1O2WA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2wA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2wA02
1O2MA 1YBWA 4AYVB 1C1RA 2ZDLA 1QJ1B 4Y8XA 3GDSA 5AFZH 1QHRB 1FIZA 3P6ZB 2Y7XA 1Y3UA 5FPSA 1YF4A 3RXBA 2BDGA 2QYIA 2W7SA 1IQGA 3EDXB 4H42U 1S85A 1BDAA 2ZECA 3M7QA 4MQAA 3MU1A 1NZQH 1WTGH 3KQDA 3ZV8A 4U01A 4X1RU 1ELDE 1EX3A 3T26A 5AHGH 2RG3A 5PTPA 3G01A 3LH3A 1ESBA 4B1TA 2ZWLH 4AFSA 3P8FA 4FUBA 4YOGA 1NPMA 2TGTA 3RU4E 1D3PB 3BEFB 1SGNE 1P9SA 1SR5C 2FLRH 1V2UT 2XBXA 5T6FA 1VGCB 3F9FA 2QF3A 3SNEA 1EJMA 3SHAH 3UNSA 5A09A 3FVFB 2SGQE 3RXKA 1O5BB 1CHGA 1MKXK 2FIRH 3ZVEA 3U98H 1T8MA 4FUJA 4XFQA 3SUEA 1UHBB 4INKA 2A4GA 1O3AA 3F6UH 3TVJB 1O35A 2ZDNA 2WV4A 4X2YA 3RXAA 1YC0A 4X2WA 1A1RA 3D49H 1FAKH 3AAUA 5EXMA 4GCHG 5EQRA 3MNBA 2BDAA 1UTQA 3K6YA 1ELTA 1E36B 2Z9IA 2TRMA 3UR6A 3VB4A 1EPTC 3HKIB 1YYY1 2DE8A 1XUIA 1AO5A 3STIA 2ZPQA 1O5AB 3B8JA 3DFLA 4K1SA 1YCPM 1O34A 4TY6A 1P09A 3M5NA 5J4QA 1C5YB 1SGDE 1HAOH 3LGUA 3GCTG 1QRZA 2EI6A 1EB2A 1M9UA 1WCZA 1FY5A 2F9OA 4NA8A 1C5MD 3U8OH 1KDQB 2H9EH 1ANEA 2BTCE 3PMHB 1SL3A 1K1NA 3M36A 3SOSA 1EATA 1QA0A 3OY6U 1W7XH 1A7SA 1WU1A 2OQUA 1H9LB 1HGTH 1GI0A 2BDIA 1ZTKA 3AVZA 1S81A 2XWAA 2QF0A 3A80A 4AFZA 4DVAU 2BB4A 2OXSA 3EA8A 4VGCB 2A31A 1K21H 3E91A 3PV4A 1LVBA 1C2FA 1IQNA 1K1OA 3LGVA 3O8DA 4X6OA 1QL7A 3LH1A 1O2ZA 4YZUA 5TJXA 2KAIA 4Y8YA 4U32A 1C1SA 3SV8A 1C5TA 1OYTH 4ABJA 3V0XA 3UTUH 1ARCA 1O2YA 3QO6A 5E8EH 2G4TA 2Z3DA 2CF8H 3D62A 3GCHC 3F9HA 5LPEA 1ELBA 1EAUA 1QCPA 1CU1A 2A5IA 1BTXA 4AN7A 2WV5A 3GOVB 4O9VA 1BT7A 1O3NA 4ABDA 1A61H 2ZGXH 2TPIZ 2VH0A 3SNAA 2ZU3A 2BD5A 1SFIA 3KIDU 2F3CE 4PROA 1EP6A 1GDQA 1SLVB 3SQHE 5JBAS 1O2OA 3EE0B 1O2LA 1RRKA 4D7FA 2W26A 3PMBB 3NCLA 1YPJH 2F9VA 2GDEH 3T29A 3MU4A 1V2RT 3TIUA 2R2MB 2SNWA 1MH0A 1NU9A 1Q2WA 2F9PA 1C5QA 1CGHA 2Q6FA 5AVDA 1BTYA 2HVXA 2P8OC 3MMGA 5DP7A 2ULLA 1JRTA 5E0HA 1O2RA 1V6DA 1IOEA 1K1IA 2FOHA 1TGCA 3QTOH 4XBDA 4Z6AH 5LH8A 4D76A 3UPEA 2XTTB 2GT7A 1O36A 1TBZH 3K2UA 2Z3EA 1SQTA 3M7UA 3JZ1B 4ZUHA 1GMHF 1UCYK 1ETTH 1P12E 1LCYA 1EXFA 1SBWA 2PKAA 3SUFA 1GG6C 1GJ7B 4Y7BA 1ZRBA 1GVZA 4D9QA 1GI4A 1NTPA 3PTNA 3ZZ4A 3O8CA 1T4UH 3RC4A 3M37A 4IMQA 2W5EA 3I29A 1AN1E 2J34A 3F68H 1GJCB 1V2KT 3E0NB 1NN6A 2SGAA 1DWCH 6LPRA 1T8NA 1YPLH 1FPCH 2D1JA 3M61U 2M5TA 2ZU4A 1KXDA 4J2YB 1Y3YA 3D23A 2ANMH 3MNSA 4LOYH 4ISLA 1RFNA 1AFQC 3E16B 1DUEA 1C5RA 1SQAA 5ESBA 1DS2E 2H9HA 4DOQA 2ZNKH 1LDTT 2TGAA 2ZTZA 3SV6A 4I33A 3OY5U 2R0LA 7GCHF 1NESE 4Z0KA 1TRYA 3RXQA 2RA0A 1QR3E 3DA9B 3PB1E 1O2GH 1EOLA 2AGIX 3P8OA 4YLUA 1F0RA 2AEIH 4XDEA 4J1YA 1CHOF 1EPTB 1WBGB 1O3OA 4F49A 1XVOA 2GCTC 1TMTH 3MH7A 4Y76A 6GCHF 1C2KA 2CV3A 1O5EH 3E90B 3TGKE 1O2UA 3RMOH 1VCPA 1MQ5A 2OBQA 2VWOA 4A92A 1A0JA 2XBWA 5LGOA 1IQLA 2B5TB 4ZHAA 2ZTXA 3A8CA 2FX6A 1C1QA 5C5NA 4ISHH 3SUGA 1NS3A 4TWYA 3GDVA 1AY6H 4WVPE 1ABJH 2SFAA 1MTVA 5DK1A 2G52A 1ANBA 4YT7H 1LKBA 4WH6A 1A4WH 2FYRA 1NFYA 2BX4A 3ZVDA 1TPAE 5DP5A 3VB3A 2ZDKA 4IBLH 1LVMA 1VJAU 1ESTA 1O3JA 1DUAA 1O3MA 1HPGA 5JDUB 1KXBA 2XWBI 2O9QA 1W2KH 1HB0B 2P3UB 2C8YB 2ZCHP 2VWNA 1HFDA 1CE5A 1PPCE 4BAHB 5L2ZH 3BG8A 3V12A 2XYAA 1NU7B 4B2BA 3EGKH 2BHGA 2ZC9H 1EKBB 2FWWA 2JETB 2IOTA 1GCTB 1B0EA 5EU8A 1J14A 3TJVA 1F7ZA 3SUDA 4FUFA 1GHBG 2BDBA 4FU9A 4WMFA 2H5DA 1V2NT 1TA2A 2F9UA 4OS4A 1F2SE 3PYHA 3RXDA 1GHXH 1A3BH 3TGJE 4AGKA 1QIXB 3URCA 1KXEA 3SU3A 2BOHB 1C9TA 3I77A 4X8VH 3LDXH 2B0FA 1J16A 3HKJB 3ZVBA 1ZGVA 1Y5BT 2FO9A 3T5FH 5HM9A 3A89A 1BHXB 2PR3A 2FI5E 1LQDB 2WUCA 1KY9A 1O2VA 4MPXA 2C8ZB 3ZVCA 1G3BA 1SB1H 4Y8ZA 3EA7A 4ZHLU 4JZ1A 1MMJN 3ZZ8A 3LKWA 2ODQA 1P11E 1YPHC 3L6PA 1K9OE 1GMDG 1GI2A 1TRNA 1H8DH 3GCOA 1MU8B 2PUQH 2TIOA 3URDA 2ZPSA 1HAVB 1QY6A 2BMGB 1VGCC 3GY2A 3MH4A 4R0IA 1O5FH 2QXIA 1OWJA 5FAHA 2P8OB 1TE0A 1PJPA 4NIVA 2O8TA 2HPQH 1QFKH 2D2DA 1FNIA 1A0LA 1ZTJA 1JBUH 1TGTA 2PW8H 1RTLA 3VEQB 1UTLM 2C8XB 2AERH 5A8ZA 3ATKA 1OP2A 3UWJH 4X1PU 1FY3A 5AF9H 5FHTA 1EAIA 3O8RA 3RXOA 4IC6A 2GZ9A 4FUDA 1Z1IA 2PWXA 3SGAE 1LPKB 4ESTE 5TCCA 1GDNA 1XMNB 1TB6H 2IJOB 2BZ6H 1LHFH 2ZGCA 1PQAA 1OOKB 1AGJA 5C67A 4H4FA 4ZXYH 1SVPA 1W3CA 4X6MA 2C93B 1OWEA 3RXTA 5T6GA 4MLFB 4GPGA 2P95A 1GHZA 4GAWA 3W94A 1O2HA 2RA3A 4WMDA 3ZZ3A 3KEEA 2A2XH 1SPJA 4Y0YE 3LC3A 3A86A 1C2EA 1W0YH 2HALA 2JH0D 1UCYE 5E0GA 4ZAEA 4Y79A 1OP0A 1DLKB 1BMMH 2VNTA 2PLXA 3SI4H 1THRH 4WH8A 8GCHG 1ZGIA 2J4IA 1SSXA 3BIUH 1C1OA 4X1QU 1NRSH 4NIXA 1KDQA 5JB9S 2Q1JA 1G2LA 1DY9A 3U69H 1TGBA 1P06A 1GHAF 1Z7KA 4E7NA 2Z3CA 3K6ZA 2ANYA 2DUCA 4HZHA 1DY8A 1H1BA 1O2NA 1PPHE 1YPEH 2HNTF 1F0SA 4D8NA 1C1UH 2GMTB 1O3LA 3RXRA 3RXPA 2VINA 2ZDAH 1GBLA 2FM2A 5F6MA 1AHTH 1FJSA 4E06H 4VGCC 1JWTA 2G8TA 3E8LA 1BBRK 4TY7A 4BXSA 3SI3H 5EW2H 2DE9A 3M5MA 2Z94A 1NROH 2BD9A 1TBRH 1O38A 2FX4A 2ODYB 5E2PA 3GYMA 1CBWC 4I31A 4O3TA 3BTEE 1JXPA 1KTTB 1EAXA 1CA0C 4X6PA 1P0SH 2PGBB 2VH6A 2BLQA 2HLCA 3HK3B 3E0PB 2Z9LA 3SNDA 1O2XA 2FZZA 1YKTA 1LVOA 1TGNA 2ZG0H 3A7VA 5G4BA 1G3CA 4FUIA 3K9XB 3ZZ5A 3B23B 3BTTE 3ZVAA 4I8GA 2P94A 5DP6A 1BTWA 3A7YA 2QXGA 2XBYA 2Y5HA 1FN6A 4H6SB 2BY6X 3S9CA 5ESTE 3AW1A 4UFDH 4ZH8A 1EP5A 