8OC 2G81E 1ELTA 2G52A 4TWYA 1GJCB 4TY6A 4CR5A 2VINA 3NPSA 1OP8A 4B71A 1QB6A 1YM0A 1QURH 3SU2A 3LC5A 4E7RG 4ASUD 4UE7H 3BTKE 1V2NT 1UTQA 3MFJA 2SFAA 3SUDA 4H4FA 2XBXA 4FVBA 3E0PB 2WPKS 3ZZ4A 2J5UA 1TALA 3STIA 1QZ8A 1ZHPA 2FOGA 3LIWA 4DURA 1RFNA 1Q31A 5DG6A 4HI3A 1A2CH 1QJ6B 1GVZA 2Z9JA 1C2JA 4ZXYH 4BTTB 3PO1C 4Y6DA 2QE7D 2ZTZA 2FI5E 3KHVA 1V2OT 4WXVA 1WQSA 2Z9LA 1S0QA 1ELVA 1HAHH 2ZKSA 1E1QD 2QF5A 3PTBA 1WBGB 2AIPA 1NROH 1KDQA 1JBUH 3P6ZB 1OYTH 3SUEA 5GIBA 1F0TA 1WOFA 2ZIQH 2UUFB 1MKXH 3LC3A 3TVJB 4ABAA 1DANH 2NWNA 3R3GB 1O32A 1EPTB 3AW0A 1M9UA 5EODA 5TJXA 3W1EA 3RU4T 2Y80A 2BOKA 2Y5FA 3MO6A 1D3PB 3OSYA 1O5CB 1MKXK 2TPIZ 4AFSA 3MNSA 1YBWA 1ZOMA 5GXPA 3MQKC 1RTKA 2AGEX 3Q76A 1C5TA 3PLPA 2VIVA 2ZA5A 2O9QA 3KNXA 3A8AA 3EA8A 4Q80A 2C8YB 2Y7ZA 4AOQA 2H6MA 3OTPA 3RXJA 2XYAA 1O2NA 1SQRA 2A5KA 4AZ2B 5EGMA 1EP5A 3TK6A 5EXLA 1IHSH 4R8TB 2VWOA 1W12U 4ZKRU 1GI0A 3SGAE 1FN8A 4Y0YE 2IJD1 5I25A 3SUFA 3HK6B 1G3DA 1Z1JA 5JDUB 1O2UA 2V3MA 1VJ9U 1Z6EA 4B2CA 5FX5A 1O2SA 3MHWU 4X1NU 1W0YH 3TJVA 2FODA 3SNEA 1B0FA 3M61U 1E34B 3GDVA 2EI8A 5E8EH 2EQNA 1KXEA 3NK8A 3GISB 2W6JD 1BTXA 3TGIE 3RC5A 3OE7D 3PRDA 1W0ZU 4FU9A 4ISNA 2RCEA 1C9TA 1YKTA 2XW9A 1HBTH 3WW7A 5BRRE 3GY3A 2AFQB 4ZHLU 1ELAA 2RFKC 3PMAB 1S85A 1P2MA 3KGPA 1P2KA 1EATA 4D7FA 4IN1A 3ATMA 1BDAA 2W6ID 4BTUB 2PWXA 2ZWLH 1O3JA 1O30A 2LNCA 2ILNA 2BHGA 3BV9B 4ZAEA 1IQFA 7LPRA 4U30A 1Z8RA 3A86A 4FUFA 4XSKU 1KY9A 1DPOA 5E2OA 3UAIC 2ZHWH 1WDIA 3TGJE 4UEHH 2A4RA 3K6YA 3UQOA 1HAVB 4XBCA 4ZXXH 1O2OA 1Z71A 1Y5AT 2FOMB 4FETA 3KQBA 1GI9B 5DO4H 2ZU5A 3UUZA 3O8BA 1GBTA 3SV8A 3OEHD 1NFXA 2O8UA 4WY3A 3MH4A 1S6LA 2XBYA 1H8IH 2HGTH 1LVBA 1J17T 2SGAA 4A5TS 2GD4B 2THFB 1HPGA 2BD9A 1Y3VA 4K1SA 2B9LA 1CBWB 1ESTA 1MKWK 3ZZ8A 4MTBA 4ZKSU 1TGBA 1O5BB 2BZAA 1QNJA 3M5OA 4BAMB 3KQDA 5EJLA 1AN1E 1O2YA 3QGJA 2J97A 4CRCA 3U28C 1O39A 2BQWB 2V3HH 1NU9A 4TPIZ 4B76A 1KXAA 4OGYA 7KMEH 3SJOA 1TOCB 5AVDA 2Y7XA 3L33A 1CHOF 3FP7E 4NA8A 3OEED 1XUGA 1SPJA 1Z6JH 1UVUH 1HAOH 1AVXA 1AI8H 1HJAB 2ZDAH 5EQRA 2GGVB 1A5IA 1FPHH 1ZGVA 3UB0A 3RUOA 1P05A 3K9XB 3PLKA 2O8LA 2ZF0H 4I8GA 1EOLA 3M3VA 1ZJDA 4I31A 1H8HD 2XNDD 2VIPA 3S69A 2C3SA 1W0JD 4LZ4B 1K1NA 4HG6A 2F43B 3ESTA 5C5OA 2IPQX 5DKMA 2F4LA 1EAXA 4K2YA 4X2WA 3RDZA 2VU8E 2QF3A 1HIAA 1V2KT 3OFND 4MPWA 2YNBA 4I8KA 1NT1A 4Y71A 1GDQA 1SR5C 