1O2WA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
molecule tags Hydrolase
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2wA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2wA02
4I8HA 1GHBG 1MTSA 4D8NA 3LONA 5IDKA 4ESTE 1YLCA 2SGQE 4ZHLU 3BTKE 4ABGA 1KLJH 1KSNA 1O5GH 1MMJN 1SI5H 5DP3A 2ZGCA 1P8VC 1JBUH 2I6SA 5E8EH 3VGCC 1L4ZA 1IAUA 1TBZH 2ZDVH 1AZ8A 3RMMH 1NU7B 2Y80A 2Z3EA 1BB0B 7GCHG 3MTYA 2J94A 2PR3A 3S9CA 5DP6A 1A5IA 1KY9A 1N8OB 1GDNA 1UTQA 3M7QA 2R0KA 1H8DH 3PMAB 4AORA 1A7SA 1WTGH 1UCYK 1D3TB 3TH4H 4GHTA 1HCGA 2VWMA 2D1JA 3FAOA 1ELTA 3V12A 5C5NA 1RGQA 4A1VA 2P8OB 1C1OA 3H7TA 3P95A 2J2UA 1G2LA 3SO3A 4X1RU 1XUJA 2FX4A 3A86A 3BG4B 1B0EA 3A84A 5DGJA 9LPRA 3HK6B 1QQUA 2FZZA 3T62A 1HFDA 1P09A 1F0UA 1KIGH 2A1DB 3ZZ7A 4ZXYH 2OXSA 4MDSA 2BX4A 1JMOH 1UCYE 4B1TA 1EAUA 2WPLS 2ZEBA 1K21H 2AS9A 1GJCB 1TBQH 1AQ7A 2BLOA 3M3VA 3TGKE 4AYVB 3U1JB 3GY2A 8LPRA 1DICA 1TMBH 4FUJA 1GI0A 4KP0A 4ZKRU 1EB1H 3HKJB 3P6ZB 4K69A 2OBOA 3ZZDA 8KME2 3ATLA 1MKXH 4BAKB 3UR9A 3TNSA 1LHGH 4JYTA 3UOPA 1LQDB 2F9PA 5T6DA 1FLEE 1HAGE 1C1WH 1GCTC 1GJDB 4MPWA 2WYGA 3H7OA 2OCVB 3W94A 3T25A 1P04A 3SJ9A 1EAXA 1QHRB 3LC5A 4RKOB 3A81A 3AASA 1ZJDA 1HAOH 3S69A 2FOGA 3RMNH 1B7XB 2A4RA 2ZFTA 4ABEA 4NIYA 1OWEA 1EOLA 1YPHC 2FI3E 1IHSH 1MCTA 3D23A 1C1TA 1SLWB 4X6NA 2Z9GA 4X8SH 3TJOA 1PYTC 3MNCA 2YNAA 2ZF0H 1GJ7B 1TNIA 1W11U 2Q6GA 3VXFH 2P94A 1OP0A 3BV9B 3I78A 1SMFE 5I25A 1XXDA 1TMUH 3A7WA 4BANB 1LVBA 3VFEA 1GHZA 1G3CA 4BTUB 2UWLA 5JYIA 4OS6A 3U9AH 1BTHH 1H8IH 2BVXH 4CH8B 2WUBA 1AVXA 2VVVA 1QA7A 3RXGA 1BCUH 1BRUP 3RMLH 1ZGIA 2GT7A 1O3AA 1Z1JA 1F7ZA 3BG8A 1PPFE 2OTVA 2P3TB 1C5OH 1UTPA 5EPNA 2UUYA 3I77A 4CBOA 1T8OA 1GBHA 2G4TA 1C5LH 1GJ5H 2WINI 3LDXH 4FUBA 2H5DA 1XM1A 1O3EA 1QFKH 5JBCS 1FIZA 1MU6B 2ZU4A 2GZ9A 1ZPBA 2VNTA 1ETTH 1T8LA 1H9IE 1GHAF 1LHCH 2A2XH 1PYTD 4WH6A 1RTKA 3GDSA 5A0AE 4B75A 1O3IA 2CJIA 1P05A 1JIRA 1HAVB 1O2PA 4X0WU 3VB3A 2Y7XA 2HGTH 1O3KA 1TFXA 1UTLM 3MMGA 3MHWU 4MTBA 2TRMA 3ZVBA 1J14A 3SNEA 2GCTC 3ZZ9A 1UHBB 1XVMA 2Y7ZA 4DIHH 2GGVB 4BTTB 9ESTA 1PQ5A 1ABJH 1C2LA 1QRXA 1SLVB 2ZDKA 5K7RA 1EPTC 1LKAA 2ZECA 4FUHA 2TGTA 2W5EA 1H1BA 1EB2A 4B2BA 4H42U 1G30B 1DXWA 2BLVA 2A2QH 1DY8A 5FCRA 3E90B 1GBEA 1DWBH 4AX9H 1EKBB 2ZU5A 2CHAC 5FBEA 1JOUB 2ZU1A 1HGTH 2F91A 4ZKOU 3RMOH 1GI5A 3JZ1B 1P12E 3ITIA 1O2QA 3ATIA 1GGDC 2JH5D 4K1EA 3PLPA 1YPKH 1O3HA 1GI8B 1V2WT 3P8OA 4ZROA 4X2VA 5A09A 2H1UA 3T5FH 5FHTA 3TK5A 1D6RA 4Q2KA 3Q3YA 2QCYA 1D3DB 3ENSB 2J38A 2B0FA 5A8YA 3LH1A 1SHYA 3DT0H 2ZTYA 2ZDLA 4IW4E 1W2KH 1E37B 1VCQA 2AGIX 2VIOA 3P92A 1J17T 4WF8A 3UR6A 1D4PB 1AGJA 1ZSJA 4YT6H 1TNLA 4B2AA 3DA9B 2GV7A 2SNWA 4GHQA 1DOJA 4NG9H 3PTBA 1C2KA 1OS8A 1EASA 1SR5C 1SGNE 2Z9IA 2BD3A 2ZGJA 1ELBA 2SGPE 1EZQA 1AE8H 1SL3A 2ZCKP 3RUOA 1Z7KA 3V0XA 2P59A 3SGBE 1ARBA 1O3NA 3UNQA 1GI1A 2D2DA 1WU1A 4AN7A 2M5TA 3GCTG 2CF8H 2HNTC 3RXKA 3E3TA 3STJA 3S9BA 2B5TB 3GDVA 2QXHA 3VPKA 1P2IA 1MQ6A 1UTKA 2XBWA 1C2MA 2XW9A 2ILNA 1GI3A 2K1QA 1THRH 2BY7X 3MWIU 1Y5UT 1F0SA 2FDAA 1UTMA 4DVAU 2XBYA 1GBBA 1BMNH 3ZVDA 1QBVH 1O2SA 1O2HA 1W8BH 3DD2H 5K0HA 1EOJA 3DUXH 2THFB 1T8NA 7KMEH 3A7VA 3PROA 3VXEH 3RXBA 4B76A 1O3MA 1UTJA 2BLQA 1K9OE 4A1XA 1SLXB 1AFQB 4F49A 5FPTA 4VGCC 1ZRBA 3ZVAA 4XE4A 3TNTA 5BRRE 3TH2H 2Y81A 2WPJS 2ZDNA 5C3NA 1NO9H 3UWJH 2SNVA 5SGAE 3D65E 1G37A 3RXDA 3ZYEA 2AYWA 1AB9B 3S0NA 2Q6FA 3SHCH 1L2EA 1P2NA 3CS7A 1DFPA 1XUFA 2BQWB 2AMDA 4YOIA 4BTIB 1DWEH 1GJBB 1NC6A 3F9HA 1A46H 1ZSKA 3NKKA 4KELA 2FOEA 1S81A 1V2VT 1SFQB 2ZGBH 1GBCA 3FZZA 3SQHE 1HAHH 3M5NA 4YO9A 3PLBA 3BTME 3MH7A 4FUIA 2UUKB 4U30A 4NA8A 4HTCH 1NESE 1NRSH 2PTNA 5EPYA 4D7FA 1GHAG 1P9SA 5A8XA 2C8ZB 1DWCH 3A7XA 1D3QB 1DSTA 5DP8A 1KDQA 3OYPA 4WY3A 2XYAA 3RC5A 4ZXXH 4AOQA 3F9FA 4CRBA 1IOEA 3ODDA 5L2YH 2W3IA 1SGTA 3P17H 2ZPQA 3EAJA 3ZZBA 1QA0A 1E0FD 4Y0YE 1DLEA 2ZKSA 1FJSA 5C2ZA 1TPPA 1TGNA 1RFNA 2R2WU 1SBWA 1ELDE 1OP2A 1HJAC 2Z94A 4I31A 3B8JA 4IN1A 4ZKSU 3KCGH 4R0IA 1GVLA 3PTNA 2ZPSA 3MNXA 5GCHF 4JYUH 1V2MT 4ABIA 3VB6A 4Y76A 4O97A 3MU0A 3A87A 4OS5A 8GCHF 2G8TA 1BRBE 3MU5A 5FAHA 2R3UA 1FY4A 4R8TB 5EXLA 3QO6A 1C5WB 4X2YA 1F0RA 5IYTA 4NA9H 2GTBA 1Z8RA 2FYQA 3EE0B 1UHBA 4JZIA 3ZVEA 3ZVFA 1FXYA 4RN6A 3BTWE 1S82A 2HALA 1P3EA 1V3XA 1FPHH 1ZJKA 4RKJB 2J4IA 1C5TA 2C90B 1YPJH 5EODA 3TU7H 2GV6A 1O0DH 1SG8B 2A4QA 3QWCH 4UONA 4CH2B 4ISHH 3MNBA 3M5OA 5EQQA 4A6LA 4ABFA 2VVCA 1GL1A 3E6PH 3URDA 3P8NA 4F4OC 1GI6A 1AD8H 1ETRH 1SGDE 2QXJA 1ANCA 3SJIA 3QDZB 1K1IA 5ETXA 1AIXH 3GCHC 1HPGA 3F6UH 5JBAS 1C2HA 2CHAB 5CHAC 1Y3YA 3M7TA 5TCCA 3Q3XA 3SUEA 2TPIZ 1ELFA 2FP7B 1NRRH 1LHFH 1V2JT 2ZWLH 1NM6A 1W3CA 3GY7A 3VB4A 1QNJA 1V2PT 3U98H 1O2YA 3U1IB 