4JK5A 1O2QA 3MWIU 2NU0E 2QA9E 1VCQA 1Z8JB 2OTVA 2ZCLP 2ZU1A 2O8LA 1AKSA 1HXEH 1NFXA 1ZYOA 1P2JA 4INHA 1MD7A 3QGNB 1VITF 3M7TA 3NK8A 5HMAA 3LGIA 1EB1H 1SGYE 2ZA5A 2V0BA 2ZP0H 1QJ6B 2R0KA 5K7RA 1BTHH 4DT7B 1TA6A 3IWMA 3LGWA 1MKWK 2NU4E 2FOAA 4U2WA 1O31A 1AVWA 1RJXB 1T32A 2B8OH 4AFUA 3RXGA 1QB6A 5ABWA 1EQ9A 1A0HB 1UTNA 3VGCB 3BTKE 1UVOA 3SJ8A 3L3TA 3SZNA 1BRUP 4NGAH 2ALPA 5EGMA 4A1TA 2Y81A 1GBKA 1XUGA 2NU3E 1UTOA 1IHSH 2QN5T 1NRNH 3RXFA 2A45B 2V3HH 1XUJA 1TNGA 2ZGBH 3M3SA 1QGFA 1CT2E 1CVWH 3PWCA 2ZHWH 2H6MA 3BTQE 4YM9A 2OCVB 7LPRA 4CH2B 3O8BA 5ETXA 3QN7A 1HAIH 3ZYEA 1BB0B 5DPAA 4IW4E 1VZQH 4Q2KA 1G36A 5C5OA 5J4SA 3UQOA 2VIWA 1C5UA 2FYQA 2FLBH 4MTBA 1DT2A 1MKWH 3ITIA 4MPVA 3FAOA 3BSQA 1PPBH 2FPZA 2NU2E 4IN2A 4I32A 1LKAA 1EZXC 1YCPH 3QWCH 4MNYA 4XE4A 1S6FA 3SHCH 3RM2H 3ELAH 3GY8A 2NWNA 1B7XB 1QNJA 2FODA 2BM2A 5L2YH 3S69A 7ESTE 2TGDA 1BTZA 1N6YA 1IAUA 4GCHF 3RLWH 3QGJA 3ZZ7A 5JB8S 1DSTA 1P05A 1SLXB 2SGEE 4ZROA 3GISB 3A8AA 1KLJH 3T28A 1A5IA 1Y5AT 4K69A 3VB5A 4JCNA 1GBMA 4B2CA 3PLPA 3LT3A 1QRXA 1NRQH 4A6LA 1WYKA 3S7HB 3MOCA 4X8TH 2QCYA 1RXPA 2CJIA 3RXLA 3CENA 3QTVH 1FY1A 1UVTH 3GCTF 3SJKA 1O3GA 2BOKA 3GDUA 1S0RA 1C2JA 2VVCA 2A5KA 5FCRA 3LJOA 2GZ7A 3RDZA 3FP8E 1FONA 1C2GA 1GBDA 3SU1A 2JETC 1GCTC 1HNEE 4WF8A 3RM0H 3E3TA 1V2PT 1GBEA 3LC5A 2BLWA 2HGTH 2CGAA 2OBOA 4YTAA 1CQQA 2VU8E 1CBWB 5GCHG 4ABAA 1D4PB 1GVKB 4JK6A 2AFQB 1BRCE 2H5CA 1Y5UT 1CA0B 1ZRKA 4XOJA 3D65E 1L0ZA 1ZHMA 1TNLA 1C4Y2 5A8YA 2SNVA 1DX5M 2BD3A 2ZGJA 4JZDH 2B9LA 1ZMLA 2H2ZA 1EAWA 1P2QA 3MU5A 2BXTH 3OSYA 1DITH 1H9HE 3U8TH 3UFAA 2JH6D 3PWBA 1BBRE 1AB9B 2TBSA 2AMQA 2GZ8A 1HLTH 1TYNA 2VB0A 2R3YA 1GBFA 1TNKA 1VR1H 1EOJA 3HPTB 1GI3A 1HXFH 4JYVH 4ISOA 1XUKA 2AIQA 4OS6A 5FPTA 3FP7E 4K3JA 1AMHA 2HOBA 3VB7A 1DWEH 3FANA 1RGQA 6ESTA 2STBE 3SBKA 1K22H 2BY9X 2H1UA 4K2YA 2ZU2A 2GCHG 1FQ3A 1T8LA 2OD3B 3I78A 4MNXA 4NWKA 2BDYA 1C4U2 1JIMA 1HJAB 1P03A 1D3QB 4HTCH 1Q3XA 4YT6H 2WPKS 3RXCA 1GJDB 1UVPA 4F4OC 1KYNA 1E35B 2WPJS 2GV7A 4ASHA 1C5OH 1NRRH 1ELCA 1T8OA 4ZMAH 1ORFA 3RXVA 1TIOA 4HFPB 1CO7E 1TNJA 3TH2H 1MTNC 1KTSB 1UJ1A 1BMNH 1O3IA 2HNTC 1AE5A 4UD9H 4A5TS 3QZRA 1C2DA 5B6OA 5HGGA 1XUFA 1K1MA 2QXJA 1C5VA 3V7TA 1KXFA 1ELVA 1LPZB 4WXVA 1O5GH 3MI4A 1NO9H 2W3IA 3LU9B 1DPOA 2ZFRH 4B2AA 5SGAE 1GI6A 3RLYH 1L4DA 1LVYA 4KTUA 1ZJKA 2Q6DA 2AMDA 1G2MA 1GHYH 2ZPRA 4BTUB 4CRAA 6CHAC 5F8ZA 1IQEA 1O2KA 4TPIZ 5JPMH 5EOKA 4UFGH 1THPB 1D9IA 2UWOA 3M3TA 1B5GH 2GMTC 3QLPH 1GI5A 3RXMA 1GJ4H 1FY8E 2HPPH 2J94A 1GMCG 1F92A 4AOQA 4UONA 1O37A 1XUHA 1Z6EA 3ATMA 8LPRA 4KP0A 3A8BA 5EXNA 1OS8A 1OWKA 4Y10E 3ZVGA 3DD2H 2LPRA 4CR9A 1D6RA 3T2NA 1UTMA 1U6QA 1ID5H 2AGGX 4BNRA 1C5LH 1SC8U 5FBEA 1HIAA 1CSOE 1ZMJA 4NIYA 5EPYA 4JZFH 2XXLA 2PKSB 4UE7H 1K2I1 1HAYB 2BXUH 4CHAB 1FN8A 1RD3B 1UTPA 4GSOA 1O5CB 3VB6A 1IQMA 4WWYA 4DY7B 1PYTC 5HYOA 2EC9H 1HJ8A 5T3HA 2V35A 2BD4A 3W95A 2ZZUH 1TPOA 1TPSA 2R9PA 4KTCA 1ELAA 1SGCA 4HI3A 1V2WT 1C5PA 1W12U 1F5KU 5FXLA 1J8AA 3RMMH 2PUXB 1MTWA 1N8OB 1OXGA 4TWWA 1F0TA 1PPFE 3U9AH 4MG3A 4FVDA 1AQ7A 2Y5GA 2QY0B 1C5XB 1OYQA 2F91A 2O8MA 2YNAA 3EQ0H 1ZSKA 1W14U 1Y3WA 1GGDC 1MD8A 2SGDE 3NPSA 3SO3A 1YPHE 2IN2A 2SGFE 4ABFA 1A3EH 3K65B 5FX5A 4LZ1H 1DVAH 2P3TB 2PSXA 1EASA 1FZZA 1YM0A 1MCTA 3FZDA 2BY5X 5FPYA 3FZZA 1DM4B 2ZFPH 1MZDA 1NY22 3A7ZA 3TJNA 4FXGH 2QIQA 3L33A 2CXVA 2ODPA 1LMWB 1AVGH 1Z71A 4GLYA 2TGPZ 5TCAA 3RUOA 3A7XA 4SGAE 1KLIH 4SGBE 1P2MA 1GHBF 1O2TA 1ELGA 1DICA 2ZHDA 3TNTA 4CRGA 1RTKA 5FBIA 4B76A 1GCDA 8ESTE 3VGCC 4AGJA 1SLUB 3U8RH 2FTLE 4ABGA 3UY9A 4FU8A 1AUTC 1TLDA 2BD2A 2AH4X 2W7UA 4KELA 1E38B 1C1MA 2BVSH 4K60A 5DP4A 1GBHA 2C3SA 1ZSJA 1SGFA 1H9IE 4ABBA 1EUFA 1HAGE 2WPIS 1ZHRA 3GICB 1QQ4A 2HWLB 3VPKA 2BY8X 5LPFA 4JMYA 2P3FH 3RXIA 1K1LA 4XBBA 3PMJA 3A83A 1QB9A 3ATLA 3PLKA 2UUFB 1QRWA 1N6XA 4I8HA 1GMDF 4WMEA 2RCEA 5HXFA 1UHBA 1O5DH 1G3DA 1SGRE 3BTGE 3ZZBA 1ZTLA 4ZKRU 3GY7A 2Y7ZA 1UTJA 2ZO3H 2GV6A 1C4V2 2FXRA 2ZEBA 2J38A 3TK9A 1O3CA 2PKAB 4Q80A 3BTWE 4OS5A 1TQ7B 2H9TH 4GHTA 3A82A 1PPGE 1UMAH 1JRSA 5CHAC 3LJJA 3A84A 3OX7U 3AW0A 3EYDA 3S7KB 2XW9A 1MTNB 1TX7A 1ZZZA 2PTCE 5BRRE 1E37B 3TH4H 3SV7A 4K8YA 5AFYH 1MUEB 1YP9A 2ZCKP 3ODDA 2ZU5A 4ISIH 3NXPA 3S9BA 1AUJA 1THSH 1V2MT 2D26C 1HAZB 2QAAA 2VVVA 1Z8GA 3UWIA 4H6TA 2FTMA 3T62A 1V2VT 1ANDA 1HDTH 4OGXA 4CRCA 2FOMB 3STJA 1EZQA 2CHAB 3F1SB 1TONA 3UUZA 3V3MA 4DW2U 4B74A 3SNCA 1O32A 2P93A 6CHAB 2YOLA 4MNWA 1FY4A 2Z9JA 1GJ6A 3E6PH 2GKVE 2ZHFH 1RTFB 2BQWB 1SFQB 1C1NA 1LTOA 3NUMA 1DDJA 4X8SH 1XM1A 1KXAA 3VXEH 4K8BA 3MTYA 3C1KA 1QB1A 4UEHH 1NRPH 5C3NA 1TFXA 3AAVA 1D3DB 3SORA 1L1NA 3MYWA 2QV1A 3RXJA 3TITA 1O2IA 4ZKOU 2Z9KA 8GCHF 1YPKH 4ISNA 2I6SA 1UK3A 3SN8A 4NFEA 2FS8A 1VCWA 1CGJE 5EQQA 2XC0A 5I46H 2R3UA 1P04A 1C2MA 3MO9A 4AB8A 2ZF0H 1AWHB 3ZV9A 1SHYA 5A2MH 2BVRH 3RU4T 2UUYA 3RMNH 1MQ6A 3GYLB 1DXWA 1AIXH 1V2JT 3RU4D 1ZJDA 5HM2A 1G32B 4JYTA 1AE8H 5CE1A 4D9RA 2PFEA 2FESH 2WINI 1P01A 1P9UA 1Y8TA 3UQVA 4BAQB 3A81A 1G9IE 1TMBH 2B7DH 3SV2H 1P57B 3NZIA 3P8GA 1FV9A 3UREA 4Y11E 1OWIA 3ZVFA 1ELFA 1QQUA 1O3DA 2FMJA 3TU7H 3H5CB 3MNCA 