1FN6A 4U01A 2A32A 4DT4A 2C93B 5F8ZA 1FZZA 2F9UA 5LPRA 1T31A 1SLUB 2P3UB 2Y82A 4Z1MD 3BEIB 2L6OA 3TJUA 1KLJH 3RMOH 2A5AA 1O3EA 3GCOA 1O3PB 3RC4A 3F9HA 1AGJA 3E1XB 3F2GA 5JB8S 2STAE 1AZZA 1TBZH 1LHDH 1JOUB 2AMDA 4X1QU 1BZXE 1GDUA 3KQEA 1C4U2 2SGDE 2FI3E 1PYTC 5F03A 3VXFH 3SORA 1TX8A 3STJA 1UMAH 1B5GH 2AMPA 1GHWH 5FPTA 3A84A 4ACBA 2LELA 4FUJA 4ISHH 1GJ6A 5HKKD 1KLIH 1WYKA 4INLA 5JBCS 2PTCE 3GYMA 1VCQA 2ANWA 2GZ8A 1LPZB 1P2OA 2K1QA 2BOHB 1MCTA 4D9QA 1LVYA 3MO9A 3S9BA 4NA9H 1CVWH 1RTFB 4I8JA 5BPEA 1EXFA 4NZLA 3SV7A 3M7QA 1G32B 3F2FA 2VWLA 3P95A 1H9LB 2BZ6H 1LHFH 1PQAA 2PW8H 5CMXH 1KLTA 3UY9A 2HPQH 2ZHDA 1E38B 3KQCA 5DP5A 1HAIH 1GMDF 1YWUA 1YPJH 4LOYH 4X2YA 1KXDA 1EB2A 4B2BA 1YCPM 2FYQA 2WPIS 1MMJN 1P3EA 1GI8B 2RDLA 5EIYA 1CHOG 1S5SA 1DXWA 1YGCH 2BQ6B 3ATLA 4Y8YA 4AC9A 3C27B 1EUFA 3P17H 3FP8E 5EXNA 3H7OA 3O8CA 1SGYE 3SU6A 3DSOA 1ARBA 1C5PA 2GP9B 5L30H 1VZQH 1XVOA 1YPHE 4GPGA 1QB1A 2ZHQH 3QZRA 4TY7A 1FAXA 1IHTH 4UFDH 3U98H 1OP2A 1Y8TA 3AAUA 4X8TH 1BBRH 1NRSH 4YO9A 5EPYA 1SOZA 1HLTH 3DCLA 1DY9A 5B6OA 1E36B 1DE7H 3E8LA 4E7NA 1O0DH 2P95A 1EJAA 4O03A 1GJ9B 2GZ9A 2G5NA 1ZGIA 3HPTB 1BBRK 1T8NA 5EW2H 1TNHA 2VGCB 4O9VA 4X6OA 1NZQH 2SNVA 1UTMA 1YPHC 3D23A 1D6WA 1FXYA 3TJOA 1KDQB 3SI3H 3MU4A 2HLDD 1FY1A 1HAVA 1RXPA 1SGTA 1V2LT 1UVOA 4OGXA 5DK1A 1O2ZA 3ZV9A 2QA9E 1O2GH 1VGCB 1W3CA 1HNEE 5TCCA 4X8UH 1ETTH 2FLBH 2KR7A 1H9IE 4THNH 3RXIA 1FPCH 2R0LA 2ZFTA 1MCVA 6CHAC 1TE0A 3F0PA 2O8WA 1UCYK 3BTQE 1C5SA 4HZHA 5EW1H 1QQUA 1IQEA 4ESTE 3KQ5A 3ZIAD 3SGQE 2OUAA 3H7TA 5DP4A 1GJ8B 2PKSC 2BLQA 2AIQA 4BAHB 5GNDA 1MTSA 1L4DA 1P10A 2ALVA 1OS8A 5E0HA 4MG3A 5FAHA 1P2JA 1SGNE 1AE8H 1PFXC 1YYY1 3LOXA 4JCNA 2HPPH 1IQKA 1ZSLA 3TH4H 1N6XA 1RRKA 1GCTC 2B5TB 1GBFA 2I6SA 2B0FA 2FOEA 1MH0A 3U8TH 2J94A 3M5LA 3SGBE 2BD3A 3GY5A 3NWUA 3EA9A 5EQSA 1YPLH 2W5EA 1TX6A 4Y10E 1C1WH 5EOKA 2UUKB 1RIWC 3BF6H 2VIOA 4NIVA 1HJ9A 5EU8A 1CGJE 1ZRKA 1QBNA 2BDBA 2ASUB 3MU0A 4ISIH 1JXPA 2OBOA 4Q7ZA 1GBLA 1BQYA 3PMHB 2C90B 1P3CA 2GVFA 3GICB 4YT7H 1FMGA 3BTHE 2NU4E 2WUCA 3ZVCA 1P03A 2GT8A 3M3TA 1VJAU 5FBIA 3RM0H 4CRBA 2K0QA 5FL7D 3JZ1B 2BY8X 2XWAA 2ZCLP 5CHAB 5C67A 4J1YA 1GJBB 5DGJA 1MU6B 3S7KB 5FCKA 1IQLA 3F0OA 4A7IB 2GKVE 3WWFA 1AQ7A 4CREA 1W0KD 5CHBA 1O2XA 2IOTA 1QRXA 4WMFA 3BTME 4JK5A 2QV1A 1F2SE 1O2IA 2FOBA 4YLUA 4LK4A 1NPMA 2JKHA 