1ESAA 1MTNB 1CE5A 3RXCA 3Q3KA 4WMEA 1TX6A 1K28D 2J92A 1NU9A 4CRGA 1EQ9A 1P57B 1P2MA 1GPZA 4KTUA 5A0CA 4O3TA 2EC9H 2XWAA 4JCNA 2UWPA 5JDUB 1UVSH 2XBVA 4E06H 5AFZH 1T4UH 3SV8A 1F92A 3BTQE 2ZC9H 1H4WA 1J16A 3M61U 5CE1A 3EA8A 1GI2A 2V0BA 1JXPA 1MQ5A 1TAWA 1DT2A 2AEIH 1HAIH 2GKVE 2GCHG 3QUMP 3M3TA 4CRDA 7LPRA 4IMZA 1P3CA 1TABE 2ANWA 4H4FA 1P2OA 2G55A 5FCKA 1IQEA 1TRYA 1GMDG 1GHWH 1P9UA 2XRCA 2F9NA 5T6GA 2ZIQH 3NK8A 3ZZ5A 3TJNA 4UE7H 3V7TA 3A7ZA 1ZZZA 3GCHB 3A88A 1F0TA 1EZUC 1Q3XA 2OC7A 1O30A 4LOYH 3ZYDA 4FVBA 1EATA 2W7SA 1RS0A 4CR9A 1UK3A 4AG1A 4INLA 2BY6X 2ZHWH 1ELAA 3ZZ3A 2BD5A 1IQMA 4GPGA 2R0LA 3DFLA 1S6HA 2RA3A 1CHOF 1CA8B 1O2XA 1Y3XA 2BD8A 1TRMA 1P10A 1MBQA 1K1PA 2DE9A 2OLGA 1VITF 1MAXA 2FTMA 2FI5E 4KTSA 4A1TA 2LPRA 2ZP0H 1MKWK 4ZHMU 1TGTA 1HB0B 4YTAA 1FN6A 1EZXC 4K5ZA 1PPZA 2ZCHP 3SU2A 3ZVCA 1AZZA 2C8YB 1O3BA 4NWKA 3SV6A 2Z7FE 3BTEE 1A0JA 1C1VH 2H9HA 2BVSH 1UVUH 1LPGB 1SFIA 2C8XB 1O3JA 1CQQA 3A7YA 4DG4A 4K60A 5DKMA 1C5UA 5L6NH 1CBWC 1J9CH 2PSXA 3GDUA 2OBQA 1BTPA 2BZAA 3O8BA 4NCYA 2WPMS 2ZDAH 1YGCH 3RXQA 1O2UA 1RRKA 1QB1A 2QF3A 2G81E 4BXSA 1O2TA 2VGCB 2STBE 4DOQA 3RP2A 5AF9H 1X7AC 1GI9B 4DIIH 1GI4A 5LGOA 2EA3A 1KXCA 3QZRA 1AB9C 1C5PA 1O33A 2Z9LA 4Y6DA 1ELEE 3QTOH 2ZFFH 2A7JA 3RXLA 3LGVA 3UNRA 5EGMA 1HNEE 4AFSA 1HBTH 1L1NA 4WMFA 1OWDA 5DK1A 5EU8A 1ZMLA 5GCHG 1AI8H 1QB6A 1HXEH 1SGQE 1AU8A 1UO6A 1IQFA 1BIOA 1QBNA 3TIUA 1H9LB 1KXDA 1LMWB 4ZH8A 1HYLA 1NT1A 3BEIB 2VWLA 1RTLA 2ZQ1A 4FU9A 4FUGA 3FP6E 5AHGH 2DE8A 2BMGB 1BBRE 1BHXF 4XDEA 4ABHA 2VGCC 4X8UH 1FY8E 4GCHG 6GCHG 1G9IE 3M5LA 2SGDE 1HIAA 3SU1A 4A5TS 2ZGXH 1T32A 1DUAA 2B7DH 3PWCA 1C5QA 4ISOA 1UVTH 4BAQB 4CHAC 5I46H 1K22H 4XFQA 3ZZ6A 4ZUHA 1PQ7A 1PQAA 1KLTA 3VB7A 4AFUA 1HJAB 1CGIE 1PFXC 2GDDA 2Z6BD 3KHVA 1GBDA 2NU4E 2ZFQH 2P93A 2ZFRH 4XSKU 4ZHAA 5EQRA 1LPZB 2BY5X 2FI4E 1WUNH 4AFZA 4JZEH 1MU8B 4ISNA 1XMNB 4YLQH 2FYRA 3GYLB 1BQYA 1YP9A 2ASUB 1UVPA 1XVOA 1BHXB 1WV7H 1GJ9B 1WTHD 2XXLA 5FX6A 3LIWA 3SGAE 2BD9A 4HGCA 4DY7B 3RXPA 2VJ1A 3RXVA 1P06A 1IQNA 2Y82A 1SGRE 3RXIA 1T31A 1V2KT 4YT7H 4B2CA 3FZDA 1VCPA 2PSYA 3ATWA 4NIWA 2FOBA 4RSPA 1AWFH 1C5SA 3FP7E 4MG3A 1HAYB 1BMMH 2VVUA 1C1UH 1HV7A 2ALVA 3QK1A 4NIXA 5EW1H 1V2QT 2ZI2H 1GVZA 4J1YA 2FIRH 2CXVA 2A7CA 3U8OH 2P8OC 1O32A 1FAXA 4MNVA 2FWWA 3K6YA 4AG2A 5E0JA 1OYQA 5JBBS 3RXEA 4BXWA 1AE5A 3ZZCA 6LPRA 1S6FA 4WXIA 2VWNA 4OS4A 2ZU2A 3BIVH 1OX1A 1NRQH 2VIWA 1O2OA 1OOKB 4BNRA 2STAE 2H6MA 1TWXB 2HPPH 3SI3H 1ZTJA 4AYYB 1ZR0A 2QF0A 1BZXE 1KTTB 1XUIA 3UQVA 1JWTA 3DHKH 1O2VA 5FX5A 5HGGA 3UTUH 4INHA 1DPOA 2PKAA 2J9NA 1HUTH 1DSUA 1RIWC 3LT3A 5E0GA 5A2MH 5F8XA 2ZFSA 1O5FH 1G3DA 3P70B 2ULLA 1SLUB 2ESTE 3GOVB 2A0QB 2OQ5A 2NU2E 1S0QA 1W0ZU 1XKAC 4TWWA 3RXOA 2D8WA 1A1RA 1S0RA 1QCPA 3VGCB 3RU4T 4D9RA 1ELGA 2OINA 2BD4A 1XKBC 5ESBA 1ABIH 1KXFA 2A32A 3B9FH 2BQ6B 1SGFA 4IGDA 3L6PA 1YCPM 1HAZB 5EXNA 1TE0A 1DM4B 1GBIA 2HRVA 1KLIH 3TVJB 4AB8A 1TA6A 2FOMB 2Q1JA 1JRTA 1V2TT 2BOKA 1J15A 1SB1H 3P8FA 3IWMA 1TPSA 1YPLH 4QT8C 1QY6A 4WVPE 2QAAA 1LVYA 2ZQ2A 2QXIA 3LJOA 2G5NA 4ZAEA 1K1MA 1A0HB 1IHTH 5F8TA 4INKA 2BVRH 2SGFE 4K2YA 1ZTKA 1NRNH 4MNWA 7GCHF 1UCYH 1LTOA 4UFDH 2ZTZA 4AGJA 2OC8A 5E0HA 3KNXA 1V2ST 1BRCE 2Y6TA 1T8MA 3M37A 1QB9A 1BMAA 1ELCA 4ZMAH 1NZQH 1Z71A 2FXRA 4NGAH 2G4UA 2Z9KA 1O34A 2YOLA 3UQOA 1C5MD 4IMQA 1ZTLA 1THPB 1OWHA 3ESTA 4GUXA 2FX6A 1P02A 1EPTA 1YPMH 3BTFE 1RXPA 4X6MA 3SNBA 5EOKA 1HLTH 1KTSB 1BBRH 2QIQA 4Y8YA 1FY3A 1K1LA 1M9UA 1B5GH 2PKSC 1DWDH 3HGNA 4K3JA 3BTTE 1BTYA 2WPIS 3IITA 2R2MB 2J95A 4OS2A 3UUZA 1UJ1A 5FPYA 1BTXA 3V3MA 4TYDA 2A45B 1GBFA 4NA7A 4NFFA 1DXPA 1BRAA 2PLXA 2PGQB 2RA0A 1HAXB 3F1SB 3RU4E 2PUXB 1LPKB 4LZ4B 1QIXB 2ODYB 6ESTA 2AERH 5C20A 1C9PA 1Q2WA 1F2SE 2PTCE 3BTDE 1BA8B 1CGJE 1CT2E 3JZ2B 1HXFH 3E1XB 2AMQA 4UEHH 1C4U2 1D3PB 1TONA 5DP4A 2BDCA 2RG3A 3L3TA 6GCHF 4X1PU 1VGCC 1GBKA 2OD3B 1BJUA 1S85A 1VR1H 2BDGA 3RU4D 2QN5T 3ELAH 4I8GA 2AIPA 1E38B 2C4FH 1LKBA 4YOGA 4Z0KA 4X1SU 3PM3A 3LGUA 2W3KA 2OUAA 3TK9A 3KQBA 1O36A 2HNTF 1O38A 4DGJA 1VCWA 3RLWH 4JZDH 1QL8A 4OGYA 1FONA 4K8YA 1WOFA 1FV9A 1GBLA 2A4OA 1C5XB 3AAUA 2GVFA 2PGBB 2PKSB 1YF4A 5DP9A 4YM9A 2ZTXA 3GYMA 2ZPRA 5C1YA 3SUDA 2IJOB 5GWZA 2WV5A 3HPTB 1YYY1 3G01A 1SGPE 1AO5A 2F9BH 3LGYA 2A4GA 4KKDA 1P2KA 3LJJA 1TNJA 1GMHF 1GVKB 2BDBA 1GBAA 1O2RA 1W12U 1DE7H 2FOHA 2ZFPH 5A8ZA 1EAWA 2IPHA 1TA2A 2JH6D 4JK5A 3MH6A 3SORA 3UPEA 1FDPA 1GJ4H 3ZZAA 4I8KA 5F8ZA 1FN8A 2HOBA 1XXFA 2BY8X 2FESH 4HI3A 5LPRA 2AMPA 1G3EA 1LHDH 4VGCB 1EP5A 1Z1IA 2GT8A 4DT7B 2BM2A 1ANBA 7ESTE 1AVWA 4Y10E 3RDZA 1FNIA 1O2WA 4LK4A 1SQOA 3Q76A 4XBBA 1C2EA 6CHAC 3A8BA 1O3CA 3MOCA 1FY1A 3ATKA 1ZYOA 1TNGA 4THNH 1ZPZA 3Q00A 