1EZSC 2A7CA 2GDDA 4X2VA 1AB9C 3RC5A 1FDPA 1MBMA 2VIDA 2PTNA 2OLGA 2C90B 3TLOA 1OKXA 1GGDB 3HATH 2G81E 4JYUH 1TNIA 3RC6A 1FUJA 5JBBS 4WY3A 4Y71A 1Z6JH 1UO6A 4AFQA 2Y5FA 1SLWB 1A46H 4BOHA 3LGYA 1OWHA 3LIWA 5F03A 2CN0H 4LZ4B 4O03A 4LXBH 2ZQ2A 5C1YA 2UUJB 5CMXH 1OWDA 1VJ9U 2BQ6B 1PFXC 3QX5H 4K5ZA 1HJAC 1G30B 1SG8B 3BTME 3A88A 3PLBA 4AYYB 2BDCA 2OP9A 1KLTA 5FCKA 1LO6A 4Y6DA 2V3OH 3MFJA 4UDWH 4MPWA 1YCPK 1O33A 1W10U 3BTHE 3DT0H 4MDSA 4ABIA 1V2OT 1MTUA 1MAYA 4RSPA 4CRFA 4I7YH 1WTHD 2EI7A 4BXWA 1ETRH 2WPLS 1LHGH 3SJIA 3RXEA 1S5SA 4CH8B 1XX9A 1F5RA 1DFPA 4AB9A 4XSKU 4YOIA 5C2ZA 1SGFG 4JZIA 2ZHEH 2ZKSA 3KF2A 3CS0A 3ESTA 3IITA 1E0FD 1PQ7A 2FP7B 1E34B 3H7OA 1B0FA 1GJBB 1GDUA 2R2WU 3KN2A 5DP9A 1GJ9B 2VVUA 2A1DB 2VJ1A 3MH5A 1AU8A 2FOEA 4AZ2B 4MVNA 4X2XA 1SOTA 3SU2A 2BX3A 2JH5D 1IHTH 2ALVA 1Z1JA 4THNH 3EA9A 4FUHA 3SU4A 3M35A 5C1XA 2G00A 1GBBA 3SU0A 4NWLA 1P2NA 4XBCA 2ILNA 1O2SA 3ZZCA 1OP8A 3BN9A 5DGJA 1HRTH 5CHAB 1T31A 5EXLA 4ZHMU 1ACBE 2BY7X 1EPTA 1C1TA 4I8KA 1DWDH 4MPUA 1RIWB 5JBCS 2OC1A 1AWFH 3GY5A 3BV9B 4AX9H 4DCDA 1IQIA 1SGTA 1ZPBA 3SNBA 1CT4E 3DUXH 4DIIH 1BQYA 3PROA 3M5OA 1ZSLA 4A1VA 1QBNA 1VITH 2ZQ1A 4U30A 1TMUH 2PKSC 3UNQA 1SI5H 2WPHS 3OTJE 4CHAC 4KGAA 1MZAA 1FI8A 3Q3XA 3UOPA 4I8LA 2BDHA 2QC2A 4NZLA 4DG4A 2ANWA 4O3UA 3P17H 4B73A 4CBNA 2UWPA 1MKXH 3DHKH 1FXYA 1L1GA 2BQ7B 1A5HA 2BLVA 3MO6A 1IQHA 4O97A 1FAXA 1BRAA 3KQBA 1N8OC 3TPIZ 4E7RG 1EJNA 1GL0E 1C5SA 2AGEX 3AASA 1TX6A 2FOCA 1Z8IB 1P2KA 1MCVA 1O3PB 1SQOA 2I6QA 4AORA 3P95A 3SW2B 2BZAA 2LNCA 2BD8A 1PQ8A 5L6NH 2G51A 2YNBA 4ABEA 1ABIH 1J17T 5DG6A 1BMLA 1FMGA 1ZHPA 2THFB 1YPMH 1KIGH 4TPYA 2STAE 1TGSZ 2F83A 1H8IH 1XVMA 3RXHA 4NSVA 1GI8B 5C20A 1F0UA 1HAXB 4GHQA 1GHVH 1ZLRA 2WYGA 3M5LA 3ZZ6A 4IC5A 1P02A 2FOBA 3Q77A 4ZKNU 4NZQA 3B9FH 1T4VH 1YLDA 3N7OA 2Y6TA 1K1PA 4A7IB 3MU0A 3HGPA 3KCGH 2VWMA 1HYLA 1MAXA 2CF9H 2GGVB 5GCHF 3MH6A 3M3VA 3TJOA 3OU0A 2Z6BD 3ENSB 2OC7A 1PYTD 2A4RA 1PPEE 1HV7A 2BYAX 5GPIB 4BAMB 3A87A 1Y3XA 2GD4B 1SMFE 2G55A 1XKBC 1S82A 3ATIA 4KKDA 2Y80A 3E1XB 3GCNA 5E0JA 1X7AC 1C9PA 2ZDVH 4BTIB 1P10A 1UVSH 1HAVA 2GX4A 1GMHG 1T7CA 2V6NA 3F9GA 2ZFQH 1BJUA 1BTUA 1TQ0B 1G3EA 3BTFE 2AS9A 3SV9A 1QL9A 4DIHH 1AKSB 1DE7H 3MU8A 2PSYA 1K1JA 3BG4B 2FOGA 3UOUA 5LPRA 4CREA 2HNTE 2GP9B 4YOJA 3H7TA 2XRCA 3HK6B 3ZYDA 3KL6A 3BTDE 3R0FA 1HCGA 3ZZ9A 1TOMH 2Z9GA 2QGRA 4RKOB 1DXPA 1GHWH 1TPPA 1TABE 3TGIE 2XBVA 3VXFH 4FUEA 3UNRA 1MU6B 5BPEA 4BANB 3RXUA 4NSYA 1BITA 1HJ9A 4UFFH 3NKKA 1LHCH 1AZZA 2GCHF 4OGYA 2G5NA 1BRBE 3C27B 4X8UH 1CGIE 1OX1A 4K1TA 1Z8RA 2GTBA 1EJAA 4GVUA 2OC8A 7GCHG 3RXSA 2AIPA 4Y7AA 1SGIB 1O3HA 1ELEE 5L30H 1ANCA 5IYTA 1HAPH 1UK4A 4GUXA 2VIOA 4M7GA 3MHWU 3T27A 1CHOG 3T25A 2IPHA 2Y82A 2CHAC 1NFUA 5JYIA 1ARBA 1ZPZA 6GCHG 1GWAA 1Q31A 4D7GA 1O3KA 1O3BA 5FX6A 1C5ZB 2P16A 2J9NA 1C2LA 1UTKA 5EODA 9LPRA 1GBCA 4YLQH 1HBTH 2WUBA 3TJUA 5DO4H 4NIWA 5I25A 2XNIA 1GBJA 3A7TA 1V3XA 1BA8B 1UCYH 2CMYA 2O8UA 2J95A 1TALA 2ANKH 1O3EA 2VGCC 1QBVH 2A32A 2A0QB 2XCNA 3TNSA 1MBQA 1QBOA 1WAYB 3S9AA 3KNXA 3R3GB 3S0NA 4KTSA 5E2OA 4DURA 3UIRA 5A0BA 1KXCA 3PO1C 3LPRA 1HAHH 1C5NH 3LONA 2PV9B 3CP7A 4B71A 1D6WA 1FPHH 3ATWA 1GMCF 1C2HA 3A85A 1BOQA 3ZZAA 2EEKA 1Y59T 1O30A 2D8WA 2ZDMA 2BVXH 5DP3A 1AD8H 1TNHA 1XXDA 4X0WU 1WOFA 1TX8A 3PM3A 1BJVA 1D3TB 1P3CA 2ZGHA 3KQEA 1F5LA 1ZMNA 1WSSH 3DFJA 1BTPA 1LHDH 4IGDA 5GIBA 4FU7A 2SGPE 2XC5A 3BIVH 1DWBH 4NFFA 4IN1A 4R8TB 4Q7YA 4YO9A 1CT0E 3QZQA 1L2EA 2ZFTA 5C1UA 1GPZA 4MNVA 3PTBA 1EZUC 2PHBA 1JIRA 1PQ5A 4CRBA 2KAIB 3MNXA 1C2IA 5DKMA 1GI9B 2OUAA 2FI3E 4NCYA 1S84A 1P2OA 2XC4A 1O2PA 1WQVH 5F8TA 3VFEA 2F9BH 3RP2A 8KME2 4Q7ZA 2OINA 2F9NA 2QXHA 1C1PA 1AZ8A 3A7WA 3KHVA 3KGPA 1IQJA 4IS5A 5H4IB 1NFWA 2AMPA 4ZKSU 1S6HA 3GCHB 4LK4A 5DJ7A 4NA9H 2JKHA 1Y3VA 2GT8A 1PPZA 1INCA 2EA3A 5EW1H 2ASUB 3Q00A 2A7HA 5A0CA 1XXFA 5EQSA 1ZR0A 1OPHB 1TOCB 3FFGA 3SQEE 1DLEA 4IMZA 3TK5A 1GI1A 4BAOB 1QURH 4K1EA 1YLCA 4X1SU 2G5VA 4CBOA 1SOZA 1WUNH 3QK1A 1O0DH 1ESAA 3NWUA 1NT1A 1P3EA 2A7JA 4OS7A 3F9EA 9ESTA 3MO3A 4RKJB 2GVFA 1QL8A 2A5AA 1BCUH 1XKAC 1OSSA 3SJOA 4AG1A 2NU1E 1W13U 1GJ5H 3EAJA 1BHXF 4X1NU 3TH3H 1FLEE 1V2ST 3BF6H 1L1JA 3P70B 3LOXA 4Q7XA 1V2TT 5GJ4B 1JMOH 4RN6A 4AG2A 4Y0ZE 2ESTE 1P8VC 1IQKA 1A5GH 4BTTB 4B75A 4WJG2 2HRVA 4FUCA 4QT8C 3U1IB 1RIWC 1SGQE 1S83A 1GG6B 1FIWA 3A8DA 1C5WB 1NM6A 1UVUH 3SJ9A 1J15A 4OS2A 1CA8B 2ZIQH 1C1VH 1ETSH 1GJAB 2ZI2H 2ZHQH 3RMLH 4DJZB 3SU5A 2FS9A 3FP6E 4X6NA 5A8XA 1H4WA 3IG6B 3Q76A 4I8JA 5JBTA 1AI8H 2C8WB 1W0ZU 3P8NA 1DANH 1GI7B 2WPMS 2P59A 5EPNA 1C1WH 1BMAA 2EI8A 7KMEH 1WV7H 2A2QH 1GHAG 5GDSH 1AFQB 1LQEA 3U1JB 1TAWA 2FEQH 1DOJA 2J2UA 2A4OA 1GVLA 2Z7FE 1S0QA 4ZXXH 1G37A 3WY8A 5DP8A 1P2IA 2J92A 1GBAA 4NG9H 1O2WA 3ZZDA 5EG4A 2W3KA 1SHHB 2ZFFH 1TBQH 4FVBA 1O2JA 3ODFA 1QJ7B 2RDLA 4A1XA 1TWXB 1BZXE 2VGCB 1GL1A 2OC0A 2UWLA 2O8WA 1IQFA 5IDKA 2VIQA 1ZPCA 2GCTB 5K0HA 5GXPA 1V2QT 4YESB 3Q3YA 2VIPA 2XCFA 3PO1B 3UR9A 1YPGH 1K28D 1O3FA 3TK6A 2PGQB 1HIAB 2ZTYA 1NC6A 1W7GH 4WXIA 1MTSA 5T6DA 1YGCH 1BUIA 1GJ8B 1QA7A 4CRDA 3SU6A 1J9CH 4DGJA 1DSUA 2VIVA 1QTFA 2WYJA 3BEIB 3SGQE 2FI4E 5GWZA 1ZOMA 2G4UA 3OYPA 1AVXA 1HUTH 3LGTA 1GBTA 1W11U 1V2LT 3GY3A 5F8XA 1A2CH 1RS0A 2K1QA 1KSNA 2A4QA 4E05H 2UUKB 3QDZB 1SGPE 1SGEE 4TYDA 2BLOA 4NA7A 4OS1A 2AYWA 4CR5A 4BAKB 5A0AE 3PMAB 2BD7A 3P92A 2FOFA 1VITG 3GY6A 4FUGA 1JOUB 3Q3KA 1UK2A 4INLA 1BIOA 4JZEH 3BEUA 3V13A 1W8BH 1TRMA 3GY4A 3SGBE 2ZFSA 2C4FH 2Q6GA 4HGCA 4ABHA 1O39A 1LHEH 3CS7A 1L4ZA 1N1LA 2FDAA 2VWLA 3JZ2B 2OQ5A 1GBIA 3BG4C 1AFEH 1BBRH 4UFEH 3HGNA 3KQCA 1WQSA 3QUMP 1LPGB
