1O2TA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2tA02
2GVFA 3MO6A 2FYRA 1INCA 4Y7BA 1O2HA 1LO6A 2WYJA 1V2NT 2AERH 2OTVA 3LJJA 1UTMA 3U69H 3ATKA 2WPHS 1UVSH 3QTOH 4GLYA 3UUZA 5EW1H 2EC9H 1TGSZ 3TNTA 3M36A 2HWLB 4E05H 1AGJA 1XUHA 4ABBA 3ZVCA 1GL0E 3N7OA 3BTTE 5I46H 2ZDLA 1TX8A 3A82A 3DA9B 4GHQA 3RXSA 3LGIA 1QY6A 1AZ8A 2GDEH 2UWLA 4ZMAH 4NCYA 2NU1E 1ZZZA 3RC6A 1HAGE 3TIUA 1L0ZA 1HAYB 2JH6D 1RRKA 1S0RA 2BX3A 2C8YB 1OKXA 3VEQB 5FCKA 1C4U2 1GBBA 1V2JT 3A85A 3RMLH 2OC7A 2P94A 4MDSA 3UPEA 2QXHA 3MU0A 4TWWA 4QT8C 2SFAA 3A87A 1RTFB 5EGMA 2TGPZ 2H5CA 1ELCA 3Q3YA 1O2QA 2BOKA 1HGTH 4X2XA 1LVOA 4UDWH 1DICA 2RDLA 1ESBA 3MWIU 1C5ZB 1O3LA 2R3UA 3LJOA 5JBCS 1Z1IA 2Z3CA 3UQOA 2IOTA 2ZKSA 1OYQA 1PQAA 2JH5D 4U01A 1BIOA 3HGNA 1XVMA 3ZZCA 1UK3A 1C4Y2 3RP2A 1FY3A 1GBIA 1UK2A 5FAHA 1MD8A 2W7SA 5F8XA 1NO9H 8GCHF 1GDNA 5FX6A 1QFKH 2W3KA 1O2YA 2PGBB 1AQ7A 2ZGBH 3M3SA 4I33A 2ZF0H 1CBWB 1AWFH 1S82A 2Q1JA 3A84A 4XBBA 4Q2KA 4X2VA 3ZZ4A 4NFFA 4XE4A 5E2OA 1ZMJA 2GMTC 5E0GA 1YF4A 2DE9A 2UWOA 3MMGA 3U8OH 1O3CA 1VCWA 1D6WA 3A7WA 3SOSA 2WYGA 1EZSC 1BTHH 1C5TA 3SJKA 1EP5A 2ZPQA 2QXJA 2ZU2A 3E8LA 3F1SB 2F91A 1WQSA 1MAYA 3KEEA 1SGFG 2PKSC 1ZRKA 2Q6FA 3HKIB 1FJSA 2XYAA 1OWKA 3MH6A 4DY7B 1N6XA 1S5SA 2ZHWH 2B5TB 1YPHC 1Z6JH 4RKJB 3GDUA 1SLWB 1UHBB 4JZ1A 1O2UA 2OC1A 4NG9H 4WXVA 2KAIA 2VWLA 3P8FA 5DKMA 1MTSA 2O8TA 5JBAS 1VCPA 2FX4A 1O39A 1P9UA 3ITIA 5EPNA 1WSSH 1IQNA 3GCTG 1Y8TA 4B2AA 4FUJA 3VFEA 3BTWE 1QL9A 1TNLA 4CH8B 1D6RA 3LH3A 5E0HA 1IQJA 5FPTA 2XC5A 1BBRH 1P2NA 4XSKU 1G30B 1XUIA 1ESAA 3SHCH 4IBLH 1NFUA 1DS2E 3UR9A 1N8OB 5EXLA 2J34A 1GVKB 1QQUA 2W7UA 2ZFSA 1JWTA 1TX7A 3MHWU 1QR3E 3TH2H 1FPCH 3RUOA 2G5NA 3NXPA 2G00A 1EZQA 1DLKB 1TPOA 2VH6A 2WUCA 3SV7A 5ABWA 4CR9A 2HNTE 1EAIA 7LPRA 4BAQB 1BMNH 1KLJH 1KXFA 4LXBH 3FZZA 2A2XH 3U8TH 2BD5A 4WJG2 3PLKA 1LMWB 1O0DH 1C2MA 1XMNB 2FLRH 4NIYA 5C5NA 4R8TB 3SNEA 2GCTC 2TBSA 2Y80A 3IWMA 4Y79A 3NCLA 4Y8XA 4CRBA 3I77A 1LHCH 4FU9A 1MKXK 3B23B 4CREA 1E38B 2XC0A 3GDSA 4NA7A 4SGAE 4JZDH 1L1JA 1V2RT 3RXRA 1F0TA 1G36A 2A5KA 1UTLM 4JK6A 5LPRA 4K1SA 3LGWA 1GJ8B 1P05A 2OC0A 4DIIH 3VXFH 1O38A 3GCHC 1FONA 4I8GA 1FIZA 1HAVB 3A7XA 4JZIA 4WMFA 1V2PT 3A7VA 2G55A 2ZNKH 3E6PH 4ISOA 4BXWA 3MNSA 2HNTF 1GHBF 1HBTH 1WOFA 1V6DA 1Z7KA 2XW9A 1WTGH 2W26A 5H4IB 1KXAA 4INKA 4K1EA 3KCGH 3TK5A 6GCHF 4IC5A 1JRTA 4THNH 1NU7B 2D1JA 1HCGA 4FUEA 4JYUH 3D23A 2ZIQH 3TH4H 4PROA 1CHGA 1QNJA 1AVWA 2BZAA 2KAIB 1J16A 3RXPA 4D7GA 2GDDA 1QIXB 2BYAX 1BMAA 5EQQA 1C1UH 3ZYDA 2H2ZA 3S9BA 2CF9H 4UFEH 3OX7U 1TX6A 2FDAA 3UFAA 2J2UA 4AGJA 4TYDA 3SGAE 1T32A 4UFGH 5L30H 3OU0A 2ZEBA 1P12E 1TONA 5ESTE 2Y82A 1EX3A 1TQ0B 1Z8IB 2XCFA 3GCNA 3RXDA 3DD2H 3H5CB 2OXSA 3UWIA 1C9TA 1QBVH 1QHRB 3TGJE 2ZDKA 1Z8RA 3Q76A 4B76A 1GJ7B 1J17T 2WINI 1SGRE 3GY3A 3PMAB 1A46H 1PQ7A 4LK4A 2CXVA 3IITA 3TJVA 1ZLRA 4O9VA 2RG3A 3SZNA 1GBJA 1A3EH 1GBCA 1GCTB 1CBWC 2PV9B 2GT8A 4Y11E 1HIAB 4ZROA 3SJ8A 5LPFA 1CGIE 3RXEA 3BEUA 1C5UA 2A1DB 4B1TA 3M7UA 3TU7H 4B74A 1Y3YA 1T7CA 1V2TT 5AFZH 4BTIB 4F4OC 1AVXA 1C1NA 2ZP0H 3E3TA 1GMDF 3LU9B 1WUNH 4OGYA 1MTWA 3T5FH 4TY7A 2FZZA 3EAJA 4XOJA 1ZPZA 2BD4A 1K1NA 3M5NA 4O03A 1GJ5H 2PR3A 5ESBA 4ISNA 1GI3A 2FIRH 4D9QA 2B7DH 1SGPE 4AFQA 1UTNA 1DSUA 2ANWA 3Q00A 2A5AA 3BTFE 1KLTA 2XCNA 3O8BA 1E34B 1BHXB 2BM2A 2ZCKP 1OYTH 1OWIA 2AYWA 3NUMA 4RN6A 5DP3A 2AGIX 1DUAA 2FMJA 2OD3B 1C2KA 1TALA 1T8MA 1C2FA 1O2XA 5PTPA 1GJ6A 1GMCG 1AE5A 1KIGH 3KQEA 3EGKH 1XKAC 3SGBE 3UNRA 1AKSB 2ZU1A 4YM9A 3RXOA 3SJ9A 1DOJA 4X6MA 4NSYA 1NFWA 1C5RA 1Q31A 1TOCB 4BOHA 3OY5U 4YOJA 1TLDA 1TBQH 2BTCE 1L2EA 1BITA 3GY6A 2XTTB 1HLTH 4X8VH 5EODA 2WV4A 1TBZH 2ILNA 2IJOB 3FP8E 3RC5A 1SGTA 2TRMA 5GCHF 1AN1E 1FMGA 4B73A 1ZYOA 1WAYB 3ZV9A 3DFJA 4WH8A 1LHGH 5FCRA 1DWDH 1QCPA 2W5EA 2VVUA 3K2UA 3A81A 1XVOA 4BXSA 1A7SA 1C1TA 1GBKA 1DWEH 2P93A 4IN1A 2CGAA 1W8BH 2Y5GA 1O2MA 3K6ZA 4H6SB 2VINA 3ODDA 1C9PA 3U9AH 4Y0ZE 3GY5A 1ZMLA 1Z71A 2ZG0H 3AAVA 4CHAB 4A1XA 1UO6A 5A0CA 1AUTC 3BTKE 2FX6A 4Q7ZA 3QGJA 1Y5UT 5GPIB 3AW1A 1EPTC 3BV9B 4WMEA 1DXPA 3TLOA 5GDSH 4FUDA 4NSVA 2FESH 1BBRE 3Q77A 1V2ST 3LGYA 4ZKOU 2VWMA 5L6NH 1GCDA 2QAAA 4YESB 2NU0E 2FTLE 1ARBA 1QA7A 2PHBA 4NGAH 7ESTE 3ODFA 4MLFB 4X6OA 2ZECA 3V0XA 1PYTC 3T25A 1F0RA 3P70B 1NTPA 1ZGIA 1WTHD 1PPBH 3F9FA 1FDPA 1G3CA 3BIUH 3M7QA 1LKBA 2FOMB 1C5VA 4WMDA 2J4IA 3QN7A 1SQOA 1ZJKA 2QF0A 3MFJA 3KQDA 1NESE 2XWBI 1DWCH 4KTUA 1K1IA 1TGCA 5T3HA 1NU9A 3ZVFA 2FPZA 5HGGA 3URCA 3SJOA 5EXNA 1OS8A 3QZQA 3JZ2B 5IDKA 3S0NA 1LHEH 5G4BA 4H4FA 2Y6TA 3CENA 1TABE 1KLIH 2ZTXA 2EI6A 3PWCA 2TGTA 3LDXH 1TPSA 1ZR0A 2QIQA 3QLPH 2OUAA 1Z6EA 3ZZDA 1A0HB 3GICB 5DK1A 1T8NA 1C5MD 2F9PA 4NZQA 1C5LH 5T6FA 3PLPA 4Y8YA 2ALPA 2F9NA 2WV5A 3BTHE 3HGPA 1GWAA 4AFZA 2F9OA 3K65B 2AGGX 4AB8A 1O2SA 2QCYA 1BTUA 1ZTJA 1MQ6A 1C5PA 3MO9A 3ZZ5A 1PYTD 1CHOF 1AIXH 4OS7A 4FVBA 2ZQ2A 5DGJA 2STBE 2OQUA 1BRBE 3ATWA 9LPRA 2ZA5A 3CS7A 2HVXA 1HAXB 3SU2A 1MAXA 1FY1A 3VB6A 2VWNA 2O8MA 5JBBS 3C27B 3EA9A 1GJBB 5A0AE 1UHBA 4BAKB 1K1OA 1HAHH 2R2WU 3PMJA 3LGUA 3MU5A 3VB3A 4TPYA 3C1KA 3SU5A 3SV2H 