1O2TA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2tA02
2GT8A 4BAHB 1L1NA 3STIA 1NRNH 2FO9A 2WPKS 2HGTH 3MU5A 1O2MA 1SFQB 2GDDA 1P02A 1J15A 3SUEA 2A0QB 1O2PA 1P57B 1Z7KA 3ATMA 4ABAA 3SI3H 4X6MA 1O3DA 4NZLA 1O2RA 1TRMA 3Q3XA 1CT2E 2GCTB 2ZPSA 1NPMA 1N8OB 3S9BA 2XWAA 5GXPA 2FX6A 1AI8H 1RFNA 4OS7A 1QA0A 1GVLA 1X7AC 2BD5A 3SNCA 1OP2A 1W13U 3MNSA 5C5OA 3SV9A 3ELAH 4NSVA 2FX4A 2BX4A 4AYYB 5A0CA 1HAIH 3PWCA 4DY7B 1GHVH 3O8BA 3RU4T 1DICA 3SNEA 2AYWA 2V3OH 3SV6A 4A1TA 4X1NU 1LO6A 2ZU3A 4IN1A 5E2PA 2VIDA 2FDAA 2ZC9H 3GCHB 4ZUHA 4ZKRU 1TWXB 1B0EA 1MKWK 1YP9A 2BDGA 4MPXA 1TPOA 5GDSH 2Z94A 4X2YA 4XBDA 1YPHC 1T32A 1T8LA 2ZDVH 1XXFA 3MTYA 3SNBA 1V2QT 1Z8JB 4BXSA 2RCEA 3OTJE 2PSXA 1MAXA 4FXGH 3DT0H 3FP7E 3U1JB 4UD9H 2BVRH 1QURH 2PKAB 2QIQA 2VIQA 2Y5GA 2YNBA 1SI5H 3EA9A 3QX5H 1G2LA 2G52A 1Y5BT 1QJ1B 1O3KA 4X8TH 2BOHB 4AORA 1S83A 1GMCF 4J2YB 3PV4A 1AVGH 1HAVA 1ANBA 1GI3A 3AASA 1VITG 3E6PH 3ZVAA 1LTOA 1O2OA 4X6OA 1GMHG 3V12A 1QRXA 3EYDA 1VCQA 5TCAA 1V2JT 2FOAA 3TK5A 1MAYA 1A5HA 1OX1A 2ZO3H 5C20A 1O2WA 1FIZA 1LKAA 1A5IA 1P12E 2BD9A 1BMLA 5B6OA 1Z8GA 2F91A 4Y11E 2R3YA 1TGCA 3HGNA 1NFUA 4H6SB 5A8XA 1BTXA 2XBVA 1O2ZA 3ZYEA 1DUAA 3VB6A 1GVZA 3E8LA 3I29A 3KGPA 4SGAE 3A7YA 3FZZA 4OGXA 1HXEH 3RXHA 2Y5HA 3SUDA 5HM9A 3FANA 3TITA 2CV3A 4ZHLU 4XOJA 7ESTE 2AERH 1F0SA 2BDHA 1O3GA 3SQEE 2RG3A 3RC6A 4B2BA 4INHA 3E90B 4MPUA 1V2NT 4RSPA 3HK6B 4H4FA 1XUKA 2JH5D 1FONA 3JZ2B 3NWUA 1G30B 5C5NA 4GHQA 1BTUA 1BT7A 1O3AA 4WMFA 1P9SA 1EP5A 1GBHA 4INKA 5EXNA 1YPMH 1NTPA 1VCWA 3E1XB 1OWJA 3E91A 1K2I1 1MTNB 2TBSA 4A1XA 1OWHA 1K1NA 4F49A 4X2WA 4WY3A 2GDEH 2IJOB 1LVMA 3L3TA 4CBOA 3AW0A 3U8TH 5JDUB 2M5TA 4KTUA 5JB8S 3A87A 1TQ0B 1BMNH 3UNQA 1O32A 1QRWA 2PW8H 3F9HA 2VWMA 2CF9H 2FIRH 1C5OH 1O3BA 3O8DA 1IQKA 1Y3VA 3UPEA 4NA8A 1TNJA 1UK3A 4GVUA 5E8EH 1BDAA 2Z9JA 3ZZCA 2ZPRA 1C9TA 1UHBB 3RU4D 4HZHA 4ISIH 4AB8A 1SQTA 4TPYA 1D3DB 1MTWA 4ABIA 1A3BH 1EQ9A 1ELFA 2ZZUH 5C1YA 4YM9A 1AE5A 1ZGIA 1GBAA 5LPRA 2XYAA 1HAOH 2AEIH 2RA0A 3HPTB 1TYNA 3SUFA 1G3DA 3RXAA 1GHAF 1OS8A 1GBKA 3LGIA 1YPEH 1FY1A 2FOMB 4ZH8A 3T5FH 1HXFH 2Y6TA 2H2ZA 3MHWU 1EPTB 1PPGE 2HNTC 2OC0A 1YM0A 1NO9H 3RXEA 1PPEE 1C1UH 4JCNA 1HBTH 5AFZH 1C5WB 1A7SA 3S0NA 1DDJA 1IQHA 2ZFSA 3MU0A 2FMJA 1B7XB 1W2KH 2BYAX 5DP7A 2B8OH 3BEFB 3SGQE 1V2UT 1QL9A 8LPRA 1SB1H 2SGQE 1CVWH 1TGTA 3AVZA 1P10A 2CJIA 1CBWC 2GZ8A 1O35A 1BZXE 4FUGA 3EGKH 1ARCA 1GCDA 2H5DA 2C4FH 1O2UA 2VJ1A 1LQEA 2BD7A 3ATWA 1K28D 2WPLS 1SGFA 4JZDH 2ZDNA 5C2ZA 1RXPA 5FBEA 4YESB 3F68H 3VEQB 1N1LA 1NRRH 2BM2A 1BJUA 2XCNA 2Q6GA 4MPVA 1GI7B 1ZHPA 2BLOA 2A5KA 3SNAA 4ZXYH 1UTNA 1GJDB 1YPKH 1YGCH 4X2XA 4CHAB 4IN2A 1E35B 1O2XA 4I7YH 1MD7A 1NFWA 1VITF 3ATLA 3ZZ9A 1OP0A 3WY8A 3TGKE 1Y8TA 3P8GA 1C1PA 1O2VA 1QB1A 1HLTH 3KL6A 4O03A 8ESTE 4JYVH 2R9PA 3SQHE 1CHGA 3ODDA 3M5OA 1FN8A 3PLKA 2OLGA 3ITIA 1QJ6B 3PMAB 1QJ7B 4GHTA 1KXCA 4YOJA 2FI5E 4ZKOU 4Q7XA 3RLYH 2P94A 1WU1A 3MNBA 3D62A 1Q3XA 2BY8X 2VVVA 1E34B 3V7TA 1FN6A 2F83A 3LH3A 3M37A 1IAUA 1W7GH 4I8JA 2FLRH 3FAOA 1DANH 1K1IA 3M35A 1B5GH 1QGFA 1BQYA 1GI2A 1P2IA 1GBLA 2A32A 1GBCA 1SMFE 3T2NA 3GCTG 1FMGA 1GPZA 1UVUH 5EOKA 3LGWA 1D4PB 4FU7A 1AE8H 2G00A 2ZCLP 2B5TB 1VR1H 1AUTC 5F03A 1GI0A 5HYOA 1E0FD 1SOZA 3A7VA 3K2UA 1C5PA 1WTHD 3EAJA 1FY8E 2FP7B 4JK5A 1O2JA 4FUFA 2O9QA 2WPIS 3PYHA 1UCYH 2FOBA 4BAKB 3ZZAA 3QN7A 5E0JA 2ZWLH 1QHRB 1J17T 1SLXB 1CSOE 1S0RA 4Y10E 4ZXXH 4Z6AH 4B75A 2O8WA 3BTKE 4ABHA 2FYRA 4K1TA 2UUJB 3PO1B 1KDQB 2FOCA 4O9VA 1YLCA 1ZMJA 2FTMA 1S85A 3P8NA 2OC1A 2VGCB 2J2UA 4ISOA 3ZZ5A 1NROH 2H9HA 2CHAB 1O30A 3E0PB 1J14A 1W11U 1EOJA 1EP6A 2UWLA 1FLEE 1S6HA 1O3HA 2AIPA 2ZFQH 3MOCA 1BITA 2BOKA 2IN2A 1T8MA 1IQLA 1XVOA 4K3JA 5CHAB 2H6MA 1UTQA 1QB9A 1O5AB 1TQ7B 2P16A 2PTCE 4LZ1H 1LPGB 1HRTH 1ANCA 3UWJH 1EJAA 1OOKB 2XC5A 1BB0B 1JOUB 1ANDA 1O31A 1P2OA 1AQ7A 1GJ9B 2P8OC 4MNXA 1ABJH 2G55A 1MZAA 4OGYA 2A5IA 1FUJA 5E2OA 2R0LA 1YCPH 1HAZB 3SU0A 4OS4A 3O8CA 1N6XA 1W14U 1JIMA 4WMEA 5FHTA 1DOJA 1MMJN 1L2EA 1V6DA 3BN9A 1HJ9A 1JRTA 1XXDA 5AFYH 1C2EA 1KXAA 2NU4E 4ZAEA 2ANYA 4RN6A 1LHEH 3HK3B 3SI4H 1QTFA 1GMDG 1A0LA 2F9BH 4UFDH 3RXRA 1NT1A 1P06A 3U9AH 1TNHA 3GY5A 4A7IB 4AZ2B 9LPRA 2XC4A 4I8LA 1Y59T 1GJ4H 1OP8A 1WQSA 4Y8YA 2QN5T 3GY6A 2ZU1A 1AWHB 2BDCA 1O3FA 1F0RA 4UONA 2A31A 1EOLA 2H9TH 2ZPQA 1W0YH 1YPLH 3MO6A 1FXYA 1V2RT 2Q6FA 1MQ6A 5JBBS 2OC7A 1ESBA 1GDUA 1SGIB 2AIQA 1BBRH 2ZFFH 2VIVA 2FPZA 1ZTKA 4FUJA 4MNWA 3LJOA 1O2GH 1THPB 3LONA 3MYWA 1EAXA 1FV9A 1V2KT 3M7QA 4IGDA 5EPYA 3CENA 2VWOA 4JZFH 5F8XA 3EA7A 4ASHA 3T29A 5FPSA 1A3EH 4ZHMU 1IHSH 1Z1JA 3V13A 1A46H 2OXSA 4TY6A 2OCVB 3BSQA 1OWDA 3TJVA 1SHYA 1ELAA 1IQMA 2W7SA 1O0DH 3P95A 1SL3A 2B9LA 1MCVA 2ILNA 2Z9LA 4ZMAH 1L1JA 1MTSA 2IPHA 5DK1A 3TH3H 3MWIU 1G2MA 1HCGA 1KLIH 2Y81A 1P2JA 1T4VH 4A5TS 1PPFE 4Z0KA 3VXEH 3ZZBA 3ZV8A 1NU7B 2ESTE 1TAWA 1TOMH 2VIPA 2G5NA 1D3QB 2A4GA 1PJPA 3DD2H 1MBMA 4NA9H 5DP5A 2D26C 2WYGA 1WAYB 3A8BA 1ZPCA 2GCHG 2P95A 1FPCH 1TALA 4I31A 1BUIA 3A86A 4CRAA 3ATKA 2UWOA 3GCTF 1HIAA 2PHBA 4IS5A 3BEIB 1P2QA 4DGJA 3M7UA 4WH6A 1UCYK 