3PMBB 5LGOA 3M7TA 3LU9B 4RT0A 2XBVA 3E6PH 3MOCA 3QK1A 4BXWA 1SL3A 1O5FH 2V7QD 1SI5H 1ZR0A 4ZH8A 1Y59T 3HGNA 4ASHA 1O3OA 1IOEA 2CN0H 4A1VA 1NFYA 2EC9H 3MH7A 3W94A 5A8XA 3A88A 9LPRA 1GHVH 1WU1A 3WWBA 1TQ0B 3HKJB 3A89A 3MWIU 2J9NA 3RXHA 6GCHF 1P04A 3LKWA 3QWCH 5AFYH 2FI4E 3QGNB 1ANCA 1DWBH 1C1VH 4JYTA 5F6MA 2BQ7B 5L2YH 1Y5UT 1OOKB 3UR6A 1SHYA 1HCGA 2GT7A 1QQ4A 1Z8GA 4CHAB 1BRBE 1HUTH 1A4WH 1Y3YA 1W10U 2PGQB 5IYTA 2WUBA 4X1RU 2VVUA 4OS5A 4AYVB 1AUJA 3LGYA 1H4WA 5GWZA 4XBBA 5JBTA 1RD3B 1SGEE 1QIXB 1AHTH 2A5IA 2ZEBA 1K1OA 1OX1A 1L1NA 3GS9A 1ZHMA 4YZUA 1YCPK 3M5NA 3F3BA 1O2RA 3A81A 2F83A 3F9EA 7ESTE 3P8FA 2KFWA 1C1TA 1CA0C 1UJ1A 2F9NA 3DSGA 4DCDA 1O5DH 4GUXA 4CR9A 1TGCA 5EQQA 4LXBH 1TOMH 5T6GA 2GCTC 3SU4A 4A6LA 4ABEA 1HIAB 1OYQA 2IPHA 3LDXH 4MNWA 1GVKB 1S84A 2G8TA 3V7TA 1K28D 1NFWA 3BIVH 3T25A 1GWAA 1TYNA 1WV7H 1C5UA 1P2QA 5I46H 1IQJA 1DVAH 3OU0A 1AU8A 1BTZA 1QBOA 2BXUH 1ELEE 4XDEA 1EASA 4ZROA 1GVLA 1C5QA 1HYLA 1DSTA 1L0ZA 1UHBB 5EXMA 4AFZA 2JJ1D 6LPRA 1P01A 4AB9A 1SFQB 1GJAB 3TITA 4IMQA 3U9AH 1QB9A 1HXEH 1W7XH 3B8JA 4NSYA 1DXPA 4R0IA 2OCVB 3NCLA 2FO9A 2CK3D 1ELFA 3A7XA 2G5VA 2ZPRA 3MO3A 2TGDA 4XRNA 2QXIA 5L2ZH 5A0AE 4KTSA 4AX9H 1DSUA 2BDIA 1A61H 1O36A 4KGAA 2FLRH 1MTWA 3TH3H 1GBEA 1HFDA 5GPIB 1BOQA 3I77A 1HAXB 2A45B 3ZVDA 1FY4A 1P57B 5H4IB 2UWPA 4UFFH 3CENA 4K60A 2KAIB 1XMNB 2QIQA 1UVTH 2OBQA 1S6HA 5JBAS 6GCHG 4TYDA 1F7ZA 2KCOA 4Q4LA 1YLCA 1QJ7B 2OP9A 3E0NB 1O5AB 2IN2A 3V13A 3G01A 3ATIA 1XM1A 2EA3A 5DSFA 1KTSB 2HVXA 1BHXF 1CQQA 4E05H 2FXRA 4CBOA 2FTMA 3ZYEA 3P8NA 4Z6AH 1F0RA 8GCHF 1AIXH 2H9TH 3BG8A 1G3EA 2FX6A 3RP2A 1THRH 4SGBE 2JIZD 5KEDA 2KM0A 1TRMA 1F0SA 1GG6C 1QA0A 4UDWH 1COWD 1CGIE 3NZIA 1T7CA 1O2KA 5HM2A 3RXSA 2OQ5A 5LH8A 3RXDA 5GCHF 2WINI 3KN2A 3QUMP 1AVWA 4ACAA 1BTPA 2PP6A 1TNKA 2VB0A 2FOHA 1C5WB 1G3CA 3IG6B 4INKA 3RMNH 2GMTC 1GGDC 4WH8A 4YESB 3DT0H 4YLQH 2Z9GA 3GY8A 1RJXB 3SU5A 1V2RT 5J4QA 4WVPE 1E0FD 1DS2E 3RXMA 1BTHH 2AERH 2PSXA 4I86A 1DLEA 2NU0E 3SV2H 1SGQE 4FUDA 1ZLRA 1V2TT 2R2WU 1INCA 1YPGH 2JH5D 4MNXA 3UTUH 1AB9B 4AORA 1ANDA 5ESTE 5FPYA 1GI2A 5A2MH 4KP0A 5K0HA 3EE0B 5F8TA 4KTUA 1GBKA 2ZU1A 2H5CA 5C17A 1DUAA 1WCZA 1K1LA 2SGPE 2W7UA 1N6YA 1AD8H 1C5LH 2FESH 4Y8ZA 2QN5T 1ID5H 1PPEE 1AZ8A 2WPDD 1HV7A 1G36A 2LP6A 1NN6A 1LVOA 1GI7B 2FP7B 3MNXA 1A0JA 2PSYA 2WPHS 