2ULLA 4FUIA 1G3DA 1P2IA 1KSNA 1AKSA 1KXBA 4U30A 2ZI2H 3SORA 4XDEA 2ALVA 1C2HA 1F0UA 4KTCA 4UEHH 1DM4B 4BTUB 1ELGA 3SQEE 4X1QU 1GBTA 1OWEA 4M7GA 1O2NA 3RM2H 2XBXA 2GT7A 1O5DH 1DITH 2O8WA 1F5LA 2VGCB 3UOPA 2NWNA 1CE5A 4ABIA 2BD8A 1KTSB 4GUXA 1WBGB 1RD3B 3EDXB 1GJ4H 2ZU5A 4HTCH 4KELA 4X0WU 1FLEE 1QQ4A 1K9OE 2F83A 3LONA 4RSPA 1KXCA 2AIPA 1O3AA 3PO1C 2I6SA 1QGFA 4NIWA 5BPEA 4DIHH 1SGDE 2FOGA 2Y7ZA 2ZFQH 1YLCA 3OSYA 2A7HA 2SGFE 1W2KH 1NRRH 2A45B 1DSTA 4H42U 3VB4A 3BG8A 3M37A 2HOBA 3UNQA 3RXVA 1UTOA 5HYOA 2ZHEH 1BRCE 1TPPA 1HAOH 4K5ZA 1QL7A 1IQLA 1F2SE 1YP9A 4JCNA 4OS2A 2PSYA 2OCVB 2A4QA 1QRWA 1F92A 1W7XH 4X1NU 1ELDE 2C8XB 1PPCE 3GY4A 1DXWA 1DUEA 1GVLA 1EXFA 1EKBB 1IQEA 4VGCC 4HI3A 1GPZA 2BY8X 3A8CA 1GDUA 3GYLB 3MU8A 2WPJS 1MTVA 2BLWA 2PFEA 1P3EA 3MH5A 1SQTA 1G3EA 2Y7XA 1T31A 2ZFRH 3RMOH 3SNBA 1ZGVA 2ZGXH 2BDIA 3PO1B 3BIVH 3E1XB 1P2KA 3GISB 3STJA 1EOLA 4ZH8A 2C93B 1LCYA 3UREA 1XXFA 1AI8H 3QK1A 3UQVA 1GHAG 1ZSLA 2TIOA 3UY9A 1MUEB 5AFYH 2ZO3H 4DOQA 5JB8S 1C2LA 1RXPA 1UTPA 1MMJN 2BY7X 4WWYA 3TNSA 3S69A 2UUFB 4U32A 4MG3A 3SI3H 2ZCHP 5CE1A 5LPEA 2C4FH 1L4ZA 2RA0A 1FNIA 5L2ZH 2QGRA 1SSXA 2ZTYA 1O36A 1O3HA 1ZRBA 1A5HA 5DO4H 2GCHF 4F49A 2F9VA 1GGDB 3SUFA 1PFXC 1K1JA 1LQEA 3PV4A 1S0QA 4X6PA 3RXBA 3BF6H 3U1JB 3LC5A 2VIVA 2BDYA 2UUYA 3RLWH 3SW2B 3ZVAA 1GI2A 3ATMA 3GY7A 4CRCA 3RMMH 2A4RA 1UCYE 1XUJA 3RLYH 3SU1A 1C1QA 2HPQH 5E0JA 4TPIZ 1E0FD 3KNXA 1C2EA 3TJOA 3V7TA 5AHGH 2ZTZA 1NS3A 1NT1A 3TITA 1GHZA 4RKOB 1CT0E 1JIRA 1MH0A 3BTME 4NA8A 3T62A 4D76A 1LVBA 4R0IA 1IAUA 1NRQH 2H6MA 1XXDA 2Y5FA 1O3PB 1EAXA 1S6HA 3E0PB 1A2CH 3GCTF 1H9IE 3MH4A 2XXLA 5BRRE 2Y5HA 1PPHE 4DVAU 1A0LA 3VPKA 1RTLA 4IMZA 1BT7A 1BTZA 5A8ZA 2ZZUH 4K69A 3RXKA 1J9CH 3A7TA 4Y8ZA 5DG6A 4BANB 4X8UH 2AS9A 4JYVH 1A5GH 2GCTB 3QUMP 1WQVH 2R0KA 3FVFB 4K8BA 5AVDA 3RMNH 3ELAH 2G5VA 1GI1A 1YCPK 4AORA 1ABJH 1SR5C 2F9BH 1O3EA 2VIOA 2BDHA 4GAWA 2P8OB 5ETXA 1Q3XA 3PMHB 1TOMH 4DG4A 3E0NB 1A3BH 1C5WB 1GBFA 1TYNA 2IN2A 4ABEA 1NFYA 4XBDA 1RIWB 1IQHA 4GSOA 3SN8A 4MNYA 1CSOE 1NRNH 3LPRA 1P2MA 1QB1A 1C1WH 1O3MA 3H7TA 7GCHG 1H8IH 3HK3B 3BTDE 4ZUHA 5GXPA 5EXMA 1VITH 2BD3A 1EJNA 5A8YA 5FXLA 5LH8A 3KL6A 1NFXA 1F0SA 2ZHDA 3P6ZB 1O5CB 5GJ4B 1HAZB 1L1GA 1A61H 1AVGH 3W95A 2VGCC 1G9IE 1FAXA 2BY5X 4FUCA 1EZUC 2PUQH 3LC3A 1C5NH 2BMGB 1QBOA 2I6QA 5E2PA 1Y3WA 3EYDA 1YPHE 1OX1A 3AASA 2VVCA 4ABGA 1PPZA 1XUKA 1GI7B 1W0YH 2Z7FE 1HJAC 1MU8B 1MU6B 5C20A 3ZV8A 1QURH 1O5GH 1BZXE 2VVVA 1Z8GA 1T8OA 1TNJA 1P01A 2CV3A 5JPMH 3QDZB 3TJNA 2SGDE 1A4WH 3NZIA 8KME2 2VIQA 3V13A 1DY9A 2FP7B 2FOBA 1ZHRA 3FZDA 1H4WA 4ISLA 1CO7E 3LH1A 1HAIH 2J94A 2YNAA 3F9HA 4AGKA 4XBCA 2PLXA 3KQCA 1SOTA 3ZZAA 2HLCA 1EB2A 5EOKA 5A09A 2OLGA 1FQ3A 3TVJB 5K0HA 3ATLA 1SBWA 1NZQH 1U6QA 3OYPA 3VXEH 5DJ7A 1GBEA 2BY9X 2EI8A 2FS9A 3F9GA 3T26A 1TNHA 1W3CA 1H1BA 1GJ9B 2VIWA 3SV9A 3HATH 3M61U 4GHTA 1N1LA 4OS6A 3UIRA 5T6DA 2BD9A 1GCTC 3HPTB 2Z3DA 2OBOA 2RA3A 2O8UA 1O2WA 4X6NA 2NU2E 3SUEA 1IHSH 1C1PA 1MZDA 1AY6H 1B7XB 1QL8A 4X8TH 4IMQA 4HZHA 2A32A 2CMYA 4DCDA 3KGPA 3ZZ7A 2FLBH 5DP7A 3M35A 2Z9JA 1EZXC 1PQ8A 4FUHA 5C1UA 3BTEE 2PW8H 4D7FA 1CT4E 4B2BA 1FY5A 2WPKS 5EQSA 4KKDA 1HDTH 1GG6B 1G37A 1NN6A 2Z9LA 1JMOH 1MQ5A 3A86A 4ESTE 4JZEH 3D62A 2ZCLP 3JZ1B 2B8OH 2FWWA 3RU4E 1OP2A 3SQHE 1GI5A 1MCTA 1RGQA 3ZVBA 3LGTA 2GV7A 8GCHG 3ZVEA 2TGAA 4YO9A 3SNDA 3IG6B 1PQ5A 3NPSA 4Q7XA 2O9QA 1TPAE 3TK6A 3P8OA 1P9SA 1VJAU 3R3GB 4K8YA 4ZXXH 2FI3E 2FOHA 3TK9A 3TGKE 1QBNA 1BCUH 2GZ7A 1TA6A 2GP9B 1MTNB 3ESTA 1HJ9A 1KY9A 1X7AC 1UCYK 2ODQA 5TCAA 4AYYB 2J92A 1GHXH 5CHAC 1J14A 3RXHA 1IHTH 2UUKB 3RM0H 2G4UA 4JMYA 3STIA 1C5SA 3FP7E 3GCOA 4NFEA 2HRVA 1AU8A 1TMBH 3TJUA 4CR5A 5FHTA 2H9TH 3FFGA 1KXEA 1FY4A 3E90B 1C5XB 2R3YA 4I8JA 1ETTH 5IYTA 1GI9B 2ANKH 2LNCA 1Z8JB 1O5BB 3SV6A 1UVPA 1AFQC 1EPTA 1GJCB 4YLQH 2A7JA 2PWXA 2BLOA 4LZ1H 1FPHH 2CN0H 3SGQE 4ZHMU 3D49H 3SU0A 4X8SH 4Y0YE 1RTKA 4ZHAA 2P8OC 3VB5A 2RCEA 1JXPA 1SFQB 1SLUB 1SGIB 1OWDA 1AMHA 4WF8A 2PGQB 1V2QT 2VU8E 3NWUA 1GMHF 1MBMA 3ZZ9A 2WPMS 4D8NA 1KXDA 2Q6GA 4ABDA 2H9HA 4NWLA 1EASA 2GCHG 1W13U 3SUGA 1H9LB 2FXRA 2ZPSA 3V3MA 1NPMA 4J2YB 2EA3A 4ABFA 1Z1JA 1C2JA 5EQRA 4AZ2B 4AG1A 5DP9A 1CA8B 2P59A 1VITG 1ZSJA 1D3PB 4ZKSU 5HXFA 1D3DB 4H6TA 1ZOMA 2DUCA 3EA7A 1O35A 3T28A 2BB4A 1AD8H 1ZPCA 3QWCH 4INLA 2BDBA 1NROH 1ELTA 2WPLS 1TRYA 2ZFPH 4ZAEA 3SU3A 1UVUH 1VITF 2HNTC 1P2JA 1AFQB 3SHAH 3MI4A 2FEQH 6LPRA 1UMAH 5EG4A 4JZFH 3ZZ3A 3MYWA 1PPEE 1G3BA 1G2LA 2BOHB 2VWOA 5FPYA 1J8AA 3S7KB 1CA0C 1MTUA 2Z9GA 2O8LA 2ZDMA 4Z6AH 1HFDA 1K22H 3O8CA 4LZ4B 1GMHG 2D8WA 2LPRA 1IQKA 2AMDA 3RXMA 1EB1H 1O3KA 2OINA 1TE0A 2SGEE 2ZDVH 2SGQE 1O2JA 2EEKA 4FU8A 1BMMH 2ZDAH 3PTNA 1BB0B 1UTQA 3TPIZ 1HNEE 1MKWK 1E37B 1HAPH 5A8XA 4E06H 4I8KA 1ANBA 1EP6A 4I31A 4A1TA 3P8GA 1P06A 3HK6B 3B8JA 2FOFA 4MPUA 1C2GA 1A5IA 3EE0B 1EOJA 1C2IA 3AAUA 2A7CA 2K1QA 1ELFA 2CHAC 1T4VH 1IQMA 1D3TB 3ENSB 3E91A 2QC2A 3LGVA 1CT2E 1SL3A 1BRUP 1C1SA 2QXGA 1CA0B 1QJ6B 2PUXB 2BVXH 1O3OA 1O2PA 3NK8A 4ISHH 3K6YA 3DUXH 3H7OA 1ZHMA 3URDA 4DT7B 6GCHG 1DDJA 2C8WB 3A8DA 1YLDA 