1O2WA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2wA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2wA02
3MTYA 3SQEE 1O34A 2C8WB 5DP9A 1QJ1B 3MH4A 1C2EA 3MU4A 2LNCA 4NA8A 3EYDA 1O3OA 1JXPA 3TGKE 2UUYA 1H9HE 3A82A 1LHDH 1C4Y2 1DWCH 4XFQA 4U2WA 2H9EH 5FAHA 2GX4A 2OCVB 1HIAB 3M3VA 1BJUA 4MNWA 1LMWB 4CBNA 3O8CA 1G30B 1QL7A 1CSOE 2OXSA 4GVUA 4IMZA 2C90B 3GCOA 1BTZA 3TVJB 3C1KA 4RN6A 3UNSA 2ZGJA 1F7ZA 3SGBE 1FIWA 4ZAEA 4ISIH 3A87A 2EC9H 2BY9X 1GI1A 3BN9A 2I6SA 5FX5A 1MBQA 4GCHF 1TGTA 2BQ7B 1A0HB 4I32A 1ZSLA 3T25A 2OD3B 3E16B 2FOFA 1NN6A 3JZ2B 1D6RA 2BLWA 2J4IA 4WMFA 4YLUA 3V0XA 3L3TA 2OBQA 1ZSKA 1D3PB 5DP5A 5C5NA 4JK6A 3ATLA 1BCUH 1HLTH 2AEIH 1TNKA 3UUZA 1UK3A 1GGDC 3OTJE 3A80A 1J9CH 5FBEA 1P3EA 3BTEE 4MPVA 4Q7ZA 1O3IA 4GHTA 2YNBA 1UTJA 5E0GA 1W0ZU 5HGGA 4YM9A 1RFNA 1C4V2 3MHWU 4INHA 2CJIA 5BPEA 1HAIH 2ZDVH 1YF4A 3EGKH 1ABIH 2TIOA 3SJOA 3FP8E 1NFUA 4YOGA 1A46H 4FUHA 1CHGA 1GBKA 2JETC 3VB6A 2VIQA 3IITA 4K8YA 1GBJA 4BAOB 1HGTH 1K1PA 1NTPA 1QY6A 1SGIB 3BTKE 3MNSA 1GJ6A 1O2MA 1BITA 1UTOA 4XOJA 4X1RU 4D76A 1MZDA 4ISOA 1EZSC 1VCPA 2BHGA 3SNEA 1G36A 3LPRA 3Q3YA 2FX4A 1BMNH 1TOMH 3HK6B 4AYVB 5LPRA 4D9QA 1PPGE 3D49H 1GI7B 4DW2U 1AY6H 4LOYH 1TAWA 5EXMA 3PV4A 5DJ7A 3SN8A 5T6GA 2FYQA 4AGJA 4TY6A 3IG6B 2AGEX 1BRUP 1FONA 3GY2A 2FOMB 2FOBA 3TJUA 4D8NA 1PYTC 2HPPH 3M3SA 3OY6U 3QLPH 2PSYA 3MU5A 2W7SA 1WUNH 1O3JA 1CO7E 1A2CH 5A0CA 1S5SA 4THNH 1GMCG 1B0FA 1ELTA 3HGNA 5FCKA 3SW2B 1TQ0B 4K60A 1QB6A 1A5GH 1GBIA 3PMJA 1YPHC 1AUJA 3MNXA 1V6DA 5EW2H 1GMCF 4FUBA 1AFQB 3AW1A 2WYGA 4MNVA 2B7DH 3SU2A 2FESH 5F03A 1V2PT 1DWDH 1NRQH 3FFGA 2TPIZ 2JH5D 1YGCH 1EKBB 3GDVA 3GISB 4NIYA 3LJJA 4H42U 4CR5A 4CR9A 2TGTA 3UR9A 2NU1E 1ABJH 1SB1H 1O3PB 1QHRB 3NKKA 4B2AA 1MD8A 2P94A 5A0AE 4LXBH 4Q7XA 1F92A 4NZLA 1ZSJA 1B5GH 2QYIA 3SGAE 2VH6A 3S7HB 1O2RA 2F83A 2XCFA 3QTVH 1N8OC 4UFFH 1NT1A 2XRCA 1Y5UT 4Q7YA 1UHBA 2CN0H 4WMEA 4AFUA 3EDXB 1MTNC 1Y8TA 2UWPA 3TU7H 3TPIZ 4X2VA 1ZHRA 2G5VA 1T7CA 5L2YH 1W2KH 1GHXH 1C1UH 1K1NA 4JK5A 4YLQH 2ZFPH 2K1QA 1TFXA 1UO6A 1IQLA 4MNXA 4DOQA 3S9BA 3LKWA 1GPZA 1S83A 1GBTA 1UVOA 2AMPA 2FOEA 4KTUA 1DUEA 1LKBA 5A8YA 3EA7A 3FP7E 2W5EA 2OBOA 3RMOH 1GCTB 1O31A 1J8AA 2GZ9A 1NO9H 3STJA 1BJVA 1S6HA 5DK1A 1YPHE 1G2LA 1MTSA 4FUIA 4O3UA 3RXBA 1TPPA 4U30A 3S0NA 2A5AA 4B71A 3MO3A 3GDUA 6GCHG 2H5DA 2R3YA 1V2MT 3MU0A 1KDQB 4IGDA 2NU3E 1SC8U 4MPXA 4BAQB 3F9HA 2BB4A 1O3DA 1RTFB 1SQOA 5CE1A 1CBWC 1P3CA 2O8LA 1C1VH 2THFB 1C2LA 4R8TB 3UWJH 3URDA 5FPTA 5AHGH 4ZHAA 3KQCA 1ESTA 4WF8A 2GDEH 4AN7A 1FNIA 1CT2E 1HIAA 1FDPA 2BX4A 1GJCB 1C5UA 3SJ8A 1YPMH 3SU3A 3SUFA 2FOHA 3GDSA 3CS7A 2ZPSA 4TPIZ 2ZHQH 1V2TT 3GICB 1G37A 2OQ5A 3SU0A 3UNQA 1C1TA 2GMTC 2XCNA 3UOUA 2V3OH 1SGPE 3L6PA 3ZZ5A 2ODQA 5CHAC 2BDBA 2R9PA 4ABEA 1V3XA 3T5FH 1KY9A 4JZEH 1T8NA 3GY6A 1IQHA 1CGJE 3Q3KA 1A7SA 1ELBA 1EATA 1HYLA 1OWHA 3P8NA 2XC5A 1C1WH 3PTNA 4ABJA 1OP0A 3QN7A 4ABBA 3E1XB 1QIXB 3NUMA 4WY3A 1NS3A 2YNAA 1OKXA 4D7GA 1O2HA 1TGBA 4IN2A 1AB9C 1GVKB 2C8XB 4AG2A 1FJSA 4J1YA 2VB0A 2VIWA 3U1JB 3ZV9A 1V2JT 1B7XB 2ZNKH 3A83A 2BD8A 2R3UA 5EPNA 1AE5A 1TGSZ 4OGXA 2JH6D 1E0FD 1XUFA 4Y8ZA 4AB9A 2BD9A 2ODPA 2G00A 4R0IA 1Y5AT 1P2MA 1S85A 3SU4A 1TLDA 2ZDNA 1GGDB 2BVXH 1VITG 3IWMA 4HTCH 2AIPA 1AMHA 2BDCA 1AI8H 4WH6A 1EJAA 1EASA 1O37A 1EJNA 4XSKU 1O5EH 1EOLA 4ISNA 1V2RT 4MTBA 1Y5BT 1GWAA 2Z9LA 2TGDA 2FS8A 1TIOA 2B8OH 3A85A 3LOXA 2BM2A 4A1TA 1Z1JA 1ZRBA 3PLPA 3PWCA 3A86A 2OQUA 2JETB 1W11U 1N1LA 3SORA 3BG4C 5GXPA 2P59A 4YTAA 3E90B 3KHVA 2AH4X 1EPTA 4KKDA 4CRBA 1TRMA 4O03A 2VJ1A 3NCLA 1FY1A 4UD9H 5GIBA 2JKHA 1WV7H 4FVBA 1EZQA 4VGCB 2BOHB 2FM2A 1O2WA 2ZFQH 2ZTZA 2Z3EA 3K2UA 1D3TB 2TGPZ 2PUXB 4OGYA 1DVAH 5DP3A 3TJVA 3H7OA 5EPYA 1TQ7B 4ZKOU 1KYNA 1THPB 1E36B 3BIUH 1SMFE 1BMAA 2G51A 1OPHB 4DIIH 3ODFA 1WYKA 5LH8A 3FAOA 2W26A 3K9XB 3SNCA 4WMDA 4Y76A 1SPJA 3DFJA 2XBWA 3CP7A 2Q6DA 5T3HA 2OP9A 5TCCA 1FZZA 1WTGH 1WTHD 4YOIA 3M35A 1SLWB 1AN1E 1UVPA 1ZGVA 1O33A 2FPZA 1C5QA 4ZHMU 1PQ7A 5H4IB 1GJ7B 5TJXA 1J15A 1TMTH 2CV3A 1GMHF 3U8RH 3TITA 4NZQA 3E0PB 2D1JA 2HPQH 4BTUB 1EPTC 2GZ8A 2IN2A 3SUEA 1B0EA 1TMBH 1BTPA 1O2LA 2ZGXH 2FTLE 2Z9KA 3BTDE 4CRDA 2A7HA 2HRVA 4FUFA 3LJOA 4AFSA 4BAKB 8GCHG 2H1UA 1G3BA 2H9HA 1GL1A 3KIDU 1N8OB 4K1TA 4YESB 1V2ST 1BZXE 1CHOG 1BRBE 1CE5A 1MTNB 3ZYDA 1WSSH 2WPJS 1PFXC 4Y11E 2EEKA 3ZZ8A 3MO9A 1IQIA 1UJ1A 2FOCA 1TNHA 5FCRA 1TX8A 1BA8B 1NRRH 9ESTA 4MDSA 2Y82A 1HCGA 3E3TA 4E05H 3A89A 4NWKA 1TE0A 1XUIA 1EX3A 1GI0A 2ODYB 3ZZ4A 3A8DA 2V3HH 2ZZUH 3ZZ6A 1NU9A 2BLQA 3RXSA 2ULLA 1OX1A 4X1PU 3ZVBA 1PJPA 3P8GA 1LHCH 1ELDE 1RGQA 1INCA 1F0TA 1MCTA 2QIQA 1C2KA 4X8TH 2A7JA 4KGAA 1EJMA 2BX3A 2UUKB 5BRRE 5E0HA 2ZECA 1CBWB 4X2WA 3TH2H 3UPEA 2A2XH 1Z8IB 3T27A 1J14A 4ISHH 3VB7A 1K1OA 1Z8GA 2WUBA 2ZO3H 1S6FA 4Y7BA 5E2PA 3ZVFA 3SV6A 1BRAA 4ABHA 1QBNA 1E35B 7ESTE 1HAOH 1THRH 2STBE 1OSSA 4BXWA 5JBAS 2ZCLP 1NY22 4FU8A 2P3FH 2HVXA 2BDIA 1UHBB 2PKSC 3ZZBA 2ZHDA 2GMTB 1OOKB 4Y79A 5GWZA 3RLWH 1C5SA 5CHAB 1QBOA 3LONA 1BMMH 4ESTE 3SNBA 3TK5A 1O5BB 1PQAA 3JZ1B 1GDNA 3L33A 2FS9A 4KTCA 5EOKA 