1HJ8A 2TGDA 4K69A 2PGBB 1WV7H 1A1RA 1TRYA 1GBBA 5ETXA 1GI4A 2STAE 3TLOA 1KTTB 1K1PA 2GV6A 3SJ9A 2OINA 3S7KB 1A5GH 1P0SH 1O5DH 1WYKA 1JMOH 1PFXC 4WXIA 3BTWE 3BG4B 1H4WA 3AAUA 3A84A 1LPKB 4Y79A 2F3CE 2QY0B 2ZEBA 2IOTA 4O3TA 1O2SA 1TGBA 1GL1A 2FI4E 1GL0E 1LHCH 1PQAA 4KTSA 2G81E 1DE7H 2A4QA 1BHXB 1UTPA 1VJAU 3OY6U 4DJZB 1TA6A 5CMXH 1O2NA 2V6NA 3IWMA 1FJSA 2BLVA 1LHGH 4NZQA 1NY22 5J4SA 4K1SA 1S5SA 2GMTB 3PWBA 1SFIA 3Q76A 1O2QA 3UTUH 2A2XH 2QA9E 5C1UA 1MUEB 3PMJA 3NUMA 1GHZA 4ISNA 1YC0A 1LDTT 3GOVB 3T62A 1O3LA 3MU1A 1A61H 4VGCC 1SGQE 3M5LA 4D7FA 1J9CH 4Y0ZE 2I6QA 1YCPK 3TPIZ 1TMTH 1GI9B 1P2KA 1V2OT 5EGMA 3P8FA 4INLA 3UR6A 1FY3A 1AUJA 3VGCC 1JIRA 3VXFH 1AB9B 1GJ8B 1RTFB 2BVXH 1AKSB 5EQRA 2ZFTA 4CRBA 1D6WA 1MKXH 1PQ8A 4DG4A 2TGTA 1ZRBA 5EQSA 3U69H 1GCTB 3ZV9A 1W8BH 3RUOA 3TK6A 4MTBA 4FUEA 4YLUA 1SLWB 4R0IA 1RRKA 1EXFA 2PR3A 4ABFA 1FY4A 4LZ4B 3NPSA 3AW1A 2GX4A 1O3CA 2AFQB 4AFQA 1D3TB 2DE9A 3A85A 1T8NA 3M3VA 4WF8A 3TGIE 2NU0E 2WUCA 3RM0H 1THSH 2ZU4A 2FOFA 2F9UA 3ZVCA 3P92A 2CGAA 1DX5M 2TRMA 1FY5A 2HALA 1YLDA 2G8TA 2A4RA 1D9IA 1Y5AT 1IQFA 1BBRK 4K5ZA 4DVAU 2QF0A 2ZTZA 1HFDA 3GDVA 2H1UA 5DKMA 2ANKH 1BRUP 8KME2 5TJXA 2A4OA 1GJ5H 1XVMA 2PKSC 1NU9A 4FVBA 5CE1A 2FTLE 1LVBA 3SO3A 3PM3A 3GICB 3MH6A 4I8GA 1ELGA 5LGOA 4M7GA 1GGDC 3URCA 3D49H 1MD8A 3RXVA 4FUDA 4YZUA 1ETSH 2ZQ1A 3GY8A 1W0ZU 1MQ5A 5HM2A 4B2CA 4UFFH 1S84A 3BTGE 4AN7A 1E37B 2ZDKA 1PPHE 4NIXA 3SJOA 2C8ZB 2VVUA 1GI6A 1Q31A 1EJMA 3F9GA 4RKJB 2J92A 2STBE 1NESE 5HMAA 1GG6B 1DXWA 1YYY1 1FAXA 3GISB 1G9IE 3BTEE 5K0HA 2A5AA 1LPZB 2VNTA 4MDSA 4BANB 1T31A 1HYLA 1SQAA 1YBWA 3GCOA 1C5VA 1AFQC 2BB4A 3CP7A 4WXVA 2PGQB 1ZLRA 2BQ6B 4IMQA 3HATH 1BRAA 3LJJA 2F9PA 4TPIZ 1ETRH 2QXIA 4X1PU 2XXLA 2GP9B 1P04A 3PLBA 3V0XA 3OY5U 1KIGH 2G5VA 6GCHF 4LXBH 3S7HB 1F92A 1HAVB 4MVNA 1DWEH 1GHXH 4OS2A 1QB6A 2XCFA 1BTWA 2PUQH 2J95A 3TIUA 3M7TA 1ZPBA 4JYUH 4D9RA 1C1VH 2RA3A 3BF6H 2CF8H 2F9VA 3BTDE 4B74A 2R3UA 1A4WH 1SC8U 2ODPA 3BEUA 4ESTE 1C5SA 1GHYH 2BXTH 5T6FA 5DP9A 5L6NH 3BTQE 1UTJA 2ZGHA 3UNSA 3P8OA 4OS1A 1XUFA 3SHCH 4HI3A 3M5NA 1P3CA 1TGNA 2W5EA 2NU3E 1WUNH 2THFB 4B71A 3Q00A 2WINI 1QBOA 3PB1E 4FU9A 2ANMH 6CHAC 1C5LH 4D8NA 4U30A 3GCNA 2JETB 4BAQB 4TWWA 2ZTXA 2SGFE 1BMMH 1NS3A 2A7CA 1THRH 1QBNA 3NK8A 4D7GA 5E0HA 3LC5A 3VB7A 1AD8H 3VB4A 3TNSA 3RDZA 1P2NA 1QQ4A 7GCHG 4JMYA 1RIWC 4B2AA 3GDSA 2BZ6H 4YOGA 2VB0A 1V2PT 3A7TA 5I46H 1T7CA 1DUEA 1GBJA 1MKXK 3DA9B 4Q2KA 4YT6H 2OP9A 5DJ7A 3MI4A 2SGAA 4K8YA 1KXFA 1RTLA 1ELEE 1SGTA 4ZKNU 4CRGA 1HJAC 4BTUB 4TWYA 1NRQH 1ESAA 2JH6D 2HPPH 3QZQA 5ESTE 5AF9H 2Z9KA 1VITH 3BTME 1CA0C 2FOEA 1E36B 1XMNB 2QXGA 4TY7A 2WPJS 4WJG2 1Z8RA 3GY2A 3ZYDA 2Z3DA 3LT3A 2WPMS 1O5FH 1QQUA 1H9IE 3SZNA 2QAAA 2NWNA 2PWXA 1A0HB 3D23A 4AGJA 3MO9A 4X8SH 1AHTH 3IG6B 3V3MA 1NC6A 3G01A 5IDKA 1N6YA 3M5MA 1TIOA 3ODFA 1KY9A 3VPKA 1S81A 2Y7XA 3TU7H 3FP8E 3M3SA 1ZGVA 4X1QU 1NRSH 1C1NA 1PYTC 1OWIA 1C1QA 4BXWA 5T6GA 3RXUA 1GMHF 1IHTH 1UTOA 4AGKA 1Z6EA 2QGRA 4GLYA 4JZIA 1GBDA 4E7RG 3U8OH 1Z6JH 2ANWA 3EQ0H 2ODYB 5FBIA 5EU8A 1EJNA 1CO7E 2I6SA 4BNRA 1G3EA 2V35A 1O3IA 5LPFA 4OS6A 5DP8A 1G36A 2EEKA 1ESTA 4WMDA 4NG9H 5AVDA 5DP3A 1UTLM 2BY5X 2R2MB 1F2SE 4DCDA 1H8IH 2G4TA 4K1EA 1ZRKA 3AAVA 5A0AE 4DIIH 3RMNH 3S9AA 3SNDA 3UREA 5L2YH 2ALPA 1TRNA 1VGCC 1YPJH 5FX6A 4UDWH 1FI8A 3TK9A 2H9EH 3M3TA 5ESBA 1MTVA 2BMGB 1ZJDA 1ZMNA 1MH0A 3SV7A 4FUHA 2Z7FE 1SGDE 3PTBA 4F4OC 5F8ZA 5A8ZA 2QXJA 2SFAA 5C1XA 2XBYA 3QO6A 3UY9A 2D1JA 1P2MA 1VJ9U 2FODA 4CRFA 3NXPA 1UVOA 3JZ1B 3LKWA 1C5NH 3QUMP 1F5KU 4GAWA 2A7HA 3UR9A 3TJUA 2Z3EA 1OPHB 3FP6E 1D3PB 2ZNKH 1UK2A 4CBNA 3M36A 1K21H 5TCCA 1BJVA 2BY7X 1UTKA 2J4IA 3QZRA 1V2TT 1UTMA 3RU4E 2BLQA 2AMQA 3ZZ4A 2WPHS 1SGEE 5DP4A 1LVYA 1EAIA 3RM2H 5SGAE 2PTNA 4DOQA 1YKTA 1F5RA 2GCTC 1W10U 1C2HA 2OBQA 3A7ZA 1BA8B 1QL8A 3RXJA 1N8OC 2BDIA 5GPIB 2HPQH 1Y3UA 2UWPA 2Z9GA 1XUIA 1ANEA 1P8VC 3KEEA 2Z6BD 2KAIA 1L0ZA 1Y3YA 4ABDA 3ESTA 1EAWA 1T8OA 3TGJE 4NSYA 4Y8XA 5FAHA 1QRZA 2R0KA 2OBOA 5EW2H 2FEQH 3KQBA 2GGVB 1JRSA 3QGJA 7GCHF 5K7RA 2XRCA 2Y5FA 3F6UH 1CGIE 1IQIA 2ZHEH 3GCHC 1P09A 3BV9B 3A80A 1DSUA 4CREA 1W12U 1JXPA 3O8RA 1TX7A 5BRRE 2DUCA 3S69A 4QT8C 1CHOG 1MTUA 3MMGA 1IOEA 1M9UA 2BZAA 1SGYE 1FDPA 1H9HE 4Y7AA 1SHHB 5F8TA 1DT2A 1KLJH 5GCHG 3QTOH 3GDUA 3OU0A 3SGBE 1Z8IB 1OSSA 1XX9A 2XC0A 2EI6A 1DWCH 2AMDA 4NFFA 2HVXA 3RXKA 3KNXA 4NIWA 4HTCH 3A83A 5JBAS 1V2ST 2V3HH 2Q6DA 5FX5A 1GHBG 2QYIA 1FPHH 1TX8A 4BTTB 2FS8A 5GWZA 3MO3A 5EXLA 1SGRE 1TONA 7LPRA 3D65E 1SPJA 1CBWB 1PPCE 1AFEH 4H42U 3QK1A 4ZHAA 5A2MH 3TH4H 1XUHA 1GJ6A 1CU1A 1QIXB 3BTTE 1ZSJA 2GZ9A 1ZPZA 2VH0A 2FWWA 1DY8A 4Q80A 1A2CH 4R8TB 1HAXB 3RMLH 2W3KA 1Y3XA 4Y71A 3RXLA 5JBCS 2R2WU 2ZHQH 1O3MA 3RXCA 4NIVA 4KELA 2AMPA 4BTIB 3SU3A 2ZG0H 4CR9A 1QCPA 1ELDE 4IC6A 2D8WA 3SU5A 3BTFE 1C2FA 1GJCB 4UE7H 2HOBA 1C5QA 1H9LB 2H5CA 1ETTH 1GI1A 4NGAH 3LGTA 2HLCA 3MH7A 3MNCA 2TGAA 3MNXA 2PFEA 2BY6X 1O3NA 4TYDA 1C4V2 2OD3B 4Y0YE 1QR3E 3RXQA 1MTNC 1OYQA 3UFAA 3RC5A 1DLKB 1JBUH 2WV5A 2ZGXH 3HGPA 5T6DA 1KLTA 1KSNA 2NU2E 3E3TA 1C5MD 3GYLB 2ZDLA 