4B71A 2J38A 1BJVA 1HJAB 3B9FH 3RXLA 1ELBA 1FN6A 3UR6A 4WXIA 1CHOG 1HAVA 1O33A 1HPGA 3RXIA 5FBIA 2FYQA 2YNBA 4DGJA 4AN7A 1WYKA 1YBWA 3G01A 1O37A 4MPWA 3TGIE 1GG6C 3T2NA 2FOAA 1G32B 1YGCH 1DANH 2PKSB 3QGNB 4VGCB 1XUFA 1XM1A 2AH4X 1O2LA 4UFFH 1ZTLA 1V2UT 4BTTB 1TAWA 2Z9KA 1P8VC 3F68H 1ETSH 2D26C 1C1RA 1SPJA 2OBQA 2VNTA 1W10U 5F6MA 4UD9H 1OWHA 2AMPA 2BVSH 4YZUA 3ZZ8A 1ORFA 1ETRH 2Y81A 1ELAA 1S85A 3F6UH 1EATA 1PPGE 4Z0KA 2JH0D 3MNCA 3RXGA 4FVDA 3P17H 5C2ZA 4DURA 1DWBH 1RFNA 1V2WT 1L1NA 1Y5AT 2PKAA 1HV7A 2ZPRA 4GVUA 4OS4A 1HXEH 3SBKA 3BG4C 4MNXA 1THRH 4GPGA 4ZHLU 3TH3H 1YKTA 1E35B 1HYLA 2FO9A 4INHA 5DP6A 2ODYB 2P3UB 4ZKRU 4D9RA 3P95A 1BHXF 4AFSA 3T27A 2ANYA 2NU4E 5HM9A 4FUFA 1F5RA 3SU6A 2ZGJA 1SOZA 1FAKH 2ZHFH 1OOKB 3PWBA 2AMQA 3KQBA 1L4DA 3PM3A 4IN2A 1FY8E 2STAE 1ZJDA 4K1TA 1DE7H 1O5EH 2C8ZB 1RS0A 5F8ZA 1O2TA 1K28D 1J15A 3L6PA 4YOGA 4IGDA 1E36B 2A5IA 1YPMH 2QYIA 1VCQA 1ZTKA 1GJDB 2BX4A 1SB1H 2ESTE 1AHTH 2ZGHA 4AOQA 2ZDNA 2QN5T 3GY2A 1PPFE 1TMTH 2P3TB 2G81E 3O8DA 2QA9E 2XBYA 2WUBA 1TWXB 2BZ6H 2BDAA 4I8LA 2F3CE 2P95A 1QRZA 1KDQB 1ID5H 2GZ8A 4ZKNU 1CVWH 1IQGA 2V3HH 2AIQA 8LPRA 3BTQE 1BOQA 4E7NA 3RU4T 5DP4A 1V2OT 5FX5A 3U1IB 5T6GA 1D4PB 4UE7H 1BTYA 3GY8A 3FANA 5DP8A 2UUJB 2F9UA 4CRAA 1UK4A 1D9IA 1GGDC 2XWAA 1RJXB 3M5OA 4IW4E 2OC8A 1HUTH 4CBOA 1W11U 1O3NA 2VIDA 1JBUH 1DX5M 6ESTA 1SLXB 3VGCC 1UVOA 4SGBE 3MU4A 2ZGCA 1CU1A 4Y6DA 2AFQB 2B0FA 2GMTB 1D3QB 1RIWC 2XRCA 3QTVH 1DLEA 3DT0H 1TRNA 1H8DH 1BDAA 1TNKA 1B0EA 2A4OA 2PTCE 4MPXA 1DVAH 3AW0A 3I78A 1ZSKA 1HIAA 4ISIH 2ZC9H 3RXAA 4Y76A 4CBNA 3RC4A 1TB6H 2W3IA 1UCYH 1TRMA 5C5OA 5FBEA 2XBWA 1JIMA 2BLVA 2FOEA 1ZMNA 1GI4A 2H5DA 4GCHF 1K1MA 3MH7A 1S84A 4CRFA 4BAHB 4FU7A 1VZQH 3MU1A 5JB9S 2QF3A 3DHKH 3A7ZA 1GMCF 1S6FA 3PLBA 4K3JA 3I29A 4ABJA 1TQ7B 1IQFA 4MTBA 1UTKA 6CHAC 4NZLA 2G52A 1AWHB 4CRDA 4I8HA 3ZZ6A 3LIWA 3ZZBA 2G4TA 1P2QA 3SNCA 1QRXA 1SC8U 3VGCB 1ARCA 5LGOA 1O2GH 1K1PA 2ASUB 3BEFB 4X1PU 3F9EA 1EJAA 2EI7A 3SO3A 1YPEH 3EQ0H 5EPYA 2VB0A 4MNWA 1MZAA 5L2YH 2NU3E 3EA8A 4XFQA 1NRPH 2HGTH 1OSSA 5DP5A 8ESTE 3R0FA 1TFXA 1XKBC 5K7RA 3FP6E 1O3DA 5GWZA 1YPGH 1GMDG 3RXUA 3P8NA 1QJ1B 1O34A 3M5MA 2SGPE 1BJUA 2YOLA 5EW2H 5TJXA 1GBMA 4YT6H 1P2OA 1FXYA 1IQIA 1P11E 1VR1H 4TY6A 4GCHG 2QXIA 2A2QH 2J9NA 4YT7H 1K21H 1SHYA 3SU4A 3PB1E 1B5GH 5A0BA 1FUJA 3M3VA 3NKKA 2Z9IA 2GD4B 3S9CA 4A6LA 2CHAB 1MD7A 5F8TA 1SGFA 3D65E 1GBAA 1TGNA 2SNVA 2AEIH 3A8AA 1AO5A 2OQ5A 5C1XA 3U8RH 3UWJH 4JYTA 1LVMA 2JETC 2OP9A 1LPKB 1SGEE 4AG2A 2BDGA 5E8EH 1SGNE 1MCVA 1A0JA 1CGJE 2PKAB 1YC0A 2BY6X 1FN8A 1GHAF 1O3FA 1JOUB 3S9AA 2HPPH 4A7IB 1NM6A 4YLUA 1GI0A 1T4UH 2C3SA 4B2CA 1T8LA 4BAMB 4X2YA 1O2RA 3UNSA 1W14U 4DJZB 4KP0A 2FM2A 1PJPA 2PTNA 1C1OA 1N8OC 1ZPBA 1BTXA 1H9HE 1ANCA 5AF9H 3LOXA 4JK5A 3KF2A 1OWJA 5J4QA 1SLVB 3DFLA 2VJ1A 1O3JA 1QB9A 1C4V2 1Q2WA 4NIXA 3KHVA 4WH6A 4Q7YA 1C1VH 3M3TA 3RXJA 1VJ9U 1S81A 1O2VA 5JDUB 2ZU4A 1MKWH 1KDQA 1OP0A 2Z3EA 2XC4A 3GOVB 2V35A 3MO3A 1O2OA 1SG8B 2GX4A 2XNIA 5TCCA 4YOIA 3MNXA 1DY8A 1TA2A 2GGVB 1V2MT 1EPTB 1THPB 1M9UA 2ZQ1A 4AX9H 5A2MH 1O2KA 4I32A 1GJAB 4Y7AA 1YPJH 4UFDH 1O30A 1O3IA 3Q3KA 2UWPA 3BG4B 4B75A 3KN2A 1HRTH 3PROA 1C5YB 1GHWH 4U2WA 5F03A 1AB9B 1XUGA 3UTUH 3FAOA 1ABIH 2WPIS 1UTJA 1GDQA 1GI6A 9ESTA 1YCPM 1P3CA 1BMLA 3MNBA 1NRSH 2BHGA 1GL1A 4TWYA 3M7TA 1FIWA 1P10A 2ZFFH 1P02A 4CRGA 1BTWA 3K9XB 3SNAA 1LHFH 2BXTH 1ANDA 1LPGB 1UVTH 5C67A 1P03A 3CP7A 2D2DA 4CH2B 3AVZA 2H9EH 3PTBA 4WY3A 2P16A 2V0BA 2Z94A 1TBRH 2M5TA 2C90B 4O97A 4X2WA 1KYNA 1GHYH 1QA0A 1WU1A 4OS1A 1GVZA 4NIVA 2BQ6B 3LKWA 4BNRA 3VB7A 1HXFH 1ANEA 4FUBA 1F7ZA 1S83A 1P04A 3RXFA 5SGAE 1F5KU 1TMUH 1Y5BT 5EU8A 3SI4H 6CHAB 1BBRK 2BLQA 4MPVA 4HGCA 4AB9A 4ASHA 4E7RG 3P92A 2FODA 4I7YH 1GBHA 1WV7H 2A4GA 1JRSA 3BEIB 1W12U 5JYIA 4X1RU 1TGTA 2CJIA 1O3BA 3A83A 4ABHA 2FS8A 2G51A 3QZRA 1DT2A 1C1MA 2FI5E 3A88A 4K2YA 3ZYEA 3UOUA 1V2VT 4IS5A 1LDTT 3O8RA 1MBQA 2BXUH 4AYVB 2GKVE 2VIPA 4FUGA 3RXCA 1EAUA 2R2MB 1O5AB 3OY6U 1TGBA 5HM2A 1TNGA 1SGCA 1XX9A 1VGCC 2ZU3A 1HJ8A 1QTFA 5DPAA 3PMBB 1LVYA 2GZ9A 2A31A 4BAOB 1BTPA 3L33A 1BA8B 1GHVH 3GYMA 5JBTA 4K60A 2XBVA 1SMFE 1SI5H 3OTJE 3A8BA 2J95A 1OPHB 1YPKH 1Y3UA 1ESTA 2TGDA 3LT3A 2FOCA 2H1UA 1MKXH 1OXGA 1UJ1A 2P3FH 4A92A 4J1YA 4X1SU 1TNIA 5GCHG 1QJ7B 5GIBA 2BVRH 1OP8A 2FI4E 1V3XA 3QO6A 3QX5H 3BSQA 1BRAA 2R9PA 3ZVDA 7GCHF 3T29A 2TPIZ 2JETB 1SFIA 1GI8B 3MOCA 2JKHA 4OGXA 3L3TA 2SNWA 4ZXYH 1C2DA 1THSH 1C5QA 3V12A 1QB6A 1YCPH 1NY22 1C5OH 3ATIA 4NA9H 3E16B 1W0ZU 1LQDB 1Y3XA 1N6YA 2V6NA 1O2IA 1EQ9A 2Q6DA 3A7YA 3A80A 2CF8H 2R0LA 1FV9A 4ABAA 3S7HB 3RXTA 1DPOA 1ELEE 3KIDU 1VGCB 2ZHQH 1B0FA 1YYY1 1K1LA 1GBLA 3WY8A 1AUJA 1P57B 1O31A 1SHHB 4O3TA 2G8TA 2IPHA 4A5TS 3RXQA 4A1VA 3MTYA 2V3OH 5CMXH 4IC6A 1LTOA 3PYHA 3SUDA 2QY0B 2ZFTA 2GTBA 1GBDA 2DE8A 3ZVGA 4UONA 1FZZA 4AFUA 1SVPA 1CQQA 1G2MA 5HMAA 1WCZA 1A1RA 4KTSA 2PSXA 1LKAA 1LPZB 2Z6BD 2A0QB 5CHAB 3BN9A 1CGHA 1V2LT 2HALA 2GV6A 1K2I1 1Y3VA 1BQYA 1MTNC 5J4SA 2B9LA 4FXGH 4DW2U 2ANMH 1AB9C 4CHAC 3GCHB 1AFEH 2BD2A 3W94A 1W7GH 2SGAA 1IOEA 3M5LA 5C3NA 1O3GA 4KGAA 2BQ7B 1Y59T 4LOYH 1ZHPA 3SJIA 3HKJB 2ODPA 1V2KT 4YTAA 4HFPB 2QV1A 2BQWB 3A89A 4MQAA 2ZWLH 5B6OA 7KMEH 2AGEX 2BDCA 4MNVA 1HB0B 4MVNA 3U98H 1ACBE 1P09A 1TIOA 3GDVA 1ELVA 1DFPA 2FTMA 1AZZA 1YM0A 3RU4D 5I25A 2VH0A 1P0SH 1SGQE 1FI8A 5FPSA 1O2ZA 1YPLH 1EAWA 1NC6A 3CS0A 2THFB 1BUIA 3Q3XA 1GHBG 4WVPE 3RDZA 3BTGE 4Y10E 1AE8H 2BD7A 4NWKA 1SQAA 4O3UA 4Q80A 1KTTB 1O5FH 5C1YA 1LHDH 3SV8A 1SGYE 1EUFA 1EJMA 1O32A 4OS5A 4Y71A