1L1GA 5A8XA 3QTOH 4GSOA 3TGIE 4I8JA 1NRNH 4X8SH 1HJAC 4J2YB 1LVBA 1W13U 1ARCA 1AWFH 1P2KA 2VVUA 1G2MA 1O30A 1OP8A 1UTQA 5GJ4B 1EB2A 1XUHA 2F9PA 2SGEE 1AB9B 3PWBA 2LPRA 1K9OE 1T4UH 2EI6A 3KF2A 4B74A 1RRKA 1Q2WA 2J95A 3ZZCA 1EP5A 1A1RA 2Q1JA 1TOCB 3K6ZA 2STAE 4F49A 1TRYA 2P93A 2FI3E 2ZQ1A 2J34A 3GCHB 1P02A 4AFQA 2OC1A 1ELAA 2Q6GA 4GAWA 1AVWA 3UQOA 2CF9H 1YCPK 4ABDA 1QBVH 2BDGA 3S9AA 1GI6A 2BZ6H 1N6XA 1TRNA 3SV7A 1SOZA 1QL8A 1SSXA 2ZTYA 2A4QA 3QDZB 1DLEA 1W7GH 3GYMA 1VR1H 4ABAA 3RU4D 4LK4A 4GCHG 1C5XB 3T28A 1DUAA 1GJ4H 1EAXA 4NG9H 1S81A 3P92A 2GP9B 1Z71A 2TRMA 2PV9B 4XBCA 3BG4B 3TH4H 6CHAC 1GBMA 2BLVA 1EZXC 2J38A 4YOJA 1C9TA 1NZQH 1PPFE 1QNJA 1TBRH 1XKBC 5GDSH 5HYOA 1AO5A 4OS5A 1CVWH 1HB0B 2ZHEH 1DSTA 4FU7A 1Y3XA 1LPKB 3F1SB 4JZ1A 3A7ZA 4WH8A 1MQ6A 3LGVA 2Z3DA 1DDJA 2AFQB 3O8RA 3NPSA 1CT0E 2RA0A 1L4ZA 2ZU1A 1P9UA 1TGCA 4OS6A 3ZVEA 1W14U 4WXVA 1O2JA 5F6MA 2FODA 2PWXA 4NIWA 4IS5A 1FMGA 4I7YH 1NC6A 1ZTLA 1HPGA 1AD8H 1GI4A 1P01A 2FX6A 4FUJA 2IJOB 3DUXH 4JMYA 2PKAA 5CMXH 1C1RA 3RMNH 1MKXH 3K6YA 4K8BA 1G3CA 5DO4H 3F6UH 4NIXA 5JBCS 3M5NA 3MH6A 3SZNA 2XBVA 3DD2H 1TNJA 4ZKSU 3RDZA 1C5VA 4K2YA 4VGCC 2B0FA 4MPUA 3HKIB 4YT7H 2UWLA 3M5OA 1HAVA 1ZJDA 1J16A 2P95A 2BD2A 1Z6EA 2BDAA 3TNTA 1AZ8A 1GMDG 1P03A 3B23B 2SGFE 2O9QA 1EPTB 4XBDA 1THSH 5K0HA 1H8DH 4K5ZA 1NM6A 2I6QA 1ZR0A 4IMQA 3R0FA 1GMDF 2TBSA 3OU0A 4ABGA 3SV2H 3BIVH 4BNRA 2ZU4A 3FVFB 4H6TA 1SGDE 3H5CB 1CA8B 4TYDA 2ZFFH 1V2LT 2TGAA 4WXIA 2WUCA 1YC0A 5FHTA 1ANEA 1FV9A 3E91A 5J4SA 2BY5X 1JRTA 4X6MA 1DS2E 1P8VC 1L1NA 4JZFH 3RXLA 2NU2E 1A0LA 1SGRE 5A2MH 1RJXB 1DICA 5C20A 2BD3A 1FN6A 1GJBB 1C9PA 1O2UA 2QN5T 4Y8XA 1VCWA 3K65B 4ABFA 1F0UA 1ORFA 5EW1H 3U1IB 2ZCKP 1C2JA 3N7OA 2A32A 1BRCE 3KNXA 4DURA 1FXYA 2VH0A 1O3LA 5GPIB 1C4U2 1YCPH 4YZUA 1F2SE 1SGNE 4UFDH 1GBHA 1GI3A 3ELAH 4WVPE 1OP2A 3RMLH 5L30H 3UY9A 1O2OA 1RS0A 1A5IA 3MNCA 2A4GA 2Y7ZA 1TMUH 1Y3VA 2OLGA 4DJZB 1TGNA 3PM3A 1DWBH 1MH0A 1ZMJA 2KAIA 1G3EA 4FUEA 4XBBA 3S69A 2F9UA 5EXLA 5FBIA 1O2YA 1TYNA 1BQYA 1TB6H 4JYTA 1FPCH 1GJ9B 1GBDA 3SOSA 2PKSB 3TJNA 1VZQH 1K2I1 1KLJH 1XM1A 1YPKH 1Q3XA 2ZFTA 4INLA 4DG4A 1UTMA 5FXLA 1V2QT 2BTCE 1O36A 2P8OC 4B2BA 1L2EA 3TNSA 1LPZB 2FI4E 2OC0A 5C5OA 5EODA 2ANWA 1JWTA 1L0ZA 1GG6C 3SHCH 2FIRH 2WPLS 1UTKA 1HJAB 1MTWA 1FQ3A 4DY7B 1ETRH 1BOQA 2H9TH 1SHHB 4FUGA 4QT8C 3VGCC 1AU8A 1LCYA 1GJAB 2XYAA 3RXEA 3E6PH 2Z3CA 1Z7KA 4I8LA 2OINA 3F9GA 4RKJB 1JMOH 3STIA 1F0SA 1CA0C 6ESTA 1UCYK 4DGJA 3EA9A 1X7AC 1SGEE 4B73A 2QC2A 2BY7X 1A3EH 2BLOA 1GDUA 1W3CA 1W12U 4NIVA 2QXGA 2Z94A 1Y3YA 3M61U 1O3FA 5DP8A 3RU4E 3RXCA 2Y5GA 7KMEH 3QZRA 3V12A 1MKWK 5T6FA 4E7NA 3CENA 1FY4A 1YPGH 1TPAE 1GI2A 4UONA 4X2XA 5IDKA 1IOEA 4NFFA 3ZVCA 1EUFA 2VWNA 3A7YA 3T62A 2A7CA 1UTPA 2Z7FE 2ZGBH 3CS0A 4X1QU 3AAVA 3ESTA 3M36A 3UOPA 2HNTE 2ASUB 2WINI 4ZHLU 1G9IE 3MYWA 4MNYA 1H4WA 3RXIA 3PO1C 2SGDE 2FLRH 1C5ZB 1UK4A 1BTXA 6CHAB 1W10U 2ANMH 2DUCA 4NA7A 4TWWA 3SQHE 1WCZA 1QA7A 1Z8JB 2IPHA 3F9EA 1MTVA 5SGAE 1QQUA 1O3AA 1O2PA 3GCHC 1EAIA 1GHVH 4OS4A 5DKMA 1YPLH 1DY8A 1AQ7A 1O2NA 1S0RA 2ZCHP 1O2VA 5C1UA 4X8UH 3SI4H 3P8FA 4NWLA 2A2QH 1K1LA 1O5AB 4UDWH 1BTYA 1TALA 3RM2H 4UFGH 1U6QA 3BTWE 1GBFA 2VNTA 3ZZAA 4NSVA 3RUOA 1MUEB 5L2ZH 1KXFA 3Q00A 3QO6A 3UR6A 2FYRA 2HALA 5AFYH 3SO3A 3PYHA 3EQ0H 3UREA 2SNVA 2F3CE 3ZV8A 1BBRK 1AKSA 2ZG0H 1F5KU 3WY8A 1PPCE 1O39A 1XX9A 2Y5FA 1EZUC 3E8LA 1SGQE 1O5FH 1SQTA 2D2DA 3SBKA 3V3MA 2EI8A 1IQJA 3T29A 3BEUA 4DVAU 3SV8A 4WWYA 2XBYA 1BUIA 2GTBA 1OXGA 1O2ZA 3OSYA 1C2MA 4HFPB 5FPSA 1E37B 1EB1H 1K1IA 3BTQE 2WPMS 4ABIA 2G81E 1DLKB 4Y6DA 1GI9B 1GJ5H 4Y10E 4RSPA 1MBMA 2ZFSA 4AZ2B 5A0BA 3M5MA 4KELA 1JOUB 1PPBH 5C67A 1T31A 2R2WU 4K1SA 2J2UA 4KP0A 3TK6A 1ZMLA 1YLCA 1XXFA 1FY8E 4BANB 2ZGCA 1OWEA 4ZROA 1C5RA 5F8XA 1AUTC 2QXJA 1GDQA 3A8AA 1O0DH 3PMAB 3ZZ3A 1SG8B 3P17H 1ELGA 1GHBF 3PLKA 1YKTA 1O2QA 1V2NT 1FIZA 1GMHG 3SU6A 2BD4A 1AVGH 4IBLH 1XXDA 2BD5A 1DXPA 1GBBA 2NU0E 1QQ4A 1SR5C 1ELEE 2PKAB 1NRSH 4E7RG 4ZXXH 2ZDMA 4AG1A 4I8HA 1IQFA 1P9SA 1EP6A 2PGQB 3AAUA 4KTSA 1D6WA 2BQ6B 1GJDB 2PUQH 3OY5U 4AGKA 1L4DA 1TX7A 5IYTA 1NPMA 4SGAE 1EXFA 4NFEA 3OX7U 3QGJA 1PPHE 1PPZA 5LGOA 1O2GH 1ESAA 1HAVB 1Y59T 3V7TA 1BMLA 3HATH 3ODDA 3MU8A 3LH3A 1QJ7B 1TABE 1K28D 2ZIQH 4IN1A 1KXBA 1ZGIA 4Y7AA 1P06A 1CU1A 1AWHB 1FUJA 3SU5A 4XDEA 1TBZH 2OC7A 2Y5HA 2FO9A 5F8ZA 5DGJA 4GPGA 3BV9B 1IQNA 1GHZA 2FOGA 2BOKA 1HAYB 3M3TA 4A1XA 3URCA 1W8BH 4GUXA 3RXTA 4O97A 1F0RA 1OWIA 3PMHB 1QRZA 2P8OB 1N6YA 5HXFA 1AFEH 2O8MA 5C3NA 5ABWA 4WJG2 3KGPA 4B2CA 3M7UA 2QXIA 1P2OA 1IQMA 2BVRH 1GG6B 2XBXA 5TCAA 3SNAA 1SBWA 2BDYA 3GCNA 1ZHMA 1Y3WA 1C5OH 1O35A 2YOLA 3QWCH 4D7FA 4X6NA 1QJ6B 1SLXB 1DM4B 1ACBE 1DXWA 3U8OH 2O8UA 3VGCB 2SGAA 3RU4T 1A4WH 3LH1A 1FN8A 4Y0YE 4B75A 1SLVB 1P2QA 1T8LA 1WAYB 2A0QB 1XKAC 1H8IH 3A7XA 5JDUB 1CA0B 3ZZ7A 4I33A 1O2SA 2GGVB 2F9NA 4A92A 1C1NA 1SGCA 1VITH 2ZDLA 2GT8A 1GBCA 3LIWA 1QB1A 2D26C 2Y7XA 1KXEA 1IHSH 2PFEA 4AORA 1WU1A 1XMNB 1MMJN 2KAIB 1EAUA 2Y81A 2B5TB 4CRFA 1MAXA 1IHTH 4Q80A 1T4VH 1PYTD 2ZPQA 1TONA 1UMAH 1O38A 2V0BA 1PPEE 1FPHH 