3UUZA 1K1OA 1BOQA 5ABWA 2BDBA 2QF3A 4XBBA 4CRCA 1GBMA 4AFSA 2ZI2H 5L30H 1BTZA 1P11E 3U98H 1TNIA 4IC5A 1EZUC 5BPEA 4AG2A 4MNYA 1QBVH 1Z1IA 1XUGA 2UUFB 3DHKH 1TABE 3GYMA 4DIHH 2OTVA 3SN8A 2QV1A 2OUAA 3H5CB 1C1MA 1C9PA 4AOQA 1SR5C 5FXLA 3L33A 4ABEA 3RXMA 1QL7A 3KQCA 3R3GB 2BHGA 3ZZ6A 1EATA 1H8DH 2Z3CA 1CA8B 3B8JA 4IBLH 1NRPH 3URDA 1ZTJA 1G32B 2PKAA 3VFEA 2ZIQH 2ZF0H 1XKAC 3BG8A 4GUXA 1B0FA 4ZKSU 3RXTA 2C8WB 1BRCE 1EPTC 3Q77A 1EZQA 1O36A 4X0WU 3KQDA 1CGHA 1C5ZB 1AMHA 2PSYA 1W3CA 1SOTA 2C90B 2ZTYA 1HAPH 3QWCH 2FLBH 1HIAB 5JPMH 1NFYA 2PUXB 4DT7B 1ZHRA 1XM1A 3SU6A 1GHAG 4Y76A 1K1JA 4NWLA 3KCGH 2VU8E 4YTAA 2P8OB 2ODQA 1C4U2 4BAMB 3MU4A 3DFJA 2P59A 3N7OA 2QC2A 1RS0A 1C1RA 4J1YA 1GMDF 2GV7A 2XTTB 1C5RA 1K1LA 1TNLA 1WQVH 2SNWA 3QLPH 2GD4B 2BD3A 3QGNB 3ZZ3A 3SUGA 1XUJA 1CHOF 1QNJA 3BIVH 3ZZDA 1U6QA 1TNGA 1S82A 1DWBH 5JB9S 3KIDU 1F7ZA 3ATIA 4X8VH 4UFGH 4E06H 2V0BA 1DITH 1C1OA 5GCHF 1SGNE 3ZZ7A 1TPAE 3EDXB 2BQ7B 1L1GA 5C67A 2A2QH 2O8MA 2BX3A 1WTGH 3PTNA 2WYJA 4CHAC 3STJA 4E7NA 3A82A 4NFEA 1GHBF 1QFKH 1G3CA 4O3UA 3W95A 4Q7YA 4X1SU 1SGCA 1WOFA 4K8BA 3LGVA 1NM6A 3LOXA 4A92A 4E05H 1GJ7B 4NIYA 4WH8A 3KHVA 4XSKU 3OX7U 4DURA 1TMUH 3MH5A 1C5UA 1LKBA 3I78A 1O2HA 1DLEA 1P05A 3K6ZA 2Y7ZA 5L2ZH 3T26A 3TVJB 1TA2A 5A0BA 1NFXA 4NA7A 2SNVA 1SLUB 1O5GH 3RXFA 3QTVH 2CN0H 4CH8B 2FXRA 2FZZA 1ID5H 3KN2A 2LPRA 1OWEA 1UHBA 1CGJE 3UQVA 2W3IA 2B7DH 4ABJA 3B23B 3LDXH 4AFZA 1UK4A 3VB3A 2GCHF 2RDLA 2ULLA 4ABGA 1CE5A 1EZSC 1TBQH 1ZR0A 2BLWA 3CS7A 5LPEA 1GBTA 1SGFG 2EI8A 3SU2A 2B0FA 1GHWH 1BRBE 1ELBA 3PO1C 2ZHFH 1O2TA 1YPGH 4SGBE 2FM2A 3KF2A 3T27A 1O3EA 3BTHE 1C1TA 2ZP0H 2GTBA 2O8TA 2ZQ2A 4KP0A 2BD8A 1EPTA 3SV2H 1D6RA 3A8AA 2J94A 4KGAA 2VGCC 2J38A 2UUYA 5FCKA 4KTCA 2FYQA 1IQEA 3RXOA 4Y8ZA 2CHAC 5AHGH 3IITA 3PLPA 2VH6A 2ZDMA 1ORFA 2G51A 5FPTA 1VCPA 2YOLA 6LPRA 1ARBA 5CHAC 1GDNA 2JKHA 2SGEE 4X6PA 5G4BA 1HUTH 1DFPA 3R0FA 2ZFRH 5EXMA 2ZGJA 1TLDA 2P93A 1K1MA 1Z71A 2BY9X 3Q3YA 4AFUA 2ZU2A 1Y5UT 2BVSH 4LOYH 2GT7A 2SGPE 1MU8B 2ZA5A 4I33A 4OS5A 3SW2B 1EZXC 1GI5A 2CMYA 3ZVDA 4ZROA 5F6MA 4GPGA 5PTPA 3CS0A 4FVDA 2XBWA 3PMBB 3SOSA 1AVXA 1C5XB 1O37A 4JZ1A 4WWYA 5DG6A 4MLFB 1G37A 3QDZB 1V3XA 2P3TB 1TBRH 3A81A 2VWLA 3Q3KA 3ZVGA 2W26A 2F9OA 4XBCA 4YLQH 1YCPM 3K65B 3U1IB 1EUFA 2Q1JA 2SGDE 4CRDA 5GJ4B 1AY6H 2QXHA 2FI3E 1WCZA 1PQ5A 1SGPE 1TE0A 1HNEE 3BIUH 2D2DA 3A88A 4YOIA 1J8AA 4Q7ZA 1ELVA 1JWTA 4VGCB 3HKIB 2C3SA 1E38B 4B73A 1C2GA 2VVCA 2EC9H 3F9EA 3LGYA 1ACBE 4GSOA 1KYNA 1KXEA 1DY9A 2ZHWH 1SVPA 3VGCB 2NU1E 1TX6A 2G4UA 1KXBA 1LQDB 1IQNA 1L4DA 2AGIX 1RTKA 5JBTA 3GY3A 2C93B 1ELCA 2QCYA 1O2KA 2DE8A 1IQGA 1O2YA 1IQJA 1EAUA 1VZQH 2A45B 4ABBA 2Y82A 1HDTH 4U01A 1C2DA 1UMAH 3LH1A 5FCRA 4JZEH 1HAGE 1GJAB 2AH4X 5FPYA 1KTSB 1MCTA 3F9FA 2TPIZ 4AYVB 1LVOA 2O8LA 2OQUA 1BMAA 1ELTA 3UOPA 1SBWA 2ASUB 3SU4A 3UIRA 1QA7A 1C4Y2 3ENSB 2FS9A 3EA8A 3SGAE 3FFGA 1OWKA 1TOCB 1Q2WA 3HKJB 1KDQA 2VIWA 4KKDA 3SHAH 1DWDH 4XDEA 4PROA 7KMEH 4K2YA 1G3BA 1V2MT 1QY6A 1P9UA 2ZDAH 3NKKA 3MU8A 5HXFA 1AN1E 3P17H 1S6FA 2HRVA 1Y3WA 1S0QA 3H7OA 3TJOA 3A8DA 1OYTH 1BCUH 4JYTA 2PKSB 3RC4A 3W94A 4NCYA 5EPNA 3C27B 1OXGA 2GKVE 4D9QA 4MNVA 1MU6B 1DXPA 3PMHB 1SG8B 2LNCA 3SJ8A 1J16A 3UNRA 1YPHE 2XW9A 1GGDB 1O2IA 2AGGX 2Z9IA 2BTCE 4IW4E 1O3PB 1BIOA 2EA3A 1P01A 2CXVA 1BTPA 2C8YB 3RLWH 3UOUA 3LGUA 2ZECA 5J4QA 5DGJA 1LMWB 4LK4A 1C5TA 2BD2A 2BDYA 2XNIA 1TNKA 2PV9B 3A7XA 4B1TA 4U2WA 1HAHH 8GCHG 5JYIA 5E0GA 1CQQA 3LC3A 1LHFH 3BG4C 1O34A 1PYTD 1LCYA 3RXSA 2ZKSA 1O5CB 1UO6A 1AFQB 1FIWA 3RXGA 4XE4A 1T4UH 1DSTA 2VIOA 3RMMH 3SORA 9ESTA 2AS9A 1P3EA 4A1VA 1AIXH 4ISLA 1PPBH 2J9NA 1UVPA 3K6YA 5DP6A 1EB1H 1GBEA 2GMTC 3ZVEA 1FZZA 2FESH 1HAYB 1H1BA 1C2KA 4DW2U 1C5YB 1GBIA 1TB6H 4GCHG 4X8UH 5EQQA 3GY4A 3ZVBA 4I8HA 1ZMLA 4HGCA 4ISHH 3NCLA 4FUCA 1BTHH 5C3NA 3DUXH 3ZVFA 1NZQH 2A1DB 2BXUH 4FUIA 1C2JA 5H4IB 1PQ7A 5EG4A 2HWLB 1NN6A 4HFPB 4BAOB 3DFLA 1AZ8A 1ZSKA 1EASA 5A09A 2P3FH 2PLXA 2FOHA 1V2WT 1C2IA 1AB9C 4IMZA 4CH2B 1V2VT 4K60A 1P03A 1TPSA 1DVAH 1L4ZA 3RXDA 1ABIH 2VINA 1GCTC 1CT4E 2YNAA 6CHAB 1EX3A 3FZDA 1A0JA 3SU1A 2P3UB 3MFJA 3RXIA 3A8CA 3M61U 3OSYA 3L6PA 1K22H 2WV4A 4MPWA 2C8XB 1UJ1A 2ZU5A 4MG3A 1UVTH 3I77A 3C1KA 2UUKB 1RIWB 1XKBC 3LIWA 2A7JA 2ALVA 1HGTH 3SJKA 1O39A 2F9NA 1UCYE 1MBQA 4AX9H 5I25A 4X2VA 1O3JA 2HNTF 1KXDA 2W7UA 4XFQA 2JH0D 2OQ5A 2XWBI 5HGGA 3U8RH 3H7TA 2ZGCA 2VWNA 1MKWH 1PPZA 1F0TA 4UEHH 1DM4B 4FUBA 1HJAB 4H6TA 2J34A 4MQAA 3T25A 1WBGB 5IYTA 3TH2H 1CA0B 3RP2A 1C1WH 3EE0B 4U32A 5T3HA 4X1RU 1GJBB 6ESTA 3SV8A 3SJIA 3NZIA 4AB9A 1HV7A 1CT0E 2FOGA 1EKBB 1GMCG 4I32A 5EW1H 4I8KA 4BOHA 2KAIB 1O38A 2HNTE 4THNH 1ZHMA 4O97A 2BQWB 2ZCKP 1ZSLA 5DPAA 4FU8A 1ZOMA 1GI8B 2WUBA 2Y80A 1FQ3A 1GBFA 1SSXA 1AO5A 1ZZZA 3UWIA 1UVSH 1EB2A 1FNIA 1GG6C 2ZFPH 1SQOA 2BDAA 3RXPA 1SLVB 5DO4H 3P6ZB 1TGSZ 1YF4A 1TMBH 2O8UA 1GWAA 3E16B 1W7XH 1TFXA 1HPGA 4Y7BA 3K9XB 3A89A 3UQOA 4B76A 3FVFB 1DPOA 1ZYOA 1RD3B 2XBXA 1C1SA 1C2MA 3KQEA 1OKXA 3F1SB 4YO9A 1INCA 3GY7A 4Y6DA 3T28A 3LU9B 2EI7A 1GVKB 5EODA 1FAKH 1C2LA 1K9OE 1AZZA 1F5LA 1HB0B 4RKOB 4CR5A 3SBKA 4WVPE 2GZ7A 8GCHF 1TBZH 5LH8A 3A7WA 1AU8A 1AWFH 1TPPA 1VGCB 1O3OA 1DS2E 1AKSA 4X6NA 3TNTA 1AGJA 1ZTLA 2ZCHP 4UFEH 6GCHG 2GVFA 3S9CA 1MZDA 2K1QA 5GIBA 3ZZ8A 4D76A 4YT7H 5A8YA 4JK6A 1WSSH 3B9FH 2ZHDA 2BD4A 2ZGBH 1BBRE 1ZJKA 1BHXF 1F0UA 3VB5A 3OYPA 4A6LA 1GDQA 3LPRA 3PROA 1BTYA 2OC8A 4AG1A 1O5BB 4NWKA 2JETC 3TJNA 1O2LA 2AGEX 1O5EH 3P70B 1RJXB 1LHDH 3RMOH 1AVWA 1O33A 3MH4A 3RXBA 4GCHF 3E0NB 2TGPZ 2TIOA 1RGQA 1V2LT