chains in the Genus database with same CATH superfamily
2GVFA 3MO6A 2FYRA 1INCA 4Y7BA 1O2HA 1LO6A 2WYJA 1V2NT 2AERH 2JDID 2OTVA 3LJJA 1UTMA 3F2GA 3U69H 3ATKA 2WPHS 1UVSH 3GS9A 3QTOH 4GLYA 3UUZA 5EW1H 1E1QD 2EC9H 1TGSZ 3TNTA 3M36A 2HWLB 4E05H 1AGJA 1XUHA 4ABBA 3ZVCA 1GL0E 3N7OA 3BTTE 5I46H 2ZDLA 1TX8A 3A82A 3DA9B 4GHQA 3RXSA 3LGIA 1QY6A 1AZ8A 2GDEH 2UWLA 3EE7A 4ZMAH 4NCYA 2NU1E 1ZZZA 4ASUD 3RC6A 1HAGE 3TIUA 1L0ZA 1HAYB 2JH6D 1RRKA 1S0RA 2BX3A 2C8YB 1OKXA 2WPDD 3VEQB 5FCKA 1C4U2 1GBBA 1V2JT 3A85A 3RMLH 2OC7A 2P94A 4MDSA 3UPEA 2QXHA 3MU0A 4TWWA 4QT8C 2SFAA 3A87A 1RTFB 5EGMA 2TGPZ 2H5CA 1ELCA 3Q3YA 1O2QA 2BOKA 1HGTH 4X2XA 1LVOA 4UDWH 1DICA 3UAIC 2RDLA 1ESBA 3MWIU 1C5ZB 1O3LA 2R3UA 3LJOA 5JBCS 1Z1IA 2Z3CA 3UQOA 2IOTA 2ZKSA 1OYQA 1PQAA 2JH5D 4U01A 1BIOA 3HGNA 1XVMA 3ZZCA 1UK3A 1C4Y2 3RP2A 1FY3A 1GBIA 1UK2A 5FAHA 1MD8A 2W7SA 5F8XA 1NO9H 8GCHF 1GDNA 5FX6A 1QFKH 2W3KA 1O2YA 2PGBB 1AQ7A 2ZGBH 3M3SA 4I33A 2ZF0H 1CBWB 1AWFH 1S82A 2Q1JA 3A84A 4XBBA 4Q2KA 4X2VA 3ZZ4A 4NFFA 4XE4A 5E2OA 1ZMJA 2GMTC 5E0GA 1YF4A 2DE9A 2UWOA 3MMGA 3U8OH 1O3CA 1VCWA 1D6WA 3A7WA 3SOSA 2WYGA 1EZSC 1BTHH 1C5TA 3SJKA 3PV5A 1EP5A 2ZPQA 2QXJA 2ZU2A 3E8LA 3F1SB 2F91A 1WQSA 1MAYA 3KEEA 1SGFG 2PKSC 1ZRKA 2Q6FA 3HKIB 1FJSA 3PRBA 2XYAA 1OWKA 3MH6A 1EFRD 4DY7B 1N6XA 1S5SA 2ZHWH 2B5TB 1YPHC 1Z6JH 4RKJB 3GDUA 1SLWB 1UHBB 4JZ1A 1O2UA 2OC1A 4NG9H 4WXVA 2KAIA 2VWLA 3P8FA 5DKMA 1MTSA 2O8TA 5JBAS 1VCPA 2FX4A 1O39A 1P9UA 3ITIA 5EPNA 1WSSH 1IQNA 2WSSD 1SQRA 3GCTG 2OK5A 1Y8TA 4B2AA 4FUJA 3VFEA 3BTWE 1QL9A 1TNLA 4CH8B 1D6RA 3LH3A 5E0HA 1IQJA 5FPTA 2XC5A 1BBRH 1P2NA 4XSKU 1G30B 1XUIA 1ESAA 3SHCH 4IBLH 1NFUA 1DS2E 3UR9A 1N8OB 5EXLA 2J34A 1GVKB 1QQUA 2W7UA 2ZFSA 1JWTA 1TX7A 3MHWU 1QR3E 3TH2H 1FPCH 3RUOA 3VG8A 2G5NA 3NXPA 2G00A 1EZQA 1DLKB 1TPOA 2VH6A 2WUCA 3SV7A 5ABWA 4CR9A 2HNTE 1EAIA 7LPRA 4BAQB 1BMNH 1KLJH 1KXFA 4LXBH 3FZZA 2A2XH 3DSOA 3U8TH 2BD5A 4WJG2 3PLKA 1LMWB 1O0DH 1C2MA 1XMNB 2FLRH 4NIYA 5C5NA 4R8TB 3SNEA 2GCTC 2TBSA 2Y80A 3IWMA 4Y79A 3NCLA 4FETA 4Y8XA 4CRBA 3I77A 1LHCH 4FU9A 1MKXK 3B23B 4CREA 1E38B 2XC0A 3GDSA 4NA7A 4SGAE 4JZDH 1L1JA 1V2RT 3RXRA 1F0TA 1G36A 2A5KA 1UTLM 4JK6A 5LPRA 4K1SA 3LGWA 1GJ8B 1P05A 2OC0A 4DIIH 3VXFH 1O38A 3GCHC 1FONA 4I8GA 1FIZA 1HAVB 3A7XA 4JZIA 4WMFA 1V2PT 3A7VA 2G55A 2ZNKH 3E6PH 4ISOA 4BXWA 3MNSA 2HNTF 1GHBF 1HBTH 1WOFA 1V6DA 1Z7KA 2XW9A 1WTGH 2W26A 5H4IB 1KXAA 4INKA 4K1EA 3KCGH 3TK5A 6GCHF 4IC5A 1JRTA 4THNH 1NU7B 2D1JA 1HCGA 4FUEA 4JYUH 3D23A 2ZIQH 3TH4H 4PROA 1CHGA 1QNJA 1AVWA 2BZAA 2KAIB 1J16A 3RXPA 4D7GA 2GDDA 1QIXB 2BYAX 1BMAA 2KR7A 5EQQA 1C1UH 3ZYDA 2H2ZA 3S9BA 2CF9H 4UFEH 3OX7U 1TX6A 2FDAA 3UFAA 2J2UA 4AGJA 4TYDA 3SGAE 1T32A 4UFGH 5L30H 3OU0A 2ZEBA 1P12E 4RI0A 1TONA 5ESTE 2Y82A 1EX3A 1TQ0B 1Z8IB 2XCFA 3GCNA 3RXDA 3DD2H 3H5CB 2L6OA 2OXSA 4RT1A 3UWIA 1C9TA 1QBVH 1QHRB 3TGJE 2ZDKA 1Z8RA 3Q76A 4B76A 1GJ7B 1J17T 2WINI 1SGRE 3GY3A 3PMAB 1A46H 2AHME 1PQ7A 4LK4A 2CXVA 3IITA 3TJVA 1ZLRA 4O9VA 2RG3A 3SZNA 1GBJA 1A3EH 1GBCA 1GCTB 1CBWC 2PV9B 2GT8A 4Y11E 1HIAB 4ZROA 3SJ8A 5LPFA 1CGIE 3RXEA 3BEUA 1C5UA 2A1DB 2JJ2D 4B1TA 3M7UA 3TU7H 4B74A 1Y3YA 1T7CA 1V2TT 5AFZH 4BTIB 4F4OC 1AVXA 1C1NA 2ZP0H 4P02A 3E3TA 1GMDF 3LU9B 1WUNH 4OGYA 1MTWA 3T5FH 2J98B 4TY7A 2FZZA 3EAJA 4XOJA 1ZPZA 2BD4A 1K1NA 3M5NA 4O03A 1GJ5H 2PR3A 5ESBA 4ISNA 1GI3A 2FIRH 4D9QA 2B7DH 1SGPE 4AFQA 1UTNA 1DSUA 2ANWA 5HIYA 3Q00A 3PRDA 2A5AA 3BTFE 2RFKC 1KLTA 2XCNA 1E79D 3O8BA 1E34B 1BHXB 2BM2A 2ZCKP 1OYTH 3KYFA 1OWIA 2AYWA 3NUMA 4RN6A 5DP3A 2AGIX 1DUAA 1YWUA 5CHBA 2FMJA 2OD3B 1C2KA 1TALA 1T8MA 1C2FA 1O2XA 5PTPA 1GJ6A 1GMCG 1AE5A 4ACBA 1KIGH 3KQEA 3EGKH 1XKAC 5T1VA 3SGBE 1AKSB 3UNRA 2ZU1A 4YM9A 3RXOA 3SJ9A 1DOJA 4X6MA 4NSYA 1NFWA 1C5RA 1Q31A 1TOCB 4BOHA 3OY5U 4YOJA 1TLDA 1TBQH 2BTCE 1L2EA 1BITA 3GY6A 2XTTB 1HLTH 4X8VH 5EODA 2WV4A 2YMSC 1TBZH 2ILNA 2IJOB 2KCYA 3FP8E 3RC5A 1SGTA 2TRMA 5GCHF 1AN1E 1FMGA 4B73A 1ZYOA 1WAYB 3ZV9A 3DFJA 4WH8A 1LHGH 5FCRA 1DWDH 1QCPA 2W5EA 2VVUA 3K2UA 3A81A 1XVOA 4BXSA 1A7SA 1C1TA 1GBKA 1DWEH 2P93A 4IN1A 2CGAA 1W8BH 2Y5GA 2KCOA 1O2MA 3K6ZA 4H6SB 1E1RD 2VINA 3ODDA 1C9PA 3U9AH 4Y0ZE 3GY5A 1ZMLA 1Z71A 2ZG0H 3AAVA 4CHAB 4A1XA 1UO6A 5A0CA 1AUTC 3BTKE 2FX6A 4Q7ZA 3QGJA 1Y5UT 5GPIB 3AW1A 1EPTC 3BV9B 4WMEA 1DXPA 3TLOA 5GDSH 4FUDA 4NSVA 2FESH 4TSFD 1BBRE 3Q77A 1V2ST 3LGYA 4ZKOU 2VWMA 5L6NH 1GCDA 2QAAA 4YESB 2NU0E 2FTLE 1ARBA 1QA7A 2KCAA 2PHBA 4NGAH 7ESTE 3ODFA 4MLFB 4X6OA 2ZECA 3V0XA 1PYTC 3T25A 1F0RA 3P70B 1NTPA 4B6FA 1ZGIA 1WTHD 1PPBH 3F9FA 1FDPA 1G3CA 3BIUH 3M7QA 1LKBA 2FOMB 1C5VA 4WMDA 2J4IA 3QN7A 1SQOA 1ZJKA 