chains in the Genus database with same CATH superfamily
1O2MA 1YBWA 4AYVB 1C1RA 2ZDLA 1QJ1B 4Y8XA 3GDSA 5AFZH 1QHRB 1FIZA 3P6ZB 2Y7XA 1Y3UA 5FPSA 1YF4A 3RXBA 2BDGA 2QYIA 2W7SA 1IQGA 3EDXB 4H42U 1S85A 1BDAA 2ZECA 3M7QA 4MQAA 3MU1A 1NZQH 1WTGH 3KQDA 3ZV8A 4U01A 4X1RU 1ELDE 1EX3A 3T26A 5AHGH 2RG3A 5PTPA 3G01A 3LH3A 1ESBA 4B1TA 2ZWLH 4AFSA 3P8FA 4FUBA 4YOGA 1NPMA 2TGTA 3RU4E 1D3PB 3BEFB 1SGNE 1P9SA 1SR5C 2FLRH 1V2UT 2XBXA 5T6FA 1VGCB 3F9FA 2QF3A 3SNEA 1EJMA 3SHAH 3UNSA 5A09A 3FVFB 2SGQE 3RXKA 1O5BB 1CHGA 1MKXK 2FIRH 3ZVEA 3U98H 1T8MA 4FUJA 4XFQA 3SUEA 1UHBB 4INKA 2A4GA 1O3AA 3F6UH 3PV5A 1O35A 2ZDNA 2WV4A 4X2YA 3TVJB 3RXAA 1YC0A 1K0HA 4X2WA 1A1RA 3D49H 1WDIA 1FAKH 3AAUA 5EXMA 4GCHG 5EQRA 3MNBA 2BDAA 1UTQA 3K6YA 1ELTA 1E36B 2Z9IA 2TRMA 3UR6A 3VB4A 1EPTC 3HKIB 1YYY1 2DE8A 3PV2A 1XUIA 1AO5A 3STIA 2ZPQA 1O5AB 3B8JA 3DFLA 4K1SA 1YCPM 1O34A 4FETA 4TY6A 1P09A 3M5NA 4AC9A 5CHBA 5J4QA 1YWUA 1C5YB 1SGDE 1HAOH 3LGUA 3GCTG 1QRZA 2EI6A 1EB2A 1M9UA 3SZEA 1WCZA 1FY5A 3OEED 1WXRA 2F9OA 4NA8A 1C5MD 3U8OH 1KDQB 2H9EH 1ANEA 2BTCE 3PMHB 1SL3A 1YLNA 1K1NA 3M36A 3SOSA 1EATA 1QA0A 3OY6U 1W7XH 1A7SA 1WU1A 2OQUA 1H9LB 1HGTH 1GI0A 2BDIA 1ZTKA 3AVZA 1S81A 2XWAA 2QF0A 5C94A 3A80A 4AFZA 4DVAU 2BB4A 2OXSA 3EA8A 4VGCB 2A31A 1K21H 3E91A 2KM0A 3PV4A 1LVBA 1C2FA 1IQNA 1K1OA 3LGVA 3O8DA 4X6OA 1QL7A 3LH1A 1O2ZA 4YZUA 5C0UA 4RT0A 5TJXA 2KAIA 4Y8YA 4U32A 1C1SA 1W0JD 3SV8A 1C5TA 1NBMD 1OYTH 4ABJA 3V0XA 3UTUH 1ARCA 1O2YA 3QO6A 5E8EH 2G4TA 2Z3DA 2CF8H 3D62A 3GCHC 3F9HA 5LPEA 1ELBA 1EAUA 1QCPA 1CU1A 2A5IA 1BTXA 4AN7A 2WV5A 3GOVB 4O9VA 1BT7A 1O3NA 4ABDA 1A61H 2ZGXH 2TPIZ 2VH0A 3SNAA 2ZU3A 2BD5A 1SFIA 1OHHD 3KIDU 2F3CE 4PROA 1EP6A 1GDQA 1SLVB 3SQHE 5JBAS 1O2OA 3EE0B 1O2LA 1RRKA 4D7FA 2W26A 3PMBB 3NCLA 1YPJH 2F9VA 2GDEH 3T29A 3MU4A 1V2RT 3TIUA 2R2MB 2SNWA 4F55A 1MH0A 1NU9A 1Q2WA 2F9PA 1C5QA 1CGHA 2Q6FA 5AVDA 1BTYA 2HVXA 2P8OC 3MMGA 5DP7A 2ULLA 1JRTA 5E0HA 1O2RA 1V6DA 1IOEA 1K1IA 2FOHA 1TGCA 3QTOH 4XBDA 4Z6AH 5LH8A 4D76A 3UPEA 2XTTB 2GT7A 1O36A 1TBZH 3K2UA 2Z3EA 1SQTA 3M7UA 3JZ1B 4ZUHA 1GMHF 1UCYK 1ETTH 1W0KD 1P12E 1LCYA 1EXFA 1SBWA 2PKAA 3SUFA 5B6LA 1GG6C 1GJ7B 4Y7BA 1ZRBA 1GVZA 4D9QA 1GI4A 1NTPA 3PTNA 3ZZ4A 3O8CA 1T4UH 3RC4A 3M37A 4IMQA 2W5EA 3I29A 1AN1E 2J34A 3F68H 1GJCB 1V2KT 3E0NB 1NN6A 2SGAA 1DWCH 6LPRA 1T8NA 1YPLH 1FPCH 2D1JA 3M61U 2M5TA 2ZU4A 1KXDA 4J2YB 1Y3YA 3D23A 2ANMH 3MNSA 4LOYH 4ISLA 1RFNA 1AFQC 3E16B 1DUEA 2M2AA 1C5RA 1SQAA 5ESBA 1DS2E 2H9HA 4DOQA 2ZNKH 1LDTT 2TGAA 2ZTZA 3SV6A 4I33A 3OY5U 2R0LA 7GCHF 1NESE 4Z0KA 5DN6D 1TRYA 3RXQA 3WW7A 2PP6A 2RA0A 1QR3E 3DA9B 3PB1E 1O2GH 1EOLA 2AGIX 3P8OA 4YLUA 1F0RA 2AEIH 4XDEA 4J1YA 1MABB 1CHOF 1EPTB 1WBGB 1O3OA 4F49A 1XVOA 2XOKD 2GCTC 1TMTH 3MH7A 4Y76A 6GCHF 1C2KA 2CV3A 1O5EH 3E90B 3TGKE 1O2UA 3RMOH 1VCPA 1MQ5A 2OBQA 2VWOA 4A92A 1A0JA 2XBWA 5LGOA 1IQLA 2B5TB 4ZHAA 2ZTXA 3A8CA 2FX6A 1C1QA 5C5NA 4ISHH 3SUGA 1NS3A 4TWYA 3GDVA 1AY6H 4WVPE 1ABJH 2SFAA 1MTVA 5DK1A 2G52A 1ANBA 4YT7H 1LKBA 4WH6A 1A4WH 2FYRA 1NFYA 2BX4A 3ZVDA 5HKKD 1TPAE 5DP5A 3VB3A 2ZDKA 4IBLH 1LVMA 1VJAU 1ESTA 1O3JA 1DUAA 1O3MA 1HPGA 2F4LA 5JDUB 1KXBA 2XWBI 2O9QA 1W2KH 1HB0B 2P3UB 2C8YB 2ZCHP 2VWNA 1HFDA 1CE5A 1PPCE 4BAHB 5L2ZH 3BG8A 3V12A 2XYAA 1NU7B 4B2BA 3EGKH 2BHGA 2ZC9H 1EKBB 2FWWA 3GS9A 2JETB 2IOTA 1GCTB 1B0EA 5EU8A 1J14A 3TJVA 1F7ZA 3SUDA 4FUFA 1GHBG 2BDBA 4FU9A 4WMFA 2H5DA 1V2NT 1TA2A 2V7QD 2F9UA 4OS4A 1F2SE 3PYHA 3RXDA 1GHXH 1A3BH 3TGJE 4AGKA 1QIXB 3URCA 3AK5A 1KXEA 3SU3A 2KX4A 2BOHB 1C9TA 3I77A 4X8VH 3LDXH 2B0FA 1J16A 3HKJB 3ZVBA 1ZGVA 3SYJA 1Y5BT 2FO9A 3T5FH 5HM9A 3A89A 1BHXB 4B6EA 2PR3A 2FI5E 1LQDB 2WUCA 1KY9A 1O2VA 4MPXA 2C8ZB 3ZVCA 1G3BA 1SB1H 4Y8ZA 3EA7A 4ZHLU 4JZ1A 1MMJN 1H8ED 3ZZ8A 3LKWA 2ODQA 1P11E 1YPHC 3L6PA 1K9OE 1GMDG 1GI2A 1TRNA 1H8DH 3GCOA 1MU8B 2PUQH 2TIOA 4I86A 3URDA 2ZPSA 1HAVB 1QY6A 2BMGB 1VGCC 4TT3D 3GY2A 3MH4A 4R0IA 1O5FH 2QXIA 1OWJA 5FAHA 2P8OB 1TE0A 1PJPA 4NIVA 2O8TA 2HPQH 1QFKH 2D2DA 1FNIA 1A0LA 1ZTJA 1JBUH 1TGTA 2PW8H 1RTLA 3VEQB 1UTLM 2C8XB 2AERH 5A8ZA 3ATKA 1OP2A 3UWJH 4X1PU 1FY3A 5AF9H 5FHTA 1EAIA 3O8RA 3RXOA 4IC6A 2GZ9A 4FUDA 1Z1IA 2PWXA 3SGAE 1LPKB 4ESTE 5TCCA 1GDNA 1XMNB 1TB6H 2IJOB 2BZ6H 1LHFH 2ZGCA 1PQAA 3OFND 1OOKB 1AGJA 5C67A 4H4FA 4ZXYH 1SVPA 1W3CA 4X6MA 2C93B 1OWEA 5T1VA 3RXTA 5T6GA 4MLFB 4GPGA 2P95A 1GHZA 4GAWA 3W94A 1O2HA 2RA3A 4WMDA 3ZZ3A 3KEEA 2A2XH 1SPJA 4Y0YE 3LC3A 3A86A 1C2EA 1W0YH 2HALA 2JH0D 1UCYE 5E0GA 4ZAEA 5F53A 4Y79A 4XD7D 1OP0A 1DLKB 1BMMH 2VNTA 2PLXA 3SI4H 1THRH 4WH8A 8GCHG 1ZGIA 2J4IA 1SSXA 3BIUH 1C1OA 