3BF6H 8ESTE 1DT2A 4X1NU 4D9RA 3A7WA 1HAGE 5EQRA 1PQ5A 1QL9A 3GY7A 3BSQA 3B8JA 3D65E 4FVDA 3BEFB 1BTUA 2FOAA 1K22H 1YYY1 2A5IA 3I77A 4Z0KA 1O2XA 3PO1B 3OYPA 2BMGB 3SNDA 1BT7A 1SOTA 1F5LA 4X1SU 3UWIA 2FI5E 1QR3E 4INKA 2W3KA 1UTNA 1AHTH 2WPHS 3MOCA 3MU1A 1K1JA 4MLFB 2FZZA 1J17T 2H2ZA 2QA9E 1LHFH 2H6MA 1HXEH 1DFPA 3D62A 2GT7A 1YLDA 1O3MA 1YBWA 2ZDKA 3UIRA 2WV4A 3LT3A 1YPEH 2PHBA 1UVTH 2V35A 4AFZA 3U8TH 2HOBA 1AE8H 4BTTB 2F9BH 1LHGH 1O5CB 4I31A 9LPRA 4O3TA 3UFAA 4HZHA 1SVPA 1NFYA 2ZU3A 2GD4B 3QX5H 4A1VA 2ESTE 1KTSB 2VIPA 3MH5A 1KXDA 2QF3A 1C1PA 2ALVA 3TK9A 3Q77A 4BXSA 2AMQA 1FY5A 2GCTC 1SGFA 4A6LA 3RXVA 3SV9A 2AS9A 3M7TA 2HGTH 1MZAA 4OS1A 1VGCC 3RM0H 3H7TA 2SNWA 2ZF0H 2EA3A 1VJAU 5EU8A 3O8DA 3W94A 5F8TA 2QGRA 1BBRE 1DX5M 3HK3B 1K21H 2AIQA 1KLTA 2CHAC 2PLXA 1ZPCA 3V13A 1TX6A 1DOJA 2F91A 1ZJKA 1A3BH 2VINA 2C4FH 3C27B 3SUDA 2RDLA 3HKJB 4GLYA 4U32A 2AMDA 1BHXB 1RD3B 1GHWH 2ZU2A 3MWIU 1H9LB 2NU4E 3ATWA 4X8VH 1ANCA 4AOQA 3SU1A 1T8OA 3M37A 4M7GA 3GY3A 5DG6A 4YO9A 1L1JA 3ATKA 1C1OA 1M9UA 1TBQH 1O3CA 7LPRA 1CT4E 4CH8B 3SJKA 4MQAA 3DA9B 1AKSB 3TIUA 1FY3A 1BTWA 2J92A 4TPYA 2JH0D 4UEHH 2BXTH 3QK1A 2ZP0H 8LPRA 3RLYH 2ZEBA 1G32B 3Q3XA 4CBOA 1SI5H 1TNGA 1C5MD 2GVFA 4Q2KA 1FAKH 5EQQA 4NSYA 3B9FH 3TJOA 1ARBA 5C1XA 1P57B 1C5TA 1TNLA 2GZ7A 3U98H 1XUGA 1XUJA 3RXKA 5JB8S 1HXFH 3GY4A 1C5PA 3PTBA 1LPGB 2QCYA 3R3GB 2XC0A 1OWKA 1SLUB 1NROH 1LO6A 3KQEA 4A5TS 2XC4A 1UTLM 3SJIA 1DE7H 4ZKNU 2A4OA 4CREA 2PW8H 4Y8YA 1NFWA 5A09A 3MNBA 2HLCA 5JBBS 1YP9A 4HGCA 2XWBI 1BHXF 1C2DA 2BQWB 1ESBA 1ELVA 4OS7A 3A8BA 4X2YA 2QV1A 1V2WT 3ZZDA 4AYYB 1MTUA 4DT7B 3GCTG 2P3TB 2QAAA 4I8GA 2G4UA 2OTVA 1LVOA 2GDDA 2UUJB 1ANBA 2M5TA 4YT6H 2GKVE 1IQGA 3GCTF 1RTKA 1BDAA 1F5RA 3Q76A 1QRXA 2SFAA 2WPIS 4MPWA 3QGNB 4NA9H 3UNRA 5T6DA 1T8MA 2Z9GA 2VWLA 1GVLA 1KIGH 3AW0A 1ZOMA 1GL0E 1GHAG 1OWJA 2P16A 1HAHH 5E8EH 3VB4A 2O8TA 3MH7A 3TLOA 1PQ8A 4K1EA 3LDXH 3KQBA 1OWDA 1SQAA 1EQ9A 5G4BA 2AGGX 5ETXA 1P12E 1LKAA 1GHAF 1QURH 1C2FA 3SI3H 7GCHG 2F9OA 2PTNA 4ZUHA 4DIHH 1MU6B 4AB8A 1O3EA 3W95A 2VWOA 1TPSA 1C5LH 5DP4A 2RCEA 4MVNA 7GCHF 2HNTC 3BTFE 1HFDA 1MU8B 2ZI2H 3RC6A 4JYVH 2FP7B 2ZA5A 1T32A 2G5NA 3PROA 1P05A 3LC5A 1IQEA 1NESE 1Z8RA 1Z1IA 4SGBE 1H1BA 2R0LA 1DANH 1S82A 4BOHA 3RXFA 2HWLB 1HNEE 1TNIA 1ZHPA 4ISLA 2XNIA 5EXNA 4E06H 2ZQ2A 3UTUH 2F9VA 1C1QA 4CRAA 1P04A 2SGPE 3ENSB 1KXAA 1LQEA 1V2OT 2CMYA 2VGCC 2XXLA 4FUDA 3VB5A 2H5CA 1O3NA 3AVZA 6GCHF 2Y80A 5DP7A 4X0WU 5EQSA 3RP2A 2FTMA 5DP6A 5E0JA 2ANYA 1V2VT 3I29A 3SUGA 3BTTE 3NZIA 3RXUA 1ZRKA 4HI3A 1TA2A 2BVSH 2ILNA 1O5DH 1ZTJA 1RIWC 3RXRA 1MD7A 1UVSH 2ZDAH 3KN2A 3A84A 1KSNA 4XE4A 5L6NH 2AERH 2Z9JA 4RKOB 4A7IB 3ZVGA 3E0NB 1EAWA 2RA3A 5JYIA 3S7KB 4CHAC 1W0YH 4LZ1H 1TWXB 3RXQA 3VXFH 4MG3A 1NRPH 1OYTH 1P0SH 3MMGA 2DE9A 2FXRA 3KCGH 3GY8A 1C2IA 1W7XH 2GV6A 3F9FA 3ZYEA 4CRCA 3PMBB 3RXAA 2QY0B 1O3KA 1QGFA 1JBUH 3AASA 3ATMA 5J4QA 3SGQE 3RXOA 3FZZA 5LPFA 1A61H 2AGIX 3PB1E 3RXMA 2QXHA 3LGUA 2GCTB 1WQVH 2PR3A 2G8TA 3BEIB 3D23A 2R0KA 1GHYH 2ZFRH 3FANA 5FPYA 3TH3H 4CH2B 1VGCB 3RXHA 5FX6A 3U9AH 1GI5A 2PTCE 4FXGH 4Y71A 2B9LA 1QA0A 1LVMA 2CHAB 1Y3UA 3DT0H 1IAUA 1FAXA 4UFEH 1CGIE 1YCPM 1HJ9A 5GCHG 3O8BA 2FMJA 3LGIA 1IQKA 4K3JA 1O2KA 3HPTB 3QUMP 3LC3A 3P70B 2OC8A 2VIVA 1DWEH 1QCPA 1KTTB 3HGPA 1GBEA 2J9NA 1ZZZA 3DFLA 4F4OC 5GCHF 3ZVAA 3RXDA 3G01A 1VJ9U 2ANKH 1D3DB 2R2MB 4AX9H 1MQ5A 4IC5A 1DITH 2Z9IA 3LU9B 1D3QB 3VPKA 1OS8A 4ASHA 4CRGA 1O32A 3A88A 1VITF 2A5KA 2BY6X 1SL3A 2C93B 1HAXB 3QZQA 1YM0A 1P2JA 4UE7H 1JRSA 5EG4A 2BD7A 2WPKS 4FU9A 1SFQB 1LQDB 3A7TA 5I25A 3LGYA 2SGQE 1H9IE 3EA8A 3VXEH 1GBLA 1O3BA 5I46H 4X6OA 4IW4E 2CGAA 1NU7B 3PLBA 2ALPA 1ETTH 4ZH8A 1WOFA 1ZTKA 2ZGHA 3FP6E 1HJ8A 3F68H 5A8ZA 4PROA 6LPRA 3RXGA 2VU8E 2WV5A 3VEQB 1D9IA 1SGYE 1P10A 3RC5A 1A0JA 2FWWA 5JPMH 1C5YB 1HAZB 1VCQA 1BIOA 2ZC9H 1GHBG 2FEQH 1WQSA 2UUFB 3KQDA 1D4PB 2ZKSA 3A7VA 8KME2 5HM9A 2CXVA 2FDAA 5E2OA 2BDHA 1DSUA 3MI4A 5EGMA 3MFJA 1UK2A 2C3SA 3RMMH 3UQVA 4JZIA 1P2IA 1HBTH 1RXPA 5AVDA 1AGJA 1ELFA 2GV7A 1V2UT 1LHEH 3BTGE 1QRWA 1QB9A 1MCVA 1ELCA 1UCYH 4O9VA 5C1YA 4TY7A 1SFIA 3SHAH 1ZYOA 4NCYA 1QFKH 1O5GH 2A31A 2RG3A 1XUKA 2G4TA 4FUCA 2VVVA 4JYUH 1AZZA 1CQQA 1GVZA 4H6SB 2ZHFH 4X6PA 3RC4A 1GBAA 3KEEA 1C1MA 5ESBA 2CF8H 3A8CA 1P2NA 1MKWH 1K1MA 3RXJA 3M7QA 1GI8B 1E38B 1P09A 2A1DB 1KLIH 1SGFG 2W7UA 4JZDH 3P8OA 5LPEA 1LVYA 1S0QA 5B6OA 4NGAH 2C8ZB 4DCDA 3I78A 4ZXYH 2VIOA 3BG8A 4U01A 4BAHB 1FLEE 1ZMNA 2FLBH 1SHYA 8GCHF 1HDTH 1MAYA 1LTOA 2D8WA 2ZU5A 1AFQC 2V6NA 1CHOF 2O8WA 1KDQA 2BZAA 1WBGB 2BY8X 1UVUH 2WYJA 2NWNA 1O3GA 3S9CA 3A81A 3SJ9A 5JBTA 1FI8A 3EE0B 3LGTA 2PGBB 2Y6TA 3VB3A 3M5LA 1XVMA 1BTHH 2OUAA 4ZKRU 1BBRH 3T2NA 1C2HA 2ZWLH 4K69A 2VIDA 1TPOA 2UWOA 1KXCA 1RTLA 3KL6A 2A45B 5JB9S 3ITIA 2J94A 2A4RA 1C2GA 4ZMAH 1QTFA 1YPJH 5AFZH 3NXPA 2W3IA 3ZVDA 2VGCB 4BAMB 1NFXA 1CGHA 1ETSH 1C5NH 3U69H 3TGJE 2BYAX 1BB0B 5HM2A 3ZZ9A 1SGTA 3EAJA 2IOTA 1MKXK 1JIRA 1OYQA 1V2KT 2XW9A 2VVCA 1JIMA 1E34B 2Q6FA 1XVOA 2GCHG 1Q31A 1RIWB 2EI7A 4TWYA 3LGWA 1S84A 1DY9A 1O2IA 3P95A 1GJ8B 3ATIA 1DPOA 1C5WB 4JCNA 1Z6JH 2GCHF 1GCTC 1O2TA 1A5HA 4B76A 4B1TA 4H4FA 4LZ4B 2XWAA 4CHAB 2DE8A 2ZTXA 3NWUA 2G55A 3GYLB 3GOVB 5DPAA 3NK8A 1TA6A 2ZPRA 1P11E 5HMAA 1UCYE 1HV7A 3VFEA 1ZPZA 2PSXA 5C2ZA 1LDTT 3BTME 1ID5H 4BTIB 1HUTH 1ANDA 4I8KA 3DHKH 2XTTB 2P3UB 1AIXH 3GY5A 2HNTF 3MO6A 2QF0A 1ZLRA 1ZPBA 1EOJA 2ZHWH 4IC6A 1HAPH 2VWMA 4OS2A 4Y0ZE 5PTPA 2C8YB 3FZDA 3RXPA 1O3HA 4GHQA 2BXUH 3BTHE 5AF9H 4Z6AH 1G3DA 2AYWA 3T26A 1AVXA 5K7RA 5ESTE 2Z6BD 3P6ZB 1HRTH 2G52A 1C1SA 1GCDA