3M37A 4Y7AA 1RS0A 4Q7XA 4K8YA 1P2IA 1FY8E 5DP8A 1SQTA 3RM2H 1O2VA 1DOJA 1MBQA 2SNWA 1C4Y2 2HALA 3ZZ6A 1SOTA 5FPSA 2AEIH 2ALPA 1W13U 1AFQB 1C5OH 3OTJE 2WPJS 3DUXH 3K65B 1EPTC 4I7YH 1O2WA 1GJ5H 4JZDH 4O97A 1XUIA 1TABE 3N7DA 2BDGA 4MVNA 2M5TA 4KKDA 3MTYA 1MKWH 1ABJH 1TX7A 1OWJA 2ZCKP 2BY9X 4ABGA 1KIGH 1GHBG 4BTIB 3PTNA 3WY8A 1TRNA 3SW2B 2VWMA 1C2DA 3SNCA 2OLGA 4FU7A 3GCHB 4UFEH 1ZTKA 2XC0A 1OXGA 4X1SU 4K3JA 1PQ7A 2YOLA 2FOFA 1EAUA 8GCHG 2A4GA 4XD7D 2QXGA 3TU7H 1SGFA 3ZZ9A 3E91A 1OPHB 3KF2A 4MPVA 5E0JA 3M5MA 1C5XB 1GHZA 5GCHG 4YXWD 1NM6A 1O3MA 2H9HA 1AY6H 2WYJA 1ZHRA 3EGKH 2R2MB 2ESTE 3F68H 3EDXB 1MTNB 1WSSH 4GLYA 1BB0B 1J14A 3E3TA 1IQIA 3Q3XA 2VNTA 2ZPQA 1TLDA 3T28A 4NWKA 1TNGA 2ZTYA 1OWKA 1QRZA 3C1KA 2ZFPH 2BLWA 2P16A 4ZKNU 2P3FH 3MU1A 3ZZDA 2FMJA 2Q6DA 1OWHA 2GTBA 1EZXC 2XWBI 3VFEA 2JH6D 2W26A 3A8CA 1T4VH 2NU2E 5A09A 4TPYA 3SQHE 1AE5A 3ODDA 3FN8A 1O2MA 3KEEA 4NZQA 2QGRA 1P9UA 5HXFA 3K2UA 1ELDE 1Q2WA 2WYGA 1FY5A 1C1PA 1A5GH 3UWJH 1E1RD 2F9OA 1YC0A 4NFEA 4UD9H 1UHBA 1O3HA 3A7TA 2J34A 1H8DH 1BHXB 5HGGA 1LHEH 1MUEB 1PPGE 1VITF 2OQUA 8KME2 3BEFB 1JRTA 3N7OA 1GI3A 1AWFH 3P8OA 1O3CA 1NFUA 2QY0B 4AFQA 4NWLA 4B6FA 2XC4A 4OS2A 1W2KH 2Y5HA 2H5DA 2D8WA 2H9EH 2JETB 1O3GA 3S0NA 1GCDA 2ZGHA 3A82A 1CBWC 3RMMH 4X0WU 3AVZA 2GV6A 1MZDA 2ZZUH 2PKAA 2G4UA 1W8BH 1OWIA 1BITA 3B23B 1K2I1 5E2PA 3S7HB 1TPSA 3SZEA 1CT0E 1TGTA 3VGCC 2KAIA 3FP6E 3I78A 1DICA 1T8OA 3RMLH 3UNRA 1DWEH 1NTPA 2Z9IA 2AYWA 4JZ1A 2ODQA 1NBME 4OS7A 2V6NA 2W3KA 2FZZA 1HJAC 1J16A 1VCPA 2C8WB 1GBHA 2Y81A 1K1PA 5IK2D 1HAYB 4NGAH 2RDEA 6CHAB 1THPB 2KCAA 1TBRH 1TMBH 4DY7B 3SO3A 2YMSC 2PV9B 1CGHA 2A2QH 4JYVH 3DD2H 3QTOH 2XOKD 3ZYDA 2ANKH 3E16B 1YY3A 3FO8D 3PV4A 1PQ5A 1C2MA 1TWXB 2XC5A 1BIOA 2XTTB 2Z6BD 2C8ZB 4PROA 1LDTT 1HRTH 3A7VA 4JZIA 4RKOB 4RI0A 1T8MA 3KCGH 5FX6A 3SNBA 3Q77A 1O3DA 3OY6U 4TT3D 5C94A 1P8VC 4DVAU 2OD3B 1YPEH 4Y76A 1Y3WA 1V2MT 1NS3A 3ODFA 2BDAA 3VB6A 1PPZA 4ABBA 1EZQA 4ZHMU 1UTPA 4B75A 4H42U 2A31A 1RIWB 5GJ4B 2FX4A 1W7GH 3A7ZA 1O31A 2UUJB 2ZDNA 3SU1A 2BVXH 1A7SA 1K1IA 3TGKE 7GCHG 1VITG 1KTTB 2PUQH 1F5RA 5T3HA 3EAJA 3ZZ3A 2J4IA 2G4TA 1SGPE 3TPIZ 5DP6A 3U1IB 1HDTH 1SLWB 4TWWA 4MNVA 1UCYH 4AGKA 4F4OC 1T8LA 4NIXA 2WV5A 2BDYA 3VB4A 3T27A 1C1RA 2ODPA 2OC8A 3S9CA 1GHAG 3PV2A 1THSH 1EOJA 5HMAA 1WUNH 4FUCA 1F0UA 3A80A 2V35A 