4Y8ZA 3PV4A 2QA9E 1T7CA 3OU0A 1GMHG 1SQAA 4ABDA 2CV3A 4K8BA 1CHGA 3SBKA 3W95A 1PQ8A 1YBWA 3SU4A 4B73A 2R9PA 4FXGH 2HLCA 5FXLA 2HNTE 4K1TA 5C1UA 2BD7A 1C2FA 3HK3B 1SGCA 1MCVA 2FS9A 2Y5GA 3MI4A 1UK2A 3U8TH 3GY5A 1PPHE 4WXVA 1FPCH 1TGSZ 1HJ8A 4MPXA 2CN0H 4YZUA 3ZV9A 2AH4X 3A8AA 5FPSA 1C1QA 3KQDA 2PKAB 4H6SB 1JIMA 3SOSA 4MNYA 2ALPA 1O31A 4ISLA 2O8TA 1QL7A 1P2JA 2Z9JA 5F03A 3RC6A 2NU3E 1GMDF 1TALA 1UTOA 2H9EH 4MPVA 2ZZUH 1O2KA 4X8VH 3FP8E 1O5CB 3CP7A 2IN2A 3QTVH 5TJXA 2G51A 3RXMA 1FI8A 4O03A 2VH0A 2LNCA 2F9UA 1Y3VA 5J4QA 1AVGH 2NWNA 2BXTH 1GL0E 3T27A 5DP7A 3SUGA 4DW2U 3MNSA 1N8OC 3SJKA 1OPHB 1MZDA 1AKSA 1D6WA 4FUFA 1MD8A 1NFYA 3LGWA 4I32A 2JETB 2GMTB 4Y7BA 4CRCA 2FOAA 4X1QU 1E35B 3I29A 1WAYB 2RDLA 1QL9A 1YPHE 1IQJA 1QJ7B 3PLKA 4MPUA 3UWIA 1SGIB 1GG6B 4ABAA 3MFJA 4WH8A 1FY5A 1V6DA 3DFJA 1CA0B 3MU1A 2FM2A 2ANYA 1QBOA 1TNHA 3LOXA 4JYVH 1GGDB 4JMYA 3LU9B 1HDTH 1Q31A 5L30H 2CMYA 1CU1A 3SZNA 4SGBE 3OSYA 1VJAU 1IQIA 3ZZ4A 1ZPCA 1C4Y2 2BX3A 1P2QA 5JBTA 3KL6A 1ORFA 1ETSH 3VEQB 1NN6A 1SOZA 4Q7YA 4UFFH 3K65B 2V6NA 3R3GB 1C2GA 1L1GA 1GBJA 2EEKA 4D9QA 3UREA 3TH3H 5CHAB 1EJMA 1WSSH 3SJ8A 5CMXH 1L4DA 1QRWA 4NSYA 2Z3DA 2QV1A 3M3SA 4BAOB 3SI4H 1S84A 3RXUA 2TGAA 4FU8A 2H5CA 1V2NT 2VWOA 2C93B 5FBIA 1MH0A 2Y5HA 4E05H 4HFPB 2P3FH 3SJOA 1CA0C 3D62A 4ISIH 3RC4A 2A31A 1C5RA 1O37A 1ESBA 1O2MA 4I8JA 3A7TA 2XCNA 1NRPH 3TJVA 2RCEA 4MQAA 2FO9A 1O3DA 4AFQA 3KIDU 1WQSA 3T29A 1QR3E 1KXAA 2QXGA 4Y71A 1GDUA 2TGDA 1WQVH 2EI8A 3MO3A 2ZHDA 4OS7A 1BTZA 4CHAB 3A83A 3A80A 1G3BA 3QGNB 4NSVA 1P0SH 3LH3A 2GX4A 4WJG2 1EUFA 5E2PA 3B23B 1ID5H 2ANKH 4I33A 2O8WA 4D7GA 4GLYA 1XUGA 5L2ZH 1V2UT 1A5GH 3GY6A 3K6ZA 1Y8TA 3M35A 4BAMB 2ZG0H 1ELVA 3SUFA 1TOCB 4Q80A 1CSOE 4YOJA 3URCA 3ZZ8A 1WBGB 1TLDA 1FAKH 1KXBA 3RLYH 5AFYH 5GDSH 1TX7A 5TCAA 3BN9A 1W7GH 5EW2H 4I8LA 1OP8A 1GWAA 4TPYA 3PMHB 2VH6A 1BTWA 2GZ8A 1MAYA 3HGPA 4IN2A 3PWBA 4UFGH 5C5OA 1Z8JB 1NROH 2V35A 1QTFA 3GCOA 1LO6A 1W10U 3F9EA 3L33A 5DP5A 3PMBB 1QJ6B 2GP9B 1G32B 1VITH 1UTNA 4K1SA 4ZKNU 3S7HB 1HRTH 4UDWH 1TYNA 2ZHEH 3U69H 1MTVA 1O3GA 4IS5A 1AWHB 3BF6H 5E2OA 1IQHA 4OS1A 3A8DA 2BXUH 4E7NA 3MU8A 4ABJA 2OP9A 1Y3WA 1QJ1B 1DX5M 1GG6C 4O9VA 2ODPA 1DY9A 5AVDA 1FQ3A 1D9IA 4Y79A 4FVDA 3SV9A 2SFAA 3QZQA 2A5KA 1O2JA 3E91A 1WYKA 2BDHA 1NY22 4MLFB 4GCHF 2DUCA 3RXSA 1PJPA 2F9VA 3LPRA 1LQEA 3NUMA 4TWYA 3P8GA 2QC2A 4Y11E 4DJZB 2GD4B 1W13U 1HAPH 5HM9A 4FU7A 1UK4A 1SPJA 3A8CA 5A0BA 4FUEA 1DDJA 1O3OA 3O8DA 1QQ4A 1PPGE 1YLDA 5DJ7A 3MU4A 2B8OH 3SU0A 2VB0A 3NXPA 4KTCA 1FIWA 4IC6A 2O9QA 1V2LT 4JK6A 2NU1E 1KXEA 2VINA 2WPHS 3A85A 1C5VA 3KN2A 1A0LA 1O3PB 1CBWB 2G00A 3KGPA 3FVFB 1DS2E 1MUEB 3SNDA 1LVMA 2UUFB 2TGPZ 2AIQA 4D76A 1NTPA 2YNBA 1FMGA 1QRZA 4JZ1A 1HIAB 4HZHA 5HMAA 3RXTA 1TPOA 2XC4A 3KQEA 2AGGX 3GY8A 1BITA 5C1XA 1K2I1 2VIDA 2XBXA 2ANMH 2HPQH 1G2MA 1O5EH 1P01A 1PPEE 2C8WB 1BOQA 1V2OT 4PROA 1GHYH 3PO1C 1ZRKA 2ZNKH 3SV7A 2FEQH 1AFEH 3TGIE 1NS3A 3BIUH 2XC0A 2BTCE 3FANA 1O3LA 1YPEH 2A5IA 1C9TA 3ZVGA 3SNAA 3SNCA 3R0FA 3T26A 1BTUA 1K1OA 2PHBA 2UWOA 1YM0A 1GHXH 3PYHA 1Z8GA 1EAIA 2O8UA 2XNIA 3EGKH 2SGAA 3UFAA 4U01A 2JKHA 4X8TH 4Y8XA 3LC3A 1UVOA 5EG4A 4OGXA 5JB8S 2FTLE 3E16B 4IC5A 3T28A 1O2GH 3A89A 2NU0E 3WY8A 2FODA 3SGQE 1L0ZA 3LKWA 2PFEA 3TJUA 1XX9A 1YCPK 2BY9X 4CR5A 1O35A 6CHAB 4X1NU 4UD9H 5HM2A 2V3OH 1RJXB 5DO4H 4SGAE 1ANEA 3AW0A 1JRSA 5JB9S 3MO9A 2WPKS 2UUJB 1O39A 4M7GA 1A5HA 3GY3A 2IOTA 2SGEE 4YLUA 2QY0B 4Q7XA 4A7IB 3UNSA 1C5NH 1HJ9A 1E36B 1TOMH 2VIQA 4X2XA 1K1NA 1DITH 1F5LA 3F9GA 1V2RT 5DG6A 1Z8IB 4BOHA 1IQLA 1SQTA 1YCPH 3TK6A 1SGFG 1YKTA 4CRAA 1GHBF 2W26A 1ANDA 2ZHQH 3T2NA 3M36A 4XBCA 1O2LA 4AZ2B 3LGIA 1U6QA 1E34B 1P11E 3D49H 2BQ7B 4LZ1H 5LPFA 1BMLA 1C2JA 4FUDA 1C1PA 1H9HE 1MZAA 1S83A 3EDXB 2BHGA 1OWIA 1O5AB 2OQUA 2A7HA 1BDAA 1FZZA 3C27B 5T6FA 3QLPH 2VIVA 4U32A 4IBLH 2ZO3H 2Z3CA 4NWLA 5DPAA 1ZLRA 1O2IA 4J2YB 3PB1E 1MTWA 2PUQH 1GCDA 1SOTA 1KDQB 2ZA5A 8GCHG 1CT0E 1SGEE 2WV4A 1O2NA 5ESTE 2PV9B 5F6MA 1F5RA 3BEUA 4MNXA 3EA9A 2W7UA 4DCDA 3K9XB 1SVPA 2P16A 5EQSA 1ZMNA 3IG6B 1TB6H 3SW2B 2FMJA 1PPCE 3SQEE 1TQ7B 3C1KA 1EX3A 1J8AA 1LCYA 2D26C 2G52A 3TGJE 1RTFB 4DURA 3BG4C 3LGTA 5HYOA 3EYDA 3SU3A 3ZV8A 5C67A 2HWLB 1MTNC 3RM0H 2CGAA 2Y5FA 2XTTB 2AGEX 1GI7B 4B71A 1C1MA 2EI6A 2OC1A 1EXFA 1MKWH 1O2ZA 2BDYA 1NFXA 3UOUA 4X6PA 4TPIZ 2FS8A 1OKXA 1VZQH 3STIA 2BYAX 3SN8A 3Q77A 4KGAA 1LDTT 3VB5A 1C1NA 3AAVA 4XOJA 1AY6H 1SHHB 4YESB 3N7OA 4FUCA 3TLOA 1Y5AT 3O8RA 3EA7A 3K2UA 1BUIA 1OXGA 5G4BA 3RXAA 1SGYE 1EJAA 4ASHA 1C2DA 1RD3B 1TBRH 4Y0ZE 3S9AA 1SSXA 5GXPA 2BZ6H 1N6XA 1TMTH 1OSSA 1ZSLA 2EI7A 1EPTB 1DVAH 1VJ9U 5J4SA 1IQKA 1NPMA 2G5VA 3KQCA 4LXBH 1ESTA 2TBSA 