chains in the Genus database with same CATH superfamily
3MTYA 3SQEE 1O34A 2C8WB 5DP9A 1QJ1B 3UAIC 3MH4A 1C2EA 3MU4A 2LNCA 4NA8A 3CNRA 3EYDA 1O3OA 1JXPA 3TGKE 2UUYA 1H9HE 3A82A 1LHDH 1C4Y2 1DWCH 4XFQA 2QF4A 4U2WA 2H9EH 5FAHA 2GX4A 2OCVB 1HIAB 3M3VA 1BJUA 4MNWA 1LMWB 4CBNA 3O8CA 3DSPA 1G30B 1QL7A 1CSOE 2OXSA 4GVUA 4IMZA 2C90B 3GCOA 1BTZA 3TVJB 3C1KA 4RN6A 3UNSA 2ZGJA 1F7ZA 3SGBE 1FIWA 4ZAEA 4ISIH 3A87A 2EC9H 2BY9X 1GI1A 3BN9A 2I6SA 5FX5A 1MBQA 4GCHF 1TGTA 2BQ7B 1A0HB 4I32A 4Z1MD 1ZSLA 3T25A 2OD3B 3E16B 2FOFA 1NN6A 3JZ2B 1D6RA 2BLWA 2J4IA 4WMFA 4YLUA 3V0XA 3L3TA 2OBQA 1ZSKA 1D3PB 3KYGA 5DP5A 5C5NA 4JK6A 3ATLA 1BCUH 1HLTH 2AEIH 1TNKA 3UUZA 1UK3A 1GGDC 3OTJE 3A80A 1J9CH 5FBEA 1P3EA 3BTEE 4MPVA 4Q7ZA 1O3IA 4GHTA 2YNBA 1UTJA 5E0GA 1W0ZU 5HGGA 4YM9A 1RFNA 1C4V2 3MHWU 4INHA 2CJIA 5BPEA 1HAIH 2YMSC 2ZDVH 1YF4A 3EGKH 1ABIH 2TIOA 3SJOA 3FP8E 1NFUA 2F4LA 4YOGA 1A46H 4FUHA 1CHGA 1GBKA 1YWUA 2JETC 3VB6A 2VIQA 3IITA 3NRLA 1GBJA 4K8YA 4BAOB 1HGTH 1K1PA 1NTPA 1QY6A 1SGIB 3BTKE 1K0HA 3MNSA 1GJ6A 1O2MA 1E1QD 1BITA 1UTOA 4XOJA 4X1RU 4D76A 1MZDA 4ISOA 1EZSC 1VCPA 2BHGA 3SNEA 1G36A 2WHXA 3LPRA 3Q3YA 2FX4A 1BMNH 1TOMH 3HK6B 4AYVB 5LPRA 4D9QA 1PPGE 3D49H 1GI7B 4DW2U 1AY6H 4LOYH 1TAWA 5EXMA 3PV4A 5DJ7A 3SN8A 5T6GA 2FYQA 4AGJA 4TY6A 3IG6B 2AGEX 1BRUP 1FONA 3GY2A 2FOMB 2FOBA 3TJUA 4D8NA 1PYTC 2HPPH 3M3SA 3OY6U 3QLPH 2PSYA 3MU5A 2W7SA 1WUNH 1O3JA 1CO7E 1A2CH 5A0CA 1S5SA 4THNH 3DSGA 1GMCG 1B0FA 1ELTA 3HGNA 5FCKA 3SW2B 1TQ0B 1WDIA 4K60A 1QB6A 1A5GH 1GBIA 3PMJA 1YPHC 1AUJA 2JJ2D 3MNXA 1V6DA 5EW2H 1GMCF 4FUBA 1AFQB 3AW1A 2WYGA 4MNVA 2B7DH 3SU2A 2FESH 5F03A 3F2FA 1V2PT 1DWDH 1NRQH 3FFGA 2TPIZ 2JH5D 1YGCH 1EKBB 3GDVA 3GISB 4NIYA 3LJJA 4H42U 4CR5A 4CR9A 2TGTA 3UR9A 2NU1E 1ABJH 1SB1H 1O3PB 1QHRB 3NKKA 4B2AA 1MD8A 2P94A 5A0AE 4LXBH 4Q7XA 1F92A 4NZLA 1ZSJA 1B5GH 2QYIA 3SGAE 2VH6A 3S7HB 1O2RA 2F83A 2XCFA 3QTVH 1N8OC 4UFFH 1NT1A 2XRCA 1Y5UT 4Q7YA 1UHBA 2CN0H 4WMEA 4AFUA 3EDXB 1MTNC 5CDFE 1Y8TA 2UWPA 3F3BA 3TU7H 3TPIZ 4X2VA 1ZHRA 2G5VA 1T7CA 5L2YH 1W2KH 1GHXH 1C1UH 1K1NA 4JK5A 4YLQH 2ZFPH 2K1QA 1TFXA 1UO6A 1IQLA 4MNXA 4DOQA 3S9BA 3LKWA 1GPZA 1S83A 1GBTA 1UVOA 2AMPA 2FOEA 2GJGA 4KTUA 1DUEA 2L6OA 1LKBA 5A8YA 3EA7A 3FP7E 2W5EA 2OBOA 3RMOH 2LELA 1GCTB 1O31A 1J8AA 2GZ9A 1NO9H 3STJA 1BJVA 1S6HA 5DK1A 2KCAA 1YPHE 1G2LA 1MTSA 4FUIA 4O3UA 3RXBA 1TPPA 4U30A 2K8IA 3S0NA 2A5AA 4B71A 3MO3A 3GDUA 4B6EA 6GCHG 2H5DA 3ZIAD 2R3YA 1V2MT 3MU0A 1KDQB 4IGDA 2NU3E 1SC8U 4MPXA 4BAQB 3F9HA 2BB4A 1O3DA 1RTFB 3OTPA 1SQOA 5CE1A 1CBWC 4P00A 1P3CA 2O8LA 1C1VH 2THFB 1C2LA 4R8TB 3UWJH 3URDA 5FPTA 5AHGH 4ZHAA 3KQCA 1ESTA 4WF8A 2GDEH 4AN7A 1FNIA 1CT2E 1HIAA 1FDPA 2BX4A 1GJCB 1C5UA 3SJ8A 1YPMH 3SU3A 3SUFA 2FOHA 3GDSA 3CS7A 2ZPSA 4TPIZ 2ZHQH 1V2TT 3GICB 1G37A 2OQ5A 3SU0A 3UNQA 1C1TA 2GMTC 2XCNA 3UOUA 2V3OH 1SGPE 3L6PA 3ZZ5A 2ODQA 5CHAC 2BDBA 2R9PA 4ABEA 1V3XA 3T5FH 1KY9A 4JZEH 1T8NA 3GY6A 1IQHA 2CK3D 1CGJE 3Q3KA 1A7SA 1ELBA 1EATA 1HYLA 1OWHA 3P8NA 2XC5A 1C1WH 3PTNA 4ABJA 1OP0A 3QN7A 4ABBA 3E1XB 1QIXB 3NUMA 4WY3A 1NS3A 2YNAA 1OKXA 4D7GA 1O2HA 1TGBA 4IN2A 1AB9C 1GVKB 2C8XB 4AG2A 1FJSA 4J1YA 2VB0A 2VIWA 3U1JB 3ZV9A 1V2JT 1B7XB 2ZNKH 3A83A 2BD8A 2R3UA 5EPNA 1AE5A 1TGSZ 4OGXA 2JH6D 1E0FD 1XUFA 4Y8ZA 4AB9A 2BD9A 2LP6A 2ODPA 2G00A 4R0IA 1Y5AT 1P2MA 1S85A 3SU4A 1TLDA 2ZDNA 1GGDB 2BVXH 1VITG 3IWMA 4HTCH 2AIPA 1AMHA 2BDCA 1AI8H 4WH6A 1EJAA 1FX0B 1EASA 1O37A 1EJNA 4XSKU 1O5EH 1EOLA 4ISNA 1V2RT 2YMSB 4MTBA 1Y5BT 1GWAA 2Z9LA 2TGDA 2FS8A 1TIOA 2B8OH 3A85A 3LOXA 1KMHB 2BM2A 4A1TA 1Z1JA 1ZRBA 3PLPA 3PWCA 3A86A 2OQUA 2JETB 1W11U 1N1LA 3SORA 3BG4C 5GXPA 2P59A 4YTAA 4AC9A 3E90B 3KHVA 2AH4X 1EPTA 4KKDA 4CRBA 1TRMA 4O03A 2VJ1A 3NCLA 4DT4A 1FY1A 4UD9H 5GIBA 1NBMD 2JKHA 1WV7H 4FVBA 2WSSD 1EZQA 4VGCB 2BOHB 2FM2A 1O2WA 2ZFQH 2ZTZA 2Z3EA 3K2UA 1D3TB 2KR7A 2TGPZ 2PUXB 4OGYA 1DVAH 5DP3A 3TJVA 3H7OA 5EPYA 1TQ7B 4ZKOU 1KYNA 1THPB 1E36B 3BIUH 4F48B 1SMFE 1BMAA 2G51A 1SKYE 1OPHB 4DIIH 3ODFA 1WYKA 5LH8A 3FAOA 2W26A 3K9XB 3SNCA 4WMDA 3PV5A 4Y76A 1SPJA 3DFJA 2XBWA 3CP7A 2Q6DA 5T3HA 2OP9A 5TCCA 1FZZA 1WTGH 1WTHD 4YOIA 3M35A 1SLWB 5HIZA 1AN1E 1UVPA 1ZGVA 1O33A 2FPZA 1C5QA 4ZHMU 1PQ7A 5H4IB 1GJ7B 5TJXA 1J15A 1TMTH 2CV3A 1GMHF 3U8RH 3OFND 4NZQA 3TITA 3E0PB 2D1JA 2HPQH 4BTUB 1EPTC 2GZ8A 2IN2A 3SUEA 1B0EA 1TMBH 1BTPA 1O2LA 2ZGXH 2FTLE 2Z9KA 3BTDE 4CRDA 2A7HA 3N99A 2HRVA 4FUFA 3LJOA 4AFSA 4BAKB 8GCHG 5C94A 2H1UA 1G3BA 2H9HA 1GL1A 3KIDU 1N8OB 4K1TA 4YESB 1V2ST 1BZXE 1CHOG 1BRBE 1CE5A 3OAAD 1MTNB 3ZYDA 2KX4A 2KCPA 1WSSH 2WPJS 3N7DA 1PFXC 4Y11E 