4FUEA 5C3NA 2P8OB 2PHBA 2GX4A 1GI1A 3MI4A 1D4PB 2ZU4A 1EFRD 1XUFA 2A1DB 3PV5A 1H8ED 2Z3DA 1S0RA 2ZGCA 1BTYA 4SGAE 3RXTA 4IGDA 3SHCH 1SGDE 4Y7BA 1BRUP 1Y3XA 2ZFQH 2BDCA 3BTDE 5HYOA 5TCAA 1GJ7B 4DG4A 2Y5GA 4Q63A 1CHGA 3MYWA 2B8OH 1O5EH 3A83A 3DA9B 2ZDMA 2CHAB 3LGIA 2GDDA 1ZTLA 2Z3EA 5FBEA 1TRYA 4AYYB 2ZU3A 3URDA 1P11E 2WZQA 3D65E 4OS6A 1VITH 3AW1A 5C5NA 1ABIH 1SLVB 4F49A 1TNLA 1KXCA 2SGQE 3LJOA 1GBIA 2B7DH 1T4UH 1ESAA 3ATWA 4IC5A 1HJ8A 2EI7A 1LQDB 1TMUH 1TA6A 2BDHA 4NSVA 1EJMA 1SGIB 2F9PA 2QXHA 2VH0A 2Q1JA 2KCYA 1C1QA 4AG1A 3T2NA 1O3LA 1J15A 1C5ZB 3QN7A 1MD7A 4AGJA 2ZGXH 5FCRA 1TIOA 1SG8B 3ZV8A 2VGCC 2CF9H 3DFJA 5DN6D 1TB6H 1Z8IB 2BX4A 4D8NA 4Q2KA 1PJPA 2PTNA 3F1SB 1AUTC 1S82A 1NRQH 4JZFH 4BOHA 1SMFE 4ZUHA 3ELAH 1ZPBA 3LGVA 2QF4A 1LPKB 3EA7A 1QL9A 3O8DA 3BG4B 4CRFA 2GDEH 5AFZH 2AS9A 4Y11E 3F2HA 5CE1A 3GYLB 1VGCC 3H5CB 3N7EA 4ZCNA 4VGCB 2ZFSA 3A7WA 2H1UA 1C1MA 5T6DA 1ZMNA 1HXFH 2QAAA 2TGPZ 1N8OB 1CA8B 3RXEA 1XKBC 4X8SH 1TPAE 1Z1IA 3BEUA 1ZZZA 1BJUA 1O3KA 2ZFRH 1SBWA 1LO6A 3RXPA 1MQ5A 2VBCA 2DUCA 2EY4C 3SJIA 4OS4A 3CS0A 1SB1H 1ELBA 1PYTD 1J9CH 3M36A 3U8OH 3RC6A 2XRCA 2BY7X 3SBKA 1SHHB 5JYIA 1A0LA 3ZZCA 2A7CA 2UWLA 2O8MA 5KECA 3PO1B 4P00A 2J98A 4UFGH 3FANA 5HIZA 3ZZAA 3KL6A 2F3CE 5AHGH 1YCPH 2FTLE 1QHRB 1ZSKA 1D3TB 1OWDA 1DUEA 5HIYA 1JWTA 3F9GA 1BRCE
chains in the Genus database with same CATH topology
3Q3YA 4JK6A 1AVGH 2XCFA 3ZVBA 3PROA 4XOJA 1TNJA 1FUJA 3RXGA 3URCA 1QCPA 3JZ2B 2XNIA 2XCNA 1D3DB 3ZVGA 1MD8A 1V2ST 4U32A 1O2HA 1C5RA 2ODYB 2I6QA 3ZZ5A 1GI5A 1VCWA 4NA7A 1F5KU 2CJIA 4K5ZA 1V2UT 1CT4E 4FUHA 3BTEE 4GHQA 4WMEA 1LPGB 5CHAC 1GMCF 1O2PA 4FVDA 4WMDA 4CH2B 5IDKA 4X1PU 1LHGH 3BN9A 3P70B 3RLWH 3T26A 1UO6A 1NRRH 3ITIA 2EEKA 4J2YB 3UOUA 3FVFB 3RXLA 4INHA 8ESTE 1GJDB 2QC2A 1Q3XA 4JMYA 1GBJA 1DX5M 1ZYOA 3EYDA 1UVSH 1FIZA 1EB1H 2WPMS 2GMTB 1GGDB 3ZZ7A 4ZMAH 1C2IA 2BYAX 1P12E 3V12A 1XUHA 4WJG2 2EI6A 4O3UA 2PFEA 1BMLA 3T29A 1HAZB 2F91A 3PYHA 3UWIA 1MAYA 4D7GA 4DIHH 1BRAA 1QBVH 4AB8A 1TAWA 2Z3CA 3LGTA 2ZFFH 3T5FH 2BD2A 4DT7B 2G00A 4ABDA 1BUIA 4Y0ZE 3UFAA 1FNIA 1L4ZA 1RTLA 3GCTG 3VB3A 1A46H 2PKAB 5SGAE 2NU1E 1A5HA 1SSXA 1G9IE 3V3MA 4YOIA 1GHBF 4IW4E 4CHAC 1YP9A 3U1JB 1EQ9A 3F9FA 4I8LA 2OXSA 1J8AA 1ZTJA 3OX7U 3SNDA 1C9PA 3MMGA 1V2PT 4NIWA 1YPKH 2R0KA 2HRVA 3S9AA 1DFPA 5K7RA 2WPLS 