4X1QU 1NRSH 4NIXA 1KDQA 5JB9S 2Q1JA 1G2LA 1DY9A 3U69H 1TGBA 1P06A 1GHAF 1Z7KA 4E7NA 2Z3CA 3K6ZA 2ANYA 2DUCA 4HZHA 1DY8A 1H1BA 1O2NA 1PPHE 1YPEH 2HNTF 1F0SA 4D8NA 1C1UH 2GMTB 1O3LA 3RXRA 3RXPA 2VINA 5EIYA 2ZDAH 1GBLA 2FM2A 3DCLA 5F6MA 1AHTH 1FJSA 4E06H 4VGCC 1JWTA 2G8TA 3E8LA 1BBRK 1E79D 4TY7A 4BXSA 3SI3H 5EW2H 2DE9A 3M5MA 2Z94A 1NROH 2BD9A 1TBRH 1O38A 2FX4A 2IJD1 2ODYB 5E2PA 3GYMA 1CBWC 4I31A 4O3TA 3BTEE 1JXPA 1KTTB 1EAXA 1CA0C 4X6PA 1P0SH 2PGBB 2VH6A 2BLQA 2HLCA 3HK3B 3E0PB 2Z9LA 3SNDA 1O2XA 2FZZA 1YKTA 1LVOA 1TGNA 2ZG0H 3A7VA 5G4BA 1G3CA 4FUIA 2XNDD 3K9XB 4B6FA 3ZZ5A 3B23B 3BTTE 3ZVAA 4I8GA 2P94A 5DP6A 1BTWA 3A7YA 2QXGA 2XBYA 2Y5HA 1FN6A 4H6SB 2BY6X 3S9CA 5ESTE 3AW1A 4UFDH 4ZH8A 1EP5A 4JK5A 1O2QA 3MWIU 2NU0E 2QA9E 1VCQA 1Z8JB 2OTVA 2ZCLP 2ZU1A 2O8LA 1AKSA 2KCPA 1BMFD 1HXEH 1NFXA 1ZYOA 1P2JA 2YMSC 3OEHD 4INHA 1MD7A 3QGNB 1VITF 3M7TA 3NK8A 5HMAA 3LGIA 1EB1H 1SGYE 2ZA5A 2V0BA 2ZP0H 1QJ6B 2R0KA 5K7RA 1BTHH 3OAAD 4DT7B 1TA6A 3IWMA 3LGWA 1MKWK 2NU4E 4YXWD 2FOAA 4U2WA 1O31A 1AVWA 1RJXB 1T32A 5IK2D 2B8OH 4AFUA 3RXGA 1QB6A 5ABWA 1EQ9A 1A0HB 1UTNA 3VGCB 2KCYA 3BTKE 4F48B 1UVOA 3SJ8A 3L3TA 3SZNA 1BRUP 4NGAH 1COWD 2ALPA 4P00A 5EGMA 4A1TA 3PRDA 2Y81A 1GBKA 1XUGA 2NU3E 1UTOA 1IHSH 2QN5T 1NRNH 3RXFA 2A45B 2V3HH 1XUJA 1TNGA 2ZGBH 3M3SA 1QGFA 1CT2E 1CVWH 2CK3D 3PWCA 2ZHWH 2H6MA 3BTQE 4YM9A 2OCVB 7LPRA 4CH2B 3O8BA 3N7DA 5ETXA 3QN7A 1HAIH 3ZYEA 1BB0B 5DPAA 4IW4E 1VZQH 4Q2KA 1G36A 5C5OA 5J4SA 3UQOA 2VIWA 1C5UA 2FYQA 2FLBH 4MTBA 1DT2A 1MKWH 3ITIA 4MPVA 4Z1MD 3FAOA 3BSQA 5EJ1A 1PPBH 2FPZA 2NU2E 4IN2A 3FO8D 4I32A 1LKAA 1EZXC 1YCPH 3QWCH 4MNYA 4XE4A 1S6FA 3SHCH 3RM2H 3ELAH 3GY8A 2NWNA 4P02A 1B7XB 1QNJA 2FODA 2BM2A 3F2HA 3S69A 5L2YH 7ESTE 2TGDA 1BTZA 1N6YA 1IAUA 4GCHF 4RI0A 3QGJA 3RLWH 3ZZ7A 5JB8S 1DSTA 1P05A 1SLXB 2SGEE 4ZROA 3GISB 3A8AA 1KLJH 3T28A 4M9FA 1A5IA 1Y5AT 4K69A 3VB5A 4JCNA 1GBMA 4B2CA 3PLPA 3LT3A 1QRXA 1NRQH 2OK5A 4A6LA 1WYKA 2J98B 3S7HB 3MOCA 4X8TH 2QCYA 2K8IA 1RXPA 2CJIA 3RXLA 3CENA 3QTVH 1FY1A 1UVTH 3GCTF 3F2FA 3SJKA 1O3GA 3W1EA 2BOKA 3GDUA 1S0RA 1C2JA 2VVCA 2A5KA 5FCRA 3LJOA 2GZ7A 3RDZA 3FP8E 1FONA 1C2GA 1GBDA 3SU1A 2JETC 1GCTC 1HNEE 4WF8A 3RM0H 3E3TA 1V2PT 1GBEA 3LC5A 3VG8A 2BLWA 2HGTH 2CGAA 2OBOA 4YTAA 1CQQA 2VU8E 1CBWB 5GCHG 4ABAA 1D4PB 1GVKB 4JK6A 2AFQB 1BRCE 2H5CA 1Y5UT 1CA0B 1ZRKA 4XOJA 5HIZA 3D65E 1L0ZA 1ZHMA 1TNLA 1C4Y2 5A8YA 2SNVA 1DX5M 2BD3A 2JJ1D 2ZGJA 4JZDH 2B9LA 1ZMLA 2H2ZA 1EAWA 2K0QA 1P2QA 3MU5A 2BXTH 3OSYA 1DITH 1H9HE 3U8TH 3UFAA 2JH6D 3PWBA 1BBRE 1AB9B 2TBSA 2AMQA 2GZ8A 1HLTH 1TYNA 2VB0A 2R3YA 1GBFA 1TNKA 1VR1H 1EOJA 3HPTB 1GI3A 1HXFH 4JYVH 4ISOA 1XUKA 2AIQA 2HVYB 3DSOA 2YMSB 4OS6A 5FPTA 3FP7E 2JIZD 4K3JA 1AMHA 2HOBA 3VB7A 1DWEH 3FANA 1RGQA 6ESTA 2V3MA 2STBE 3SBKA 1K22H 2BY9X 1KMHB 2H1UA 4K2YA 2ZU2A 2GCHG 1FQ3A 1T8LA 2OD3B 3I78A 4MNXA 4NWKA 1S6LA 2BDYA 1C4U2 1JIMA 1HJAB 1P03A 1D3QB 4HTCH 1Q3XA 4YT6H 2WPKS 3RXCA 2F43B 1GJDB 1UVPA 4F4OC 2L74A 1KYNA 1E35B 2WPJS 2GV7A 4ASHA 1C5OH 1NRRH 1ELCA 1T8OA 4ZMAH 1ORFA 3RXVA 1TIOA 4HFPB 1CO7E 1NBME 3CNRA 1TNJA 3TH2H 1MTNC 1KTSB 1UJ1A 1BMNH 1O3IA 2HNTC 1AE5A 4UD9H 4A5TS 3QZRA 1C2DA 5B6OA 5HGGA 1XUFA 1K1MA 2QXJA 1C5VA 3V7TA 1KXFA 2KR7A 1ELVA 2J5UA 1LPZB 4WXVA 1O5GH 3MI4A 1NO9H 2W3IA 3LU9B 1DPOA 2ZFRH 4B2AA 5SGAE 1GI6A 3RLYH 1L4DA 1LVYA 4KTUA 1ZJKA 2Q6DA 2AMDA 1G2MA 1GHYH 2ZPRA 3H09A 4BTUB 4CRAA 6CHAC 5F8ZA 1IQEA 1O2KA 4TPIZ 5JPMH 5EOKA 4UFGH 1THPB 1D9IA 2UWOA 3M3TA 1B5GH 4RT1A 2JJ2D 2GMTC 3QLPH 1GI5A 3RXMA 1GJ4H 1FY8E 2HPPH 2J94A 1GMCG 1F92A 4AOQA 4UONA 1O37A 1XUHA 1Z6EA 3ATMA 8LPRA 4KP0A 3A8BA 5EXNA 1OS8A 1OWKA 4Y10E 3ZVGA 5C0TA 3DD2H 2LPRA 4CR9A 1D6RA 3T2NA 1UTMA 2KCAA 1U6QA 1ID5H 2AGGX 4BNRA 1C5LH 1SC8U 5FBEA 1UW7A 1HIAA 1CSOE 1ZMJA 4NIYA 5EPYA 4JZFH 2XXLA 2PKSB 4UE7H 1K2I1 1HAYB 2BXUH 4CHAB 1FN8A 1RD3B 1UTPA 4GSOA 1O5CB 3VB6A 1IQMA 4WWYA 4DY7B 1PYTC 5HYOA 2EC9H 1HJ8A 5T3HA 2V35A 2BD4A 3W95A 2WV9A 2ZZUH 1TPOA 1TPSA 2R9PA 4KTCA 1ELAA 1SGCA 4HI3A 1V2WT 4ACBA 1C5PA 1W12U 1F5KU 5FXLA 1J8AA 3RMMH 5KEDA 2PUXB 1MTWA 3ZIAD 1N8OB 1OXGA 4TWWA 1F0TA 1PPFE 3U9AH 4MG3A 4FVDA 1AQ7A 2Y5GA 2QY0B 1C5XB 1OYQA 2F91A 2O8MA 2YNAA 3EQ0H 1ZSKA 1W14U 1Y3WA 1GGDC 1MD8A 2SGDE 3NPSA 3SO3A 1YPHE 2IN2A 2SGFE 4ABFA 1A3EH 3K65B 5FX5A 4LZ1H 1DVAH 2P3TB 2PSXA 1EASA 1FZZA 1YM0A 1MCTA 3FZDA 2BY5X 5FPYA 3FZZA 1DM4B 2ZFPH 1MZDA 1NY22 3A7ZA 3TJNA 4FXGH 2QIQA 3L33A 2CXVA 2ODPA 1SKYE 1LMWB 5CDFE 1AVGH 1Z71A 4GLYA 2TGPZ 5TCAA 3RUOA 3A7XA 4SGAE 1KLIH 2KZ4A 4SGBE 1P2MA 1GHBF 1O2TA 1ELGA 1DICA 2ZHDA 3TNTA 4CRGA 1RTKA 5FBIA 2VBCA 4B76A 1GCDA 8ESTE 3VGCC 4AGJA 1SLUB 3U8RH 2FTLE 3F0PA 3UY9A 4ABGA 4FU8A 1AUTC 1TLDA 2BD2A 3F0OA 2AH4X 2W7UA 4KELA 1E38B 1C1MA 2BVSH 4K60A 5DP4A 1GBHA 2C3SA 1ZSJA 1SGFA 1H9IE 4ABBA 1EUFA 1HAGE 2WPIS 1ZHRA 3GICB 1QQ4A 2HWLB 3VPKA 2BY8X 5LPFA 4JMYA 2P3FH 3RXIA 1K1LA 4XBBA 3PMJA 3A83A 1QB9A 3ATLA 3PLKA 2UUFB 1QRWA 1N6XA 4I8HA 1GMDF 4WMEA 2RCEA 5HXFA 1UHBA 1O5DH 4Q4LA 1G3DA 1SGRE 3BTGE 2KFWA 3ZZBA 1ZTLA 4ZKRU 3GY7A 2Y7ZA 1UTJA 2ZO3H 2GV6A 1C4V2 2FXRA 2ZEBA 