2EEKA 3ZZ8A 3MO9A 1IQIA 1UJ1A 2FOCA 1TNHA 5FCRA 5DSFA 1TX8A 1BA8B 1NRRH 9ESTA 4MDSA 2Y82A 1HCGA 3E3TA 4E05H 3A89A 4NWKA 1TE0A 1XUIA 1EX3A 1GI0A 2ODYB 3ZZ4A 3A8DA 2V3HH 2ZZUH 3ZZ6A 1NU9A 2BLQA 3RXSA 2ULLA 1OX1A 4X1PU 3ZVBA 1PJPA 3P8GA 1LHCH 1ELDE 1RGQA 1INCA 1F0TA 1MCTA 2QIQA 1C2KA 4X8TH 2A7JA 4KGAA 1EJMA 2BX3A 2UUKB 5BRRE 5E0HA 2ZECA 1CBWB 4X2WA 3TH2H 3UPEA 2A2XH 1Z8IB 3T27A 1J14A 4ISHH 3VB7A 1K1OA 1Z8GA 2WUBA 2ZO3H 1S6FA 4Y7BA 5E2PA 3ZVFA 3SV6A 1BRAA 4ABHA 1QBNA 1UW7A 3WWBA 1E35B 7ESTE 1HAOH 1THRH 2STBE 1OSSA 4BXWA 5JBAS 2ZCLP 1NY22 4FU8A 2P3FH 2HVXA 2QE7D 2BDIA 1UHBB 2PKSC 3ZZBA 2ZHDA 2GMTB 1OOKB 4Y79A 5GWZA 3RLWH 1C5SA 5CHAB 1QBOA 3LONA 1BMMH 4ESTE 3SNBA 3TK5A 1O5BB 4ZCNA 1PQAA 3JZ1B 1GDNA 3L33A 2FS9A 4KTCA 5EOKA 1L1GA 5A8XA 3QTOH 4GSOA 3TGIE 4I8JA 1NRNH 4X8SH 1HJAC 4J2YB 1LVBA 1W13U 5F53A 1ARCA 1AWFH 1P2KA 2VVUA 1G2MA 1O30A 1OP8A 1UTQA 5GJ4B 1EB2A 1XUHA 2F9PA 2SGEE 1AB9B 3PWBA 2LPRA 1K9OE 1T4UH 2EI6A 3KF2A 4B74A 1RRKA 1Q2WA 2J95A 3ZZCA 5C0TA 1EP5A 1A1RA 2Q1JA 1TOCB 3K6ZA 2STAE 1H8ED 4F49A 1TRYA 2P93A 2FI3E 2ZQ1A 2J34A 3GCHB 1P02A 4AFQA 2OC1A 1ELAA 2Q6GA 4GAWA 1AVWA 3UQOA 2CF9H 1YCPK 4ABDA 1QBVH 2BDGA 3S9AA 1GI6A 2BZ6H 1N6XA 1TRNA 3SV7A 1SOZA 1QL8A 1SSXA 2ZTYA 2A4QA 3QDZB 2WZQA 1DLEA 1W7GH 3GYMA 1VR1H 4ABAA 3RU4D 4LK4A 4GCHG 1C5XB 3T28A 1DUAA 1GJ4H 1EAXA 4NG9H 1S81A 3P92A 3N7EA 4FOUC 2GP9B 1Z71A 2XOKD 2TRMA 2PV9B 4XBCA 3BG4B 3TH4H 6CHAC 1GBMA 2BLVA 1EZXC 1NBME 2J38A 2RDEA 4YOJA 1C9TA 1NZQH 1PPFE 1QNJA 1TBRH 1XKBC 5GDSH 5GNDA 5HYOA 1AO5A 4OS5A 1CVWH 1HB0B 2ZHEH 1DSTA 4FU7A 1Y3XA 1LPKB 3F1SB 4JZ1A 3A7ZA 3DCLA 4WH8A 1MQ6A 3LGVA 2Z3DA 1DDJA 2AFQB 3O8RA 3NPSA 1CT0E 2RA0A 1L4ZA 2ZU1A 1P9UA 1TGCA 4OS6A 3ZVEA 1W14U 4WXVA 1O2JA 5F6MA 2FODA 2PWXA 4NIWA 4IS5A 1FMGA 4I7YH 1NC6A 1ZTLA 1HPGA 1AD8H 1GI4A 1P01A 2FX6A 4FUJA 2IJOB 3DUXH 4JMYA 2PKAA 5CMXH 1C1RA 3RMNH 1MKXH 3K6YA 4K8BA 1G3CA 5DO4H 3F6UH 4NIXA 5JBCS 3M5NA 3MH6A 3SZNA 2XBVA 3DD2H 1TNJA 4ZKSU 3RDZA 1E79D 1C5VA 4K2YA 4VGCC 2B0FA 4MPUA 3HKIB 4YT7H 2UWLA 3M5OA 1HAVA 1ZJDA 1J16A 2P95A 2BD2A 1Z6EA 2BDAA 3PV2A 3TNTA 1AZ8A 1GMDG 1P03A 3B23B 2SGFE 2O9QA 1EPTB 4XBDA 3FKSD 1THSH 5K0HA 1H8DH 4K5ZA 1NM6A 2I6QA 3H09A 1ZR0A 4IMQA 3R0FA 1GMDF 2TBSA 3OU0A 4ABGA 3SV2H 3BIVH 4BNRA 2ZU4A 3FVFB 4I86A 4H6TA 1SGDE 3H5CB 1CA8B 4TYDA 2ZFFH 1V2LT 2TGAA 4WXIA 2WUCA 1YC0A 5FHTA 1ANEA 1FV9A 3E91A 5J4SA 2BY5X 1JRTA 4X6MA 1DS2E 1P8VC 1L1NA 4JZFH 3RXLA 2NU2E 1A0LA 1SGRE 5A2MH 1RJXB 1DICA 3OEHD 5C20A 2BD3A 1FN6A 1GJBB 1C9PA 1O2UA 2QN5T 4Y8XA 1VCWA 2HVYB 3K65B 4ABFA 1F0UA 1ORFA 5EW1H 4ASUD 3U1IB 2ZCKP 1C2JA 3N7OA 1COWD 2A32A 1BRCE 3KNXA 4DURA 1FXYA 2VH0A 1O3LA 5GPIB 1C4U2 1YCPH 4YZUA 1F2SE 1SGNE 4UFDH 4TSFD 1GBHA 1GI3A 3ELAH 4WVPE 1OP2A 3RMLH 5EJZA 5L30H 3UY9A 1O2OA 1RS0A 1A5IA 3MNCA 2KCYA 2A4GA 2Y7ZA 1TMUH 1Y3VA 2OLGA 4DJZB 1TGNA 3PM3A 1YY3A 1DWBH 1MH0A 3UB0A 1ZMJA 2KAIA 1G3EA 4FUEA 4XBBA 3S69A 4Q4LA 2F9UA 5EXLA 5FBIA 1O2YA 1TYNA 1BQYA 1TB6H 4JYTA 1FPCH 1GJ9B 1GBDA 3SOSA 2PKSB 3TJNA 1VZQH 1K2I1 1KLJH 1XM1A 1YPKH 1Q3XA 2ZFTA 4INLA 4DG4A 3AK5A 1UTMA 3PRBA 5FXLA 1V2QT 2BTCE 1O36A 2P8OC 4B2BA 1L2EA 3TNSA 1LPZB 2FI4E 2OC0A 5C5OA 5EODA 2ANWA 1JWTA 1L0ZA 3WWFA 1GG6C 3SHCH 2FIRH 2WPLS 1UTKA 1HJAB 1MTWA 1FQ3A 4DY7B 1ETRH 1BOQA 2H9TH 1SHHB 4FUGA 4QT8C 3VGCC 1AU8A 1LCYA 1GJAB 2XYAA 3RXEA 3E6PH 2Z3CA 1Z7KA 4I8LA 2OINA 3F9GA 4RKJB 1JMOH 3STIA 1F0SA 1CA0C 2L74A 5KGOA 6ESTA 1UCYK 4DGJA 3EA9A 1X7AC 1SGEE 4B73A 2QC2A 2BY7X 1A3EH 2BLOA 1GDUA 1W3CA 1W12U 4NIVA 2QXGA 2Z94A 1Y3YA 3M61U 1O3FA 5DP8A 3RU4E 3RXCA 2Y5GA 7KMEH 3QZRA 3V12A 1MKWK 5T6FA 3OE7D 4E7NA 3CENA 1FY4A 1YPGH 1TPAE 1GI2A 4UONA 4X2XA 5IDKA 1IOEA 4NFFA 3WW7A 3ZVCA 1EUFA 2VWNA 3A7YA 3T62A 5C17A 2A7CA 2VBCA 1UTPA 2Z7FE 5DN6D 2ZGBH 3CS0A 4X1QU 3AAVA 3ESTA 3M36A 5EIYA 3UOPA 2HNTE 2ASUB 2WINI 4ZHLU 1G9IE 3MYWA 4MNYA 1H4WA 3RXIA 3PO1C 2SGDE 2FLRH 1C5ZB 1UK4A 1BTXA 6CHAB 1W10U 2ANMH 2DUCA 4NA7A 4TWWA 2JJ1D 3SQHE 1WCZA 1QA7A 1Z8JB 2IPHA 3F9EA 1MTVA 4P02A 5SGAE 1QQUA 1O3AA 2KZ4A 1O2PA 3GCHC 1EAIA 1GHVH 4OS4A 5DKMA 1YPLH 1DY8A 1AQ7A 1O2NA 1S0RA 2ZCHP 1O2VA 5C1UA 4X8UH 3SI4H 3P8FA 4NWLA 2A2QH 1K1LA 1O5AB 4UDWH 1BTYA 1TALA 3RM2H 4UFGH 1U6QA 3BTWE 1GBFA 2VNTA 3ZZAA 4NSVA 3RUOA 5IK2D 1MUEB 5L2ZH 1KXFA 3Q00A 3QO6A 3UR6A 2FYRA 2HALA 5AFYH 3SO3A 3PYHA 3EQ0H 3UREA 2SNVA 2F3CE 3ZV8A 1BBRK 1AKSA 2ZG0H 1F5KU 3WY8A 1PPCE 1O39A 1XX9A 2Y5FA 1EZUC 3E8LA 1SGQE 1O5FH 1SQTA 2D2DA 3SBKA 3V3MA 2EI8A 1IQJA 3T29A 3BEUA 4DVAU 3SV8A 2W6JD 4WWYA 2V7QD 1BUIA 2GTBA 2XBYA 1OXGA 1O2ZA 3OSYA 1C2MA 4HFPB 5FPSA 1E37B 3U28C 1EB1H 1K1IA 3BTQE 2WPMS 4ABIA 2G81E 1DLKB 4Y6DA 1GI9B 1GJ5H 4Y10E 4RSPA 1MBMA 2ZFSA 4AZ2B 5A0BA 3M5MA 4KELA 1JOUB 1PPBH 5C67A 1T31A 2R2WU 4K1SA 2J2UA 4KP0A 3TK6A 3SYJA 1ZMLA 2F43B 3F2GA 1YLCA 1XXFA 1FY8E 4BANB 2ZGCA 1OWEA 4ZROA 1C5RA 5F8XA 1AUTC 2QXJA 1GDQA 3A8AA 1O0DH 3PMAB 3ZZ3A 1SG8B 3P17H 1ELGA 1GHBF 3PLKA 1YKTA 1O2QA 1V2NT 1FIZA 1GMHG 3SU6A 2BD4A 1AVGH 4IBLH 1XXDA 2BD5A 1DXPA 1GBBA 3PRDA 2NU0E 2K0QA 5C0UA 1QQ4A 1SR5C 1ELEE 2PKAB 1NRSH 4E7RG 