3AVZA 1DUEA 1GJAB 3FFGA 1MTUA 5HXFA 2F83A 1TPAE 3BTHE 5JPMH 1YPGH 1ACBE 2J34A 3RXJA 1EP6A 1O5BB 1ZGVA 2JETC 2VU8E 1B0FA 1ZOMA 4GVUA 1CGHA 2BB4A 3GY4A 1QURH 1C5ZB 1CO7E 2VIPA 1TIOA 3UIRA 1G36A 3BEFB 1TNKA 4GAWA 1N6YA 1GBMA 3NWUA 1ZHPA 1L1JA 1DANH 2ZGHA 3E0PB 3M5MA 1KYNA 3MH4A 3MH5A 1XUKA 2FLBH 2GCHF 1RIWB 8ESTE 2QGRA 5T3HA 1CVWH 2TIOA 5PTPA 4GSOA 2Q6DA 3KF2A 2O8MA 2F9OA 3SV2H 1MKXK 3PO1B 2R3YA 4O3UA 5LPEA 1ZHRA 3QN7A 1C2IA 5LH8A 2KAIA 3OY6U 1PPBH 2KAIB 1SC8U 3SU5A 4B74A 2H9TH 3HATH 1MBMA 4TY6A 3GCNA 2GCTB 1Y59T 1VGCB 2C3SA 4MVNA 2BDIA 3PMJA 3CS0A 3NPSA 3M7UA 1A2CH 1YC0A 2ODQA 1TGBA 1W7XH 3BTGE 1NFWA 2F3CE 2BD2A 1EJNA 2CF9H 1TGCA 5GIBA 1K1JA 4X6OA 1XUHA 1AKSB 1A61H 3F68H 2GZ7A 3SHAH 1AFQC 1DLKB 3MYWA 5GJ4B 3RM2H 2XWBI 3A82A 1BJVA 1O3FA 2JH0D 4UFEH 1VITG 1MD7A 3OY5U 4Q7ZA 3NCLA 3CENA 4E7RG 3BSQA 1AUTC 5H4IB 1UMAH 4AGKA 3E8LA 4JZFH 1F5KU 5EXMA 3S7KB 1HAVA 2P3UB 4I7YH 3ODFA 3UY9A 3GICB 2FLRH 3E0NB 3SU6A 4H6TA 1O5DH 3TPIZ 1TX8A 2BLWA 2ZDMA 1QGFA 1GCTB 1OYTH 1Y3UA 4NFEA 2XCFA 1S5SA 4WWYA 2ZCLP 3ATMA 2H2ZA 1IQGA 3QX5H 2I6QA 4NZLA 1LVOA 1T4VH 4Y7AA 2V3HH 4CRFA 5B6OA 1ARCA 2BOHB 4Z6AH 1AUJA 1N1LA 1AHTH 2AFQB 2A5AA 2O8LA 2QYIA 1WCZA 2PWXA 5ABWA 1TRNA 1THSH 1LHEH 3GISB 1GDQA 1C1SA 3NZIA 1C4V2 2OC0A 2BDAA 1NFUA 2XC5A 4WMDA 4BAHB 1GJ8B 3RXRA 4AB9A 1Z6EA 1W0YH 2FOFA 3GCTF 5BPEA 1GJ6A 2P95A 1OWJA 1GMCF 1OWKA 1INCA 3EQ0H 2ZHFH 2FOCA 4A92A 1CT4E 2WUCA 1W14U 2FPZA 2PW8H 1C5YB 1ZHMA 4X2WA 3MO6A 4TY7A 1A4WH 2B9LA 3O8CA 3KEEA 1AN1E 1CHOG 1C1RA 3U8RH 2GMTC 1AMHA 3AW1A 1BBRK 3HKIB 4ABBA 1ZMJA 4CBNA 4CREA 3OX7U 2HVXA 1GHVH 2ZU3A 2WYJA 1Z6JH 3TITA 1BT7A 3OTJE 4NIVA 1A3BH 1P03A 1A3EH 1FUJA 3V13A 3QGJA 1GMCG 3RXFA 4NZQA 3H5CB 5GPIB 3RXHA 2GDEH 1Y5BT 1EZSC 1GBTA 4U2WA 4XBDA 1TQ0B
chains in the Genus database with same CATH superfamily
4I8HA 1GHBG 1MTSA 4D8NA 3LONA 3AK5A 5IDKA 4ESTE 1YLCA 2SGQE 4ZHLU 3BTKE 4ABGA 3N7EA 1KLJH 1KSNA 1O5GH 1MMJN 1SI5H 1OHHD 2ZGCA 1P8VC 5DP3A 1JBUH 2I6SA 5E8EH 3VGCC 1L4ZA 1IAUA 1TBZH 2ZDVH 1AZ8A 3RMMH 1NU7B 2Y80A 2Z3EA 1BB0B 1H8ED 7GCHG 3MTYA 2J94A 2PR3A 3S9CA 5DP6A 1A5IA 1KY9A 2K8IA 1N8OB 1GDNA 1NBME 1UTQA 3M7QA 2R0KA 1H8DH 3PMAB 4AORA 1A7SA 1WTGH 1UCYK 1D3TB 3TH4H 4GHTA 1HCGA 2VWMA 2D1JA 3FAOA 1ELTA 3V12A 5C5NA 1RGQA 4A1VA 2P8OB 1C1OA 3H7TA 3P95A 2J2UA 1G2LA 3SO3A 4X1RU 1XUJA 2FX4A 3A86A 3BG4B 1B0EA 3A84A 5DGJA 9LPRA 2XNDD 3HK6B 1QQUA 2FZZA 3T62A 1HFDA 1P09A 1F0UA 1KIGH 2A1DB 3ZZ7A 4ZXYH 2OXSA 4MDSA 2XOKD 2BX4A 1W0KD 4B6FA 1JMOH 1UCYE 4B1TA 1EAUA 2WPLS 2ZEBA 1K21H 2AS9A 1GJCB 1TBQH 1AQ7A 5T1VA 2WV9A 2BLOA 3M3VA 3TGKE 4AYVB 3U1JB 3GY2A 2VBCA 1DICA 1TMBH 4FUJA 8LPRA 1GI0A 4KP0A 5B6LA 4ZKRU 1EB1H 3HKJB 3P6ZB 4K69A 2OBOA 3ZZDA 8KME2 3ATLA 1MKXH 4BAKB 2IPQX 3KYFA 3TNSA 1LHGH 3UR9A 4JYTA 3UOPA 2JJ1D 1LQDB 2F9PA 5T6DA 1FLEE 1HAGE 1C1WH 1GCTC 1GJDB 4MPWA 2WYGA 3H7OA 2OCVB 3W94A 3T25A 1P04A 3SJ9A 1EAXA 1QHRB 3LC5A 4RKOB 3A81A 3AASA 1ZJDA 1HAOH 3S69A 2FOGA 3RMNH 1B7XB 2A4RA 2ZFTA 1MABB 4ABEA 4NIYA 1OWEA 1EOLA 1YPHC 2FI3E 1IHSH 1MCTA 3D23A 1C1TA 1SLWB 4X6NA 2Z9GA 4X8SH 3TJOA 1PYTC 3MNCA 2YNAA 2ZF0H 1GJ7B 1TNIA 1W11U 2WHXA 2Q6GA 3VXFH 2P94A 1OP0A 3BV9B 3I78A 1SMFE 5I25A 1XXDA 1TMUH 3A7WA 4BANB 1LVBA 3VFEA 1GHZA 1G3CA 4BTUB 2UWLA 5JYIA 4OS6A 3U9AH 1BTHH 1H8IH 2BVXH 4CH8B 2WUBA 1AVXA 2VVVA 1QA7A 3RXGA 1BCUH 1BRUP 3RMLH 1ZGIA 2GT7A 1O3AA 1Z1JA 2J98A 1F7ZA 3BG8A 1PPFE 2OTVA 2P3TB 1C5OH 1UTPA 5EPNA 2UUYA 3I77A 4CBOA 1T8OA 1GBHA 2G4TA 1C5LH 1GJ5H 2WINI 3LDXH 4FUBA 2H5DA 1XM1A 1O3EA 1QFKH 5JBCS 1FIZA 1MU6B 2ZU4A 2GZ9A 1ZPBA 2VNTA 1ETTH 1T8LA 1H9IE 1GHAF 1LHCH 2A2XH 1PYTD 4WH6A 4ACAA 1RTKA 3GDSA 5A0AE 4B75A 1O3IA 2CJIA 1P05A 1JIRA 1HAVB 1O2PA 4X0WU 3VB3A 2Y7XA 2HGTH 1O3KA 1TFXA 3WW7A 1UTLM 3MMGA 3MHWU 4MTBA 2TRMA 3ZVBA 1J14A 3SNEA 2GCTC 3ZZ9A 1UHBB 1XVMA 2Y7ZA 4DIHH 2GGVB 4BTTB 9ESTA 1PQ5A 1ABJH 1C2LA 1QRXA 1SLVB 2ZDKA 5K7RA 1EPTC 1LKAA 2ZECA 4FUHA 2TGTA 4ZCNA 2W5EA 1H1BA 1EB2A 4B2BA 4H42U 1G30B 1DXWA 2BLVA 2A2QH 1DY8A 5FCRA 3E90B 1E79D 1DWBH 1GBEA 4AX9H 1EKBB 2ZU5A 2CHAC 5FBEA 1JOUB 2ZU1A 1HGTH 2F91A 4ZKOU 2GJGA 3RMOH 1GI5A 3JZ1B 1P12E 3ITIA 1O2QA 3ATIA 1GGDC 2JH5D 4K1EA 3PLPA 1YPKH 1O3HA 1GI8B 1V2WT 3P8OA 4ZROA 4X2VA 5A09A 2H1UA 3T5FH 5FHTA 3TK5A 1D6RA 4Q2KA 3Q3YA 2QCYA 1D3DB 3ENSB 2J38A 2B0FA 5A8YA 3LH1A 1SHYA 3DT0H 2ZTYA 2ZDLA 4IW4E 1W2KH 1E37B 1VCQA 2AGIX 2VIOA 3P92A 1J17T 4WF8A 3UR6A 1D4PB 1AGJA 1ZSJA 3OEHD 1TNLA 4YT6H 4B2AA 3DA9B 4XRNA 2GV7A 4YXWD 2SNWA 4GHQA 1DOJA 4NG9H 3PTBA 1C2KA 1OS8A 1EASA 1SR5C 1SGNE 2Z9IA 2BD3A 2ZGJA 1ELBA 2SGPE 2OK5A 1EZQA 1AE8H 1YY3A 1SL3A 2ZCKP 3RUOA 1Z7KA 3V0XA 2P59A 3SGBE 1ARBA 1O3NA 3UNQA 1GI1A 