2J38A 2YMSD 1O3CA 2PKAB 4Q80A 3TK9A 3BTWE 4OS5A 1TQ7B 2H9TH 4GHTA 3A82A 1PPGE 1UMAH 1JRSA 5CHAC 3LJJA 3A84A 3OX7U 3AW0A 3EYDA 3S7KB 2XW9A 1MTNB 1TX7A 1ZZZA 2PTCE 5BRRE 1E37B 3KQ5A 3TH4H 3SV7A 4K8YA 5AFYH 1MUEB 1YP9A 2ZCKP 3ODDA 2ZU5A 4ISIH 3NXPA 3S9BA 1AUJA 1THSH 1V2MT 2D26C 1HAZB 2QAAA 2VVVA 1Z8GA 3UWIA 4H6TA 2FTMA 3T62A 1V2VT 1ANDA 1HDTH 4OGXA 4CRCA 2FOMB 3STJA 2JDID 1EZQA 2CHAB 3F1SB 1TONA 3UUZA 3V3MA 4DW2U 4Q63A 4B74A 3SNCA 1O32A 2P93A 6CHAB 2YOLA 4MNWA 1FY4A 2Z9JA 1GJ6A 3E6PH 2GKVE 2ZHFH 1SQRA 1RTFB 2BQWB 1SFQB 1C1NA 1LTOA 3NUMA 1DDJA 4X8SH 1XM1A 1KXAA 3VXEH 4K8BA 3MTYA 3C1KA 1QB1A 4UEHH 1NRPH 5C3NA 1TFXA 3AAVA 1D3DB 3SORA 1L1NA 3MYWA 2QV1A 3RXJA 3TITA 1O2IA 4ZKOU 2Z9KA 1E1RD 1YPKH 8GCHF 4ISNA 5GNDA 2I6SA 1UK3A 3SN8A 4NFEA 2FS8A 1VCWA 2J97A 1CGJE 5EQQA 2XC0A 5I46H 2R3UA 1P04A 1C2MA 3MO9A 4AB8A 2ZF0H 1AWHB 3ZV9A 1SHYA 5A2MH 2BVRH 3RU4T 2UUYA 3RMNH 1MQ6A 3GYLB 1DXWA 1AIXH 1V2JT 3RU4D 1ZJDA 4TSFD 5HM2A 1G32B 4JYTA 1AE8H 5CE1A 4D9RA 2PFEA 2FESH 2WINI 1P01A 1P9UA 1Y8TA 3WWFA 3UQVA 4BAQB 3A81A 1G9IE 1TMBH 2B7DH 2WSSD 3SV2H 1P57B 3NZIA 3P8GA 1FV9A 3UREA 4Y11E 1OWIA 3ZVFA 1ELFA 1QQUA 1O3DA 2FMJA 3TU7H 3H5CB 3MNCA 1EZSC 2A7CA 2GDDA 4X2VA 1AB9C 3RC5A 1FDPA 1MBMA 2VIDA 2PTNA 2OLGA 2C90B 3TLOA 1OKXA 4ZCNA 1GGDB 3HATH 2G81E 4JYUH 1TNIA 3RC6A 1FUJA 1FX0B 3OTPA 5JBBS 4WY3A 4Y71A 1Z6JH 1UO6A 4AFQA 2Y5FA 1SLWB 1A46H 4BOHA 3LGYA 1OWHA 3LIWA 5F03A 2CN0H 4LZ4B 4O03A 4LXBH 2LP6A 2ZQ2A 5C1YA 1YY3A 2UUJB 5CMXH 1OWDA 1VJ9U 2BQ6B 1PFXC 3QX5H 4K5ZA 1HJAC 1G30B 1SG8B 3BTME 3A88A 3PLBA 4AYYB 2BDCA 2OP9A 1KLTA 5FCKA 1LO6A 4Y6DA 2V3OH 3MFJA 4UDWH 4MPWA 1YCPK 1O33A 1W10U 3BTHE 3DT0H 4MDSA 4ABIA 1V2OT 4ASUD 1MTUA 1MAYA 4RSPA 4CRFA 4I7YH 1WTHD 2EI7A 4BXWA 1ETRH 2WPLS 1LHGH 3SJIA 3RXEA 1S5SA 4CH8B 1XX9A 1F5RA 1DFPA 4AB9A 4XSKU 4YOIA 5C2ZA 1SGFG 4JZIA 2ZHEH 2ZKSA 3KF2A 3CS0A 3ESTA 3IITA 1E0FD 1PQ7A 2FP7B 1E34B 3H7OA 1B0FA 1GJBB 1GDUA 2R2WU 3KN2A 5DP9A 1GJ9B 2VVUA 2A1DB 2VJ1A 3MH5A 1AU8A 2FOEA 4AZ2B 4MVNA 4X2XA 1SOTA 3SU2A 2BX3A 2JH5D 2EQNA 1IHTH 2ALVA 5EJZA 1Z1JA 4THNH 3EA9A 3EE7A 4FUHA 3M35A 3SU4A 5C1XA 2G00A 1GBBA 3SU0A 4NWLA 1P2NA 4XBCA 2ILNA 1O2SA 3ZZCA 1OP8A 3BN9A 5DGJA 1HRTH 5CHAB 1T31A 5EXLA 4ZHMU 1ACBE 2BY7X 1EPTA 1C1TA 4I8KA 1DWDH 4MPUA 1RIWB 5JBCS 4ACAA 2OC1A 1AWFH 3GY5A 3BV9B 4AX9H 4DCDA 1IQIA 1SGTA 1ZPBA 3SNBA 1CT4E 3DUXH 4DIIH 1BQYA 3PROA 3M5OA 1ZSLA 4A1VA 1QBNA 1VITH 2ZQ1A 4U30A 1TMUH 2PKSC 3UNQA 1SI5H 2WPHS 3OTJE 4CHAC 4KGAA 1MZAA 1FI8A 3Q3XA 3UOPA 4I8LA 2BDHA 2QC2A 4NZLA 4DG4A 2ANWA 3PRBA 4O3UA 2W6JD 3P17H 4B73A 4CBNA 2UWPA 1MKXH 3DHKH 1FXYA 1L1GA 2BQ7B 1A5HA 2BLVA 3MO6A 1IQHA 4O97A 1FAXA 1BRAA 3KQBA 1N8OC 3TPIZ 4E7RG 1EJNA 1GL0E 1C5SA 3F2GA 2AGEX 3AASA 1TX6A 2FOCA 1Z8IB 1P2KA 1MCVA 1O3PB 1SQOA 2I6QA 4AORA 3P95A 3SW2B 2BZAA 3UAIC 2LNCA 2BD8A 1PQ8A 5L6NH 2G51A 2YNBA 4ABEA 1ABIH 1J17T 5DG6A 1BMLA 1FMGA 1ZHPA 2THFB 1YPMH 1KIGH 4TPYA 2STAE 1TGSZ 2F83A 1H8IH 1XVMA 3RXHA 4NSVA 1GI8B 5C20A 1F0UA 1HAXB 2RDEA 4GHQA 1GHVH 1ZLRA 2WYGA 3M5LA 3ZZ6A 4IC5A 1P02A 2FOBA 3Q77A 4ZKNU 3NRLA 4NZQA 3B9FH 1T4VH 1YLDA 3N7OA 2Y6TA 1K1PA 4A7IB 3MU0A 3HGPA 3KCGH 2VWMA 1HYLA 1MAXA 2CF9H 2GGVB 5GCHF 3MH6A 3M3VA 3TJOA 3OU0A 2Z6BD 3ENSB 2OC7A 1PYTD 2A4RA 1PPEE 1HV7A 2BYAX 5GPIB 4BAMB 3A87A 1Y3XA 2GD4B 5EJLA 1SMFE 2G55A 1XKBC 2QF5A 1S82A 3ATIA 4KKDA 2Y80A 3E1XB 3GCNA 5E0JA 1X7AC 1C9PA 2ZDVH 4BTIB 1P10A 3KYGA 2IPQX 1UVSH 1HAVA 2GX4A 1GMHG 1T7CA 2V6NA 3F9GA 2ZFQH 2QE7D 1BJUA 1BTUA 1TQ0B 1G3EA 3BTFE 2AS9A 3SV9A 1QL9A 4DIHH 1AKSB 1DE7H 3MU8A 2PSYA 1K1JA 3BG4B 2FOGA 3UOUA 5LPRA 4CREA 2HNTE 2GP9B 4YOJA 3H7TA 2XRCA 3DSPA 3HK6B 3ZYDA 3KL6A 3BTDE 3R0FA 1HCGA 3ZZ9A 5HIYA 1TOMH 2Z9GA 4DT4A 2QGRA 4RKOB 1DXPA 1GHWH 1TPPA 1TABE 3TGIE 2XBVA 3VXFH 4FUEA 3UNRA 1MU6B 5BPEA 4BANB 2EY4C 3RXUA 4NSYA 1BITA 1HJ9A 4UFFH 3NKKA 1LHCH 1AZZA 2GCHF 4OGYA 2G5NA 3MQKC 1BRBE 3C27B 4X8UH 1CGIE 1OX1A 4K1TA 1Z8RA 2GTBA 1EJAA 4GVUA 2OC8A 7GCHG 3F3BA 3RXSA 2AIPA 4Y7AA 1SGIB 1O3HA 1ELEE 5L30H 1ANCA 5IYTA 1HAPH 1UK4A 4GUXA 2VIOA 4M7GA 3MHWU 3T27A 1CHOG 2L6OA 3T25A 2IPHA 2Y82A 2CHAC 1NFUA 5JYIA 1ARBA 1ZPZA 6GCHG 1GWAA 1Q31A 4D7GA 1O3KA 1O3BA 5FX6A 1C5ZB 2P16A 2J9NA 1C2LA 1UTKA 5EODA 9LPRA 1GBCA 2AHME 4YLQH 1HBTH 2WUBA 3TJUA 5DO4H 4OM9A 4NIWA 5I25A 2XNIA 1GBJA 3A7TA 1V3XA 1BA8B 1UCYH 2CMYA 2O8UA 2J95A 3KYFA 1TALA 2ANKH 1O3EA 2VGCC 1QBVH 2A32A 2A0QB 2XCNA 3TNSA 2W6ID 1MBQA 1QBOA 1WAYB 3S9AA 3KNXA 3R3GB 3S0NA 4KTSA 5E2OA 4DURA 3UIRA 5A0BA 1KXCA 3PO1C 2WZQA 3LPRA 1HAHH 1C5NH 3LONA 2PV9B 3CP7A 4B71A 1D6WA 1FPHH 3ATWA 1GMCF 1C2HA 3A85A 1BOQA 3ZZAA 2EEKA 1Y59T 1O30A 2D8WA 2ZDMA 3FKSD 2BVXH 5DP3A 1AD8H 1TNHA 1XXDA 4X0WU 1WOFA 3N7EA 1TX8A 3PM3A 2WPDD 1BJVA 1D3TB 1P3CA 1VKYA 2ZGHA 3KQEA 1F5LA 1ZMNA 1WSSH 3DFJA 1BTPA 1LHDH 4IGDA 5GIBA 4FU7A 2SGPE 2XC5A 3BIVH 5DSFA 1DWBH 4NFFA 4IN1A 4R8TB 4Q7YA 4YO9A 1CT0E 3QZQA 1L2EA 2KCOA 2ZFTA 5C1UA 1GPZA 4MNVA 3PTBA 1EZUC 1JIRA 2PHBA 1PQ5A 4CRBA 2KAIB 3MNXA 1C2IA 5DKMA 1GI9B 2OUAA 1EFRD 2FI3E 4NCYA 1S84A 1P2OA 4XRNA 2XC4A 1O2PA 1WQVH 5F8TA 