4ZXXH 2ZDMA 4AG1A 4I8HA 1IQFA 1P9SA 1EP6A 2PGQB 3AAUA 4KTSA 1D6WA 2BQ6B 4HG6A 2WPDD 1GJDB 2PUQH 3OY5U 3FO8D 4AGKA 1L4DA 1TX7A 5IYTA 1NPMA 4SGAE 1EXFA 4NFEA 3OX7U 3QGJA 1PPHE 1PPZA 5LGOA 1O2GH 1ESAA 1HAVB 1Y59T 3V7TA 1BMLA 3HATH 3ODDA 3MU8A 3LH3A 1QJ7B 1TABE 1K28D 2ZIQH 4IN1A 1KXBA 1ZGIA 4Y7AA 1P06A 1CU1A 1AWHB 1FUJA 3SU5A 4XDEA 1TBZH 2OC7A 2Y5HA 2PP6A 2FO9A 5F8ZA 5DGJA 4GPGA 3BV9B 1IQNA 1GHZA 2QF5A 2FOGA 2BOKA 1HAYB 3M3TA 4A1XA 3URCA 1W8BH 4GUXA 3RXTA 4O97A 1F0RA 1OWIA 3PMHB 1QRZA 2P8OB 1N6YA 5HXFA 1AFEH 2O8MA 5C3NA 5ABWA 4WJG2 3KGPA 4B2CA 3M7UA 2QXIA 1P2OA 1IQMA 2BVRH 2YMSD 1GG6B 2XBXA 5TCAA 3SNAA 1SBWA 2BDYA 3GCNA 1ZHMA 1Y3WA 1C5OH 1O35A 2YOLA 3QWCH 4D7FA 3FN8A 4X6NA 1QJ6B 1SLXB 1DM4B 1ACBE 1DXWA 3U8OH 2O8UA 3VGCB 2SGAA 3RU4T 4XD7D 1A4WH 3LH1A 1FN8A 4Y0YE 4B75A 5KEDA 1SLVB 1P2QA 1T8LA 1WAYB 2A0QB 1XKAC 1H8IH 3A7XA 5JDUB 1CA0B 3ZZ7A 4I33A 1O2SA 2GGVB 2EQNA 2F9NA 4A92A 1C1NA 1SGCA 1VITH 2ZDLA 4YXWD 2GT8A 1GBCA 3LIWA 1QB1A 2D26C 2Y7XA 1KXEA 1IHSH 2PFEA 4AORA 1WU1A 1XMNB 1MMJN 2KAIB 1EAUA 2Y81A 2B5TB 4CRFA 1MAXA 1IHTH 4Q80A 1T4VH 1W0JD 1PYTD 2ZPQA 1TONA 1UMAH 2J98A 1O38A 2V0BA 4Q63A 5CHBA 1PPEE 1FPHH 3BF6H 8ESTE 1DT2A 4X1NU 4D9RA 3A7WA 1HAGE 5EQRA 1PQ5A 1QL9A 3GY7A 2JDID 3BSQA 3B8JA 3D65E 4FVDA 3BEFB 1BTUA 2OK5A 2FOAA 1K22H 1YYY1 2A5IA 3I77A 4Z0KA 1O2XA 3PO1B 3OYPA 2BMGB 3SNDA 1BT7A 1SOTA 1VKYA 1F5LA 4X1SU 3UWIA 2FI5E 1QR3E 4INKA 2W3KA 1UTNA 1AHTH 2WPHS 3MOCA 3MU1A 1K1JA 4MLFB 2FZZA 5KECA 1J17T 2H2ZA 2QA9E 1LHFH 2H6MA 1HXEH 1DFPA 3D62A 2GT7A 1YLDA 1O3MA 1YBWA 2ZDKA 3UIRA 2J5UA 2WV4A 3LT3A 1YPEH 2PHBA 1UVTH 2V35A 4AFZA 3U8TH 2HOBA 1AE8H 4BTTB 2F9BH 1LHGH 1O5CB 4M9FA 4I31A 2KFWA 9LPRA 4O3TA 3UFAA 3F0OA 4HZHA 1SVPA 1NFYA 2ZU3A 2GD4B 3QX5H 4A1VA 2ESTE 1KTSB 2VIPA 3MH5A 1KXDA 2QF3A 1C1PA 4F55A 2ALVA 3TK9A 3Q77A 4BXSA 2AMQA 1FY5A 2GCTC 1SGFA 4A6LA 3RXVA 3SV9A 2AS9A 3M7TA 5T1VA 2HGTH 1MZAA 4OS1A 1VGCC 3RM0H 3H7TA 2SNWA 2ZF0H 2EA3A 1VJAU 2EY4C 5EU8A 3O8DA 3W94A 5F8TA 2QGRA 4RT1A 1BBRE 1DX5M 3HK3B 1K21H 2AIQA 1KLTA 2CHAC 2PLXA 1ZPCA 3V13A 1TX6A 1DOJA 2F91A 1ZJKA 1A3BH 2VINA 2C4FH 3C27B 3SUDA 2RDLA 3HKJB 4GLYA 4U32A 2AMDA 1BHXB 1RD3B 2XNDD 1GHWH 2ZU2A 3MWIU 3VG8A 1H9LB 2NU4E 3ATWA 4X8VH 2V3MA 2KCOA 1ANCA 4AOQA 3SU1A 1T8OA 2IPQX 3M37A 4M7GA 3GY3A 5DG6A 4YO9A 1L1JA 3ATKA 1C1OA 1M9UA 1TBQH 1O3CA 7LPRA 1CT4E 4CH8B 3SJKA 4MQAA 3DA9B 1AKSB 3TIUA 1FY3A 1BTWA 2J92A 4TPYA 2JH0D 4UEHH 2BXTH 3QK1A 2ZP0H 8LPRA 3RLYH 2ZEBA 1G32B 3Q3XA 4CBOA 5B6LA 1SI5H 1TNGA 1C5MD 2GVFA 4Q2KA 1FAKH 5EQQA 4NSYA 3B9FH 3TJOA 1ARBA 5C1XA 1P57B 1C5TA 1TNLA 2GZ7A 3U98H 1XUGA 1XUJA 3RXKA 2WV9A 1HXFH 3GY4A 1C5PA 3PTBA 5JB8S 1LPGB 2QCYA 3R3GB 2XC0A 1OWKA 1SLUB 1NROH 4XRNA 1LO6A 3KQEA 3SZEA 4A5TS 2XC4A 1UTLM 3SJIA 1DE7H 4ZKNU 2A4OA 4CREA 2PW8H 4Y8YA 1NFWA 5A09A 3MNBA 2HLCA 5JBBS 1YP9A 1BMFD 4HGCA 1H8HD 2XWBI 1BHXF 1C2DA 2BQWB 1ESBA 1ELVA 4OS7A 3A8BA 4X2YA 2QV1A 1V2WT 3ZZDA 4AYYB 1MTUA 4DT7B 3GCTG 2P3TB 2QAAA 4OM9A 4I8GA 2G4UA 2OTVA 1LVOA 2GDDA 2UUJB 1ANBA 2M5TA 4YT6H 2GKVE 1IQGA 3GCTF 1RTKA 1BDAA 1F5RA 3Q76A 1QRXA 2SFAA 2WPIS 4MPWA 3QGNB 4NA9H 3UNRA 5T6DA 1T8MA 2Z9GA 2VWLA 1GVLA 1KIGH 3AW0A 1ZOMA 1GL0E 1GHAG 1OWJA 5EJ1A 2P16A 1HAHH 5E8EH 3VB4A 2O8TA 3MH7A 3TLOA 1PQ8A 4K1EA 3LDXH 3KQBA 1OWDA 1SQAA 1EQ9A 5G4BA 2AGGX 5ETXA 1P12E 1LKAA 1GHAF 1QURH 1C2FA 3MQKC 1MABB 3SI3H 1W0KD 2RFKC 7GCHG 2F9OA 2PTNA 4ZUHA 4DIHH 1MU6B 4AB8A 1O3EA 3W95A 2VWOA 1TPSA 1C5LH 5DP4A 2RCEA 4MVNA 7GCHF 2HNTC 3BTFE 1HFDA 1MU8B 2ZI2H 3RC6A 2AHME 4JYVH 2FP7B 2ZA5A 1T32A 2G5NA 3PROA 1P05A 3LC5A 1IQEA 1NESE 1Z8RA 1Z1IA 4SGBE 1H1BA 2R0LA 1DANH 1S82A 4BOHA 3RXFA 2HWLB 1HNEE 1TNIA 1ZHPA 4ISLA 2XNIA 5EXNA 4E06H 2ZQ2A 3F2HA 3UTUH 2F9VA 1C1QA 4CRAA 1P04A 2SGPE 3ENSB 1KXAA 1LQEA 1V2OT 2CMYA 2VGCC 2XXLA 4FUDA 3VB5A 2H5CA 1O3NA 3AVZA 6GCHF 2Y80A 5DP7A 4X0WU 5EQSA 3RP2A 2FTMA 5DP6A 5E0JA 2ANYA 1V2VT 3I29A 3SUGA 3BTTE 3NZIA 3RXUA 1ZRKA 4HI3A 1TA2A 2BVSH 2ILNA 1O5DH 1ZTJA 1RIWC 3RXRA 1MD7A 1UVSH 5FL7D 3FOAA 2ZDAH 3KN2A 3KQ5A 3A84A 1KSNA 4XE4A 5L6NH 2AERH 2Z9JA 4RKOB 4A7IB 3GS9A 3ZVGA 3E0NB 1EAWA 2RA3A 5JYIA 3S7KB 4CHAC 1W0YH 4LZ1H 1TWXB 3RXQA 3VXFH 4MG3A 1NRPH 1OYTH 1P0SH 3MMGA 2DE9A 2FXRA 3KCGH 3GY8A 1C2IA 1W7XH 2GV6A 3F9FA 3ZYEA 4CRCA 3PMBB 3RXAA 1QZ8A 2IJD1 2QY0B 1O3KA 1QGFA 1JBUH 3AASA 3ATMA 5J4QA 3SGQE 3RXOA 3FZZA 5LPFA 1A61H 2AGIX 1YLNA 3PB1E 3RXMA 2QXHA 3LGUA 2GCTB 1WQVH 2PR3A 2J98B 2G8TA 3BEIB 3D23A 3EE7A 2R0KA 1GHYH 2ZFRH 3FANA 5FPYA 3TH3H 4CH2B 1VGCB 3RXHA 5FX6A 3U9AH 1GI5A 2PTCE 4FXGH 4Y71A 2B9LA 1QA0A 1LVMA 2CHAB 1Y3UA 3DT0H 1IAUA 1FAXA 2J97A 4UFEH 1CGIE 1YCPM 1HJ9A 5GCHG 3O8BA 2FMJA 3LGIA 1IQKA 4K3JA 1O2KA 3W1EA 5HKKD 3HPTB 3QUMP 3LC3A 3P70B 2OC8A 2VIVA 1DWEH 1QCPA 1KTTB 3HGPA 1GBEA 2J9NA 1ZZZA 3DFLA 4RI0A 4F4OC 5GCHF 3ZVAA 3RXDA 3G01A 1VJ9U 2ANKH 1EFRD 1D3DB 2R2MB 4AX9H 1MQ5A 4IC5A 1DITH 2Z9IA 3LU9B 1D3QB 3VPKA 1OS8A 4ASHA 4CRGA 1O32A 3A88A 1VITF 2A5KA 2BY6X 1SL3A 2C93B 1HAXB 3QZQA 1YM0A 1P2JA 4UE7H 1JRSA 3DSOA 4FETA 5EG4A 2BD7A 2W6ID 2WPKS 1SFQB 1LQDB 2HLDD 3A7TA 