3VEQB 2H2ZA 1OKXA 4CBNA 5JPMH 4BAOB 4RSPA 1UTLM 2BD8A 2BM2A 3QO6A 1KYNA 4ABJA 1P2NA 2G55A 3SN8A 1BT7A 2SGEE 3UR9A 3GOVB 2FIRH 2CF8H 5J4SA 3OYPA 1G2MA 4B2AA 2OTVA 1IQHA 1NC6A 1O37A 1UTJA 1EKBB 2BXTH 3UREA 1B0EA 2OC0A 4WH6A 1Z8JB 1NRNH 1YF4A 1BTWA 1SVPA 2ZTXA 2C4FH 3L3TA 1TA2A 3SV6A 1MBMA 2CV3A 1WAYB 4GHTA 1F5LA 4BANB 4K8BA 3R0FA 1BMMH 1UTKA 1E35B 4I32A 1MTUA 1G2LA 3VXEH 5L6NH 2HNTE 2OC7A 2Z7FE 2ZP0H 1PPFE 3TK9A 3VB5A 2D26C 2ZECA 1IQMA 1FY3A 1GMCG 4AN7A 2J95A 1SGRE 2J92A 4HTCH 1TGSZ 2NU3E 2Q6FA 3ZZBA 3AASA 3MNBA 4B1TA 1SLXB 4B73A 1K21H 4D9RA 4GSOA 3IITA 1HGTH 4YOJA 3UIRA 5DPAA 1UK4A 2AGIX 3BTFE 1DLKB 3NXPA 1O3IA 1L1GA 1OWEA 3CS7A 2GZ7A 4U2WA 4MNYA 3GCNA 4GCHF 5ETXA 3GDUA 2HNTC 1KSNA 4B74A 4MDSA 2FOCA 4CH8B 3VB7A 1ELGA 3D62A 1WQVH 1BTUA 1C1UH 3FZZA 4RN6A 1S81A 3A85A 1O34A 1ETRH 3SQEE 2BY5X 2XBWA 4NG9H 2Z9KA 2OINA 3F6UH 1O3BA 1C5VA 1BMNH 2P94A 1DITH 3BTTE 2QCYA 4DGJA 5C2ZA 2J38A 6ESTA 3QX5H 3HGPA 1JIMA 1AWHB 1Z7KA 1EP6A 1SC8U 3L6PA 1IQNA 1P02A 1EZSC 1WTHD 1NESE 2F9VA 5C1UA 3RU4E 1CSOE 1O3NA 4IC6A 4NIYA 3EQ0H 2LPRA 2A0QB 3GY6A 1C2EA 1YLDA 1NRPH 3P92A 4XE4A 3RXQA 1S83A 3NUMA 4IMZA 2CMYA 1PQ8A 1C2GA 4K1TA 2BD4A 1EJNA 3UNQA 2W7SA 1AB9C 1SQAA 3LPRA 4ZKOU 1O33A 3UPEA 3SHAH 1AO5A 1V2WT 3FZDA 2A4OA 1YPMH 5DP9A 2PR3A 1DM4B 3RXBA 3VGCB 1TPPA 1MAXA 1C2KA 1HB0B 5EPNA 2PLXA 1G3BA 1FAKH 3ATKA 4RKJB 3RXFA 5A0BA 3Q3KA 3LH3A 1TMTH 3FFGA 2BLVA 1Y3UA 1EAIA 2ZDVH 8LPRA 1AKSA 2QF0A 3ZVFA 1JIRA 4I8HA 1H9HE 1C1NA 2HOBA 1SGCA 3UOPA 3UNSA 1QJ1B 1ZSJA 2D2DA 4YOGA 1TQ7B 2ZCHP 2ZGBH 1CE5A 1UK2A 2FDAA 1QGFA 4KELA 5ABWA 2ZDLA 1CO7E 1AFQC 1ZMJA 4IN2A 5FHTA 2JH0D 1ZPZA 2TIOA 4AG2A 7GCHF 1TFXA 1MU8B 3PM3A 4GCHG 2RA0A 1FQ3A 1G37A 3RLYH 5JBBS 1GI6A 3MNCA 1D3QB 5LPEA 4FUGA 3K6ZA 1TONA 1HAPH 1QL7A 3CP7A 1A3BH 1K1JA 1T32A 1LKBA 1GHAF 1GBAA 1BJVA 1GHXH 4ISOA 1SFIA 1MQ6A 1C5MD 3ZVEA 1ZPCA 3GCHC 1ZMLA 4ZHAA 1N1LA 2BLOA 2BB4A 4H6SB 3SV9A 1QY6A 1LKAA 3LT3A 5G4BA 1GPZA 3LJJA 4Z0KA 1F92A 1XXDA 2V3OH 2J2UA 5C1YA 2ZNKH 1C5YB 1GMHF 1ZRBA 1P9SA 2A7HA 4XFQA 1LTOA 4IBLH 2SGFE 2Z94A 1QR3E 4X8VH 5DP7A 3SOSA 1LQEA 2DE8A 2GCHF 3SNAA 2Y6TA 1LCYA 1GBCA 2D1JA 4DJZB 1MTNC 4DOQA 1C5NH 1EPTA 4WXIA 1BCUH 1W11U 2OC1A 4NFFA 3TJNA 2F9BH 4E06H 3TLOA 3SJKA 5A8ZA 1FLEE 1JRSA 1AFEH 2O8TA 4K69A 2ZO3H 1V2JT 4XBDA 4BAQB 3AAVA 1NU7B 3BIUH 