chains in the Genus database with same CATH superfamily
2GT8A 4BAHB 1L1NA 3STIA 1NRNH 2FO9A 2WPKS 2HGTH 3MU5A 1O2MA 2V3MA 5GNDA 1SFQB 2GDDA 1P02A 1J15A 3SUEA 5F53A 2A0QB 1O2PA 1P57B 1Z7KA 3ATMA 4ABAA 3SI3H 5FL7D 4X6MA 1O3DA 4NZLA 1O2RA 1TRMA 3Q3XA 1CT2E 2GCTB 2ZPSA 1NPMA 1N8OB 3S9BA 2XWAA 5GXPA 2FX6A 1AI8H 1RFNA 4OS7A 1QA0A 1GVLA 1X7AC 1S6LA 2BD5A 3PRBA 3SNCA 1OP2A 1W13U 3MNSA 5C5OA 3SV9A 3ELAH 4NSVA 2FX4A 2BX4A 4AYYB 5A0CA 1HAIH 3PWCA 4DY7B 2IJD1 1GHVH 3O8BA 3RU4T 1DICA 3SNEA 2AYWA 2V3OH 4Q63A 3SV6A 1QZ8A 4A1TA 4X1NU 1LO6A 2ZU3A 4IN1A 5E2PA 2VIDA 2FDAA 2ZC9H 3GCHB 4ZUHA 4ZKRU 1TWXB 1B0EA 1MKWK 1YP9A 2BDGA 4MPXA 1TPOA 5GDSH 2Z94A 4X2YA 4XBDA 1YPHC 1T32A 1T8LA 2ZDVH 1XXFA 3MTYA 3SNBA 1V2QT 1Z8JB 4BXSA 2RCEA 3OFND 3OTJE 2PSXA 1MAXA 4FXGH 3DT0H 3FP7E 3U1JB 1OHHD 4UD9H 2BVRH 1QURH 2PKAB 2QIQA 5HIYA 2VIQA 2Y5GA 2YNBA 1SI5H 3EA9A 3QX5H 1G2LA 2G52A 1Y5BT 5C94A 1QJ1B 1O3KA 5IK2D 4X8TH 2BOHB 4AORA 1S83A 1GMCF 4J2YB 3PV4A 1AVGH 1HAVA 1ANBA 1GI3A 3AASA 1VITG 3E6PH 3ZVAA 1LTOA 1O2OA 4X6OA 1GMHG 3V12A 1QRXA 3EYDA 1VCQA 5TCAA 1V2JT 2FOAA 3TK5A 1MAYA 1A5HA 1OX1A 2ZO3H 5C20A 1O2WA 1FIZA 1LKAA 1A5IA 3WW7A 1P12E 2BD9A 4ACBA 3OTPA 1BMLA 5B6OA 3FOAA 1Z8GA 2F91A 4Y11E 2R3YA 1TGCA 3HGNA 1NFUA 4H6SB 5A8XA 1BTXA 2XBVA 1O2ZA 3ZYEA 1DUAA 3VB6A 1GVZA 3E8LA 3I29A 3KGPA 4SGAE 3A7YA 3FZZA 5C0UA 4OGXA 1HXEH 3RXHA 2Y5HA 3SUDA 5HM9A 3FANA 3TITA 2CV3A 4ZHLU 4XOJA 7ESTE 2AERH 1F0SA 1WDIA 2BDHA 1O3GA 3SQEE 2RG3A 3RC6A 4B2BA 4INHA 3E90B 4MPUA 1V2NT 4RSPA 3HK6B 4H4FA 1XUKA 2JH5D 1FONA 2W6ID 3JZ2B 1G30B 3NWUA 5C5NA 4GHQA 5B6LA 1BTUA 1BT7A 1O3AA 4WMFA 1P9SA 1EP5A 1GBHA 4INKA 5EXNA 1YPMH 1NTPA 1VCWA 3E1XB 1OWJA 3E91A 2WHXA 5DSFA 1K2I1 1MTNB 2TBSA 4A1XA 1OWHA 1K1NA 4F49A 4X2WA 4WY3A 2GDEH 2IJOB 1LVMA 3L3TA 4CBOA 3AW0A 3U8TH 5JDUB 2M5TA 4KTUA 5JB8S 3A87A 1TQ0B 1BMNH 3UNQA 1O32A 1QRWA 2PW8H 3F9HA 2VWMA 2CF9H 2FIRH 1C5OH 1O3BA 3O8DA 1IQKA 1Y3VA 3UPEA 4NA8A 1TNJA 1UK3A 2JJ1D 4GVUA 5E8EH 1BDAA 2Z9JA 3ZZCA 2ZPRA 1C9TA 1UHBB 3RU4D 4HZHA 4ISIH 4AB8A 1SQTA 4TPYA 1D3DB 1MTWA 2KFWA 4ABIA 1A3BH 1EQ9A 1ELFA 2ZZUH 5C1YA 4YM9A 1AE5A 1ZGIA 1GBAA 5LPRA 2XYAA 1HAOH 2AEIH 3U28C 2RA0A 4RT0A 3HPTB 1TYNA 2KZ4A 3SUFA 1G3DA 3RXAA 1GHAF 1OS8A 1GBKA 3LGIA 1YPEH 1FY1A 2FOMB 4ZH8A 3T5FH 1HXFH 2Y6TA 2H2ZA 3MHWU 1EPTB 1PPGE 2HNTC 2OC0A 1YM0A 1NO9H 3RXEA 1PPEE 1C1UH 4JCNA 1HBTH 5AFZH 1C5WB 1A7SA 3S0NA 1DDJA 1IQHA 2ZFSA 3MU0A 1FX0B 2FMJA 1B7XB 1W2KH 2BYAX 5DP7A 2B8OH 3BEFB 3SGQE 1V2UT 1QL9A 8LPRA 1SB1H 2SGQE 1CVWH 1TGTA 3AVZA 2CJIA 1P10A 1CBWC 2GZ8A 3UAIC 1O35A 1BZXE 4FUGA 3EGKH 1ARCA 1GCDA 2H5DA 2C4FH 1O2UA 2VJ1A 1LQEA 2BD7A 3ATWA 1K28D 2WPLS 1SGFA 4JZDH 2ZDNA 5C2ZA 2QE7D 1RXPA 2J97A 5FBEA 4YESB 3F68H 3VEQB 1N1LA 1NRRH 2BM2A 1BJUA 2XCNA 2Q6GA 4MPVA 1GI7B 1ZHPA 2BLOA 2A5KA 3SNAA 4ZXYH 1UTNA 1GJDB 1YPKH 1YGCH 4X2XA 4CHAB 4IN2A 1E35B 1O2XA 4I7YH 1MD7A 1NFWA 1VITF 2JJ2D 3ATLA 1OP0A 3ZZ9A 3WY8A 3TGKE 1Y8TA 3P8GA 1C1PA 1O2VA 2JDID 1QB1A 1HLTH 3KL6A 1SQRA 4O03A 8ESTE 4JYVH 2R9PA 3SQHE 1CHGA 1E1QD 3M5OA 3ODDA 1FN8A 3PLKA 2OLGA 3ITIA 1QJ6B 4ZCNA 3PMAB 1QJ7B 4GHTA 1KXCA 3VG8A 4YOJA 2FI5E 4ZKOU 4Q7XA 3RLYH 2P94A 1WU1A 3MNBA 3D62A 1Q3XA 2BY8X 2VVVA 1E34B 3V7TA 1FN6A 2F83A 3LH3A 3M37A 1IAUA 1W7GH 4I8JA 3F2HA 2FLRH 3FAOA 1DANH 1K1IA 3M35A 1B5GH 1QGFA 1BQYA 1GI2A 1P2IA 1GBLA 2A32A 1GBCA 1SMFE 1BMFD 3T2NA 3PRDA 3GCTG 1FMGA 1GPZA 1UVUH 5EOKA 3LGWA 1D4PB 4FU7A 1AE8H 2G00A 2KM0A 2ZCLP 2B5TB 1VR1H 1AUTC 5F03A 1GI0A 5HYOA 1E0FD 1SOZA 3A7VA 3K2UA 1C5PA 1WTHD 3EAJA 3W1EA 1FY8E 2FP7B 4JK5A 4P02A 1O2JA 4FUFA 2O9QA 2WPIS 3PYHA 1UCYH 2FOBA 4BAKB 3ZZAA 3QN7A 5E0JA 2ZWLH 1QHRB 1J17T 1SLXB 1CSOE 1S0RA 4Y10E 4ZXXH 4Z6AH 4B75A 2O8WA 3BTKE 4ABHA 2FYRA 4K1TA 2UUJB 3PO1B 1KDQB 2FOCA 4O9VA 5KECA 1YLCA 1ZMJA 2FTMA 1S85A 3P8NA 2OC1A 2VGCB 2J2UA 4ISOA 3ZZ5A 1NROH 2H9HA 2CHAB 1O30A 3E0PB 1J14A 1W11U 1EOJA 1EP6A 2UWLA 3NRLA 1FLEE 1S6HA 1O3HA 2AIPA 2ZFQH 3MOCA 1BITA 2BOKA 2IN2A 1T8MA 1IQLA 1XVOA 4K3JA 5CHAB 2H6MA 1UTQA 1QB9A 1O5AB 1TQ7B 2P16A 2PTCE 4LZ1H 1LPGB 1HRTH 1ANCA 3UWJH 1EJAA 1OOKB 2XC5A 1BB0B 1JOUB 1ANDA 1O31A 1P2OA 1AQ7A 3KQ5A 1GJ9B 2P8OC 4MNXA 1ABJH 2G55A 1MZAA 4OGYA 2A5IA 1FUJA 5E2OA 2R0LA 1YCPH 1HAZB 3SU0A 4OS4A 3O8CA 1N6XA 1W14U 4XD7D 1JIMA 4WMEA 5FHTA 1DOJA 1MMJN 1L2EA 1V6DA 3BN9A 1HJ9A 1JRTA 1XXDA 5AFYH 1C2EA 1KXAA 2NU4E 4ZAEA 2ANYA 4RN6A 1LHEH 3HK3B 3SI4H 1QTFA 1GMDG 1A0LA 2F9BH 4UFDH 3RXRA 1NT1A 1P06A 3U9AH 1TNHA 3GY5A 5EJ1A 4A7IB 4AZ2B 9LPRA 2XC4A 4I8LA 1Y59T 4ASUD 1GJ4H 1OP8A 1WQSA 4Y8YA 2QN5T 4P00A 3GY6A 2ZU1A 1AWHB 2BDCA 1O3FA 1F0RA 4UONA 2A31A 