3LGYA 2SGQE 4FU9A 5I25A 1H9IE 3EA8A 3VXEH 1GBLA 1O3BA 5I46H 4X6OA 1E1RD 4IW4E 2CGAA 1NU7B 3PLBA 2ALPA 1ETTH 4ZH8A 1WOFA 1ZTKA 2ZGHA 3FP6E 1HJ8A 3F68H 5A8ZA 4PROA 6LPRA 3RXGA 2VU8E 2WV5A 3VEQB 1D9IA 1SGYE 1P10A 3RC5A 1A0JA 2FWWA 5JPMH 1C5YB 1HAZB 1VCQA 1BIOA 2ZC9H 1GHBG 2FEQH 1WQSA 2UUFB 3KQDA 1D4PB 2ZKSA 3A7VA 8KME2 5HM9A 2CXVA 4TT3D 2FDAA 5E2OA 4B6FA 2BDHA 1DSUA 3MI4A 5EGMA 3MFJA 1UK2A 2C3SA 3RMMH 3UQVA 4JZIA 1P2IA 5EJLA 1HBTH 1RXPA 5AVDA 1AGJA 1ELFA 2GV7A 1V2UT 1LHEH 3BTGE 1QRWA 1QB9A 1MCVA 1ELCA 1UCYH 4O9VA 5C1YA 4TY7A 1SFIA 3SHAH 1ZYOA 4NCYA 1QFKH 1O5GH 2A31A 2RG3A 1XUKA 2G4TA 2M2AA 4FUCA 2VVVA 4JYUH 1AZZA 1CQQA 1GVZA 4H6SB 2ZHFH 4X6PA 3RC4A 1GBAA 3KEEA 1C1MA 5ESBA 2CF8H 3A8CA 1P2NA 1MKWH 1K1MA 3OEED 3RXJA 3M7QA 1GI8B 1E38B 1P09A 2A1DB 1KLIH 1SGFG 2W7UA 4JZDH 3P8OA 5LPEA 1LVYA 1S0QA 5B6OA 4NGAH 2C8ZB 4DCDA 3I78A 4ZXYH 2VIOA 3BG8A 4U01A 1OHHD 4BAHB 1FLEE 1ZMNA 2FLBH 1SHYA 8GCHF 1HDTH 1MAYA 1LTOA 2D8WA 2ZU5A 1AFQC 2V6NA 1CHOF 2O8WA 1KDQA 2BZAA 1WBGB 2BY8X 1UVUH 2WYJA 2NWNA 1O3GA 3S9CA 3A81A 5HIYA 3KYFA 3SJ9A 5JBTA 1FI8A 3EE0B 3LGTA 2PGBB 2Y6TA 3VB3A 3M5LA 4ACBA 4ACAA 1XVMA 1BTHH 2OUAA 4RT0A 4ZKRU 1BBRH 3T2NA 1C2HA 2ZWLH 3F0PA 4K69A 2VIDA 1TPOA 2UWOA 1KXCA 1RTLA 3KL6A 2A45B 5JB9S 3ITIA 2J94A 2A4RA 1C2GA 4ZMAH 1QTFA 1YPJH 5AFZH 3NXPA 2W3IA 3ZVDA 2VGCB 4BAMB 1NFXA 1CGHA 1ETSH 1C5NH 3U69H 3TGJE 2BYAX 1BB0B 5HM2A 3ZZ9A 1SGTA 3EAJA 2IOTA 1MKXK 1JIRA 1OYQA 1V2KT 2XW9A 2VVCA 1JIMA 1E34B 2Q6FA 1XVOA 2GCHG 1S6LA 1Q31A 1RIWB 2EI7A 4TWYA 3LGWA 1S84A 1DY9A 1O2IA 3P95A 1GJ8B 3ATIA 1DPOA 1C5WB 4JCNA 1WXRA 1Z6JH 2GCHF 1GCTC 2KM0A 1O2TA 1A5HA 4B76A 4B1TA 4H4FA 4LZ4B 2XWAA 4CHAB 2DE8A 2ZTXA 3NWUA 2G55A 3GYLB 3GOVB 5DPAA 3NK8A 1TA6A 2ZPRA 1P11E 5HMAA 1UCYE 1HV7A 3VFEA 1ZPZA 2PSXA 5C2ZA 1LDTT 3BTME 1ID5H 4BTIB 1HUTH 1ANDA 4I8KA 3DHKH 2XTTB 2P3UB 1AIXH 3GY5A 2HNTF 3MO6A 2QF0A 1ZLRA 1ZPBA 1EOJA 1SQRA 2ZHWH 4IC6A 1HAPH 2VWMA 4OS2A 4Y0ZE 5PTPA 2C8YB 3FZDA 3RXPA 1O3HA 4GHQA 2BXUH 3BTHE 5AF9H 4Z6AH 1G3DA 2AYWA 3T26A 1AVXA 5K7RA 5ESTE 2JIZD 2Z6BD 1HRTH 3P6ZB 2G52A 1C1SA 1GCDA
chains in the Genus database with same CATH topology
3MTYA 3SQEE 1O34A 2C8WB 5DP9A 1QJ1B 3MH4A 1C2EA 3MU4A 2LNCA 4NA8A 3EYDA 1O3OA 1JXPA 3TGKE 2UUYA 1H9HE 3A82A 1LHDH 1C4Y2 1DWCH 4XFQA 4U2WA 2H9EH 5FAHA 2GX4A 2OCVB 1HIAB 3M3VA 1BJUA 4MNWA 1LMWB 4CBNA 3O8CA 1G30B 1QL7A 1CSOE 2OXSA 4GVUA 4IMZA 2C90B 3GCOA 1BTZA 3TVJB 3C1KA 4RN6A 3UNSA 2ZGJA 1F7ZA 3SGBE 1FIWA 4ZAEA 4ISIH 3A87A 2EC9H 2BY9X 1GI1A 3BN9A 2I6SA 5FX5A 1MBQA 4GCHF 1TGTA 2BQ7B 1A0HB 4I32A 1ZSLA 3T25A 2OD3B 3E16B 2FOFA 1NN6A 3JZ2B 1D6RA 2BLWA 2J4IA 4WMFA 4YLUA 3V0XA 3L3TA 2OBQA 1ZSKA 1D3PB 5DP5A 5C5NA 4JK6A 3ATLA 1BCUH 1HLTH 2AEIH 1TNKA 3UUZA 1UK3A 1GGDC 3OTJE 3A80A 1J9CH 5FBEA 1P3EA 3BTEE 4MPVA 4Q7ZA 1O3IA 4GHTA 2YNBA 1UTJA 5E0GA 1W0ZU 5HGGA 4YM9A 1RFNA 1C4V2 3MHWU 4INHA 2CJIA 5BPEA 1HAIH 2ZDVH 1YF4A 3EGKH 1ABIH 2TIOA 3SJOA 3FP8E 1NFUA 4YOGA 1A46H 4FUHA 1CHGA 1GBKA 2JETC 3VB6A 2VIQA 3IITA 4K8YA 1GBJA 4BAOB 1HGTH 1K1PA 1NTPA 1QY6A 1SGIB 3BTKE 3MNSA 1GJ6A 1O2MA 1BITA 1UTOA 4XOJA 4X1RU 4D76A 1MZDA 4ISOA 1EZSC 1VCPA 2BHGA 3SNEA 1G36A 3LPRA 3Q3YA 2FX4A 1BMNH 1TOMH 3HK6B 4AYVB 5LPRA 4D9QA 1PPGE 3D49H 1GI7B 4DW2U 1AY6H 4LOYH 1TAWA 5EXMA 3PV4A 5DJ7A 3SN8A 5T6GA 2FYQA 4AGJA 4TY6A 3IG6B 2AGEX 1BRUP 1FONA 3GY2A 2FOMB 2FOBA 3TJUA 4D8NA 1PYTC 2HPPH 3M3SA 3OY6U 3QLPH 2PSYA 3MU5A 2W7SA 1WUNH 1O3JA 1CO7E 1A2CH 5A0CA 1S5SA 4THNH 1GMCG 1B0FA 1ELTA 3HGNA 5FCKA 3SW2B 1TQ0B 4K60A 1QB6A 1A5GH 1GBIA 3PMJA 1YPHC 1AUJA 3MNXA 1V6DA 5EW2H 1GMCF 4FUBA 1AFQB 3AW1A 2WYGA 4MNVA 2B7DH 3SU2A 2FESH 5F03A 1V2PT 1DWDH 1NRQH 3FFGA 2TPIZ 2JH5D 1YGCH 1EKBB 3GDVA 3GISB 4NIYA 3LJJA 4H42U 4CR5A 4CR9A 2TGTA 3UR9A 2NU1E 1ABJH 1SB1H 1O3PB 1QHRB 3NKKA 4B2AA 1MD8A 2P94A 5A0AE 4LXBH 4Q7XA 1F92A 4NZLA 1ZSJA 1B5GH 2QYIA 3SGAE 2VH6A 3S7HB 1O2RA 2F83A 2XCFA 3QTVH 1N8OC 4UFFH 1NT1A 2XRCA 1Y5UT 4Q7YA 1UHBA 2CN0H 4WMEA 4AFUA 3EDXB 1MTNC 1Y8TA 2UWPA 3TU7H 3TPIZ 4X2VA 1ZHRA 2G5VA 1T7CA 5L2YH 1W2KH 1GHXH 1C1UH 1K1NA 4JK5A 4YLQH 2ZFPH 2K1QA 1TFXA 1UO6A 1IQLA 4MNXA 4DOQA 3S9BA 3LKWA 1GPZA 1S83A 1GBTA 1UVOA 2AMPA 2FOEA 4KTUA 1DUEA 1LKBA 5A8YA 3EA7A 3FP7E 2W5EA 2OBOA 3RMOH 1GCTB 1O31A 1J8AA 2GZ9A 1NO9H 3STJA 1BJVA 1S6HA 5DK1A 1YPHE 1G2LA 1MTSA 4FUIA 4O3UA 3RXBA 1TPPA 4U30A 3S0NA 2A5AA 4B71A 3MO3A 3GDUA 6GCHG 2H5DA 2R3YA 1V2MT 3MU0A 1KDQB 4IGDA 2NU3E 1SC8U 4MPXA 4BAQB 3F9HA 2BB4A 1O3DA 1RTFB 1SQOA 5CE1A 1CBWC 1P3CA 2O8LA 1C1VH 2THFB 1C2LA 4R8TB 3UWJH 3URDA 5FPTA 5AHGH 4ZHAA 3KQCA 1ESTA 4WF8A 2GDEH 4AN7A 1FNIA 1CT2E 1HIAA 1FDPA 2BX4A 1GJCB 1C5UA 3SJ8A 1YPMH 3SU3A 3SUFA 2FOHA 3GDSA 3CS7A 2ZPSA 4TPIZ 2ZHQH 1V2TT 3GICB 1G37A 2OQ5A 3SU0A 3UNQA 1C1TA 2GMTC 2XCNA 3UOUA 2V3OH 1SGPE 3L6PA 3ZZ5A 2ODQA 5CHAC 2BDBA 2R9PA 4ABEA 1V3XA 3T5FH 1KY9A 4JZEH 1T8NA 3GY6A 1IQHA 1CGJE 3Q3KA 1A7SA 1ELBA 1EATA 1HYLA 1OWHA 3P8NA 2XC5A 1C1WH 3PTNA 4ABJA 1OP0A 3QN7A 4ABBA 3E1XB 1QIXB 3NUMA 4WY3A 1NS3A 2YNAA 1OKXA 4D7GA 1O2HA 1TGBA 4IN2A 1AB9C 1GVKB 2C8XB 4AG2A 1FJSA 4J1YA 