2D2DA 1WU1A 4AN7A 2M5TA 3GCTG 2CF8H 2HNTC 3RXKA 3E3TA 3STJA 2KZ4A 3S9BA 2B5TB 3GDVA 2QXHA 1H8HD 3VPKA 1P2IA 1MQ6A 1UTKA 2XBWA 1C2MA 2XW9A 2ILNA 1GI3A 2K1QA 1THRH 2BY7X 3MWIU 1Y5UT 1F0SA 2FDAA 1UTMA 4DVAU 2XBYA 1GBBA 1BMNH 3ZVDA 1QBVH 2YMSC 1O2SA 1O2HA 1W8BH 3DD2H 5K0HA 1EOJA 2L74A 3DUXH 1VKYA 2THFB 1T8NA 7KMEH 3A7VA 3PROA 3VXEH 3RXBA 4B76A 1O3MA 1UTJA 2BLQA 1K9OE 4A1XA 1SLXB 1AFQB 4F49A 5FPTA 4VGCC 1ZRBA 3ZVAA 4XE4A 3TNTA 5BRRE 3TH2H 2Y81A 2WPJS 2ZDNA 5C3NA 1NO9H 3UWJH 2SNVA 5SGAE 1WXRA 3D65E 1COWD 1G37A 3RXDA 3ZYEA 2AYWA 3F0OA 5EJLA 1AB9B 3S0NA 3MQKC 2Q6FA 3SHCH 1L2EA 1P2NA 3CS7A 1DFPA 1XUFA 2BQWB 2AMDA 4YOIA 4BTIB 1DWEH 1GJBB 1NC6A 3F9HA 1A46H 1ZSKA 3NKKA 4KELA 2FOEA 1S81A 1V2VT 1SFQB 2ZGBH 1GBCA 3FZZA 3SQHE 1HAHH 3M5NA 3DCLA 4YO9A 3PLBA 3BTME 3MH7A 4FUIA 2UUKB 4U30A 4NA8A 4HTCH 1NESE 1NRSH 2PTNA 5EPYA 4D7FA 1GHAG 1P9SA 5A8XA 2C8ZB 1DWCH 3A7XA 3W1EA 1D3QB 1DSTA 5DP8A 1KDQA 3OYPA 2JJ2D 4WY3A 2XYAA 3RC5A 4ZXXH 4AOQA 3F9FA 4CRBA 1IOEA 3ODDA 5L2YH 2W3IA 1SGTA 3P17H 2ZPQA 3EAJA 3ZZBA 1QA0A 1E0FD 4Y0YE 1DLEA 2ZKSA 1FJSA 5C2ZA 1TPPA 1TGNA 1RFNA 2R2WU 1SBWA 1ELDE 1OP2A 1HJAC 2Z94A 3KYGA 4I31A 3B8JA 3OFND 4IN1A 4ZKSU 3KCGH 4R0IA 1GVLA 3PTNA 2QF4A 2ZPSA 3MNXA 5GCHF 4JYUH 1V2MT 4ABIA 3VB6A 4Y76A 4O97A 3MU0A 3A87A 4OS5A 8GCHF 2G8TA 1BRBE 3MU5A 5FAHA 2JDID 2R3UA 1FY4A 4R8TB 5EXLA 3QO6A 1C5WB 4X2YA 1F0RA 2L6OA 3ZIAD 5IYTA 4NA9H 2GTBA 1Z8RA 2QF5A 2FYQA 3EE0B 1UHBA 5F53A 4JZIA 3ZVEA 3ZVFA 1FXYA 4RN6A 3BTWE 1S82A 2IJD1 2HALA 1P3EA 1V3XA 1FPHH 1ZJKA 4RKJB 2J4IA 1C5TA 2C90B 1YPJH 5EODA 3TU7H 4Z1MD 2GV6A 1O0DH 1SG8B 2A4QA 3QWCH 4UONA 4CH2B 4ISHH 3MNBA 3M5OA 5EQQA 4A6LA 4ABFA 2VVCA 1GL1A 3E6PH 3URDA 3P8NA 4F4OC 1GI6A 1AD8H 1ETRH 1SGDE 2QXJA 1ANCA 3SJIA 3QDZB 1K1IA 5ETXA 1AIXH 3GCHC 1HPGA 3F6UH 5JBAS 1C2HA 2CHAB 5CHAC 1Y3YA 3M7TA 5TCCA 3Q3XA 5HIYA 3SUEA 2TPIZ 1ELFA 2FP7B 1NRRH 1LHFH 1V2JT 2ZWLH 1NM6A 1W3CA 3GY7A 3VB4A 1QNJA 1V2PT 3U98H 1O2YA 3U1IB 1ESAA 1MTNB 1CE5A 3RXCA 3UB0A 3Q3KA 1YWUA 4WMEA 1TX6A 1K28D 2J92A 1NU9A 4CRGA 1EQ9A 1P57B 1P2MA 2KCYA 1GPZA 4KTUA 5A0CA 4O3TA 2HLDD 2EC9H 2XWAA 4JCNA 2UWPA 5JDUB 1UVSH 1EFRD 2XBVA 4E06H 3FKSD 5AFZH 1T4UH 2F43B 3SV8A 1F92A 3BTQE 2YMSD 2ZC9H 1H4WA 4FETA 1J16A 3M61U 5CE1A 3EA8A 1GI2A 2YMSB 2J98B 2V0BA 1JXPA 1MQ5A 1TAWA 1DT2A 2AEIH 1HAIH 2GKVE 2GCHG 3QUMP 3M3TA 4CRDA 7LPRA 1BMFD 4IMZA 1P3CA 1TABE 2ANWA 4H4FA 1P2OA 2G55A 5FCKA 1IQEA 1TRYA 1GMDG 1GHWH 1P9UA 2XRCA 2F9NA 5T6GA 2ZIQH 3NK8A 3ZZ5A 3TJNA 4UE7H 3V7TA 3A7ZA 2HVYB 1ZZZA 3GCHB 3A88A 5C17A 1F0TA 1EZUC 1Q3XA 2OC7A 1O30A 4LOYH 3ZYDA 4FVBA 1EATA 2W7SA 1RS0A 4CR9A 1UK3A 4AG1A 4INLA 2BY6X 2ZHWH 1ELAA 3ZZ3A 2BD5A 3U28C 1IQMA 4GPGA 2R0LA 3DFLA 1S6HA 2RA3A 1CHOF 1CA8B 1O2XA 1Y3XA 2BD8A 1TRMA 1P10A 1MBQA 1K1PA 2DE9A 2OLGA 1VITF 1MAXA 2FTMA 2FI5E 4KTSA 4A1TA 2LPRA 2ZP0H 1MKWK 4ZHMU 1TGTA 1HB0B 4YTAA 1FN6A 1EZXC 4K5ZA 1PPZA 2ZCHP 3SU2A 3ZVCA 1AZZA 2C8YB 1O3BA 4NWKA 3SV6A 2Z7FE 3BTEE 1A0JA 1C1VH 2H9HA 2BVSH 1UVUH 1LPGB 1SFIA 2C8XB 1O3JA 1CQQA 3A7YA 4DG4A 4K60A 2V7QD 5DKMA 1C5UA 5L6NH 1CBWC 1J9CH 2PSXA 4F55A 4I86A 3GDUA 2OBQA 1BTPA 2BZAA 3O8BA 4NCYA 2WPMS 5DN6D 2ZDAH 1YGCH 3RXQA 1O2UA 1RRKA 1QB1A 2QF3A 2G81E 4BXSA 1O2TA 2VGCB 2WPDD 2STBE 4DOQA 3RP2A 5AF9H 1X7AC 1GI9B 4DIIH 1GI4A 5LGOA 2EA3A 5EIYA 1KXCA 3QZRA 1AB9C 1C5PA 1O33A 2Z9LA 4Y6DA 1ELEE 3QTOH 2J97A 2ZFFH 2A7JA 3RXLA 3LGVA 3UNRA 5EGMA 1HNEE 3CNRA 4AFSA 1HBTH 1L1NA 4WMFA 1OWDA 5DK1A 5EU8A 1ZMLA 5GCHG 1AI8H 1QB6A 1HXEH 1SGQE 1AU8A 1UO6A 1IQFA 3SYJA 1S6LA 1BIOA 1QBNA 5C0TA 3TIUA 1H9LB 1KXDA 1LMWB 3N7DA 4ZH8A 1HYLA 1NT1A 3BEIB 2VWLA 1RTLA 2ZQ1A 4FU9A 4FUGA 3FP6E 5AHGH 2DE8A 2BMGB 1BBRE 1BHXF 4XDEA 4ABHA 2VGCC 4X8UH 1FY8E 4GCHG 2QE7D 1G9IE 6GCHG 3KQ5A 3M5LA 2SGDE 1HIAA 3SU1A 4A5TS 2ZGXH 1T32A 1DUAA 2B7DH 3PWCA 1C5QA 4ISOA 1UVTH 4BAQB 4CHAC 5I46H 1K22H 4XFQA 3ZZ6A 4ZUHA 1PQ7A 1PQAA 1KLTA 3VB7A 4AFUA 1HJAB 1CGIE 1PFXC 2GDDA 2Z6BD 5KEDA 3KHVA 1GBDA 2NU4E 2ZFQH 2P93A 5CHBA 2ZFRH 4XSKU 4ZHAA 5EQRA 1LPZB 2BY5X 2FI4E 1WUNH 3FN8A 4AFZA 4JZEH 1MU8B 4ISNA 1XMNB 4YLQH 2FYRA 3GYLB 1BQYA 1YP9A 2ASUB 5CDFE 1UVPA 1XVOA 1BHXB 1WV7H 1GJ9B 1WTHD 2XXLA 5FX6A 3LIWA 3SGAE 2BD9A 4HGCA 4DY7B 3RXPA 2VJ1A 3RXVA 1P06A 1IQNA 2Y82A 1SGRE 3RXIA 1T31A 1V2KT 4YT7H 5IK2D 1SKYE 4B2CA 3FZDA 1VCPA 2PSYA 3ATWA 2PP6A 4NIWA 2FOBA 4RSPA 1AWFH 1C5SA 3FP7E 4MG3A 1HAYB 1BMMH 2VVUA 1C1UH 1HV7A 4RT1A 2ALVA 3QK1A 4NIXA 5KECA 5EW1H 1V2QT 2ZI2H 1GVZA 4J1YA 5EJ1A 2FIRH 2CXVA 2A7CA 3U8OH 2P8OC 1O32A 1FAXA 4MNVA 2FWWA 3K6YA 4AG2A 5E0JA 1OYQA 3N99A 5JBBS 3RXEA 4BXWA 1AE5A 3ZZCA 6LPRA 1S6FA 4WXIA 2VWNA 4OS4A 2ZU2A 3BIVH 3F2GA 1OX1A 1NRQH 2VIWA 1O2OA 