1EOLA 2H9TH 2ZPQA 1W0YH 1YPLH 3MO6A 1FXYA 1V2RT 2Q6FA 1MQ6A 5JBBS 2OC7A 1ESBA 1GDUA 1SGIB 2AIQA 1BBRH 2ZFFH 2VIVA 2FPZA 1ZTKA 4FUJA 4MNWA 3LJOA 1O2GH 1THPB 3LONA 3MYWA 1EAXA 2L6OA 1FV9A 1V2KT 3M7QA 4IGDA 5EPYA 3CENA 2VWOA 2K0QA 4JZFH 5F8XA 3EA7A 4ASHA 3T29A 5FPSA 1A3EH 4ZHMU 1IHSH 1Z1JA 3V13A 1A46H 2OXSA 4TY6A 2OCVB 3BSQA 1OWDA 3TJVA 1SHYA 1ELAA 1IQMA 2W7SA 1O0DH 3P95A 1SL3A 2B9LA 1MCVA 2ILNA 2Z9LA 4ZMAH 1L1JA 1MTSA 1NBME 2IPHA 5DK1A 3TH3H 3MWIU 1G2MA 1HCGA 1KLIH 2Y81A 1P2JA 1T4VH 4A5TS 1PPFE 4Z0KA 3VXEH 3ZZBA 3ZV8A 1NU7B 2ESTE 1TAWA 1TOMH 2VIPA 2G5NA 1D3QB 2A4GA 1PJPA 3DD2H 1MBMA 4NA9H 5DP5A 2D26C 2WYGA 1WAYB 3A8BA 1ZPCA 2GCHG 2P95A 1FPCH 1TALA 4I31A 1BUIA 3A86A 4CRAA 3ATKA 2UWOA 3GCTF 1HIAA 2PHBA 4IS5A 3BEIB 1P2QA 4DGJA 3M7UA 4WH6A 1UCYK 1HJ8A 2TGDA 4K69A 2PGBB 1WV7H 1A1RA 1TRYA 1GBBA 5ETXA 2VBCA 1GI4A 2STAE 3TLOA 1KTTB 1K1PA 2GV6A 3SJ9A 2OINA 3S7KB 1A5GH 2L74A 1P0SH 1O5DH 1WYKA 1JMOH 1PFXC 4WXIA 3BTWE 3BG4B 1H4WA 3AAUA 3A84A 1YLNA 1LPKB 4Y79A 2F3CE 2QY0B 2ZEBA 2IOTA 3WWBA 4O3TA 1O2SA 1TGBA 1GL1A 2FI4E 1GL0E 1LHCH 1PQAA 4KTSA 2HLDD 2G81E 1DE7H 2A4QA 1BHXB 1UTPA 1VJAU 3OY6U 4DJZB 1TA6A 5CMXH 3FKSD 1O2NA 2V6NA 3IWMA 1FJSA 2BLVA 1LHGH 4NZQA 1NY22 5J4SA 4K1SA 1S5SA 2GMTB 3PWBA 1SFIA 3Q76A 1O2QA 3UTUH 2A2XH 2QA9E 5C1UA 1MUEB 3PMJA 3NUMA 1GHZA 4ISNA 1YC0A 1LDTT 3GOVB 3T62A 1O3LA 3MU1A 1A61H 4VGCC 1SGQE 3M5LA 4D7FA 1J9CH 4Y0ZE 2I6QA 1YCPK 3TPIZ 1TMTH 1GI9B 1P2KA 1V2OT 5EGMA 3P8FA 4INLA 3UR6A 1FY3A 1AUJA 4OM9A 1JIRA 3VGCC 3VXFH 1AB9B 1GJ8B 4B6FA 1MABB 1RTFB 2BVXH 1AKSB 3OAAD 5EQRA 2ZFTA 4CRBA 1D6WA 1MKXH 1PQ8A 4DG4A 2TGTA 1ZRBA 5EQSA 3U69H 1GCTB 3ZV9A 1W8BH 3RUOA 3TK6A 4MTBA 4FUEA 4YLUA 1SLWB 4R0IA 1RRKA 1EXFA 2PR3A 2F4LA 4FETA 4ABFA 1FY4A 4LZ4B 3NPSA 3AW1A 2GX4A 1O3CA 2AFQB 4AFQA 1D3TB 2DE9A 3A85A 1T8NA 3M3VA 4WF8A 3TGIE 2NU0E 2WUCA 3RM0H 1THSH 2ZU4A 2FOFA 2F9UA 4F48B 1COWD 3ZVCA 3P92A 2CGAA 1DX5M 2TRMA 1FY5A 2HALA 1YLDA 2G8TA 2A4RA 1D9IA 1Y5AT 3F0PA 1IQFA 1BBRK 4K5ZA 4DVAU 2QF0A 2ZTZA 1EFRD 1HFDA 3GDVA 2H1UA 5DKMA 2ANKH 1BRUP 8KME2 5TJXA 2A4OA 1GJ5H 1XVMA 2PKSC 1NU9A 4FVBA 5CE1A 2FTLE 1LVBA 3SO3A 3PM3A 3GICB 3MH6A 4I8GA 1ELGA 5LGOA 4M7GA 1GGDC 3URCA 3D49H 1MD8A 3RXVA 4FUDA 4YZUA 1ETSH 2ZQ1A 3GY8A 1W0ZU 1MQ5A 5HM2A 4B2CA 4UFFH 1S84A 3BTGE 2RFKC 4AN7A 1E37B 2JIZD 2ZDKA 1PPHE 4NIXA 3SJOA 2C8ZB 2VVUA 1GI6A 1Q31A 1EJMA 3F9GA 4RKJB 2J92A 2STBE 1NESE 5HMAA 1GG6B 1DXWA 1YYY1 1FAXA 3GISB 1G9IE 3BTEE 5K0HA 2A5AA 1LPZB 2VNTA 4MDSA 4BANB 1T31A 1HYLA 1SQAA 1YBWA 3GCOA 1C5VA 1AFQC 2BB4A 3CP7A 4WXVA 2PGQB 1ZLRA 2BQ6B 4IMQA 3HATH 1BRAA 3LJJA 2F9PA 4TPIZ 1ETRH 2QXIA 4X1PU 2XXLA 2GP9B 1P04A 3PLBA 3V0XA 3OY5U 1KIGH 2G5VA 6GCHF 4LXBH 3S7HB 1F92A 1HAVB 4MVNA 1DWEH 1GHXH 1K0HA 4OS2A 1QB6A 2XCFA 3DCLA 1BTWA 2PUQH 2J95A 3TIUA 3M7TA 3AK5A 1ZPBA 4JYUH 4D9RA 1C1VH 2RA3A 3BF6H 2CF8H 3MQKC 2F9VA 3BTDE 4B74A 2R3UA 1A4WH 1SC8U 2ODPA 3BEUA 3GS9A 4ESTE 1C5SA 1GHYH 2BXTH 5T6FA 5DP9A 5L6NH 3BTQE 1UTJA 2ZGHA 3UNSA 3P8OA 4OS1A 1XUFA 3SHCH 4HI3A 3M5NA 1P3CA 1TGNA 2W5EA 2NU3E 1WUNH 2THFB 4B71A 3Q00A 2W6JD 2WINI 1QBOA 3PB1E 4FU9A 2ANMH 6CHAC 1C5LH 4D8NA 1VKYA 3GCNA 4U30A 2JETB 3PV5A 4BAQB 4TWWA 2ZTXA 2SGFE 1UW7A 1BMMH 1NS3A 2A7CA 1THRH 1QBNA 3NK8A 4D7GA 5E0HA 5CHBA 3LC5A 2XOKD 3VB7A 1AD8H 3VB4A 4RT1A 3TNSA 3RDZA 1P2NA 1QQ4A 7GCHG 2YMSC 4JMYA 1RIWC 4B2AA 3GDSA 5HIZA 2BZ6H 4YOGA 2VB0A 1V2PT 3A7TA 5I46H 1T7CA 1DUEA 1GBJA 1MKXK 3DA9B 4Q2KA 4YT6H 2OP9A 5DJ7A 3MI4A 2XNDD 2LP6A 2SGAA 4K8YA 1KXFA 1RTLA 1ELEE 1SGTA 3H09A 4ZKNU 4CRGA 1HJAC 4BTUB 4TWYA 1NRQH 1ESAA 2JH6D 2HPPH 3QZQA 5ESTE 5AF9H 2Z9KA 1VITH 3BTME 1CA0C 2FOEA 1E36B 1XMNB 2QXGA 4TY7A 2WPJS 4WJG2 1W0KD 1Z8RA 3GY2A 3ZYDA 2Z3DA 2LELA 3LT3A 2WPMS 1O5FH 1QQUA 1H9IE 3SZNA 2QAAA 3F2FA 2NWNA 2PWXA 1A0HB 3D23A 4AGJA 3MO9A 4X8SH 1AHTH 3FO8D 3IG6B 3V3MA 2EY4C 1NC6A 3G01A 5IDKA 3WWFA 1N6YA 3M5MA 1TIOA 3ODFA 1KY9A 3VPKA 1S81A 2Y7XA 3TU7H 3FP8E 3M3SA 1ZGVA 2J98A 4X1QU 1NRSH 2WSSD 1C1NA 1PYTC 1OWIA 1C1QA 4BXWA 5T6GA 3EE7A 3RXUA 1GMHF 1IHTH 1UTOA 4AGKA 1Z6EA 2QGRA 4GLYA 4JZIA 1GBDA 4E7RG 3U8OH 1Z6JH 2ANWA 3EQ0H 2ODYB 5FBIA 5EU8A 1EJNA 2J5UA 1CO7E 2I6SA 4BNRA 1G3EA 2V35A 1O3IA 5LPFA 4OS6A 5DP8A 1G36A 2EEKA 1ESTA 4WMDA 4NG9H 5AVDA 2KCPA 5DP3A 1UTLM 2BY5X 2R2MB 1F2SE 4DCDA 4HG6A 1H8IH 2G4TA 4K1EA 1ZRKA 3AAVA 5A0AE 4DIIH 3RMNH 3S9AA 3SNDA 3UREA 5L2YH 2ALPA 1TRNA 1VGCC 1YPJH 5FX6A 4UDWH 1FI8A 3TK9A 2H9EH 3M3TA 5ESBA 1MTVA 2BMGB 1ZJDA 1ZMNA 1MH0A 3SV7A 4FUHA 2Z7FE 1SGDE 3PTBA 4F4OC 5F8ZA 5A8ZA 2QXJA 2SFAA 5C1XA 2XBYA 3QO6A 3UY9A 2D1JA 1P2MA 1VJ9U 2FODA 4CRFA 3NXPA 1UVOA 3JZ1B 3LKWA 1C5NH 3QUMP 1F5KU 2AHME 4GAWA 2A7HA 5T1VA 3UR9A 3TJUA 2Z3EA 1OPHB 3FP6E 1D3PB 2ZNKH 1UK2A 4CBNA 3M36A 1K21H 5TCCA 1BJVA 2BY7X 1UTKA 2J4IA 3QZRA 1V2TT 1UTMA 3RU4E 2BLQA 2AMQA 3ZZ4A 2WPHS 1SGEE 5DP4A 1LVYA 1EAIA 3RM2H 5SGAE 2PTNA 4DOQA 1YKTA 1F5RA 2GCTC 1W10U 1C2HA 2OBQA 3A7ZA 1BA8B 1QL8A 3RXJA 1N8OC 2BDIA 5GPIB 2HPQH 1Y3UA 2UWPA 2Z9GA 1XUIA 1ANEA 1P8VC 3KEEA 2Z6BD 2KAIA 1L0ZA 1Y3YA 4ABDA 3ESTA 1EAWA 1T8OA 3TGJE 