5DP3A 2FOAA 1ORFA 2V0BA 1V6DA 4FXGH 3HKIB 3PWBA 2RA3A 1PPBH 3TNTA 2PKSB 2BX3A 1XVMA 1O35A 1IAUA 4WWYA 4BXSA 1A1RA 4ABHA 1S6FA 2VIQA 3MH5A 1LMWB 4H6TA 2ZQ2A 4UONA 1P0SH 4YT6H 4KTCA 1JMOH 4YM9A 3GY2A 1GCTB 1ETSH 1KXFA 1FV9A 3TIUA 2VJ1A 1E37B 2ZHFH 2ZG0H 3SU3A 3GDSA 2DE9A 1D9IA 5HM9A 4Q7YA 1FIWA 3SUGA 1SQOA 4MQAA 1V2QT 2JETC 1U6QA 1OP0A 4A1TA 2AMQA 2VIWA 1CT2E 2TBSA 1GBDA 4NCYA 2BVSH 9ESTA 2CGAA 3D49H 5JB9S 1DDJA 3A8DA 2VWNA 1Y5BT 3P8GA 1XXFA 3RXRA 2BMGB 3LONA 3TH2H 2A4QA 2TGAA 3SZNA 3ZVAA 4DIIH 2R9PA 3A8BA 2FWWA 2HWLB 1C4V2 2CXVA 2FYRA 2ZGJA 5DJ7A 4O3TA 2BY6X 4QT8C 1UK3A 1GHYH 1C2FA 4ISLA 2ZC9H 1H1BA 2FPZA 4MPUA 5C1XA 1C2LA 1MZAA 5PTPA 3M3SA 2QYIA 1HAGE 1ZJKA 4X6MA 3UQVA 1X7AC 3BTGE 3SI4H 2A2XH 2XXLA 3HK3B 1ACBE 4FU8A 4A1XA 2VIDA 3Q00A 3GY7A 1C2HA 1GMHG 4D76A 1WTGH 4FUBA 4YTAA 1EAWA 4JYUH 2FEQH 1AMHA 1BBRE 2BVRH 1GBBA 3O8RA 1TNIA 4BAKB 1QL8A 1KXBA 1DWDH 2GCHG 1L1JA 2PGBB 4CRGA 3NKKA 3TNSA 4MPXA 1O3FA 3QDZB 2P3TB 1A3EH 5FXLA 3PB1E 5C20A 2ZU2A 3GY4A 4OS1A 2BTCE 2R3UA 3HATH 2C8XB 1IQGA 4HGCA 2HNTF 2TRMA 1PPCE 1QRWA 1B7XB 2UUYA 1XUJA 4X2VA 4CRAA 1GMDG 1ARCA 1W14U 2BD7A 2ANMH 3T62A 1UCYE 1FJSA 2BD5A 2P93A 1FONA 1GL1A 1BA8B 3MU8A 3SJ8A 5A8YA 2PUXB 3SU0A 3LGUA 2ZQ1A 1EZUC 1PPHE 3LGWA 4ABIA 1TGNA 4Y8XA 3U8RH 3LH1A 1UTNA 3RU4D 1K9OE 1CA0B 1L2EA 3BTWE 1LVMA 2FS8A 3RXCA 1P09A 4X6PA 2VVCA 4X2XA 2ZPSA 2AGGX 1SGFG 2GCTB 4FUIA 4HFPB 3RXKA 3PLBA 3A87A 1XKAC 1QTFA 2ZI2H 3E90B 2W3IA 3GCTF 2YNAA 1GJ4H 1CU1A 1XUKA 1GI4A 1MTVA 1D6RA 2P8OC 4M7GA 1XX9A 1OSSA 3RXVA 1G30B 3M35A 1GL0E 4BNRA 2ZHEH 4AFUA 2VVVA 5AF9H 1UVPA 4DW2U 1ESBA 5F8XA 1ELCA 1FI8A 2ZDKA 2A7JA 1FDPA 3BSQA 4CRDA 1RGQA 4K1EA 1GDNA 4X6NA 5GDSH 4JZEH 4GAWA 1NO9H 1UTOA 1K22H 2QXJA 2WV4A 1O38A 1P06A 4ABFA 2GV7A 5EG4A 5LPFA 1C1OA 1BMAA 1DY8A 1O3AA 2STBE 2CHAC 4IS5A 1QA7A 1O2JA 2TGTA 3FAOA 3KIDU 1O2TA 3MU5A 1O5GH 5T6FA 4A92A 1K1MA 1DT2A 5A0CA 3SJ9A 1DWCH 3M7UA 2G51A 2AH4X 2ANYA 2ULLA 1C1SA 3A7YA 3DHKH 3PWCA 1O2LA 1A0HB 1TBQH 3OY5U 4Y79A 1O2QA 1ANBA 2Q6GA 2VH6A 4GVUA 1GBMA 1QFKH 1AKSB 3RXOA 2FM2A 2IJOB 3RXUA 4WF8A 2RG3A 1GG6B 1V3XA 2FS9A 2R3YA 5E0GA 1ANEA 1TPOA 3QLPH 2UWOA 1LHCH 1NY22 3W95A 2P59A 3MH6A 4LZ1H 3U69H 3DFLA 3B9FH 3BG4C 3QTVH 3I29A 4I33A 1V2VT 1VR1H 3RXAA 3TK5A 2HLCA 3ENSB 4MLFB 4VGCC 5ESBA 3V0XA 3QZQA 3VPKA 1EX3A 3PMJA 3IWMA 