2QF0A 3MFJA 3KQDA 1NESE 2XWBI 1DWCH 4KTUA 4TT3D 1K1IA 1TGCA 5T3HA 1NU9A 3ZVFA 2FPZA 5HGGA 3URCA 3SJOA 5EXNA 1OS8A 3QZQA 3JZ2B 5IDKA 3S0NA 1LHEH 5G4BA 4H4FA 2Y6TA 3CENA 1TABE 1KLIH 2ZTXA 2EI6A 3PWCA 2TGTA 3LDXH 4AC9A 1TPSA 1ZR0A 2QIQA 3QLPH 2OUAA 1Z6EA 3ZZDA 1A0HB 3GICB 5DK1A 1T8NA 1C5MD 2F9PA 4NZQA 1C5LH 5T6FA 3PLPA 4Y8YA 2ALPA 2F9NA 2WV5A 3BTHE 3HGPA 1GWAA 4AFZA 2F9OA 3K65B 2AGGX 4AB8A 1O2SA 2QCYA 1BTUA 1ZTJA 1MQ6A 1C5PA 2IJD1 3MO9A 1PYTD 1CHOF 1AIXH 4OS7A 3ZZ5A 4FVBA 2ZQ2A 5DGJA 2STBE 2OQUA 1BRBE 3ATWA 9LPRA 2ZA5A 3CS7A 2HVXA 1HAXB 3SU2A 1MAXA 1FY1A 3VB6A 2VWNA 2O8MA 5JBBS 3C27B 3EA9A 1GJBB 5A0AE 1UHBA 4BAKB 1K1OA 1HAHH 2R2WU 3PMJA 3LGUA 3MU5A 3VB3A 4TPYA 3C1KA 3SU5A 3SV2H 2ULLA 4FUIA 1G3DA 1P2IA 1KSNA 1AKSA 1KXBA 4U30A 2ZI2H 3SORA 4XDEA 2ALVA 1C2HA 1F0UA 4F48B 4KTCA 4UEHH 1DM4B 4BTUB 1ELGA 3SQEE 4X1QU 1GBTA 1OWEA 4M7GA 5C17A 1O2NA 3RM2H 2XBXA 2GT7A 1O5DH 1DITH 2O8WA 1F5LA 2VGCB 3UOPA 2NWNA 1CE5A 4ABIA 2BD8A 1KTSB 4GUXA 1WBGB 1RD3B 3EDXB 1GJ4H 5EJ1A 2ZU5A 4HTCH 4KELA 4X0WU 1FLEE 1QQ4A 1K9OE 2F83A 3LONA 4RSPA 1KXCA 2AIPA 1O3AA 4OM9A 3PO1C 2I6SA 1QGFA 4NIWA 5BPEA 4DIHH 1SGDE 2FOGA 2Y7ZA 2ZFQH 1YLCA 3OSYA 2A7HA 2SGFE 1W2KH 1NRRH 2A45B 2YMSB 1DSTA 4H42U 4RT0A 3VB4A 3BG8A 3M37A 2HOBA 3UNQA 3RXVA 1UTOA 4FOUC 5HYOA 2ZHEH 1BRCE 1TPPA 1HAOH 4K5ZA 1QL7A 1IQLA 1F2SE 1YP9A 4JCNA 4OS2A 2M2AA 3DSPA 2PSYA 2OCVB 2A4QA 1QRWA 3AK5A 1F92A 1W7XH 4X1NU 1ELDE 2C8XB 1PPCE 3GY4A 1DXWA 1DUEA 1GVLA 1EXFA 1EKBB 1IQEA 2K0QA 4VGCC 4HI3A 1GPZA 2BY8X 3A8CA 1GDUA 1SKYE 3GYLB 3MU8A 2WPJS 1MTVA 2BLWA 2PFEA 1P3EA 3MH5A 1SQTA 1G3EA 2Y7XA 1T31A 2ZFRH 3RMOH 3SNBA 1ZGVA 2ZGXH 2BDIA 3PO1B 3BIVH 3E1XB 5FL7D 1P2KA 4Z1MD 3GISB 3STJA 1EOLA 4ZH8A 2C93B 1LCYA 3UREA 1XXFA 1AI8H 3QK1A 1FX0B 3UQVA 1GHAG 1ZSLA 2TIOA 3UY9A 3MQKC 3OE7D 1MUEB 2EQNA 5AFYH 2ZO3H 4DOQA 2V7QD 5HIZA 1C2LA 1RXPA 5JB8S 1UTPA 1MMJN 2BY7X 4WWYA 3TNSA 3S69A 5EJLA 2UUFB 4U32A 4MG3A 3SI3H 2ZCHP 5CE1A 5LPEA 2C4FH 2J5UA 1L4ZA 2RA0A 1FNIA 5L2ZH 5DSFA 2QGRA 1SSXA 2ZTYA 1O36A 1O3HA 1ZRBA 1A5HA 5DO4H 2GCHF 4F49A 2F9VA 1GGDB 3SUFA 1PFXC 1K1JA 1LQEA 3PV4A 1S0QA 4X6PA 3RXBA 3BF6H 3U1JB 3LC5A 2VIVA 2V3MA 2BDYA 2UUYA 3RLWH 3SW2B 3ZVAA 1GI2A 3ATMA 3GY7A 4CRCA 3RMMH 2A4RA 1UCYE 1XUJA 3RLYH 3SU1A 1C1QA 2HPQH 5E0JA 4TPIZ 1E0FD 3KNXA 1C2EA 3TJOA 3V7TA 5AHGH 2ZTZA 1NS3A 1NT1A 3TITA 1GHZA 4RKOB 1CT0E 1JIRA 1MH0A 3BTME 4NA8A 3T62A 4D76A 1LVBA 4R0IA 1IAUA 1NRQH 2H6MA 1XXDA 2Y5FA 1O3PB 1EAXA 1S6HA 3E0PB 1A2CH 3GCTF 1H9IE 3MH4A 2XXLA 5BRRE 2Y5HA 2KX4A 1PPHE 4DVAU 1A0LA 3VPKA 1RTLA 4IMZA 1BT7A 1BTZA 5A8ZA 2ZZUH 4K69A 3RXKA 1J9CH 3A7TA 4Y8ZA 5DG6A 4BANB 4X8UH 2AS9A 4JYVH 1A5GH 2GCTB 3QUMP 1WQVH 2R0KA 3FVFB 4K8BA 5AVDA 3RMNH 3ELAH 2KZ4A 2G5VA 1GI1A 1YCPK 4AORA 1ABJH 1SR5C 2F9BH 1O3EA 2VIOA 2BDHA 4GAWA 2P8OB 5ETXA 1Q3XA 3PMHB 1TOMH 4DG4A 3E0NB 1A3BH 1C5WB 1GBFA 1TYNA 2IN2A 4ABEA 1NFYA 4XBDA 1RIWB 1IQHA 4GSOA 3SN8A 4MNYA 1CSOE 1QZ8A 1NRNH 3LPRA 1P2MA 1QB1A 1C1WH 1O3MA 3H7TA 7GCHG 1H8IH 3HK3B 3BTDE 4ZUHA 5GXPA 5EXMA 1VITH 2BD3A 1EJNA 5A8YA 5FXLA 5LH8A 3KL6A 1NFXA 1F0SA 2ZHDA 3P6ZB 1O5CB 5GJ4B 1HAZB 1L1GA 1A61H 1AVGH 3W95A 2VGCC 1G9IE 1FAXA 2BY5X 4FUCA 1EZUC 2PUQH 3DSGA 3LC3A 1C5NH 2BMGB 1QBOA 2I6QA 5E2PA 1Y3WA 3EYDA 3WWBA 1YPHE 1OX1A 3AASA 2VVCA 4ABGA 1PPZA 1XUKA 1GI7B 1W0YH 2Z7FE 1HJAC 1MU8B 1MU6B 5C20A 3ZV8A 1QURH 1O5GH 1BZXE 2VVVA 1Z8GA 1T8OA 1TNJA 1P01A 2CV3A 5JPMH 2L74A 3QDZB 3TJNA 2SGDE 1A4WH 3NZIA 8KME2 4P00A 2VIQA 3V13A 1DY9A 2FP7B 2FOBA 1ZHRA 1MABB 1H4WA 3FZDA 4ISLA 1CO7E 3LH1A 1HAIH 2J94A 2PP6A 2YNAA 5EJZA 3F9HA 4AGKA 4XBCA 2PLXA 3KQCA 1SOTA 3ZZAA 2HLCA 1EB2A 5EOKA 3KQ5A 2OLGA 5A09A 3N7DA 1FQ3A 3TVJB 5K0HA 3ATLA 1SBWA 1NZQH 1U6QA 3OYPA 3VXEH 2WHXA 5DJ7A 1GBEA 2BY9X 2EI8A 2FS9A 3F9GA 3T26A 1TNHA 1W3CA 1H1BA 1GJ9B 2VIWA 3SV9A 3HATH 3M61U 4GHTA 1N1LA 4OS6A 3UIRA 5T6DA 2BD9A 1GCTC 2JIZD 3HPTB 2Z3DA 2OBOA 2RA3A 2RDEA 5F53A 2O8UA 1O2WA 4X6NA 2NU2E 3SUEA 1IHSH 1C1PA 1MZDA 1AY6H 1B7XB 1QL8A 4X8TH 4IMQA 4HZHA 2A32A 2CMYA 4DCDA 4Q4LA 3KGPA 3ZZ7A 3KYGA 2FLBH 5DP7A 3M35A 2Z9JA 1EZXC 1PQ8A 4FUHA 5C1UA 3BTEE 2PW8H 4D7FA 1CT4E 4B2BA 1FY5A 2WPKS 5EQSA 4KKDA 1HDTH 1GG6B 1G37A 3DCLA 1NN6A 2Z9LA 1JMOH 1MQ5A 3A86A 4ESTE 4JZEH 3D62A 2ZCLP 3JZ1B 2B8OH 2KFWA 2FWWA 3RU4E 1OP2A 3SQHE 1GI5A 1MCTA 1RGQA 3ZVBA 3LGTA 2GV7A 2QE7D 8GCHG 3ZVEA 2TGAA 4YO9A 3SNDA 3IG6B 1PQ5A 3NPSA 4Q7XA 2O9QA 1TPAE 3TK6A 3P8OA 3SYJA 1P9SA 1VJAU 3R3GB 4K8YA 4ZXXH 2FI3E 2FOHA 3TK9A 3TGKE 1QBNA 1BCUH 2GZ7A 1TA6A 2GP9B 1MTNB 3ESTA 1HJ9A 1KY9A 1X7AC 1UCYK 2ODQA 5TCAA 4AYYB 2J92A 1GHXH 5CHAC 1J14A 3RXHA 1IHTH 2UUKB 5C0UA 3RM0H 4YXWD 2G4UA 4JMYA 3STIA 1C5SA 2EY4C 3FP7E 3GCOA 4NFEA 2HRVA 1AU8A 1TMBH 1NBME 3F0OA 3TJUA 4CR5A 5FHTA 2H9TH 3FFGA 1KXEA 1FY4A 3E90B 1C5XB 2R3YA 4I8JA 1ETTH 1NBMD 5IYTA 1GI9B 2ANKH 2LNCA 1Z8JB 1O5BB 3SV6A 1UVPA 1AFQC 1EPTA 1GJCB 4YLQH 2A7JA 2PWXA 2BLOA 4LZ1H 1FPHH 2CN0H 3SGQE 4ZHMU 3D49H 2JJ1D 3SU0A 4X8SH 2HLDD 4Y0YE 1RTKA 4ZHAA 2P8OC 3VB5A 2RCEA 3UB0A 1JXPA 1SFQB 1SLUB 1SGIB 1OWDA 1AMHA 4WF8A 2PGQB 1V2QT 