4NSYA 4Y8XA 5FAHA 1QRZA 2R0KA 2OBOA 5EW2H 2FEQH 3KQBA 2GGVB 1JRSA 3QGJA 7GCHF 5K7RA 2XRCA 2Y5FA 3F6UH 1CGIE 1IQIA 2ZHEH 3GCHC 1P09A 3BV9B 3A80A 1DSUA 4CREA 1W12U 2HVYB 1JXPA 3O8RA 1TX7A 5BRRE 2DUCA 3S69A 4QT8C 1CHOG 1MTUA 3MMGA 1IOEA 1M9UA 2BZAA 1SGYE 1FDPA 3N99A 1H9HE 4Y7AA 1SHHB 5F8TA 1DT2A 4DT4A 1KLJH 5GCHG 3QTOH 3GDUA 3OU0A 3SGBE 1Z8IB 1OSSA 1XX9A 2XC0A 2EI6A 1DWCH 2AMDA 4NFFA 2HVXA 3RXKA 3KNXA 4NIWA 3DSGA 4HTCH 3A83A 5JBAS 1V2ST 2V3HH 2Q6DA 5FX5A 1GHBG 2QYIA 1FPHH 1TX8A 4BTTB 2FS8A 5GWZA 3MO3A 5EXLA 1SGRE 1TONA 7LPRA 3D65E 1SPJA 1CBWB 4B6EA 1PPCE 1AFEH 5C17A 4H42U 5CDFE 3QK1A 4ZHAA 5A2MH 3TH4H 1XUHA 1GJ6A 1CU1A 1QIXB 3BTTE 1ZSJA 5EJLA 5HKKD 2GZ9A 1H8ED 1ZPZA 2VH0A 2FWWA 1DY8A 4Q80A 1A2CH 4R8TB 1HAXB 3FN8A 3RMLH 2W3KA 1Y3XA 4Y71A 3RXLA 5JBCS 2R2WU 2ZHQH 1O3MA 3RXCA 4NIVA 4KELA 2AMPA 4BTIB 3SU3A 2ZG0H 4CR9A 1QCPA 1ELDE 4IC6A 2D8WA 3SU5A 3BTFE 1C2FA 1GJCB 4UE7H 2HOBA 1C5QA 1H9LB 2H5CA 1ETTH 1GI1A 4NGAH 3LGTA 2HLCA 3MH7A 3MNCA 2TGAA 3MNXA 5KGOA 2PFEA 2BY6X 1O3NA 4TYDA 1C4V2 2OD3B 4Y0YE 1QR3E 3RXQA 1MTNC 1OYQA 3UFAA 3RC5A 1DLKB 1JBUH 2WV5A 2ZGXH 3HGPA 5T6DA 1KLTA 1KSNA 2NU2E 3E3TA 1C5MD 3GYLB 1KMHB 2ZDLA 3UUZA 1K1OA 1BOQA 5ABWA 2BDBA 2QF3A 4XBBA 4CRCA 1GBMA 4AFSA 2ZI2H 3OE7D 5L30H 1BTZA 1P11E 3U98H 1TNIA 4IC5A 1EZUC 5BPEA 4AG2A 4MNYA 1QBVH 1Z1IA 1XUGA 2UUFB 3DHKH 1TABE 4Q4LA 3GYMA 4DIHH 2OTVA 3SN8A 2QV1A 2OUAA 3H5CB 1C1MA 1C9PA 4AOQA 1SR5C 5FXLA 3L33A 4ABEA 3RXMA 1QL7A 3KQCA 3R3GB 1E1RD 2BHGA 3ZZ6A 1EATA 1H8DH 2Z3CA 1CA8B 3B8JA 4IBLH 1NRPH 3URDA 1ZTJA 1G32B 2PKAA 3VFEA 2ZIQH 2ZF0H 1XKAC 4YXWD 3BG8A 4GUXA 1B0FA 4ZKSU 2WV9A 2C8WB 3RXTA 1BRCE 1EPTC 3Q77A 2OK5A 1EZQA 1O36A 4X0WU 3KQDA 2EQNA 1CGHA 1C5ZB 1AMHA 2PSYA 1W3CA 1SOTA 2C90B 2ZTYA 1HAPH 3QWCH 2FLBH 1HIAB 5JPMH 1NFYA 2PUXB 3SZEA 4DT7B 1ZHRA 1XM1A 3SU6A 1GHAG 4Y76A 1K1JA 4NWLA 3KCGH 2VU8E 5EJZA 4YTAA 2P8OB 2ODQA 1C4U2 4BAMB 3MU4A 3DFJA 2P59A 3N7OA 2QC2A 1RS0A 1C1RA 4J1YA 2GV7A 1GMDF 2XTTB 1C5RA 1K1LA 1TNLA 1WQVH 2SNWA 3QLPH 2GD4B 2BD3A 3QGNB 3ZZ3A 3SUGA 1XUJA 1CHOF 1QNJA 3BIVH 3ZZDA 1U6QA 1TNGA 1S82A 1DWBH 5JB9S 3KIDU 1F7ZA 3ATIA 4X8VH 4UFGH 4E06H 2V0BA 1DITH 3SYJA 2RDEA 1C1OA 4F55A 5GCHF 1SGNE 3ZZ7A 1TPAE 3EDXB 2BQ7B 1L1GA 5C67A 2A2QH 2O8MA 2BX3A 1WTGH 3PTNA 2WYJA 3KYFA 4CHAC 3STJA 4E7NA 3A82A 4NFEA 1GHBF 1QFKH 1G3CA 4O3UA 3W95A 5C0TA 4Q7YA 4X1SU 1SGCA 1WOFA 4K8BA 3LGVA 1NM6A 3LOXA 4A92A 4E05H 1GJ7B 4NIYA 5KEDA 4WH8A 3KHVA 4XSKU 3OX7U 4DURA 1TMUH 3MH5A 1C5UA 1LKBA 3I78A 1O2HA 1DLEA 1P05A 4ACAA 2KCYA 3K6ZA 2Y7ZA 5L2ZH 4M9FA 3T26A 3TVJB 1TA2A 5A0BA 1NFXA 4NA7A 2SNVA 1SLUB 1O5GH 3RXFA 3QTVH 2CN0H 4CH8B 2FXRA 2FZZA 1ID5H 3KN2A 4XRNA 2LPRA 1OWEA 1UHBA 1CGJE 3UQVA 2W3IA 2B7DH 4ABJA 3B23B 3LDXH 4Z1MD 2KCOA 4AFZA 1UK4A 3VB3A 2F43B 2GCHF 2RDLA 2ULLA 4ABGA 1CE5A 1EZSC 1TBQH 1ZR0A 2BLWA 3CS7A 5LPEA 1GBTA 1SGFG 2EI8A 3SU2A 2B0FA 1GHWH 1BRBE 1ELBA 3PO1C 2ZHFH 1O2TA 1YPGH 2KR7A 4SGBE 2FM2A 3KF2A 3T27A 1O3EA 3BTHE 1C1TA 2ZP0H 2GTBA 2O8TA 2ZQ2A 4KP0A 2BD8A 1EPTA 3SV2H 1D6RA 3A8AA 2J94A 4KGAA 2VGCC 2J38A 2UUYA 5FCKA 3CNRA 4KTCA 2FYQA 1IQEA 3RXOA 4Y8ZA 2CHAC 5AHGH 3OEED 2M2AA 3IITA 3PLPA 2VH6A 2ZDMA 1ORFA 2G51A 5FPTA 1VCPA 2YOLA 6LPRA 1ARBA 5CHAC 1GDNA 2JKHA 2SGEE 5DN6D 4X6PA 5G4BA 1HUTH 3ZIAD 1DFPA 3R0FA 2ZFRH 4TSFD 5EXMA 2ZGJA 1TLDA 2P93A 1K1MA 1Z71A 2BY9X 3Q3YA 4AFUA 2ZU2A 1Y5UT 2BVSH 4LOYH 2GT7A 2SGPE 1MU8B 2ZA5A 4I33A 4OS5A 3SW2B 1EZXC 1GI5A 2CMYA 3ZVDA 4ZROA 5F6MA 4GPGA 5PTPA 3CS0A 4FVDA 2XBWA 3PMBB 3SOSA 1AVXA 1C5XB 1O37A 4JZ1A 4WWYA 5DG6A 4MLFB 1G37A 3QDZB 1V3XA 2P3TB 1TBRH 1W0JD 3A81A 2VWLA 3Q3KA 3ZVGA 2W26A 2F9OA 4XBCA 4YLQH 1YCPM 3K65B 3U1IB 1EUFA 2Q1JA 2SGDE 4CRDA 5GJ4B 1AY6H 2QXHA 2FI3E 1WCZA 1PQ5A 1SGPE 1TE0A 1HNEE 3BIUH 2D2DA 3A88A 4YOIA 1J8AA 2KX4A 4Q7ZA 1ELVA 1JWTA 4FOUC 4VGCB 3HKIB 2C3SA 1E38B 3N7DA 4B73A 1C2GA 2VVCA 2EC9H 3F9EA 3LGYA 1WXRA 1ACBE 4GSOA 1KYNA 1KXEA 1DY9A 2ZHWH 1SVPA 3VGCB 2NU1E 1TX6A 2G4UA 1KXBA 1LQDB 1IQNA 1L4DA 2AGIX 1RTKA 5JBTA 3GY3A 2C93B 1ELCA 2QCYA 1O2KA 2DE8A 1IQGA 1O2YA 1IQJA 1EAUA 1VZQH 2A45B 4ABBA 2Y82A 1HDTH 4U01A 1C2DA 1UMAH 3LH1A 5FCRA 4JZEH 1HAGE 1GJAB 2AH4X 5FPYA 1KTSB 1MCTA 3F9FA 2TPIZ 2QF5A 4AYVB 1LVOA 2O8LA 2OQUA 3F0OA 1BMAA 1ELTA 2KCAA 3UOPA 1SBWA 2ASUB 3SU4A 3UIRA 1QA7A 1C4Y2 3ENSB 2YMSD 2FS9A 3EA8A 3SGAE 3FFGA 1OWKA 1TOCB 1Q2WA 3HKJB 1KDQA 2VIWA 4KKDA 3SHAH 1DWDH 4XDEA 4PROA 7KMEH 4K2YA 1G3BA 1V2MT 1QY6A 1P9UA 2ZDAH 3NKKA 3MU8A 5HXFA 1AN1E 3P17H 1S6FA 2HRVA 1Y3WA 1S0QA 3H7OA 3TJOA 3A8DA 1OYTH 1BCUH 4JYTA 2PKSB 3RC4A 3W94A 4NCYA 5EPNA 3C27B 1OXGA 2GKVE 4D9QA 3F2GA 4MNVA 1MU6B 1DXPA 3PMHB 1SG8B 2LNCA 3SJ8A 1J16A 3UNRA 1YPHE 2XW9A 1GGDB 1O2IA 2AGGX 2Z9IA 2BTCE 4IW4E 1O3PB 1BIOA 2EA3A 1P01A 2CXVA 1BTPA 2C8YB 3RLWH 1NBMD 3UOUA 3LGUA 2ZECA 5J4QA 5DGJA 1LMWB 4LK4A 1C5TA 2BD2A 3F3BA 2BDYA 2XNIA 1TNKA 2PV9B 3A7XA 4B1TA 4U2WA 1HAHH 8GCHG 5JYIA 5E0GA 1CQQA 3LC3A 3N7EA 1LHFH 3BG4C 2J98B 1O34A 1PYTD 2GJGA 1LCYA 3RXSA 2ZKSA 1O5CB 1UO6A 1AFQB 1FIWA 3RXGA 4I86A 3PV2A 4XE4A 1T4UH 1DSTA 2VIOA 3RMMH 3SORA 