3VFEA 2F9BH 3RP2A 8KME2 4Q7ZA 2OINA 2F9NA 2QXHA 1C1PA 3FOAA 1AZ8A 3A7WA 3KHVA 3KGPA 1IQJA 4IS5A 5H4IB 1NFWA 2AMPA 4ZKSU 1S6HA 3GCHB 4LK4A 5DJ7A 4NA9H 2JKHA 1Y3VA 2GT8A 1PPZA 1INCA 2EA3A 5EW1H 2ASUB 3Q00A 2A7HA 3N99A 2RFKC 5A0CA 1XXFA 5EQSA 1ZR0A 1OPHB 1TOCB 3FFGA 3SQEE 1DLEA 4IMZA 3UB0A 3TK5A 1GI1A 4BAOB 1QURH 4K1EA 2HLDD 1YLCA 4X1SU 2G5VA 4CBOA 1SOZA 1WUNH 3QK1A 1O0DH 1E1QD 1ESAA 3NWUA 1NT1A 1P3EA 2A7JA 4OS7A 3F9EA 9ESTA 3MO3A 2GJGA 4RKJB 2GVFA 1QL8A 2A5AA 1BCUH 1XKAC 1OSSA 3SJOA 4AG1A 2NU1E 1W13U 1GJ5H 3EAJA 1BHXF 3FN8A 4X1NU 5FL7D 3TH3H 1FLEE 1V2ST 3BF6H 1L1JA 3P70B 3LOXA 4Q7XA 1V2TT 5GJ4B 1JMOH 4RN6A 5KGOA 4AG2A 4Y0ZE 2ESTE 1P8VC 1IQKA 1A5GH 4BTTB 4B75A 4WJG2 2HRVA 4FUCA 4QT8C 3U1IB 1RIWC 1SGQE 1S83A 1GG6B 1FIWA 3A8DA 1C5WB 1NM6A 1UVUH 3SJ9A 1J15A 4OS2A 1CA8B 2ZIQH 1C1VH 1ETSH 1GJAB 2ZI2H 2ZHQH 3RMLH 4DJZB 5KECA 3SU5A 2FS9A 3FP6E 2QF4A 4X6NA 5A8XA 1H4WA 3IG6B 3Q76A 4I8JA 5JBTA 1AI8H 2C8WB 1W0ZU 3P8NA 1DANH 1GI7B 2WPMS 2P59A 5EPNA 1C1WH 1BMAA 2EI8A 3U28C 7KMEH 1WV7H 2A2QH 1GHAG 5GDSH 1AFQB 1LQEA 3U1JB 1TAWA 2FEQH 1DOJA 2J2UA 2A4OA 1GVLA 2Z7FE 1S0QA 4ZXXH 1G37A 3WY8A 5DP8A 1P2IA 2J92A 2J98A 1GBAA 4HG6A 4NG9H 1O2WA 1H8HD 3ZZDA 4FOUC 5EG4A 2W3KA 1SHHB 2ZFFH 1TBQH 4FVBA 1O2JA 3ODFA 1QJ7B 2RDLA 4A1XA 1TWXB 1BZXE 2VGCB 1GL1A 2OC0A 2UWLA 2O8WA 1IQFA 5IDKA 2VIQA 1ZPCA 2GCTB 3OE7D 5K0HA 5GXPA 1V2QT 4YESB 3Q3YA 2VIPA 2XCFA 3PO1B 3UR9A 1YPGH 1K28D 1O3FA 3TK6A 2PGQB 5C17A 1HIAB 2ZTYA 1NC6A 1W7GH 4WXIA 1MTSA 5T6DA 1YGCH 1BUIA 2WHXA 1GJ8B 1QA7A 4CRDA 3SU6A 1J9CH 4DGJA 1DSUA 2VIVA 1QTFA 2WYJA 3BEIB 3SGQE 2FI4E 5GWZA 1ZOMA 2G4UA 3OYPA 1AVXA 1HUTH 3LGTA 2LELA 1GBTA 1W11U 1V2LT 3GY3A 5F8XA 1A2CH 1RS0A 2K1QA 1KSNA 1QZ8A 2A4QA 4E05H 2UUKB 3QDZB 1SGPE 1SGEE 4TYDA 2BLOA 4NA7A 4OS1A 2AYWA 4CR5A 4BAKB 5A0AE 3PMAB 2BD7A 3P92A 2FOFA 1VITG 3GY6A 4FUGA 1JOUB 3Q3KA 1UK2A 4INLA 1BIOA 3DSGA 4JZEH 3BEUA 3V13A 1W8BH 1TRMA 3GY4A 3SGBE 2ZFSA 2C4FH 2Q6GA 3WWBA 4HGCA 4ABHA 1O39A 1LHEH 3CS7A 1L4ZA 1N1LA 2FDAA 2VWLA 3JZ2B 2OQ5A 1GBIA 3BG4C 1AFEH 1BBRH 4UFEH 3HGNA 3KQCA 1WQSA 3QUMP 1LPGB
chains in the Genus database with same CATH topology
1O2MA 1YBWA 4AYVB 1C1RA 2ZDLA 1QJ1B 4Y8XA 3GDSA 5AFZH 1QHRB 1FIZA 3P6ZB 2Y7XA 1Y3UA 5FPSA 1YF4A 3RXBA 2BDGA 2QYIA 2W7SA 1IQGA 3EDXB 4H42U 1S85A 1BDAA 2ZECA 3M7QA 4MQAA 3MU1A 1NZQH 1WTGH 3KQDA 3ZV8A 4U01A 4X1RU 1ELDE 1EX3A 3T26A 5AHGH 2RG3A 5PTPA 3G01A 3LH3A 1ESBA 4B1TA 2ZWLH 4AFSA 3P8FA 4FUBA 4YOGA 1NPMA 2TGTA 3RU4E 1D3PB 3BEFB 1SGNE 1P9SA 1SR5C 2FLRH 1V2UT 2XBXA 5T6FA 1VGCB 3F9FA 2QF3A 3SNEA 1EJMA 3SHAH 3UNSA 5A09A 3FVFB 2SGQE 3RXKA 1O5BB 1CHGA 1MKXK 2FIRH 3ZVEA 3U98H 1T8MA 4FUJA 4XFQA 3SUEA 1UHBB 4INKA 2A4GA 1O3AA 3F6UH 3TVJB 1O35A 2ZDNA 2WV4A 4X2YA 3RXAA 1YC0A 4X2WA 1A1RA 3D49H 1FAKH 3AAUA 5EXMA 4GCHG 5EQRA 3MNBA 2BDAA 1UTQA 3K6YA 1ELTA 1E36B 2Z9IA 2TRMA 3UR6A 3VB4A 1EPTC 3HKIB 1YYY1 2DE8A 1XUIA 1AO5A 3STIA 2ZPQA 1O5AB 3B8JA 3DFLA 4K1SA 1YCPM 1O34A 4TY6A 1P09A 3M5NA 5J4QA 1C5YB 1SGDE 1HAOH 3LGUA 3GCTG 1QRZA 2EI6A 1EB2A 1M9UA 1WCZA 1FY5A 2F9OA 4NA8A 1C5MD 3U8OH 1KDQB 2H9EH 1ANEA 2BTCE 3PMHB 1SL3A 1K1NA 3M36A 3SOSA 1EATA 1QA0A 3OY6U 1W7XH 1A7SA 1WU1A 2OQUA 1H9LB 1HGTH 1GI0A 2BDIA 1ZTKA 3AVZA 1S81A 2XWAA 2QF0A 3A80A 4AFZA 4DVAU 2BB4A 2OXSA 3EA8A 4VGCB 2A31A 1K21H 3E91A 3PV4A 1LVBA 1C2FA 1IQNA 1K1OA 3LGVA 3O8DA 4X6OA 1QL7A 3LH1A 1O2ZA 4YZUA 5TJXA 2KAIA 4Y8YA 4U32A 1C1SA 3SV8A 1C5TA 1OYTH 4ABJA 3V0XA 3UTUH 1ARCA 1O2YA 3QO6A 5E8EH 2G4TA 2Z3DA 2CF8H 3D62A 3GCHC 3F9HA 5LPEA 1ELBA 1EAUA 1QCPA 1CU1A 2A5IA 1BTXA 4AN7A 2WV5A 3GOVB 4O9VA 1BT7A 1O3NA 4ABDA 1A61H 2ZGXH 2TPIZ 2VH0A 3SNAA 2ZU3A 2BD5A 1SFIA 3KIDU 2F3CE 4PROA 1EP6A 1GDQA 1SLVB 3SQHE 5JBAS 1O2OA 3EE0B 1O2LA 1RRKA 4D7FA 2W26A 3PMBB 3NCLA 1YPJH 2F9VA 2GDEH 3T29A 3MU4A 1V2RT 3TIUA 2R2MB 2SNWA 1MH0A 1NU9A 1Q2WA 2F9PA 1C5QA 1CGHA 2Q6FA 5AVDA 1BTYA 2HVXA 2P8OC 3MMGA 5DP7A 2ULLA 1JRTA 5E0HA 1O2RA 1V6DA 1IOEA 1K1IA 2FOHA 1TGCA 3QTOH 4XBDA 4Z6AH 5LH8A 4D76A 3UPEA 2XTTB 2GT7A 1O36A 1TBZH 3K2UA 2Z3EA 1SQTA 3M7UA 3JZ1B 4ZUHA 1GMHF 1UCYK 1ETTH 1P12E 1LCYA 1EXFA 1SBWA 2PKAA 3SUFA 1GG6C 1GJ7B 4Y7BA 1ZRBA 1GVZA 4D9QA 1GI4A 1NTPA 3PTNA 3ZZ4A 3O8CA 1T4UH 3RC4A 3M37A 4IMQA 2W5EA 3I29A 1AN1E 2J34A 3F68H 1GJCB 1V2KT 3E0NB 1NN6A 2SGAA 1DWCH 6LPRA 1T8NA 1YPLH 1FPCH 2D1JA 3M61U 2M5TA 2ZU4A 1KXDA 4J2YB 1Y3YA 3D23A 2ANMH 3MNSA 4LOYH 4ISLA 1RFNA 1AFQC 3E16B 1DUEA 1C5RA 1SQAA 5ESBA 1DS2E 2H9HA 4DOQA 2ZNKH 1LDTT 2TGAA 2ZTZA 3SV6A 4I33A 3OY5U 2R0LA 7GCHF 1NESE 4Z0KA 1TRYA 3RXQA 2RA0A 1QR3E 3DA9B 3PB1E 1O2GH 1EOLA 2AGIX 3P8OA 4YLUA 1F0RA 2AEIH 4XDEA 4J1YA 1CHOF 1EPTB 1WBGB 1O3OA 4F49A 1XVOA 2GCTC 1TMTH 3MH7A 4Y76A 6GCHF 1C2KA 2CV3A 1O5EH 3E90B 3TGKE 1O2UA 3RMOH 1VCPA 1MQ5A 2OBQA 2VWOA 4A92A 1A0JA 2XBWA 5LGOA 1IQLA 2B5TB 4ZHAA 2ZTXA 3A8CA 2FX6A 1C1QA 5C5NA 4ISHH 3SUGA 1NS3A 4TWYA 3GDVA 1AY6H 4WVPE 1ABJH 2SFAA 1MTVA 5DK1A 2G52A 1ANBA 4YT7H 1LKBA 4WH6A 1A4WH 2FYRA 1NFYA 2BX4A 3ZVDA 1TPAE 5DP5A 3VB3A 2ZDKA 4IBLH 1LVMA 1VJAU 1ESTA 1O3JA 1DUAA 1O3MA 1HPGA 5JDUB 1KXBA 2XWBI 