2VB0A 2VIWA 3U1JB 3ZV9A 1V2JT 1B7XB 2ZNKH 3A83A 2BD8A 2R3UA 5EPNA 1AE5A 1TGSZ 4OGXA 2JH6D 1E0FD 1XUFA 4Y8ZA 4AB9A 2BD9A 2ODPA 2G00A 4R0IA 1Y5AT 1P2MA 1S85A 3SU4A 1TLDA 2ZDNA 1GGDB 2BVXH 1VITG 3IWMA 4HTCH 2AIPA 1AMHA 2BDCA 1AI8H 4WH6A 1EJAA 1EASA 1O37A 1EJNA 4XSKU 1O5EH 1EOLA 4ISNA 1V2RT 4MTBA 1Y5BT 1GWAA 2Z9LA 2TGDA 2FS8A 1TIOA 2B8OH 3A85A 3LOXA 2BM2A 4A1TA 1Z1JA 1ZRBA 3PLPA 3PWCA 3A86A 2OQUA 2JETB 1W11U 1N1LA 3SORA 3BG4C 5GXPA 2P59A 4YTAA 3E90B 3KHVA 2AH4X 1EPTA 4KKDA 4CRBA 1TRMA 4O03A 2VJ1A 3NCLA 1FY1A 4UD9H 5GIBA 2JKHA 1WV7H 4FVBA 1EZQA 4VGCB 2BOHB 2FM2A 1O2WA 2ZFQH 2ZTZA 2Z3EA 3K2UA 1D3TB 2TGPZ 2PUXB 4OGYA 1DVAH 5DP3A 3TJVA 3H7OA 5EPYA 1TQ7B 4ZKOU 1KYNA 1THPB 1E36B 3BIUH 1SMFE 1BMAA 2G51A 1OPHB 4DIIH 3ODFA 1WYKA 5LH8A 3FAOA 2W26A 3K9XB 3SNCA 4WMDA 4Y76A 1SPJA 3DFJA 2XBWA 3CP7A 2Q6DA 5T3HA 2OP9A 5TCCA 1FZZA 1WTGH 1WTHD 4YOIA 3M35A 1SLWB 1AN1E 1UVPA 1ZGVA 1O33A 2FPZA 1C5QA 4ZHMU 1PQ7A 5H4IB 1GJ7B 5TJXA 1J15A 1TMTH 2CV3A 1GMHF 3U8RH 3TITA 4NZQA 3E0PB 2D1JA 2HPQH 4BTUB 1EPTC 2GZ8A 2IN2A 3SUEA 1B0EA 1TMBH 1BTPA 1O2LA 2ZGXH 2FTLE 2Z9KA 3BTDE 4CRDA 2A7HA 2HRVA 4FUFA 3LJOA 4AFSA 4BAKB 8GCHG 2H1UA 1G3BA 2H9HA 1GL1A 3KIDU 1N8OB 4K1TA 4YESB 1V2ST 1BZXE 1CHOG 1BRBE 1CE5A 1MTNB 3ZYDA 1WSSH 2WPJS 1PFXC 4Y11E 2EEKA 3ZZ8A 3MO9A 1IQIA 1UJ1A 2FOCA 1TNHA 5FCRA 1TX8A 1BA8B 1NRRH 9ESTA 4MDSA 2Y82A 1HCGA 3E3TA 4E05H 3A89A 4NWKA 1TE0A 1XUIA 1EX3A 1GI0A 2ODYB 3ZZ4A 3A8DA 2V3HH 2ZZUH 3ZZ6A 1NU9A 2BLQA 3RXSA 2ULLA 1OX1A 4X1PU 3ZVBA 1PJPA 3P8GA 1LHCH 1ELDE 1RGQA 1INCA 1F0TA 1MCTA 2QIQA 1C2KA 4X8TH 2A7JA 4KGAA 1EJMA 2BX3A 2UUKB 5BRRE 5E0HA 2ZECA 1CBWB 4X2WA 3TH2H 3UPEA 2A2XH 1Z8IB 3T27A 1J14A 4ISHH 3VB7A 1K1OA 1Z8GA 2WUBA 2ZO3H 1S6FA 4Y7BA 5E2PA 3ZVFA 3SV6A 1BRAA 4ABHA 1QBNA 1E35B 7ESTE 1HAOH 1THRH 2STBE 1OSSA 4BXWA 5JBAS 2ZCLP 1NY22 4FU8A 2P3FH 2HVXA 2BDIA 1UHBB 2PKSC 3ZZBA 2ZHDA 2GMTB 1OOKB 4Y79A 5GWZA 3RLWH 1C5SA 5CHAB 1QBOA 3LONA 1BMMH 4ESTE 3SNBA 3TK5A 1O5BB 1PQAA 3JZ1B 1GDNA 3L33A 2FS9A 4KTCA 5EOKA 1L1GA 5A8XA 3QTOH 4GSOA 3TGIE 4I8JA 1NRNH 4X8SH 1HJAC 4J2YB 1LVBA 1W13U 1ARCA 1AWFH 1P2KA 2VVUA 1G2MA 1O30A 1OP8A 1UTQA 5GJ4B 1EB2A 1XUHA 2F9PA 2SGEE 1AB9B 3PWBA 2LPRA 1K9OE 1T4UH 2EI6A 3KF2A 4B74A 1RRKA 1Q2WA 2J95A 3ZZCA 1EP5A 1A1RA 2Q1JA 1TOCB 3K6ZA 2STAE 4F49A 1TRYA 2P93A 2FI3E 2ZQ1A 2J34A 3GCHB 1P02A 4AFQA 2OC1A 1ELAA 2Q6GA 4GAWA 1AVWA 3UQOA 2CF9H 1YCPK 4ABDA 1QBVH 2BDGA 3S9AA 1GI6A 2BZ6H 1N6XA 1TRNA 3SV7A 1SOZA 1QL8A 1SSXA 2ZTYA 2A4QA 3QDZB 1DLEA 1W7GH 3GYMA 1VR1H 4ABAA 3RU4D 4LK4A 4GCHG 1C5XB 3T28A 1DUAA 1GJ4H 1EAXA 4NG9H 1S81A 3P92A 2GP9B 1Z71A 2TRMA 2PV9B 4XBCA 3BG4B 3TH4H 6CHAC 1GBMA 2BLVA 1EZXC 2J38A 4YOJA 1C9TA 1NZQH 1PPFE 1QNJA 1TBRH 1XKBC 5GDSH 5HYOA 1AO5A 4OS5A 1CVWH 1HB0B 2ZHEH 1DSTA 4FU7A 1Y3XA 1LPKB 3F1SB 4JZ1A 3A7ZA 4WH8A 1MQ6A 3LGVA 2Z3DA 1DDJA 2AFQB 3O8RA 3NPSA 1CT0E 2RA0A 1L4ZA 2ZU1A 1P9UA 1TGCA 4OS6A 3ZVEA 1W14U 4WXVA 1O2JA 5F6MA 2FODA 2PWXA 4NIWA 4IS5A 1FMGA 4I7YH 1NC6A 1ZTLA 1HPGA 1AD8H 1GI4A 1P01A 2FX6A 4FUJA 2IJOB 3DUXH 4JMYA 2PKAA 5CMXH 1C1RA 3RMNH 1MKXH 3K6YA 4K8BA 1G3CA 5DO4H 3F6UH 4NIXA 5JBCS 3M5NA 3MH6A 3SZNA 2XBVA 3DD2H 1TNJA 4ZKSU 3RDZA 1C5VA 4K2YA 4VGCC 2B0FA 4MPUA 3HKIB 4YT7H 2UWLA 3M5OA 1HAVA 1ZJDA 1J16A 2P95A 2BD2A 1Z6EA 2BDAA 3TNTA 1AZ8A 1GMDG 1P03A 3B23B 2SGFE 2O9QA 1EPTB 4XBDA 1THSH 5K0HA 1H8DH 4K5ZA 1NM6A 2I6QA 1ZR0A 4IMQA 3R0FA 1GMDF 2TBSA 3OU0A 4ABGA 3SV2H 3BIVH 4BNRA 2ZU4A 3FVFB 4H6TA 1SGDE 3H5CB 1CA8B 4TYDA 2ZFFH 1V2LT 2TGAA 4WXIA 2WUCA 1YC0A 5FHTA 1ANEA 1FV9A 3E91A 5J4SA 2BY5X 1JRTA 4X6MA 1DS2E 1P8VC 1L1NA 4JZFH 3RXLA 2NU2E 1A0LA 1SGRE 5A2MH 1RJXB 1DICA 5C20A 2BD3A 1FN6A 1GJBB 1C9PA 1O2UA 2QN5T 4Y8XA 1VCWA 3K65B 4ABFA 1F0UA 1ORFA 5EW1H 3U1IB 2ZCKP 1C2JA 3N7OA 2A32A 1BRCE 3KNXA 4DURA 1FXYA 2VH0A 1O3LA 5GPIB 1C4U2 1YCPH 4YZUA 1F2SE 1SGNE 4UFDH 1GBHA 1GI3A 3ELAH 4WVPE 1OP2A 3RMLH 5L30H 3UY9A 1O2OA 1RS0A 1A5IA 3MNCA 2A4GA 2Y7ZA 1TMUH 1Y3VA 2OLGA 4DJZB 1TGNA 3PM3A 1DWBH 1MH0A 1ZMJA 2KAIA 1G3EA 4FUEA 4XBBA 3S69A 2F9UA 5EXLA 5FBIA 1O2YA 1TYNA 1BQYA 1TB6H 4JYTA 1FPCH 1GJ9B 1GBDA 3SOSA 2PKSB 3TJNA 1VZQH 1K2I1 1KLJH 1XM1A 1YPKH 1Q3XA 2ZFTA 4INLA 4DG4A 1UTMA 5FXLA 1V2QT 2BTCE 1O36A 2P8OC 4B2BA 1L2EA 3TNSA 1LPZB 2FI4E 2OC0A 5C5OA 5EODA 2ANWA 1JWTA 1L0ZA 1GG6C 3SHCH 2FIRH 2WPLS 1UTKA 1HJAB 1MTWA 1FQ3A 4DY7B 1ETRH 1BOQA 2H9TH 1SHHB 4FUGA 4QT8C 3VGCC 1AU8A 1LCYA 1GJAB 2XYAA 3RXEA 3E6PH 2Z3CA 1Z7KA 4I8LA 2OINA 3F9GA 4RKJB 1JMOH 3STIA 1F0SA 1CA0C 6ESTA 1UCYK 4DGJA 3EA9A 1X7AC 1SGEE 4B73A 2QC2A 2BY7X 1A3EH 2BLOA 1GDUA 1W3CA 1W12U 4NIVA 2QXGA 2Z94A 1Y3YA 3M61U 1O3FA 5DP8A 3RU4E 3RXCA 2Y5GA 7KMEH 3QZRA 3V12A 1MKWK 5T6FA 4E7NA 3CENA 1FY4A 1YPGH 1TPAE 1GI2A 4UONA 4X2XA 5IDKA 1IOEA 4NFFA 3ZVCA 1EUFA 2VWNA 3A7YA 3T62A 2A7CA 1UTPA 2Z7FE 2ZGBH 3CS0A 4X1QU 3AAVA 3ESTA 3M36A 3UOPA 2HNTE 2ASUB 2WINI 4ZHLU 1G9IE 3MYWA 4MNYA 1H4WA 3RXIA 3PO1C 2SGDE 2FLRH 1C5ZB 1UK4A 1BTXA 6CHAB 1W10U 2ANMH 2DUCA 4NA7A 4TWWA 3SQHE 1WCZA 1QA7A 1Z8JB 2IPHA 3F9EA 1MTVA 5SGAE 1QQUA 1O3AA 1O2PA 3GCHC 1EAIA 1GHVH