1OOKB 4BNRA 2STAE 2H6MA 1TWXB 2HPPH 3SI3H 1ZTJA 4AYYB 1ZR0A 2QF0A 1BZXE 1KTTB 3WWFA 1XUIA 3UQVA 1JWTA 3DHKH 1O2VA 5FX5A 5HGGA 3UTUH 2W6JD 1DPOA 2PKAA 4INHA 5EJZA 2J9NA 1HUTH 1DSUA 1RIWC 3LT3A 5E0GA 5A2MH 5F8XA 2V3MA 2ZFSA 1O5FH 1G3DA 3P70B 2ULLA 1SLUB 2ESTE 1W0JD 3GOVB 2A0QB 2OQ5A 2NU2E 1S0QA 1W0ZU 1XKAC 4TWWA 3RXOA 2D8WA 1A1RA 1S0RA 1QCPA 3VGCB 3RU4T 4D9RA 1ELGA 2OINA 2BD4A 1XKBC 5ESBA 1ABIH 1KXFA 2A32A 2KCAA 3B9FH 2BQ6B 1SGFA 4IGDA 3L6PA 1YCPM 1HAZB 5EXNA 1TE0A 1DM4B 1GBIA 3EE7A 2HRVA 1KLIH 3TVJB 4AB8A 1TA6A 2FOMB 2Q1JA 1JRTA 1V2TT 2BOKA 1J15A 1SB1H 3P8FA 3IWMA 1TPSA 1YPLH 4QT8C 1QY6A 4WVPE 2QAAA 1LVYA 2ZQ2A 2QXIA 3LJOA 2G5NA 2EQNA 4ZAEA 1K1MA 1A0HB 1IHTH 5F8TA 4INKA 2BVRH 2SGFE 4K2YA 1ZTKA 1NRNH 4MNWA 7GCHF 1UCYH 3H09A 1LTOA 4UFDH 2ZTZA 3PV2A 2OC8A 4AGJA 5E0HA 3KNXA 1V2ST 1BRCE 2Y6TA 1T8MA 3M37A 1QB9A 1BMAA 1ELCA 4ZMAH 1NZQH 1Z71A 2FXRA 4NGAH 2G4UA 2Z9KA 1O34A 2YOLA 3UQOA 1C5MD 4IMQA 1ZTLA 1THPB 1OWHA 3ESTA 4GUXA 2FX6A 1P02A 2KCPA 1EPTA 1YPMH 3BTFE 1RXPA 4X6MA 3SNBA 5EOKA 1HLTH 1KTSB 1BBRH 2QIQA 4Y8YA 1FY3A 1K1LA 1M9UA 1B5GH 4RI0A 2PKSC 1DWDH 3HGNA 4K3JA 3BTTE 1BTYA 2WPIS 3IITA 2R2MB 2J95A 4OS2A 3UUZA 1UJ1A 5FPYA 1BTXA 3V3MA 4TYDA 2A45B 1GBFA 4NA7A 4OM9A 4NFFA 5HKKD 1DXPA 1BRAA 2PLXA 2PGQB 2RA0A 1HAXB 3F1SB 3RU4E 2PUXB 1LPKB 4LZ4B 1QIXB 2ODYB 6ESTA 2AERH 5C20A 1C9PA 1Q2WA 1F2SE 2PTCE 3BTDE 1BA8B 1CGJE 1CT2E 2LELA 3JZ2B 1HXFH 3E1XB 2AMQA 4UEHH 1C4U2 1D3PB 1TONA 5DP4A 2BDCA 2RG3A 3L3TA 6GCHF 4X1PU 1VGCC 1GBKA 2OD3B 1BJUA 1S85A 1VR1H 2BDGA 3RU4D 2QN5T 3ELAH 4I8GA 2AIPA 1E38B 2C4FH 1LKBA 4YOGA 4Z0KA 4X1SU 3PM3A 3LGUA 2W3KA 2OUAA 3TK9A 3KQBA 1O36A 2HNTF 2KFWA 1O38A 4ACBA 4DGJA 1VCWA 3RLWH 4JZDH 1QL8A 4OGYA 1FONA 4K8YA 1WOFA 1FV9A 1GBLA 2A4OA 1C5XB 3AAUA 3F3BA 2GVFA 2PGBB 2PKSB 1YF4A 5DP9A 4YM9A 2ZTXA 3GYMA 2ZPRA 5C1YA 3SUDA 2IJOB 5GWZA 2WV5A 3HPTB 1YYY1 3G01A 1SGPE 1AO5A 2F9BH 3LGYA 2A4GA 4KKDA 1P2KA 3LJJA 1TNJA 1GMHF 1GVKB 2BDBA 1GBAA 1O2RA 1W12U 1DE7H 2FOHA 2ZFPH 5A8ZA 1EAWA 2IPHA 1TA2A 2JH6D 4JK5A 3MH6A 3SORA 3UPEA 1FDPA 1GJ4H 3ZZAA 4I8KA 5F8ZA 1FN8A 2HOBA 1XXFA 2BY8X 2FESH 4HI3A 5LPRA 2AMPA 1G3EA 1LHDH 4VGCB 1EP5A 1Z1IA 2GT8A 4DT7B 2BM2A 1ANBA 3VG8A 7ESTE 1AVWA 4Y10E 5GNDA 3RDZA 1FNIA 1O2WA 4LK4A 1SQOA 3Q76A 4XBBA 1C2EA 6CHAC 3A8BA 1O3CA 3MOCA 1FY1A 3ATKA 1ZYOA 1TNGA 4THNH 1ZPZA 2M2AA 3Q00A 4Y8ZA 3PV4A 2QA9E 1T7CA 3OU0A 1GMHG 1SQAA 4ABDA 2CV3A 4K8BA 1CHGA 3SBKA 3W95A 1PQ8A 1YBWA 5FL7D 3SU4A 4B73A 2R9PA 4FXGH 2HLCA 5FXLA 2HNTE 4K1TA 5C1UA 2BD7A 1C2FA 3HK3B 1SGCA 1MCVA 2FS9A 2Y5GA 3MI4A 5HIZA 1UK2A 3U8TH 3GY5A 1PPHE 4WXVA 1FPCH 1TGSZ 1HJ8A 4MPXA 2CN0H 4YZUA 3ZV9A 2AH4X 3A8AA 5FPSA 1C1QA 3KQDA 2PKAB 4H6SB 1JIMA 2RFKC 3SOSA 4MNYA 2ALPA 1O31A 4ISLA 2O8TA 1QL7A 1P2JA 2Z9JA 5F03A 3RC6A 2NU3E 1GMDF 1TALA 1UTOA 2H9EH 4MPVA 2ZZUH 1O2KA 4X8VH 3FP8E 1O5CB 3CP7A 2IN2A 3QTVH 5TJXA 2G51A 3RXMA 1FI8A 4O03A 2VH0A 2LNCA 2F9UA 1Y3VA 5J4QA 1AVGH 2NWNA 2BXTH 1YLNA 1GL0E 3T27A 5DP7A 3SUGA 4DW2U 3MNSA 1N8OC 3SJKA 1OPHB 1MZDA 1AKSA 1D6WA 4FUFA 1MD8A 1NFYA 3LGWA 4I32A 2JETB 2GMTB 4Y7BA 4CRCA 2FOAA 4X1QU 1E35B 3I29A 1UW7A 1WAYB 2RDLA 1QL9A 1YPHE 1IQJA 1QJ7B 3PLKA 4MPUA 3UWIA 1SGIB 1QZ8A 1GG6B 3OE7D 4ABAA 3MFJA 4WH8A 1FY5A 1V6DA 3PRDA 3DFJA 1CA0B 3MU1A 2FM2A 2ANYA 1QBOA 1TNHA 3LOXA 4JYVH 1GGDB 4JMYA 3LU9B 1HDTH 1Q31A 5L30H 2CMYA 1CU1A 3SZNA 4SGBE 3OSYA 1VJAU 1IQIA 3ZZ4A 1ZPCA 2J5UA 1C4Y2 2BX3A 1P2QA 5JBTA 3KL6A 1ORFA 1ETSH 3VEQB 1NN6A 1SOZA 4Q7YA 4UFFH 3K65B 2V6NA 3R3GB 1C2GA 1L1GA 1GBJA 2EEKA 4D9QA 3UREA 3TH3H 5CHAB 1EJMA 1WSSH 5C94A 3SJ8A 5CMXH 1L4DA 1QRWA 4NSYA 2Z3DA 2QV1A 3M3SA 4BAOB 3SI4H 4P00A 1S84A 3OTPA 3RXUA 2TGAA 4FU8A 2H5CA 1V2NT 2VWOA 2C93B 5FBIA 1MH0A 2Y5HA 4E05H 4HFPB 2P3FH 3SJOA 1CA0C 3D62A 4ISIH 3DSOA 3RC4A 2A31A 1C5RA 1O37A 1ESBA 1O2MA 4Q4LA 4I8JA 3A7TA 2XCNA 1WDIA 1NRPH 3TJVA 2RCEA 4MQAA 2FO9A 1O3DA 4AFQA 3KIDU 1WQSA 3T29A 1QR3E 1KXAA 2QXGA 4Y71A 1GDUA 2TGDA 1WQVH 2EI8A 3MO3A 2ZHDA 4OS7A 1BTZA 4CHAB 3A83A 3A80A 1G3BA 3QGNB 4NSVA 1P0SH 3LH3A 2GX4A 4WJG2 1EUFA 5E2PA 3B23B 1ID5H 2ANKH 4I33A 2O8WA 4D7GA 4GLYA 1XUGA 5L2ZH 1V2UT 1A5GH 2AHME 3GY6A 3K6ZA 1Y8TA 3M35A 4BAMB 2ZG0H 1ELVA 3SUFA 1TOCB 4Q80A 1CSOE 4YOJA 3URCA 3ZZ8A 1WBGB 1TLDA 1FAKH 1KXBA 3RLYH 5KGOA 5AFYH 5GDSH 1TX7A 5TCAA 3BN9A 1W7GH 5EW2H 4I8LA 1OP8A 1GWAA 4TPYA 3PMHB 2VH6A 1BTWA 2GZ8A 1MAYA 3HGPA 4IN2A 3PWBA 4UFGH 5C5OA 2W6ID 1E1RD 1Z8JB 1NROH 2CK3D 2F4LA 2V35A 1QTFA 3GCOA 1LO6A 1W10U 3F9EA 3L33A 5DP5A 3PMBB 1QJ6B 2GP9B 1G32B 1VITH 1UTNA 4K1SA 4ZKNU 3S7HB 1HRTH 4UDWH 1TYNA 2ZHEH 3U69H 1MTVA 1O3GA 4IS5A 1AWHB 3BF6H 5E2OA 3UAIC 1IQHA 4OS1A 3A8DA 2BXUH 4E7NA 3MU8A 4ABJA 