2VU8E 3NWUA 1GMHF 1MBMA 3ZZ9A 4Q63A 2WPMS 4D8NA 1KXDA 2Q6GA 4ABDA 2H9HA 4NWLA 1EASA 2GCHG 1W13U 3SUGA 1H9LB 2FXRA 2ZPSA 3V3MA 1NPMA 3FKSD 4J2YB 2EA3A 4ABFA 1Z1JA 1C2JA 5EQRA 4AZ2B 4AG1A 3H09A 5DP9A 1CA8B 2P59A 1VITG 1ZSJA 1D3PB 4ZKSU 5HXFA 1D3DB 4H6TA 1ZOMA 2DUCA 3EA7A 1O35A 3T28A 2BB4A 1AD8H 1ZPCA 5C0TA 3QWCH 4INLA 2BDBA 1NROH 1ELTA 2WPLS 1TRYA 2ZFPH 4ZAEA 3SU3A 1UVUH 1VITF 2HNTC 1P2JA 1AFQB 3SHAH 3MI4A 2FEQH 2IPQX 6LPRA 1UMAH 5EG4A 4JZFH 3ZZ3A 3MYWA 1PPEE 1G3BA 1G2LA 2BOHB 2VWOA 5FPYA 1J8AA 3S7KB 1CA0C 1MTUA 2Z9GA 2O8LA 2ZDMA 4Z6AH 1HFDA 1K22H 3O8CA 4LZ4B 1GMHG 2D8WA 2LPRA 1IQKA 2AMDA 3RXMA 1EB1H 1O3KA 2OINA 4XRNA 1TE0A 2SGEE 2ZDVH 2SGQE 1O2JA 2EEKA 4FU8A 1BMMH 2ZDAH 3PTNA 1BB0B 1UTQA 3TPIZ 1HNEE 1MKWK 1E37B 1HAPH 5A8XA 4E06H 4I8KA 1ANBA 1EP6A 4I31A 4A1TA 3P8GA 1P06A 2LELA 3HK6B 3B8JA 2FOFA 4MPUA 1C2GA 1A5IA 4M9FA 3EE0B 1EOJA 1C2IA 3AAUA 2A7CA 2K1QA 1ELFA 2CHAC 1T4VH 1IQMA 1D3TB 3ENSB 3E91A 2QC2A 3LGVA 1CT2E 1SL3A 1BRUP 1C1SA 2QXGA 1CA0B 1QJ6B 2PUXB 2BVXH 2GJGA 1O3OA 1O2PA 3NK8A 4ISHH 3K6YA 3DUXH 3H7OA 1ZHMA 3URDA 4DT7B 6GCHG 1DDJA 2C8WB 3A8DA 1YLDA 4B71A 2J38A 1BJVA 1HJAB 3B9FH 3RXLA 1ELBA 1FN6A 3UR6A 4WXIA 1CHOG 1HAVA 1O33A 1HPGA 3RXIA 5FBIA 2FYQA 2YNBA 4DGJA 4AN7A 1WYKA 1YBWA 3G01A 1O37A 4MPWA 3TGIE 1GG6C 3T2NA 2FOAA 1WDIA 5DN6D 1G32B 1YGCH 1DANH 2PKSB 3QGNB 4VGCB 1XUFA 1XM1A 2AH4X 1O2LA 4UFFH 1ZTLA 1V2UT 4BTTB 1TAWA 1H8ED 2Z9KA 1P8VC 3F68H 1ETSH 2D26C 1C1RA 1SPJA 2OBQA 2VNTA 1W10U 5F6MA 4UD9H 1OWHA 3N99A 2AMPA 1VKYA 2BVSH 2F43B 2KCPA 4YZUA 3ZZ8A 1ORFA 1ETRH 2Y81A 1ELAA 1S85A 3F6UH 1EATA 1PPGE 4Z0KA 2JH0D 3MNCA 3RXGA 4FVDA 3P17H 5C2ZA 3OEHD 4DURA 1DWBH 1RFNA 1V2WT 1L1NA 1Y5AT 2PKAA 1HV7A 2ZPRA 4GVUA 4OS4A 1HXEH 3SBKA 3BG4C 4MNXA 1THRH 4GPGA 4ZHLU 3TH3H 1YKTA 1E35B 1HYLA 2FO9A 4INHA 5DP6A 2ODYB 3SZEA 2P3UB 4ZKRU 4D9RA 3P95A 1BHXF 4AFSA 3T27A 2ANYA 2NU4E 5HM9A 4FUFA 1F5RA 3SU6A 2ZGJA 1SOZA 1FAKH 2ZHFH 1OOKB 3PWBA 2AMQA 3CNRA 3KQBA 1L4DA 3PM3A 4IN2A 1FY8E 1WXRA 2STAE 1ZJDA 4K1TA 1DE7H 1O5EH 2C8ZB 1RS0A 5F8ZA 1O2TA 1K28D 1J15A 3L6PA 4YOGA 4IGDA 1E36B 2A5IA 1YPMH 2QYIA 1VCQA 1ZTKA 1GJDB 2BX4A 1SB1H 2ESTE 2VBCA 1AHTH 2ZGHA 4AOQA 2ZDNA 2QN5T 3GY2A 3N7EA 1PPFE 1TMTH 2P3TB 2G81E 3O8DA 2QA9E 2XBYA 2WUBA 1TWXB 2BZ6H 2BDAA 4I8LA 2F3CE 2P95A 1QRZA 1KDQB 1ID5H 2GZ8A 4ZKNU 1CVWH 1IQGA 2KM0A 2V3HH 4I86A 2AIQA 8LPRA 3BTQE 1BOQA 4E7NA 3RU4T 5DP4A 4ACAA 1V2OT 5FX5A 3U1IB 5T6GA 1D4PB 4UE7H 1BTYA 3GY8A 3FANA 5DP8A 2UUJB 2F9UA 4CRAA 4F55A 1UK4A 1D9IA 1GGDC 2XWAA 1RJXB 3M5OA 4IW4E 2OC8A 1HUTH 4CBOA 1W11U 1O3NA 5EIYA 2VIDA 3FO8D 1JBUH 1DX5M 6ESTA 1SLXB 3VGCC 1UVOA 4SGBE 2WZQA 3MU4A 2ZGCA 1CU1A 4Y6DA 2AFQB 2B0FA 2GMTB 1D3QB 1RIWC 2LP6A 2XRCA 3QTVH 1DLEA 3DT0H 1TRNA 1H8DH 1BDAA 1TNKA 1B0EA 2A4OA 2PTCE 4MPXA 1DVAH 3AW0A 3I78A 1ZSKA 1HIAA 4ISIH 2ZC9H 3RXAA 4Y76A 2YMSD 4CBNA 3RC4A 1TB6H 2W3IA 3OEED 1UCYH 5GNDA 1TRMA 5C5OA 5FBEA 2XBWA 1JIMA 2BLVA 2FOEA 1ZMNA 1GI4A 2H5DA 4GCHF 1K1MA 3MH7A 3WWFA 1S84A 4CRFA 4BAHB 4FU7A 1VZQH 3MU1A 5JB9S 2QF3A 3DHKH 3A7ZA 1GMCF 1S6FA 3PLBA 4K3JA 3I29A 1KMHB 4ABJA 1TQ7B 1IQFA 4XD7D 4MTBA 1UTKA 6CHAC 4NZLA 2G52A 1AWHB 4CRDA 4I8HA 3ZZ6A 3LIWA 3ZZBA 2G4TA 1P2QA 3SNCA 1QRXA 1SC8U 3VGCB 1ARCA 5LGOA 1O2GH 1K1PA 1W0JD 2ASUB 3BEFB 4X1PU 3F9EA 1EJAA 2EI7A 3SO3A 1YPEH 3EQ0H 5EPYA 2VB0A 4MNWA 1MZAA 5L2YH 2NU3E 3EA8A 4XFQA 1NRPH 2HGTH 1OSSA 3OAAD 5DP5A 8ESTE 3R0FA 1TFXA 1XKBC 5K7RA 3FP6E 1O3DA 5GWZA 2K8IA 1YPGH 1GMDG 3RXUA 3P8NA 1QJ1B 1O34A 3M5MA 2SGPE 1BJUA 2YOLA 5EW2H 5TJXA 1GBMA 4YT6H 1P2OA 3W1EA 1FXYA 1IQIA 1P11E 1VR1H 4TY6A 4GCHG 2QXIA 2A2QH 2J9NA 4YT7H 1K21H 1SHYA 3SU4A 3PB1E 1B5GH 3F2HA 5A0BA 1FUJA 3M3VA 3NKKA 2Z9IA 2GD4B 3S9CA 4A6LA 2CHAB 1MD7A 5F8TA 1SGFA 3D65E 1GBAA 1TGNA 2SNVA 2AEIH 3A8AA 1AO5A 2OQ5A 5C1XA 1H8HD 3U8RH 3UWJH 4JYTA 1LVMA 2JETC 2OP9A 1LPKB 1SGEE 4AG2A 2BDGA 5E8EH 1SGNE 1MCVA 1A0JA 1CGJE 2PKAB 1YC0A 2BY6X 1FN8A 1GHAF 1O3FA 1JOUB 3NRLA 3S9AA 2HPPH 4A7IB 1NM6A 4YLUA 1GI0A 1T4UH 4ZCNA 2C3SA 4B2CA 1T8LA 4BAMB 4X2YA 1O2RA 3UNSA 1W14U 4DJZB 4KP0A 3ZIAD 2FM2A 1PJPA 2PTNA 1C1OA 1N8OC 2XOKD 3FOAA 1ZPBA 1BTXA 1YY3A 1H9HE 1ANCA 5AF9H 3LOXA 4JK5A 3KF2A 1OWJA 5J4QA 1SLVB 3DFLA 2VJ1A 1O3JA 1QB9A 1C4V2 1Q2WA 4NIXA 3KHVA 4WH6A 4Q7YA 1C1VH 3M3TA 3RXJA 1VJ9U 1S81A 1O2VA 5JDUB 2ZU4A 1MKWH 1KDQA 1OP0A 2Z3EA 2XC4A 3GOVB 2V35A 3MO3A 1O2OA 1SG8B 2GX4A 2XNIA 5TCCA 2QF4A 4YOIA 3MNXA 1DY8A 1TA2A 2GGVB 1V2MT 1EPTB 1THPB 1M9UA 2ZQ1A 4AX9H 5A2MH 1O2KA 4I32A 1GJAB 4Y7AA 1COWD 1YPJH 4UFDH 1O30A 5KECA 1O3IA 3Q3KA 2UWPA 3BG4B 4B75A 3KN2A 1HRTH 3PROA 1C5YB 1GHWH 4U2WA 5F03A 1AB9B 1XUGA 3UTUH 3FAOA 1ABIH 2WPIS 1UTJA 5IK2D 1GDQA 1GI6A 3FN8A 9ESTA 1YCPM 1P3CA 1BMLA 3MNBA 1NRSH 2BHGA 1GL1A 4TWYA 3M7TA 1FIWA 1P10A 2ZFFH 4HG6A 1P02A 4CRGA 4DT4A 1BTWA 3K9XB 3SNAA 1LHFH 2BXTH 1ANDA 1LPGB 1UVTH 5C67A 1P03A 3CP7A 2D2DA 4CH2B 3AVZA 2H9EH 3PTBA 4WY3A 2P16A 2V0BA 5C94A 2Z94A 1TBRH 2M5TA 5CDFE 2C90B 4O97A 4X2WA 1KYNA 1GHYH 1QA0A 1WU1A 4OS1A 1GVZA 4NIVA 2BQ6B 3LKWA 4BNRA 5B6LA 3VB7A 1HXFH 1ANEA 4FUBA 1F7ZA 