9ESTA 2AS9A 2QF4A 1P3EA 4A1VA 1AIXH 4ISLA 1PPBH 2J9NA 1UVPA 1YY3A 3K6YA 5DP6A 1EB1H 1GBEA 2GMTC 3ZVEA 1FZZA 2FESH 1HAYB 1H1BA 2WZQA 1C2KA 4DW2U 1C5YB 1GBIA 1TB6H 2K8IA 4GCHG 4X8UH 5EQQA 3GY4A 3ZVBA 4I8HA 1ZMLA 4HGCA 4ISHH 3NCLA 4FUCA 1BTHH 5C3NA 3DUXH 3ZVFA 1NZQH 2A1DB 2BXUH 4FUIA 1C2JA 5H4IB 1PQ7A 5EG4A 2HWLB 1NN6A 4HFPB 4BAOB 3DFLA 1AZ8A 1ZSKA 1EASA 5A09A 2P3FH 2PLXA 2FOHA 1V2WT 1C2IA 1H8HD 1AB9C 4IMZA 4CH2B 1V2VT 4K60A 1P03A 1TPSA 1DVAH 1L4ZA 3RXDA 1ABIH 1E79D 2VINA 1GCTC 1CT4E 2YNAA 6CHAB 1EX3A 3FZDA 1A0JA 3SU1A 2P3UB 3MFJA 3RXIA 2PP6A 3A8CA 3M61U 3OSYA 3L6PA 1K22H 2WV4A 4MPWA 2C8XB 1UJ1A 2ZU5A 4MG3A 1UVTH 3I77A 3C1KA 2YMSB 2UUKB 1RIWB 1XKBC 3LIWA 2A7JA 2ALVA 1HGTH 3SJKA 1O39A 2F9NA 1UCYE 1MBQA 4AX9H 5I25A 4X2VA 1O3JA 2HNTF 1KXDA 2W7UA 4XFQA 2JH0D 2OQ5A 2XWBI 5HGGA 3U8RH 1YWUA 3H7TA 2ZGCA 2VWNA 1MKWH 1PPZA 1F0TA 4UEHH 1DM4B 4FUBA 1HJAB 4H6TA 2J34A 4MQAA 3T25A 1WBGB 5IYTA 3TH2H 1CA0B 3RP2A 1C1WH 3EE0B 4U32A 5T3HA 4X1RU 1GJBB 6ESTA 3SV8A 3SJIA 3NZIA 4AB9A 1HV7A 1CT0E 2FOGA 1EKBB 1GMCG 4I32A 5EW1H 4I8KA 4BOHA 2KAIB 1O38A 2HNTE 2WPDD 4THNH 1ZHMA 4O97A 2BQWB 2ZCKP 1ZSLA 5DPAA 4FU8A 1ZOMA 1GI8B 2WUBA 2Y80A 1FQ3A 1GBFA 1SSXA 1AO5A 1ZZZA 3UWIA 1UVSH 1EB2A 1FNIA 1GG6C 2ZFPH 1SQOA 2BDAA 3RXPA 1SLVB 5DO4H 3P6ZB 1TGSZ 1YF4A 1TMBH 2O8UA 1GWAA 3E16B 1W7XH 2CK3D 1TFXA 1HPGA 4Y7BA 3K9XB 3A89A 3UQOA 4B76A 3FVFB 1DPOA 1ZYOA 1RD3B 2XBXA 1C1SA 1C2MA 3KQEA 1OKXA 3F1SB 4YO9A 1INCA 3GY7A 4Y6DA 3T28A 3LU9B 2EI7A 3DSPA 1GVKB 5EODA 1FAKH 1C2LA 1K9OE 3OEHD 1AZZA 1F5LA 1HB0B 4RKOB 4CR5A 3SBKA 4WVPE 2GZ7A 8GCHF 1TBZH 3KYGA 5LH8A 3A7WA 3UB0A 1AU8A 1AWFH 3DSOA 1TPPA 1VGCB 2V7QD 1O3OA 1DS2E 1AKSA 5EIYA 4X6NA 3TNTA 1AGJA 1ZTLA 2ZCHP 4UFEH 6GCHG 2GVFA 3S9CA 1MZDA 2K1QA 5GIBA 3ZZ8A 4D76A 4YT7H 5A8YA 4AC9A 4JK6A 1WSSH 3B9FH 2ZHDA 2BD4A 2ZGBH 1BBRE 1ZJKA 1BHXF 1F0UA 3VB5A 3OYPA 4A6LA 1GDQA 3LPRA 3PROA 1BTYA 2OC8A 4AG1A 1O5BB 4NWKA 2JETC 3TJNA 1O2LA 2AGEX 1O5EH 3P70B 2IPQX 1RJXB 1LHDH 3RMOH 1AVWA 1O33A 4TT3D 3MH4A 3RXBA 1SKYE 4GCHF 4RI0A 3E0NB 2TGPZ 2TIOA 1RGQA 1V2LT
chains in the Genus database with same CATH topology
2GT8A 4BAHB 1L1NA 3STIA 1NRNH 2FO9A 2WPKS 2HGTH 3MU5A 1O2MA 1SFQB 2GDDA 1P02A 1J15A 3SUEA 2A0QB 1O2PA 1P57B 1Z7KA 3ATMA 4ABAA 3SI3H 4X6MA 1O3DA 4NZLA 1O2RA 1TRMA 3Q3XA 1CT2E 2GCTB 2ZPSA 1NPMA 1N8OB 3S9BA 2XWAA 5GXPA 2FX6A 1AI8H 1RFNA 4OS7A 1QA0A 1GVLA 1X7AC 2BD5A 3SNCA 1OP2A 1W13U 3MNSA 5C5OA 3SV9A 3ELAH 4NSVA 2FX4A 2BX4A 4AYYB 5A0CA 1HAIH 3PWCA 4DY7B 1GHVH 3O8BA 3RU4T 1DICA 3SNEA 2AYWA 2V3OH 3SV6A 4A1TA 4X1NU 1LO6A 2ZU3A 4IN1A 5E2PA 2VIDA 2FDAA 2ZC9H 3GCHB 4ZUHA 4ZKRU 1TWXB 1B0EA 1MKWK 1YP9A 2BDGA 4MPXA 1TPOA 5GDSH 2Z94A 4X2YA 4XBDA 1YPHC 1T32A 1T8LA 2ZDVH 1XXFA 3MTYA 3SNBA 1V2QT 1Z8JB 4BXSA 2RCEA 3OTJE 2PSXA 1MAXA 4FXGH 3DT0H 3FP7E 3U1JB 4UD9H 2BVRH 1QURH 2PKAB 2QIQA 2VIQA 2Y5GA 2YNBA 1SI5H 3EA9A 3QX5H 1G2LA 2G52A 1Y5BT 1QJ1B 1O3KA 4X8TH 2BOHB 4AORA 1S83A 1GMCF 4J2YB 3PV4A 1AVGH 1HAVA 1ANBA 1GI3A 3AASA 1VITG 3E6PH 3ZVAA 1LTOA 1O2OA 4X6OA 1GMHG 3V12A 1QRXA 3EYDA 1VCQA 5TCAA 1V2JT 2FOAA 3TK5A 1MAYA 1A5HA 1OX1A 2ZO3H 5C20A 1O2WA 1FIZA 1LKAA 1A5IA 1P12E 2BD9A 1BMLA 5B6OA 1Z8GA 2F91A 4Y11E 2R3YA 1TGCA 3HGNA 1NFUA 4H6SB 5A8XA 1BTXA 2XBVA 1O2ZA 3ZYEA 1DUAA 3VB6A 1GVZA 3E8LA 3I29A 3KGPA 4SGAE 3A7YA 3FZZA 4OGXA 1HXEH 3RXHA 2Y5HA 3SUDA 5HM9A 3FANA 3TITA 2CV3A 4ZHLU 4XOJA 7ESTE 2AERH 1F0SA 2BDHA 1O3GA 3SQEE 2RG3A 3RC6A 4B2BA 4INHA 3E90B 4MPUA 1V2NT 4RSPA 3HK6B 4H4FA 1XUKA 2JH5D 1FONA 3JZ2B 3NWUA 1G30B 5C5NA 4GHQA 1BTUA 1BT7A 1O3AA 4WMFA 1P9SA 1EP5A 1GBHA 4INKA 5EXNA 1YPMH 1NTPA 1VCWA 3E1XB 1OWJA 3E91A 1K2I1 1MTNB 2TBSA 4A1XA 1OWHA 1K1NA 4F49A 4X2WA 4WY3A 2GDEH 2IJOB 1LVMA 3L3TA 4CBOA 3AW0A 3U8TH 5JDUB 2M5TA 4KTUA 5JB8S 3A87A 1TQ0B 1BMNH 3UNQA 1O32A 1QRWA 2PW8H 3F9HA 2VWMA 2CF9H 2FIRH 1C5OH 1O3BA 3O8DA 1IQKA 1Y3VA 3UPEA 4NA8A 1TNJA 1UK3A 4GVUA 5E8EH 1BDAA 2Z9JA 3ZZCA 2ZPRA 1C9TA 1UHBB 3RU4D 4HZHA 4ISIH 4AB8A 1SQTA 4TPYA 1D3DB 1MTWA 4ABIA 1A3BH 1EQ9A 1ELFA 2ZZUH 5C1YA 4YM9A 1AE5A 1ZGIA 1GBAA 5LPRA 2XYAA 1HAOH 2AEIH 2RA0A 3HPTB 1TYNA 3SUFA 1G3DA 3RXAA 1GHAF 1OS8A 1GBKA 3LGIA 1YPEH 1FY1A 2FOMB 4ZH8A 3T5FH 1HXFH 2Y6TA 2H2ZA 3MHWU 1EPTB 1PPGE 2HNTC 2OC0A 1YM0A 1NO9H 3RXEA 1PPEE 1C1UH 4JCNA 1HBTH 5AFZH 1C5WB 1A7SA 3S0NA 1DDJA 1IQHA 2ZFSA 3MU0A 2FMJA 1B7XB 1W2KH 2BYAX 5DP7A 2B8OH 3BEFB 3SGQE 1V2UT 1QL9A 8LPRA 1SB1H 2SGQE 1CVWH 1TGTA 3AVZA 1P10A 2CJIA 1CBWC 2GZ8A 1O35A 1BZXE 4FUGA 3EGKH 1ARCA 1GCDA 2H5DA 2C4FH 1O2UA 2VJ1A 1LQEA 2BD7A 3ATWA 1K28D 2WPLS 1SGFA 4JZDH 2ZDNA 5C2ZA 1RXPA 5FBEA 4YESB 3F68H 3VEQB 1N1LA 1NRRH 2BM2A 1BJUA 2XCNA 2Q6GA 4MPVA 1GI7B 1ZHPA 2BLOA 2A5KA 3SNAA 4ZXYH 1UTNA 1GJDB 1YPKH 1YGCH 4X2XA 4CHAB 4IN2A 1E35B 1O2XA 4I7YH 1MD7A 1NFWA 1VITF 3ATLA 3ZZ9A 1OP0A 3WY8A 3TGKE 1Y8TA 3P8GA 1C1PA 1O2VA 1QB1A 1HLTH 3KL6A 4O03A 8ESTE 4JYVH 2R9PA 3SQHE 1CHGA 3ODDA 3M5OA 1FN8A 3PLKA 2OLGA 3ITIA 1QJ6B 3PMAB 1QJ7B 4GHTA 1KXCA 4YOJA 2FI5E 4ZKOU 4Q7XA 3RLYH 2P94A 1WU1A 3MNBA 3D62A 1Q3XA 2BY8X 2VVVA 1E34B 3V7TA 