2K0QA 2OP9A 1Y3WA 1QJ1B 1DX5M 1GG6C 2KX4A 2LP6A 4O9VA 2ODPA 3F0PA 4TSFD 1DY9A 5AVDA 1FQ3A 1D9IA 4Y79A 4FVDA 3SV9A 2SFAA 3QZQA 2A5KA 1O2JA 3E91A 1WYKA 2BDHA 1NY22 4MLFB 4GCHF 2DUCA 3RXSA 1PJPA 2F9VA 3LPRA 1LQEA 3NUMA 4TWYA 3P8GA 2QC2A 4Y11E 4DJZB 2GD4B 1W13U 3OEED 1HAPH 5HM9A 4FU7A 1UK4A 1SPJA 3A8CA 5A0BA 4FUEA 1DDJA 1O3OA 3O8DA 1QQ4A 1PPGE 1YLDA 5DJ7A 3MU4A 2B8OH 3SU0A 2VB0A 3NXPA 4KTCA 1FIWA 4IC6A 2O9QA 1V2LT 4JK6A 2NU1E 1KXEA 2VINA 2WPHS 3A85A 3FO8D 1C5VA 3KN2A 1A0LA 1O3PB 1CBWB 2G00A 3KGPA 3FVFB 1DS2E 1MUEB 3SNDA 1LVMA 2UUFB 2TGPZ 2AIQA 4D76A 1NTPA 2YNBA 1FMGA 1QRZA 4JZ1A 1HIAB 4HZHA 5HMAA 3RXTA 1TPOA 2XC4A 3KQEA 2AGGX 3GY8A 1BITA 5C1XA 1K2I1 2VIDA 2XBXA 2ANMH 2HPQH 1G2MA 1O5EH 1P01A 1PPEE 2C8WB 1BOQA 1V2OT 4PROA 1GHYH 3PO1C 1ZRKA 2ZNKH 3SV7A 2FEQH 1AFEH 1E1QD 3TGIE 1NS3A 3PV5A 3BIUH 2XC0A 2BTCE 3FANA 1O3LA 1YPEH 2A5IA 1C9TA 3ZVGA 3SNAA 3SNCA 3R0FA 3T26A 1BTUA 1K1OA 2PHBA 3SZEA 2UWOA 1YM0A 2EY4C 1GHXH 3PYHA 1Z8GA 1EAIA 2O8UA 2XNIA 3EGKH 2SGAA 3UFAA 4U01A 2JKHA 4X8TH 4Y8XA 3LC3A 1UVOA 2KR7A 5EG4A 4OGXA 5JB8S 2FTLE 3E16B 4IC5A 3T28A 1O2GH 3A89A 2NU0E 3WY8A 2FODA 3SGQE 1L0ZA 3LKWA 2PFEA 3TJUA 1XX9A 1YCPK 2BY9X 4CR5A 1O35A 6CHAB 4X1NU 4UD9H 5HM2A 2V3OH 1RJXB 5DO4H 4SGAE 1ANEA 3AW0A 1JRSA 1KMHB 5JB9S 3MO9A 2WPKS 2UUJB 1O39A 4M7GA 1A5HA 3GY3A 2IOTA 4ASUD 2SGEE 4YLUA 2QY0B 4Q7XA 4A7IB 3UNSA 1C5NH 1HJ9A 1E36B 1TOMH 2VIQA 4X2XA 1K1NA 1DITH 1F5LA 3F9GA 1V2RT 5DG6A 1Z8IB 4BOHA 1IQLA 1SQTA 1YCPH 3TK6A 1SGFG 1YKTA 4CRAA 1GHBF 2W26A 1ANDA 2ZHQH 3T2NA 3M36A 4XBCA 1O2LA 4AZ2B 3LGIA 1U6QA 1E34B 1P11E 3D49H 2BQ7B 4LZ1H 5LPFA 1BMLA 1C2JA 4FUDA 1C1PA 1H9HE 1MZAA 1S83A 4M9FA 3EDXB 2BHGA 1OWIA 1O5AB 2OQUA 2A7HA 1BDAA 1FZZA 3C27B 5T6FA 3QLPH 2VIVA 4U32A 4IBLH 2ZO3H 2Z3CA 4NWLA 5DPAA 1ZLRA 1O2IA 4J2YB 3PB1E 1MTWA 2PUQH 4Q63A 1GCDA 1SOTA 1KDQB 2ZA5A 3WWBA 8GCHG 1CT0E 1SGEE 2WV4A 1O2NA 5ESTE 2PV9B 5F6MA 1F5RA 3PRBA 3BEUA 1K0HA 4MNXA 3EA9A 2W7UA 4DCDA 3K9XB 1SVPA 2P16A 5EQSA 1ZMNA 3IG6B 1TB6H 3SW2B 2FMJA 1PPCE 3SQEE 4F48B 1TQ7B 3C1KA 1EX3A 1J8AA 1LCYA 2D26C 2G52A 3TGJE 1RTFB 4DURA 3BG4C 3LGTA 5HYOA 3EYDA 3SU3A 3ZV8A 4RT0A 2HWLB 5C67A 1MTNC 3RM0H 2CGAA 2Y5FA 2XTTB 2AGEX 1GI7B 4B71A 1C1MA 2EI6A 2OC1A 1EXFA 1MKWH 1O2ZA 2BDYA 1NFXA 3UOUA 4X6PA 4TPIZ 2FS8A 1OKXA 1VZQH 3STIA 2BYAX 3DSPA 3SN8A 3Q77A 3FOAA 1LDTT 3OAAD 4KGAA 3VB5A 1C1NA 3AAVA 4XOJA 1AY6H 4XD7D 1SHHB 4YESB 3N7OA 4FUCA 3TLOA 1Y5AT 3O8RA 3EA7A 3K2UA 1BUIA 1OXGA 5G4BA 3RXAA 1SGYE 1EJAA 4ASHA 1C2DA 1RD3B 1TBRH 4Y0ZE 3S9AA 1SSXA 5GXPA 2BZ6H 1N6XA 1TMTH 1OSSA 1ZSLA 2EI7A 1EPTB 1DVAH 1VJ9U 5J4SA 1IQKA 1NPMA 2G5VA 3KQCA 2KM0A 1ESTA 4LXBH 2TBSA 3AVZA 1DUEA 1GJAB 3FFGA 1MTUA 5HXFA 2F83A 1TPAE 3BTHE 5JPMH 1YPGH 1ACBE 2J34A 3RXJA 1EP6A 1O5BB 1ZGVA 2JETC 2VU8E 3F2FA 1B0FA 1ZOMA 4GVUA 1CGHA 2BB4A 3GY4A 1QURH 1C5ZB 1CO7E 2VIPA 1TIOA 3UIRA 1G36A 3BEFB 1TNKA 4P02A 4GAWA 1N6YA 1GBMA 3NWUA 1ZHPA 1L1JA 1DANH 2ZGHA 3E0PB 3M5MA 1FX0B 1KYNA 3MH5A 3MH4A 1XUKA 2FLBH 2GCHF 1RIWB 8ESTE 2QGRA 5T3HA 4FOUC 1CVWH 2TIOA 5PTPA 3F2HA 4GSOA 2Q6DA 3KF2A 1NBMD 2O8MA 2F9OA 3SV2H 1MKXK 4AC9A 3PO1B 2R3YA 4O3UA 5LPEA 1ZHRA 3QN7A 1C2IA 5LH8A 2KAIA 3OY6U 1PPBH 2KAIB 1SC8U 3SU5A 4B74A 2H9TH 3HATH 1MBMA 3DSGA 4TY6A 3GCNA 2GCTB 1Y59T 1VGCB 4TT3D 2C3SA 4MVNA 2BDIA 3PMJA 3CS0A 3NPSA 3M7UA 1A2CH 1YC0A 2ODQA 1TGBA 1W7XH 3BTGE 1NFWA 2F3CE 4B6EA 2BD2A 1EJNA 2CF9H 1TGCA 5GIBA 1K1JA 4X6OA 1XUHA 1AKSB 1A61H 3F68H 2GZ7A 3SHAH 1AFQC 1DLKB 3MYWA 5GJ4B 3RM2H 2XWBI 3A82A 1BJVA 3GS9A 1O3FA 2JH0D 4UFEH 1VITG 1MD7A 3OY5U 4Q7ZA 3NCLA 3CENA 4E7RG 3BSQA 1AUTC 5H4IB 1UMAH 4AGKA 3E8LA 4JZFH 1F5KU 5EXMA 3S7KB 2WSSD 1HAVA 2P3UB 4I7YH 3ODFA 3UY9A 3GICB 2FLRH 3E0NB 4HG6A 2RDEA 3SU6A 4H6TA 1O5DH 3TPIZ 1TX8A 2BLWA 2ZDMA 1QGFA 2KCOA 1GCTB 1OYTH 1Y3UA 4NFEA 2XCFA 1S5SA 4WWYA 2ZCLP 3ATMA 2H2ZA 1IQGA 3QX5H 2I6QA 4NZLA 1LVOA 1T4VH 4Y7AA 2V3HH 4CRFA 5B6OA 1ARCA 2BOHB 4Z6AH 1AUJA 1N1LA 1AHTH 2AFQB 2A5AA 2O8LA 2QYIA 5C0UA 1WCZA 2PWXA 5ABWA 1TRNA 1THSH 1SQRA 1LHEH 3GISB 1GDQA 1C1SA 3NZIA 1C4V2 2OC0A 2BDAA 1NFUA 2XC5A 4WMDA 4BAHB 1GJ8B 3RXRA 4AB9A 1Z6EA 1W0YH 2FOFA 3GCTF 5BPEA 1GJ6A 2P95A 1OWJA 1GMCF 1OWKA 1INCA 3EQ0H 2ZHFH 2FOCA 4A92A 1CT4E 2WUCA 1W14U 2FPZA 2PW8H 1C5YB 1ZHMA 4X2WA 3MO6A 4TY7A 1A4WH 2B9LA 3O8CA 3KEEA 1AN1E 1CHOG 1C1RA 3U8RH 3NRLA 2GMTC 1AMHA 3AW1A 1BBRK 3HKIB 4ABBA 1ZMJA 4CBNA 4CREA 3OX7U 2WZQA 2HVXA 1GHVH 2ZU3A 2WYJA 1Z6JH 3TITA 1BT7A 3OTJE 4NIVA 1A3BH 1P03A 5DSFA 1A3EH 1FUJA 3V13A 3QGJA 4DT4A 1GMCG 3RXFA 2JIZD 3H5CB 4NZQA 5GPIB 3RXHA 2GDEH 1Y5BT 1EZSC 1GBTA 4U2WA 4XBDA 1TQ0B
chains in the Genus database with same CATH topology