3PV2A 1S83A 3F2FA 1P04A 3RXFA 5SGAE 1F5KU 1TMUH 1Y5BT 5EU8A 3SI4H 6CHAB 1BBRK 2BLQA 4MPVA 4HGCA 4AB9A 4ASHA 4E7RG 3P92A 2FODA 4I7YH 1GBHA 1WV7H 2A4GA 1JRSA 3BEIB 1W12U 5JYIA 4X1RU 1TGTA 2CJIA 2QF5A 1O3BA 3A83A 4ABHA 2FS8A 2G51A 3F0PA 3QZRA 1DT2A 1C1MA 2FI5E 3A88A 2J98A 4K2YA 3ZYEA 3UOUA 1V2VT 4IS5A 1LDTT 3O8RA 2F4LA 1MBQA 2BXUH 4AYVB 2GKVE 2VIPA 4FUGA 2XNDD 1EAUA 2R2MB 1O5AB 3RXCA 2CK3D 3OY6U 1TGBA 5HM2A 1TNGA 3U28C 1SGCA 1XX9A 1VGCC 2ZU3A 1HJ8A 1QTFA 1S6LA 5DPAA 3PMBB 1LVYA 2GZ9A 2A31A 4BAOB 1BTPA 3L33A 1BA8B 1GHVH 3GYMA 5JBTA 4K60A 2XBVA 1SMFE 1SI5H 3OTJE 3A8BA 2J95A 1OPHB 1YPKH 1Y3UA 1ESTA 2TGDA 3LT3A 2FOCA 2H1UA 1MKXH 1OXGA 1UJ1A 2P3FH 4A92A 4J1YA 4X1SU 1TNIA 5GCHG 1QJ7B 5GIBA 2BVRH 1OP8A 2FI4E 1V3XA 3QO6A 3QX5H 3BSQA 1BRAA 1W0KD 2R9PA 3WW7A 3ZVDA 3OFND 3T29A 7GCHF 2TPIZ 2JETB 1SFIA 1GI8B 3MOCA 5KGOA 2JKHA 4OGXA 3L3TA 2SNWA 4ZXYH 1C2DA 1THSH 1C5QA 3V12A 1QB6A 1YCPH 1NY22 1C5OH 3ATIA 4NA9H 3E16B 1W0ZU 1LQDB 1Y3XA 1N6YA 2V6NA 1O2IA 1EQ9A 2Q6DA 2J97A 3A7YA 2CF8H 2R0LA 1FV9A 3A80A 5HKKD 4ABAA 3S7HB 3RXTA 1DPOA 1ELEE 3KIDU 1VGCB 2ZHQH 1B0FA 1YYY1 1K1LA 1GBLA 3WY8A 1AUJA 1OHHD 1P57B 1O31A 1SHHB 4O3TA 2G8TA 2IPHA 4A5TS 3RXQA 4A1VA 3MTYA 2V3OH 5CMXH 4IC6A 1LTOA 3PYHA 3SUDA 2QY0B 2ZFTA 2GTBA 1GBDA 2DE8A 3ZVGA 4UONA 1FZZA 4AFUA 1SVPA 1CQQA 1G2MA 5HMAA 1WCZA 1A1RA 1BMFD 4KTSA 2PSXA 1LKAA 1K0HA 1LPZB 2Z6BD 2A0QB 2WV9A 5CHAB 3BN9A 1CGHA 1V2LT 2HALA 2GV6A 1K2I1 1Y3VA 1BQYA 1MTNC 5J4SA 2B9LA 4FXGH 4DW2U 2ANMH 1AB9C 4CHAC 3GCHB 1AFEH 2BD2A 3W94A 1W7GH 2SGAA 1IOEA 3M5LA 5C3NA 1O3GA 4B6EA 1YLNA 4KGAA 2W6ID 2BQ7B 1Y59T 4LOYH 1ZHPA 3SJIA 3HKJB 2ODPA 1V2KT 4YTAA 4HFPB 2QV1A 2BQWB 3A89A 4MQAA 2ZWLH 5B6OA 7KMEH 2AGEX 2BDCA 4MNVA 1HB0B 4MVNA 3U98H 5KEDA 1ACBE 1P09A 1TIOA 3GDVA 1ELVA 1DFPA 2FTMA 1AZZA 1UW7A 1YM0A 2HVYB 3RU4D 5I25A 2VH0A 1P0SH 1SGQE 1FI8A 5FPSA 1O2ZA 1YPLH 1EAWA 1NC6A 3CS0A 2THFB 1BUIA 2W6JD 3Q3XA 1GHBG 3OTPA 4WVPE 3RDZA 3F3BA 3BTGE 4Y10E 1AE8H 2BD7A 4NWKA 1SQAA 4O3UA 4Q80A 1KTTB 1O5FH 5C1YA 1LHDH 3SV8A 1SGYE 1EUFA 1EJMA 1O32A 4OS5A 4Y71A
chains in the Genus database with same CATH topology
2GVFA 3MO6A 2FYRA 1INCA 4Y7BA 1O2HA 1LO6A 2WYJA 1V2NT 2AERH 2OTVA 3LJJA 1UTMA 3U69H 3ATKA 2WPHS 1UVSH 3QTOH 4GLYA 3UUZA 5EW1H 2EC9H 1TGSZ 3TNTA 3M36A 2HWLB 4E05H 1AGJA 1XUHA 4ABBA 3ZVCA 1GL0E 3N7OA 3BTTE 5I46H 2ZDLA 1TX8A 3A82A 3DA9B 4GHQA 3RXSA 3LGIA 1QY6A 1AZ8A 2GDEH 2UWLA 4ZMAH 4NCYA 2NU1E 1ZZZA 3RC6A 1HAGE 3TIUA 1L0ZA 1HAYB 2JH6D 1RRKA 1S0RA 2BX3A 2C8YB 1OKXA 3VEQB 5FCKA 1C4U2 1GBBA 1V2JT 3A85A 3RMLH 2OC7A 2P94A 4MDSA 3UPEA 2QXHA 3MU0A 4TWWA 4QT8C 2SFAA 3A87A 1RTFB 5EGMA 2TGPZ 2H5CA 1ELCA 3Q3YA 1O2QA 2BOKA 1HGTH 4X2XA 1LVOA 4UDWH 1DICA 2RDLA 1ESBA 3MWIU 1C5ZB 1O3LA 2R3UA 3LJOA 5JBCS 1Z1IA 2Z3CA 3UQOA 2IOTA 2ZKSA 1OYQA 1PQAA 2JH5D 4U01A 1BIOA 3HGNA 1XVMA 3ZZCA 1UK3A 1C4Y2 3RP2A 1FY3A 1GBIA 1UK2A 5FAHA 1MD8A 2W7SA 5F8XA 1NO9H 8GCHF 1GDNA 5FX6A 1QFKH 2W3KA 1O2YA 2PGBB 1AQ7A 2ZGBH 3M3SA 4I33A 2ZF0H 1CBWB 1AWFH 1S82A 2Q1JA 3A84A 4XBBA 4Q2KA 4X2VA 3ZZ4A 4NFFA 4XE4A 5E2OA 1ZMJA 2GMTC 5E0GA 1YF4A 2DE9A 2UWOA 3MMGA 3U8OH 1O3CA 1VCWA 1D6WA 3A7WA 3SOSA 2WYGA 1EZSC 1BTHH 1C5TA 3SJKA 1EP5A 2ZPQA 2QXJA 2ZU2A 3E8LA 3F1SB 2F91A 1WQSA 1MAYA 3KEEA 1SGFG 2PKSC 1ZRKA 2Q6FA 3HKIB 1FJSA 2XYAA 1OWKA 3MH6A 4DY7B 1N6XA 1S5SA 2ZHWH 2B5TB 1YPHC 1Z6JH 4RKJB 3GDUA 1SLWB 1UHBB 4JZ1A 1O2UA 2OC1A 4NG9H 4WXVA 2KAIA 2VWLA 3P8FA 5DKMA 1MTSA 2O8TA 5JBAS 1VCPA 2FX4A 1O39A 1P9UA 3ITIA 5EPNA 1WSSH 1IQNA 3GCTG 1Y8TA 4B2AA 4FUJA 3VFEA 3BTWE 1QL9A 1TNLA 4CH8B 1D6RA 3LH3A 5E0HA 1IQJA 5FPTA 2XC5A 1BBRH 1P2NA 4XSKU 1G30B 1XUIA 1ESAA 3SHCH 4IBLH 1NFUA 1DS2E 3UR9A 1N8OB 5EXLA 2J34A 1GVKB 1QQUA 2W7UA 2ZFSA 1JWTA 1TX7A 3MHWU 1QR3E 3TH2H 1FPCH 3RUOA 2G5NA 3NXPA 2G00A 1EZQA 1DLKB 1TPOA 2VH6A 2WUCA 3SV7A 5ABWA 4CR9A 2HNTE 1EAIA 7LPRA 4BAQB 1BMNH 1KLJH 1KXFA 4LXBH 3FZZA 2A2XH 3U8TH 2BD5A 4WJG2 3PLKA 1LMWB 1O0DH 1C2MA 1XMNB 2FLRH 4NIYA 5C5NA 4R8TB 3SNEA 2GCTC 2TBSA 2Y80A 3IWMA 4Y79A 3NCLA 4Y8XA 4CRBA 3I77A 1LHCH 4FU9A 1MKXK 3B23B 4CREA 1E38B 2XC0A 3GDSA 4NA7A 4SGAE 4JZDH 1L1JA 1V2RT 3RXRA 1F0TA 1G36A 2A5KA 1UTLM 4JK6A 5LPRA 4K1SA 3LGWA 1GJ8B 1P05A 2OC0A 4DIIH 3VXFH 1O38A 3GCHC 1FONA 4I8GA 1FIZA 1HAVB 3A7XA 4JZIA 4WMFA 1V2PT 3A7VA 2G55A 2ZNKH 3E6PH 4ISOA 4BXWA 3MNSA 2HNTF 1GHBF 1HBTH 1WOFA 1V6DA 1Z7KA 2XW9A 1WTGH 2W26A 5H4IB 1KXAA 4INKA 4K1EA 3KCGH 3TK5A 6GCHF 4IC5A 1JRTA 4THNH 1NU7B 2D1JA 1HCGA 4FUEA 4JYUH 3D23A 2ZIQH 3TH4H 4PROA 1CHGA 1QNJA 1AVWA 2BZAA 2KAIB 1J16A 3RXPA 4D7GA 2GDDA 1QIXB 2BYAX 1BMAA 5EQQA 1C1UH 3ZYDA 2H2ZA 3S9BA 2CF9H 4UFEH 3OX7U 1TX6A 2FDAA 3UFAA 2J2UA 4AGJA 4TYDA 3SGAE 1T32A 4UFGH 5L30H 3OU0A 2ZEBA 1P12E 1TONA 5ESTE 2Y82A 1EX3A 1TQ0B 1Z8IB 2XCFA 3GCNA 3RXDA 3DD2H 3H5CB 2OXSA 3UWIA 1C9TA 1QBVH 1QHRB 3TGJE 2ZDKA 1Z8RA 3Q76A 4B76A 1GJ7B 1J17T 2WINI 1SGRE 3GY3A 3PMAB 1A46H 1PQ7A 4LK4A 2CXVA 3IITA 3TJVA 1ZLRA 4O9VA 2RG3A 3SZNA 1GBJA 1A3EH 1GBCA 1GCTB 1CBWC 2PV9B 2GT8A 4Y11E 1HIAB 4ZROA 3SJ8A 5LPFA 1CGIE 3RXEA 3BEUA 1C5UA 2A1DB 