1N8OC 2G81E 1ELTA 2G52A 4TWYA 1GJCB 4TY6A 4CR5A 2VINA 3NPSA 1OP8A 4B71A 1QB6A 1YM0A 1QURH 3SU2A 3LC5A 4E7RG 4UE7H 3BTKE 1V2NT 1UTQA 3MFJA 2SFAA 3SUDA 4H4FA 2XBXA 4FVBA 3E0PB 2WPKS 3ZZ4A 1TALA 3STIA 3LIWA 1ZHPA 2FOGA 4DURA 1RFNA 1Q31A 5DG6A 4HI3A 1A2CH 1QJ6B 1GVZA 2Z9JA 1C2JA 4ZXYH 4BTTB 3PO1C 4Y6DA 2ZTZA 2FI5E 3KHVA 1V2OT 4WXVA 1WQSA 2Z9LA 1S0QA 1ELVA 1HAHH 2ZKSA 3PTBA 1WBGB 2AIPA 1NROH 1KDQA 1JBUH 3P6ZB 1OYTH 3SUEA 5GIBA 1F0TA 1WOFA 2ZIQH 2UUFB 1MKXH 3LC3A 3TVJB 4ABAA 1DANH 2NWNA 3R3GB 1O32A 1EPTB 3AW0A 1M9UA 5EODA 5TJXA 3RU4T 2Y80A 2BOKA 2Y5FA 3MO6A 1D3PB 3OSYA 1O5CB 1MKXK 2TPIZ 4AFSA 3MNSA 1YBWA 1ZOMA 5GXPA 1RTKA 2AGEX 3Q76A 1C5TA 3PLPA 2VIVA 2ZA5A 2O9QA 3KNXA 3A8AA 3EA8A 4Q80A 2C8YB 2Y7ZA 4AOQA 2H6MA 3RXJA 2XYAA 1O2NA 2A5KA 4AZ2B 5EGMA 1EP5A 3TK6A 5EXLA 1IHSH 4R8TB 2VWOA 1W12U 4ZKRU 1GI0A 3SGAE 1FN8A 4Y0YE 5I25A 3SUFA 3HK6B 1G3DA 1Z1JA 5JDUB 1O2UA 1VJ9U 1Z6EA 4B2CA 5FX5A 1O2SA 3MHWU 4X1NU 1W0YH 3TJVA 2FODA 3SNEA 1B0FA 3M61U 1E34B 3GDVA 2EI8A 5E8EH 1KXEA 3NK8A 3GISB 1BTXA 3TGIE 3RC5A 1W0ZU 4FU9A 4ISNA 2RCEA 1C9TA 1YKTA 2XW9A 1HBTH 5BRRE 3GY3A 2AFQB 4ZHLU 1ELAA 3PMAB 1S85A 1P2MA 3KGPA 1P2KA 1EATA 4D7FA 4IN1A 3ATMA 1BDAA 4BTUB 2PWXA 2ZWLH 1O3JA 1O30A 2LNCA 2ILNA 2BHGA 3BV9B 4ZAEA 1IQFA 7LPRA 4U30A 1Z8RA 3A86A 4FUFA 4XSKU 1KY9A 1DPOA 5E2OA 2ZHWH 3TGJE 4UEHH 2A4RA 3K6YA 3UQOA 1HAVB 4XBCA 4ZXXH 1O2OA 1Z71A 1Y5AT 2FOMB 3KQBA 1GI9B 5DO4H 2ZU5A 3UUZA 3O8BA 1GBTA 3SV8A 1NFXA 2O8UA 4WY3A 3MH4A 2XBYA 1H8IH 2HGTH 1LVBA 1J17T 2SGAA 4A5TS 2GD4B 2THFB 1HPGA 2BD9A 1Y3VA 4K1SA 2B9LA 1CBWB 1ESTA 1MKWK 3ZZ8A 4MTBA 4ZKSU 1TGBA 1O5BB 2BZAA 1QNJA 3M5OA 4BAMB 3KQDA 1AN1E 1O2YA 3QGJA 4CRCA 1O39A 2BQWB 2V3HH 1NU9A 4TPIZ 4B76A 1KXAA 4OGYA 7KMEH 3SJOA 1TOCB 5AVDA 2Y7XA 3L33A 1CHOF 3FP7E 4NA8A 1XUGA 1SPJA 1Z6JH 1UVUH 1HAOH 1AVXA 1AI8H 1HJAB 2ZDAH 5EQRA 2GGVB 1A5IA 1FPHH 1ZGVA 3RUOA 1P05A 3K9XB 3PLKA 2O8LA 2ZF0H 4I8GA 1EOLA 3M3VA 1ZJDA 4I31A 2VIPA 3S69A 2C3SA 4LZ4B 1K1NA 5C5OA 3ESTA 5DKMA 1EAXA 4K2YA 4X2WA 3RDZA 2VU8E 2QF3A 1HIAA 1V2KT 4MPWA 2YNBA 4I8KA 1NT1A 4Y71A 1GDQA 1SR5C 1FN6A 4U01A 2A32A 2C93B 5F8ZA 1FZZA 2F9UA 5LPRA 1T31A 1SLUB 2P3UB 2Y82A 3BEIB 3TJUA 1KLJH 3RMOH 2A5AA 1O3EA 3GCOA 1O3PB 3RC4A 3F9HA 1AGJA 3E1XB 5JB8S 2STAE 1AZZA 1TBZH 1LHDH 1JOUB 2AMDA 4X1QU 1BZXE 1GDUA 3KQEA 1C4U2 2SGDE