2O9QA 1W2KH 1HB0B 2P3UB 2C8YB 2ZCHP 2VWNA 1HFDA 1CE5A 1PPCE 4BAHB 5L2ZH 3BG8A 3V12A 2XYAA 1NU7B 4B2BA 3EGKH 2BHGA 2ZC9H 1EKBB 2FWWA 2JETB 2IOTA 1GCTB 1B0EA 5EU8A 1J14A 3TJVA 1F7ZA 3SUDA 4FUFA 1GHBG 2BDBA 4FU9A 4WMFA 2H5DA 1V2NT 1TA2A 2F9UA 4OS4A 1F2SE 3PYHA 3RXDA 1GHXH 1A3BH 3TGJE 4AGKA 1QIXB 3URCA 1KXEA 3SU3A 2BOHB 1C9TA 3I77A 4X8VH 3LDXH 2B0FA 1J16A 3HKJB 3ZVBA 1ZGVA 1Y5BT 2FO9A 3T5FH 5HM9A 3A89A 1BHXB 2PR3A 2FI5E 1LQDB 2WUCA 1KY9A 1O2VA 4MPXA 2C8ZB 3ZVCA 1G3BA 1SB1H 4Y8ZA 3EA7A 4ZHLU 4JZ1A 1MMJN 3ZZ8A 3LKWA 2ODQA 1P11E 1YPHC 3L6PA 1K9OE 1GMDG 1GI2A 1TRNA 1H8DH 3GCOA 1MU8B 2PUQH 2TIOA 3URDA 2ZPSA 1HAVB 1QY6A 2BMGB 1VGCC 3GY2A 3MH4A 4R0IA 1O5FH 2QXIA 1OWJA 5FAHA 2P8OB 1TE0A 1PJPA 4NIVA 2O8TA 2HPQH 1QFKH 2D2DA 1FNIA 1A0LA 1ZTJA 1JBUH 1TGTA 2PW8H 1RTLA 3VEQB 1UTLM 2C8XB 2AERH 5A8ZA 3ATKA 1OP2A 3UWJH 4X1PU 1FY3A 5AF9H 5FHTA 1EAIA 3O8RA 3RXOA 4IC6A 2GZ9A 4FUDA 1Z1IA 2PWXA 3SGAE 1LPKB 4ESTE 5TCCA 1GDNA 1XMNB 1TB6H 2IJOB 2BZ6H 1LHFH 2ZGCA 1PQAA 1OOKB 1AGJA 5C67A 4H4FA 4ZXYH 1SVPA 1W3CA 4X6MA 2C93B 1OWEA 3RXTA 5T6GA 4MLFB 4GPGA 2P95A 1GHZA 4GAWA 3W94A 1O2HA 2RA3A 4WMDA 3ZZ3A 3KEEA 2A2XH 1SPJA 4Y0YE 3LC3A 3A86A 1C2EA 1W0YH 2HALA 2JH0D 1UCYE 5E0GA 4ZAEA 4Y79A 1OP0A 1DLKB 1BMMH 2VNTA 2PLXA 3SI4H 1THRH 4WH8A 8GCHG 1ZGIA 2J4IA 1SSXA 3BIUH 1C1OA 4X1QU 1NRSH 4NIXA 1KDQA 5JB9S 2Q1JA 1G2LA 1DY9A 3U69H 1TGBA 1P06A 1GHAF 1Z7KA 4E7NA 2Z3CA 3K6ZA 2ANYA 2DUCA 4HZHA 1DY8A 1H1BA 1O2NA 1PPHE 1YPEH 2HNTF 1F0SA 4D8NA 1C1UH 2GMTB 1O3LA 3RXRA 3RXPA 2VINA 2ZDAH 1GBLA 2FM2A 5F6MA 1AHTH 1FJSA 4E06H 4VGCC 1JWTA 2G8TA 3E8LA 1BBRK 4TY7A 4BXSA 3SI3H 5EW2H 2DE9A 3M5MA 2Z94A 1NROH 2BD9A 1TBRH 1O38A 2FX4A 2ODYB 5E2PA 3GYMA 1CBWC 4I31A 4O3TA 3BTEE 1JXPA 1KTTB 1EAXA 1CA0C 4X6PA 1P0SH 2PGBB 2VH6A 2BLQA 2HLCA 3HK3B 3E0PB 2Z9LA 3SNDA 1O2XA 2FZZA 1YKTA 1LVOA 1TGNA 2ZG0H 3A7VA 5G4BA 1G3CA 4FUIA 3K9XB 3ZZ5A 3B23B 3BTTE 3ZVAA 4I8GA 2P94A 5DP6A 1BTWA 3A7YA 2QXGA 2XBYA 2Y5HA 1FN6A 4H6SB 2BY6X 3S9CA 5ESTE 3AW1A 4UFDH 4ZH8A 1EP5A 4JK5A 1O2QA 3MWIU 2NU0E 2QA9E 1VCQA 1Z8JB 2OTVA 2ZCLP 2ZU1A 2O8LA 1AKSA 1HXEH 1NFXA 1ZYOA 1P2JA 4INHA 1MD7A 3QGNB 1VITF 3M7TA 3NK8A 5HMAA 3LGIA 1EB1H 1SGYE 2ZA5A 2V0BA 2ZP0H 1QJ6B 2R0KA 5K7RA 1BTHH 4DT7B 1TA6A 3IWMA 3LGWA 1MKWK 2NU4E 2FOAA 4U2WA 1O31A 1AVWA 1RJXB 1T32A 2B8OH 4AFUA 3RXGA 1QB6A 5ABWA 1EQ9A 1A0HB 1UTNA 3VGCB 3BTKE 1UVOA 3SJ8A 3L3TA 3SZNA 1BRUP 4NGAH 2ALPA 5EGMA 4A1TA 2Y81A 1GBKA 1XUGA 2NU3E 1UTOA 1IHSH 2QN5T 1NRNH 3RXFA 2A45B 2V3HH 1XUJA 1TNGA 2ZGBH 3M3SA 1QGFA 1CT2E 1CVWH 3PWCA 2ZHWH 2H6MA 3BTQE 4YM9A 2OCVB 7LPRA 4CH2B 3O8BA 5ETXA 3QN7A 1HAIH 3ZYEA 1BB0B 5DPAA 4IW4E 1VZQH 4Q2KA 1G36A 5C5OA 5J4SA 3UQOA 2VIWA 1C5UA 2FYQA 2FLBH 4MTBA 1DT2A 1MKWH 3ITIA 4MPVA 3FAOA 3BSQA 1PPBH 2FPZA 2NU2E 4IN2A 4I32A 1LKAA 1EZXC 1YCPH 3QWCH 4MNYA 4XE4A 1S6FA 3SHCH 3RM2H 3ELAH 3GY8A 2NWNA 1B7XB 1QNJA 2FODA 2BM2A 5L2YH 3S69A 7ESTE 2TGDA 1BTZA 1N6YA 1IAUA 4GCHF 3RLWH 3QGJA 3ZZ7A 5JB8S 1DSTA 1P05A 1SLXB 2SGEE 4ZROA 3GISB 3A8AA 1KLJH 3T28A 1A5IA 1Y5AT 4K69A 3VB5A 4JCNA 1GBMA 4B2CA 3PLPA 3LT3A 1QRXA 1NRQH 4A6LA 1WYKA 3S7HB 3MOCA 4X8TH 2QCYA 1RXPA 2CJIA 3RXLA 3CENA 3QTVH 1FY1A 1UVTH 3GCTF 3SJKA 1O3GA 2BOKA 3GDUA 1S0RA 1C2JA 2VVCA 2A5KA 5FCRA 3LJOA 2GZ7A 3RDZA 3FP8E 1FONA 1C2GA 1GBDA 3SU1A 2JETC 1GCTC 1HNEE 4WF8A 3RM0H 3E3TA 1V2PT 1GBEA 3LC5A 2BLWA 2HGTH 2CGAA 2OBOA 4YTAA 1CQQA 2VU8E 1CBWB 5GCHG 4ABAA 1D4PB 1GVKB 4JK6A 2AFQB 1BRCE 2H5CA 1Y5UT 1CA0B 1ZRKA 4XOJA 3D65E 1L0ZA 1ZHMA 1TNLA 1C4Y2 5A8YA 2SNVA 1DX5M 2BD3A 2ZGJA 4JZDH 2B9LA 1ZMLA 2H2ZA 1EAWA 1P2QA 3MU5A 2BXTH 3OSYA 1DITH 1H9HE 3U8TH 3UFAA 2JH6D 3PWBA 1BBRE 1AB9B 2TBSA 2AMQA 2GZ8A 1HLTH 1TYNA 2VB0A 2R3YA 1GBFA 1TNKA 1VR1H 1EOJA 3HPTB 1GI3A 1HXFH 4JYVH 4ISOA 1XUKA 2AIQA 4OS6A 5FPTA 3FP7E 4K3JA 1AMHA 2HOBA 3VB7A 1DWEH 3FANA 1RGQA 6ESTA 2STBE 3SBKA 1K22H 2BY9X 2H1UA 4K2YA 2ZU2A 2GCHG 1FQ3A 1T8LA 2OD3B 3I78A 4MNXA 4NWKA 2BDYA 1C4U2 1JIMA 1HJAB 1P03A 1D3QB 4HTCH 1Q3XA 4YT6H 2WPKS 3RXCA 1GJDB 1UVPA 4F4OC 1KYNA 1E35B 2WPJS 2GV7A 4ASHA 1C5OH 1NRRH 1ELCA 1T8OA 4ZMAH 1ORFA 3RXVA 1TIOA 4HFPB 1CO7E 1TNJA 3TH2H 1MTNC 1KTSB 1UJ1A 1BMNH 1O3IA 2HNTC 1AE5A 4UD9H 4A5TS 3QZRA 1C2DA 5B6OA 5HGGA 1XUFA 1K1MA 2QXJA 1C5VA 3V7TA 1KXFA 1ELVA 1LPZB 4WXVA 1O5GH 3MI4A 1NO9H 2W3IA 3LU9B 1DPOA 2ZFRH 4B2AA 5SGAE 1GI6A 3RLYH 1L4DA 1LVYA 4KTUA 1ZJKA 2Q6DA 2AMDA 1G2MA 1GHYH 2ZPRA 4BTUB 4CRAA 6CHAC 5F8ZA 1IQEA 1O2KA 4TPIZ 5JPMH 5EOKA 4UFGH 1THPB 1D9IA 2UWOA 3M3TA 1B5GH 2GMTC 3QLPH 1GI5A 3RXMA 1GJ4H 1FY8E 2HPPH 2J94A 1GMCG 1F92A 4AOQA 4UONA 1O37A 1XUHA 1Z6EA 3ATMA 8LPRA 4KP0A 3A8BA 5EXNA 1OS8A 1OWKA 4Y10E 3ZVGA 3DD2H 2LPRA 4CR9A 1D6RA 3T2NA 1UTMA 1U6QA 1ID5H 2AGGX 4BNRA 1C5LH 1SC8U 5FBEA 1HIAA 1CSOE 1ZMJA 4NIYA 5EPYA 4JZFH 2XXLA 2PKSB 4UE7H 1K2I1 1HAYB 2BXUH 4CHAB 1FN8A 1RD3B 1UTPA 4GSOA 1O5CB 3VB6A 1IQMA 4WWYA 4DY7B 1PYTC 5HYOA 2EC9H 1HJ8A 5T3HA 2V35A 2BD4A 3W95A 2ZZUH 1TPOA 1TPSA 2R9PA 4KTCA 1ELAA 1SGCA 4HI3A 1V2WT 1C5PA 1W12U 1F5KU 5FXLA 1J8AA 3RMMH 2PUXB 1MTWA 1N8OB 1OXGA 4TWWA 1F0TA 1PPFE 3U9AH