4B1TA 3M7UA 3TU7H 4B74A 1Y3YA 1T7CA 1V2TT 5AFZH 4BTIB 4F4OC 1AVXA 1C1NA 2ZP0H 3E3TA 1GMDF 3LU9B 1WUNH 4OGYA 1MTWA 3T5FH 4TY7A 2FZZA 3EAJA 4XOJA 1ZPZA 2BD4A 1K1NA 3M5NA 4O03A 1GJ5H 2PR3A 5ESBA 4ISNA 1GI3A 2FIRH 4D9QA 2B7DH 1SGPE 4AFQA 1UTNA 1DSUA 2ANWA 3Q00A 2A5AA 3BTFE 1KLTA 2XCNA 3O8BA 1E34B 1BHXB 2BM2A 2ZCKP 1OYTH 1OWIA 2AYWA 3NUMA 4RN6A 5DP3A 2AGIX 1DUAA 2FMJA 2OD3B 1C2KA 1TALA 1T8MA 1C2FA 1O2XA 5PTPA 1GJ6A 1GMCG 1AE5A 1KIGH 3KQEA 3EGKH 1XKAC 3SGBE 3UNRA 1AKSB 2ZU1A 4YM9A 3RXOA 3SJ9A 1DOJA 4X6MA 4NSYA 1NFWA 1C5RA 1Q31A 1TOCB 4BOHA 3OY5U 4YOJA 1TLDA 1TBQH 2BTCE 1L2EA 1BITA 3GY6A 2XTTB 1HLTH 4X8VH 5EODA 2WV4A 1TBZH 2ILNA 2IJOB 3FP8E 3RC5A 1SGTA 2TRMA 5GCHF 1AN1E 1FMGA 4B73A 1ZYOA 1WAYB 3ZV9A 3DFJA 4WH8A 1LHGH 5FCRA 1DWDH 1QCPA 2W5EA 2VVUA 3K2UA 3A81A 1XVOA 4BXSA 1A7SA 1C1TA 1GBKA 1DWEH 2P93A 4IN1A 2CGAA 1W8BH 2Y5GA 1O2MA 3K6ZA 4H6SB 2VINA 3ODDA 1C9PA 3U9AH 4Y0ZE 3GY5A 1ZMLA 1Z71A 2ZG0H 3AAVA 4CHAB 4A1XA 1UO6A 5A0CA 1AUTC 3BTKE 2FX6A 4Q7ZA 3QGJA 1Y5UT 5GPIB 3AW1A 1EPTC 3BV9B 4WMEA 1DXPA 3TLOA 5GDSH 4FUDA 4NSVA 2FESH 1BBRE 3Q77A 1V2ST 3LGYA 4ZKOU 2VWMA 5L6NH 1GCDA 2QAAA 4YESB 2NU0E 2FTLE 1ARBA 1QA7A 2PHBA 4NGAH 7ESTE 3ODFA 4MLFB 4X6OA 2ZECA 3V0XA 1PYTC 3T25A 1F0RA 3P70B 1NTPA 1ZGIA 1WTHD 1PPBH 3F9FA 1FDPA 1G3CA 3BIUH 3M7QA 1LKBA 2FOMB 1C5VA 4WMDA 2J4IA 3QN7A 1SQOA 1ZJKA 2QF0A 3MFJA 3KQDA 1NESE 2XWBI 1DWCH 4KTUA 1K1IA 1TGCA 5T3HA 1NU9A 3ZVFA 2FPZA 5HGGA 3URCA 3SJOA 5EXNA 1OS8A 3QZQA 3JZ2B 5IDKA 3S0NA 1LHEH 5G4BA 4H4FA 2Y6TA 3CENA 1TABE 1KLIH 2ZTXA 2EI6A 3PWCA 2TGTA 3LDXH 1TPSA 1ZR0A 2QIQA 3QLPH 2OUAA 1Z6EA 3ZZDA 1A0HB 3GICB 5DK1A 1T8NA 1C5MD 2F9PA 4NZQA 1C5LH 5T6FA 3PLPA 4Y8YA 2ALPA 2F9NA 2WV5A 3BTHE 3HGPA 1GWAA 4AFZA 2F9OA 3K65B 2AGGX 4AB8A 1O2SA 2QCYA 1BTUA 1ZTJA 1MQ6A 1C5PA 3MO9A 3ZZ5A 1PYTD 1CHOF 1AIXH 4OS7A 4FVBA 2ZQ2A 5DGJA 2STBE 2OQUA 1BRBE 3ATWA 9LPRA 2ZA5A 3CS7A 2HVXA 1HAXB 3SU2A 1MAXA 1FY1A 3VB6A 2VWNA 2O8MA 5JBBS 3C27B 3EA9A 1GJBB 5A0AE 1UHBA 4BAKB 1K1OA 1HAHH 2R2WU 3PMJA 3LGUA 3MU5A 3VB3A 4TPYA 3C1KA 3SU5A 3SV2H 2ULLA 4FUIA 1G3DA 1P2IA 1KSNA 1AKSA 1KXBA 4U30A 2ZI2H 3SORA 4XDEA 2ALVA 1C2HA 1F0UA 4KTCA 4UEHH 1DM4B 4BTUB 1ELGA 3SQEE 4X1QU 1GBTA 1OWEA 4M7GA 1O2NA 3RM2H 2XBXA 2GT7A 1O5DH 1DITH 2O8WA 1F5LA 2VGCB 3UOPA 2NWNA 1CE5A 4ABIA 2BD8A 1KTSB 4GUXA 1WBGB 1RD3B 3EDXB 1GJ4H 2ZU5A 4HTCH 4KELA 4X0WU 1FLEE 1QQ4A 1K9OE 2F83A 3LONA 4RSPA 1KXCA 2AIPA 1O3AA 3PO1C 2I6SA 1QGFA 4NIWA 5BPEA 4DIHH 1SGDE 2FOGA 2Y7ZA 2ZFQH 1YLCA 3OSYA 2A7HA 2SGFE 1W2KH 1NRRH 2A45B 1DSTA 4H42U 3VB4A 3BG8A 3M37A 2HOBA 3UNQA 3RXVA 1UTOA 5HYOA 2ZHEH 1BRCE 1TPPA 1HAOH 4K5ZA 1QL7A 1IQLA 1F2SE 1YP9A 4JCNA 4OS2A 2PSYA 2OCVB 2A4QA 1QRWA 1F92A 1W7XH 4X1NU 1ELDE 2C8XB 1PPCE 3GY4A 1DXWA 1DUEA 1GVLA 1EXFA 1EKBB 1IQEA 4VGCC 4HI3A 1GPZA 2BY8X 3A8CA 1GDUA 3GYLB 3MU8A 2WPJS 1MTVA 2BLWA 2PFEA 1P3EA 3MH5A 1SQTA 1G3EA 2Y7XA 1T31A 2ZFRH 3RMOH 3SNBA 1ZGVA 2ZGXH 2BDIA 3PO1B 3BIVH 3E1XB 1P2KA 3GISB 3STJA 1EOLA 4ZH8A 2C93B 1LCYA 3UREA 1XXFA 1AI8H 3QK1A 3UQVA 1GHAG 1ZSLA 2TIOA 3UY9A 1MUEB 5AFYH 2ZO3H 4DOQA 5JB8S 1C2LA 1RXPA 1UTPA 1MMJN 2BY7X 4WWYA 3TNSA 3S69A 2UUFB 4U32A 4MG3A 3SI3H 2ZCHP 5CE1A 5LPEA 2C4FH 1L4ZA 2RA0A 1FNIA 5L2ZH 2QGRA 1SSXA 2ZTYA 1O36A 1O3HA 1ZRBA 1A5HA 5DO4H 2GCHF 4F49A 2F9VA 1GGDB 3SUFA 1PFXC 1K1JA 1LQEA 3PV4A 1S0QA 4X6PA 3RXBA 3BF6H 3U1JB 3LC5A 2VIVA 2BDYA 2UUYA 3RLWH 3SW2B 3ZVAA 1GI2A 3ATMA 3GY7A 4CRCA 3RMMH 2A4RA 1UCYE 1XUJA 3RLYH 3SU1A 1C1QA 2HPQH 5E0JA 4TPIZ 1E0FD 3KNXA 1C2EA 3TJOA 3V7TA 5AHGH 2ZTZA 1NS3A 1NT1A 3TITA 1GHZA 4RKOB 1CT0E 1JIRA 1MH0A 3BTME 4NA8A 3T62A 4D76A 1LVBA 4R0IA 1IAUA 1NRQH 2H6MA 1XXDA 2Y5FA 1O3PB 1EAXA 1S6HA 3E0PB 1A2CH 3GCTF 1H9IE 3MH4A 2XXLA 5BRRE 2Y5HA 1PPHE 4DVAU 1A0LA 3VPKA 1RTLA 4IMZA 1BT7A 1BTZA 5A8ZA 2ZZUH 4K69A 3RXKA 1J9CH 3A7TA 4Y8ZA 5DG6A 4BANB 4X8UH 2AS9A 4JYVH 1A5GH 2GCTB 3QUMP 1WQVH 2R0KA 3FVFB 4K8BA 5AVDA 3RMNH 3ELAH 2G5VA 1GI1A 1YCPK 4AORA 1ABJH 1SR5C 2F9BH 1O3EA 2VIOA 2BDHA 4GAWA 2P8OB 5ETXA 1Q3XA 3PMHB 1TOMH 4DG4A 3E0NB 1A3BH 1C5WB 1GBFA 1TYNA 2IN2A 4ABEA 1NFYA 4XBDA 1RIWB 1IQHA 4GSOA 3SN8A 4MNYA 1CSOE 1NRNH 3LPRA 1P2MA 1QB1A 1C1WH 1O3MA 3H7TA 7GCHG 1H8IH 3HK3B 3BTDE 4ZUHA 5GXPA 5EXMA 1VITH 2BD3A 1EJNA 5A8YA 5FXLA 5LH8A 3KL6A 1NFXA 1F0SA 2ZHDA 3P6ZB 1O5CB 5GJ4B 1HAZB 1L1GA 1A61H 1AVGH 3W95A 2VGCC 1G9IE 1FAXA 2BY5X 4FUCA 1EZUC 2PUQH 3LC3A 1C5NH 2BMGB 1QBOA 2I6QA 5E2PA 1Y3WA 3EYDA 1YPHE 1OX1A 3AASA 2VVCA 4ABGA 1PPZA 1XUKA 1GI7B 1W0YH 2Z7FE 1HJAC 1MU8B 1MU6B 5C20A 3ZV8A 1QURH 1O5GH 1BZXE 2VVVA 1Z8GA 1T8OA 1TNJA 1P01A 2CV3A 5JPMH 3QDZB 3TJNA 2SGDE 1A4WH 3NZIA 8KME2 2VIQA 3V13A 1DY9A 2FP7B 2FOBA 1ZHRA 3FZDA 1H4WA 4ISLA 1CO7E 3LH1A 1HAIH 2J94A 2YNAA 3F9HA 4AGKA 4XBCA 2PLXA 3KQCA 1SOTA 3ZZAA 2HLCA 1EB2A 5EOKA 5A09A 2OLGA 1FQ3A 3TVJB 5K0HA 3ATLA 1SBWA 1NZQH 1U6QA 3OYPA 3VXEH 5DJ7A 1GBEA 2BY9X 2EI8A 2FS9A 3F9GA 3T26A 1TNHA 1W3CA 1H1BA 1GJ9B 2VIWA 3SV9A 3HATH 3M61U 4GHTA 1N1LA 4OS6A 3UIRA 5T6DA 2BD9A 1GCTC 3HPTB 2Z3DA 2OBOA 2RA3A 2O8UA 1O2WA 4X6NA 2NU2E 3SUEA 1IHSH 1C1PA