1FN6A 2F83A 3LH3A 3M37A 1IAUA 1W7GH 4I8JA 2FLRH 3FAOA 1DANH 1K1IA 3M35A 1B5GH 1QGFA 1BQYA 1GI2A 1P2IA 1GBLA 2A32A 1GBCA 1SMFE 3T2NA 3GCTG 1FMGA 1GPZA 1UVUH 5EOKA 3LGWA 1D4PB 4FU7A 1AE8H 2G00A 2ZCLP 2B5TB 1VR1H 1AUTC 5F03A 1GI0A 5HYOA 1E0FD 1SOZA 3A7VA 3K2UA 1C5PA 1WTHD 3EAJA 1FY8E 2FP7B 4JK5A 1O2JA 4FUFA 2O9QA 2WPIS 3PYHA 1UCYH 2FOBA 4BAKB 3ZZAA 3QN7A 5E0JA 2ZWLH 1QHRB 1J17T 1SLXB 1CSOE 1S0RA 4Y10E 4ZXXH 4Z6AH 4B75A 2O8WA 3BTKE 4ABHA 2FYRA 4K1TA 2UUJB 3PO1B 1KDQB 2FOCA 4O9VA 1YLCA 1ZMJA 2FTMA 1S85A 3P8NA 2OC1A 2VGCB 2J2UA 4ISOA 3ZZ5A 1NROH 2H9HA 2CHAB 1O30A 3E0PB 1J14A 1W11U 1EOJA 1EP6A 2UWLA 1FLEE 1S6HA 1O3HA 2AIPA 2ZFQH 3MOCA 1BITA 2BOKA 2IN2A 1T8MA 1IQLA 1XVOA 4K3JA 5CHAB 2H6MA 1UTQA 1QB9A 1O5AB 1TQ7B 2P16A 2PTCE 4LZ1H 1LPGB 1HRTH 1ANCA 3UWJH 1EJAA 1OOKB 2XC5A 1BB0B 1JOUB 1ANDA 1O31A 1P2OA 1AQ7A 1GJ9B 2P8OC 4MNXA 1ABJH 2G55A 1MZAA 4OGYA 2A5IA 1FUJA 5E2OA 2R0LA 1YCPH 1HAZB 3SU0A 4OS4A 3O8CA 1N6XA 1W14U 1JIMA 4WMEA 5FHTA 1DOJA 1MMJN 1L2EA 1V6DA 3BN9A 1HJ9A 1JRTA 1XXDA 5AFYH 1C2EA 1KXAA 2NU4E 4ZAEA 2ANYA 4RN6A 1LHEH 3HK3B 3SI4H 1QTFA 1GMDG 1A0LA 2F9BH 4UFDH 3RXRA 1NT1A 1P06A 3U9AH 1TNHA 3GY5A 4A7IB 4AZ2B 9LPRA 2XC4A 4I8LA 1Y59T 1GJ4H 1OP8A 1WQSA 4Y8YA 2QN5T 3GY6A 2ZU1A 1AWHB 2BDCA 1O3FA 1F0RA 4UONA 2A31A 1EOLA 2H9TH 2ZPQA 1W0YH 1YPLH 3MO6A 1FXYA 1V2RT 2Q6FA 1MQ6A 5JBBS 2OC7A 1ESBA 1GDUA 1SGIB 2AIQA 1BBRH 2ZFFH 2VIVA 2FPZA 1ZTKA 4FUJA 4MNWA 3LJOA 1O2GH 1THPB 3LONA 3MYWA 1EAXA 1FV9A 1V2KT 3M7QA 4IGDA 5EPYA 3CENA 2VWOA 4JZFH 5F8XA 3EA7A 4ASHA 3T29A 5FPSA 1A3EH 4ZHMU 1IHSH 1Z1JA 3V13A 1A46H 2OXSA 4TY6A 2OCVB 3BSQA 1OWDA 3TJVA 1SHYA 1ELAA 1IQMA 2W7SA 1O0DH 3P95A 1SL3A 2B9LA 1MCVA 2ILNA 2Z9LA 4ZMAH 1L1JA 1MTSA 2IPHA 5DK1A 3TH3H 3MWIU 1G2MA 1HCGA 1KLIH 2Y81A 1P2JA 1T4VH 4A5TS 1PPFE 4Z0KA 3VXEH 3ZZBA 3ZV8A 1NU7B 2ESTE 1TAWA 1TOMH 2VIPA 2G5NA 1D3QB 2A4GA 1PJPA 3DD2H 1MBMA 4NA9H 5DP5A 2D26C 2WYGA 1WAYB 3A8BA 1ZPCA 2GCHG 2P95A 1FPCH 1TALA 4I31A 1BUIA 3A86A 4CRAA 3ATKA 2UWOA 3GCTF 1HIAA 2PHBA 4IS5A 3BEIB 1P2QA 4DGJA 3M7UA 4WH6A 1UCYK 1HJ8A 2TGDA 4K69A 2PGBB 1WV7H 1A1RA 1TRYA 1GBBA 5ETXA 1GI4A 2STAE 3TLOA 1KTTB 1K1PA 2GV6A 3SJ9A 2OINA 3S7KB 1A5GH 1P0SH 1O5DH 1WYKA 1JMOH 1PFXC 4WXIA 3BTWE 3BG4B 1H4WA 3AAUA 3A84A 1LPKB 4Y79A 2F3CE 2QY0B 2ZEBA 2IOTA 4O3TA 1O2SA 1TGBA 1GL1A 2FI4E 1GL0E 1LHCH 1PQAA 4KTSA 2G81E 1DE7H 2A4QA 1BHXB 1UTPA 1VJAU 3OY6U 4DJZB 1TA6A 5CMXH 1O2NA 2V6NA 3IWMA 1FJSA 2BLVA 1LHGH 4NZQA 1NY22 5J4SA 4K1SA 1S5SA 2GMTB 3PWBA 1SFIA 3Q76A 1O2QA 3UTUH 2A2XH 2QA9E 5C1UA 1MUEB 3PMJA 3NUMA 1GHZA 4ISNA 1YC0A 1LDTT 3GOVB 3T62A 1O3LA 3MU1A 1A61H 4VGCC 1SGQE 3M5LA 4D7FA 1J9CH 4Y0ZE 2I6QA 1YCPK 3TPIZ 1TMTH 1GI9B 1P2KA 1V2OT 5EGMA 3P8FA 4INLA 3UR6A 1FY3A 1AUJA 3VGCC 1JIRA 3VXFH 1AB9B 1GJ8B 1RTFB 2BVXH 1AKSB 5EQRA 2ZFTA 4CRBA 1D6WA 1MKXH 1PQ8A 4DG4A 2TGTA 1ZRBA 5EQSA 3U69H 1GCTB 3ZV9A 1W8BH 3RUOA 3TK6A 4MTBA 4FUEA 4YLUA 1SLWB 4R0IA 1RRKA 1EXFA 2PR3A 4ABFA 1FY4A 4LZ4B 3NPSA 3AW1A 2GX4A 1O3CA 2AFQB 4AFQA 1D3TB 2DE9A 3A85A 1T8NA 3M3VA 4WF8A 3TGIE 2NU0E 2WUCA 3RM0H 1THSH 2ZU4A 2FOFA 2F9UA 3ZVCA 3P92A 2CGAA 1DX5M 2TRMA 1FY5A 2HALA 1YLDA 2G8TA 2A4RA 1D9IA 1Y5AT 1IQFA 1BBRK 4K5ZA 4DVAU 2QF0A 2ZTZA 1HFDA 3GDVA 2H1UA 5DKMA 2ANKH 1BRUP 8KME2 5TJXA 2A4OA 1GJ5H 1XVMA 2PKSC 1NU9A 4FVBA 5CE1A 2FTLE 1LVBA 3SO3A 3PM3A 3GICB 3MH6A 4I8GA 1ELGA 5LGOA 4M7GA 1GGDC 3URCA 3D49H 1MD8A 3RXVA 4FUDA 4YZUA 1ETSH 2ZQ1A 3GY8A 1W0ZU 1MQ5A 5HM2A 4B2CA 4UFFH 1S84A 3BTGE 4AN7A 1E37B 2ZDKA 1PPHE 4NIXA 3SJOA 2C8ZB 2VVUA 1GI6A 1Q31A 1EJMA 3F9GA 4RKJB 2J92A 2STBE 1NESE 5HMAA 1GG6B 1DXWA 1YYY1 1FAXA 3GISB 1G9IE 3BTEE 5K0HA 2A5AA 1LPZB 2VNTA 4MDSA 4BANB 1T31A 1HYLA 1SQAA 1YBWA 3GCOA 1C5VA 1AFQC 2BB4A 3CP7A 4WXVA 2PGQB 1ZLRA 2BQ6B 4IMQA 3HATH 1BRAA 3LJJA 2F9PA 4TPIZ 1ETRH 2QXIA 4X1PU 2XXLA 2GP9B 1P04A 3PLBA 3V0XA 3OY5U 1KIGH 2G5VA 6GCHF 4LXBH 3S7HB 1F92A 1HAVB 4MVNA 1DWEH 1GHXH 4OS2A 1QB6A 2XCFA 1BTWA 2PUQH 2J95A 3TIUA 3M7TA 1ZPBA 4JYUH 4D9RA 1C1VH 2RA3A 3BF6H 2CF8H 2F9VA 3BTDE 4B74A 2R3UA 1A4WH 1SC8U 2ODPA 3BEUA 4ESTE 1C5SA 1GHYH 2BXTH 5T6FA 5DP9A 5L6NH 3BTQE 1UTJA 2ZGHA 3UNSA 3P8OA 4OS1A 1XUFA 3SHCH 4HI3A 3M5NA 1P3CA 1TGNA 2W5EA 2NU3E 1WUNH 2THFB 4B71A 3Q00A 2WINI 1QBOA 3PB1E 4FU9A 2ANMH 6CHAC 1C5LH 4D8NA 4U30A 3GCNA 2JETB 4BAQB 4TWWA 2ZTXA 2SGFE 1BMMH 1NS3A 2A7CA 1THRH 1QBNA 3NK8A 4D7GA 5E0HA 3LC5A 3VB7A 1AD8H 3VB4A 3TNSA 3RDZA 1P2NA 1QQ4A 7GCHG 4JMYA 1RIWC 4B2AA 3GDSA 2BZ6H 4YOGA 2VB0A 1V2PT 3A7TA 5I46H 1T7CA 1DUEA 1GBJA 1MKXK 3DA9B 4Q2KA 4YT6H 2OP9A 5DJ7A 3MI4A 2SGAA 4K8YA 1KXFA 1RTLA 1ELEE 1SGTA 4ZKNU 4CRGA 1HJAC 4BTUB 4TWYA 1NRQH 1ESAA 2JH6D 2HPPH 3QZQA 5ESTE 5AF9H 2Z9KA 1VITH 3BTME 1CA0C 2FOEA 1E36B 1XMNB 2QXGA 4TY7A 2WPJS 4WJG2 1Z8RA 3GY2A 3ZYDA 2Z3DA 3LT3A 2WPMS 1O5FH 1QQUA 1H9IE 3SZNA 2QAAA 2NWNA 2PWXA 1A0HB 3D23A 4AGJA 3MO9A 4X8SH 1AHTH 3IG6B 3V3MA 1NC6A 3G01A 5IDKA 1N6YA 3M5MA 1TIOA 3ODFA 1KY9A 3VPKA 1S81A 2Y7XA 3TU7H 3FP8E 3M3SA 1ZGVA 4X1QU 1NRSH 1C1NA 1PYTC 1OWIA 1C1QA 4BXWA 5T6GA 3RXUA 1GMHF 1IHTH 1UTOA 4AGKA 1Z6EA