4I8HA 1GHBG 1MTSA 4D8NA 3LONA 5IDKA 4ESTE 1YLCA 2SGQE 4ZHLU 3BTKE 4ABGA 1KLJH 1KSNA 1O5GH 1MMJN 1SI5H 5DP3A 2ZGCA 1P8VC 1JBUH 2I6SA 5E8EH 3VGCC 1L4ZA 1IAUA 1TBZH 2ZDVH 1AZ8A 3RMMH 1NU7B 2Y80A 2Z3EA 1BB0B 7GCHG 3MTYA 2J94A 2PR3A 3S9CA 5DP6A 1A5IA 1KY9A 1N8OB 1GDNA 1UTQA 3M7QA 2R0KA 1H8DH 3PMAB 4AORA 1A7SA 1WTGH 1UCYK 1D3TB 3TH4H 4GHTA 1HCGA 2VWMA 2D1JA 3FAOA 1ELTA 3V12A 5C5NA 1RGQA 4A1VA 2P8OB 1C1OA 3H7TA 3P95A 2J2UA 1G2LA 3SO3A 4X1RU 1XUJA 2FX4A 3A86A 3BG4B 1B0EA 3A84A 5DGJA 9LPRA 3HK6B 1QQUA 2FZZA 3T62A 1HFDA 1P09A 1F0UA 1KIGH 2A1DB 3ZZ7A 4ZXYH 2OXSA 4MDSA 2BX4A 1JMOH 1UCYE 4B1TA 1EAUA 2WPLS 2ZEBA 1K21H 2AS9A 1GJCB 1TBQH 1AQ7A 2BLOA 3M3VA 3TGKE 4AYVB 3U1JB 3GY2A 8LPRA 1DICA 1TMBH 4FUJA 1GI0A 4KP0A 4ZKRU 1EB1H 3HKJB 3P6ZB 4K69A 2OBOA 3ZZDA 8KME2 3ATLA 1MKXH 4BAKB 3UR9A 3TNSA 1LHGH 4JYTA 3UOPA 1LQDB 2F9PA 5T6DA 1FLEE 1HAGE 1C1WH 1GCTC 1GJDB 4MPWA 2WYGA 3H7OA 2OCVB 3W94A 3T25A 1P04A 3SJ9A 1EAXA 1QHRB 3LC5A 4RKOB 3A81A 3AASA 1ZJDA 1HAOH 3S69A 2FOGA 3RMNH 1B7XB 2A4RA 2ZFTA 4ABEA 4NIYA 1OWEA 1EOLA 1YPHC 2FI3E 1IHSH 1MCTA 3D23A 1C1TA 1SLWB 4X6NA 2Z9GA 4X8SH 3TJOA 1PYTC 3MNCA 2YNAA 2ZF0H 1GJ7B 1TNIA 1W11U 2Q6GA 3VXFH 2P94A 1OP0A 3BV9B 3I78A 1SMFE 5I25A 1XXDA 1TMUH 3A7WA 4BANB 1LVBA 3VFEA 1GHZA 1G3CA 4BTUB 2UWLA 5JYIA 4OS6A 3U9AH 1BTHH 1H8IH 2BVXH 4CH8B 2WUBA 1AVXA 2VVVA 1QA7A 3RXGA 1BCUH 1BRUP 3RMLH 1ZGIA 2GT7A 1O3AA 1Z1JA 1F7ZA 3BG8A 1PPFE 2OTVA 2P3TB 1C5OH 1UTPA 5EPNA 2UUYA 3I77A 4CBOA 1T8OA 1GBHA 2G4TA 1C5LH 1GJ5H 2WINI 3LDXH 4FUBA 2H5DA 1XM1A 1O3EA 1QFKH 5JBCS 1FIZA 1MU6B 2ZU4A 2GZ9A 1ZPBA 2VNTA 1ETTH 1T8LA 1H9IE 1GHAF 1LHCH 2A2XH 1PYTD 4WH6A 1RTKA 3GDSA 5A0AE 4B75A 1O3IA 2CJIA 1P05A 1JIRA 1HAVB 1O2PA 4X0WU 3VB3A 2Y7XA 2HGTH 1O3KA 1TFXA 1UTLM 3MMGA 3MHWU 4MTBA 2TRMA 3ZVBA 1J14A 3SNEA 2GCTC 3ZZ9A 1UHBB 1XVMA 2Y7ZA 4DIHH 2GGVB 4BTTB 9ESTA 1PQ5A 1ABJH 1C2LA 1QRXA 1SLVB 2ZDKA 5K7RA 1EPTC 1LKAA 2ZECA 4FUHA 2TGTA 2W5EA 1H1BA 1EB2A 4B2BA 4H42U 1G30B 1DXWA 2BLVA 2A2QH 1DY8A 5FCRA 3E90B 1GBEA 1DWBH 4AX9H 1EKBB 2ZU5A 2CHAC 5FBEA 1JOUB 2ZU1A 1HGTH 2F91A 4ZKOU 3RMOH 1GI5A 3JZ1B 1P12E 3ITIA 1O2QA 3ATIA 1GGDC 2JH5D 4K1EA 3PLPA 1YPKH 1O3HA 1GI8B 1V2WT 3P8OA 4ZROA 4X2VA 5A09A 2H1UA 3T5FH 5FHTA 3TK5A 1D6RA 4Q2KA 3Q3YA 2QCYA 1D3DB 3ENSB 2J38A 2B0FA 5A8YA 3LH1A 1SHYA 3DT0H 2ZTYA 2ZDLA 4IW4E 1W2KH 1E37B 1VCQA 2AGIX 2VIOA 3P92A 1J17T 4WF8A 3UR6A 1D4PB 1AGJA 1ZSJA 4YT6H 1TNLA 4B2AA 3DA9B 2GV7A 2SNWA 4GHQA 1DOJA 4NG9H 3PTBA 1C2KA 1OS8A 1EASA 1SR5C 1SGNE 2Z9IA 2BD3A 2ZGJA 1ELBA 2SGPE 1EZQA 1AE8H 1SL3A 2ZCKP 3RUOA 1Z7KA 3V0XA 2P59A 3SGBE 1ARBA 1O3NA 3UNQA 1GI1A 2D2DA 1WU1A 4AN7A 2M5TA 3GCTG 2CF8H 2HNTC 3RXKA 3E3TA 3STJA 3S9BA 2B5TB 3GDVA 2QXHA 3VPKA 1P2IA 1MQ6A 1UTKA 2XBWA 1C2MA 2XW9A 2ILNA 1GI3A 2K1QA 1THRH 2BY7X 3MWIU 1Y5UT 1F0SA 2FDAA 1UTMA 4DVAU 2XBYA 1GBBA 1BMNH 3ZVDA 1QBVH 1O2SA 1O2HA 1W8BH 3DD2H 5K0HA 1EOJA 3DUXH 2THFB 1T8NA 7KMEH 3A7VA 3PROA 3VXEH 3RXBA 4B76A 1O3MA 1UTJA 2BLQA 1K9OE 4A1XA 1SLXB 1AFQB 4F49A 5FPTA 4VGCC 1ZRBA 3ZVAA 4XE4A 3TNTA 5BRRE 3TH2H 2Y81A 2WPJS 2ZDNA 5C3NA 1NO9H 3UWJH 2SNVA 5SGAE 3D65E 1G37A 3RXDA 3ZYEA 2AYWA 1AB9B 3S0NA 2Q6FA 3SHCH 1L2EA 1P2NA 3CS7A 1DFPA 1XUFA 2BQWB 2AMDA 4YOIA 4BTIB 1DWEH 1GJBB 1NC6A 3F9HA 1A46H 1ZSKA 3NKKA 4KELA 2FOEA 1S81A 1V2VT 1SFQB 2ZGBH 1GBCA 3FZZA 3SQHE 1HAHH 3M5NA 4YO9A 3PLBA 3BTME 3MH7A 4FUIA 2UUKB 4U30A 4NA8A 4HTCH 1NESE 1NRSH 2PTNA 5EPYA 4D7FA 1GHAG 1P9SA 5A8XA 2C8ZB 1DWCH 3A7XA 1D3QB 1DSTA 5DP8A 1KDQA 3OYPA 4WY3A 2XYAA 3RC5A 4ZXXH 4AOQA 3F9FA 4CRBA 1IOEA 3ODDA 5L2YH 2W3IA 1SGTA 3P17H 2ZPQA 3EAJA 3ZZBA 1QA0A 1E0FD 4Y0YE 1DLEA 2ZKSA 1FJSA 5C2ZA 1TPPA 1TGNA 1RFNA 2R2WU 1SBWA 1ELDE 1OP2A 1HJAC 2Z94A 4I31A 3B8JA 4IN1A 4ZKSU 3KCGH 4R0IA 1GVLA 3PTNA 2ZPSA 3MNXA 5GCHF 4JYUH 1V2MT 4ABIA 3VB6A 4Y76A 4O97A 3MU0A 3A87A 4OS5A 8GCHF 2G8TA 1BRBE 3MU5A 5FAHA 2R3UA 1FY4A 4R8TB 5EXLA 3QO6A 1C5WB 4X2YA 1F0RA 5IYTA 4NA9H 2GTBA 1Z8RA 2FYQA 3EE0B 1UHBA 4JZIA 3ZVEA 3ZVFA 1FXYA 4RN6A 3BTWE 1S82A 2HALA 1P3EA 1V3XA 1FPHH 1ZJKA 4RKJB 2J4IA 1C5TA 2C90B 1YPJH 5EODA 3TU7H 2GV6A 1O0DH 1SG8B 2A4QA 3QWCH 4UONA 4CH2B 4ISHH 3MNBA 3M5OA 5EQQA 4A6LA 4ABFA 2VVCA 1GL1A 3E6PH 3URDA 3P8NA 4F4OC 1GI6A 1AD8H 1ETRH 1SGDE 2QXJA 1ANCA 3SJIA 3QDZB 1K1IA 5ETXA 1AIXH 3GCHC 1HPGA 3F6UH 5JBAS 1C2HA 2CHAB 5CHAC 1Y3YA 3M7TA 5TCCA 3Q3XA 3SUEA 2TPIZ 1ELFA 2FP7B 1NRRH 1LHFH 1V2JT 2ZWLH 1NM6A 1W3CA 3GY7A 3VB4A 1QNJA 1V2PT 3U98H 1O2YA 3U1IB 1ESAA 1MTNB 1CE5A 3RXCA 3Q3KA 4WMEA 1TX6A 1K28D 2J92A 1NU9A 4CRGA 1EQ9A 1P57B 1P2MA 1GPZA 4KTUA 5A0CA 4O3TA 2EC9H 2XWAA 4JCNA 2UWPA 5JDUB 1UVSH 2XBVA 4E06H 5AFZH 1T4UH 3SV8A 1F92A 3BTQE 2ZC9H 1H4WA 1J16A 3M61U 5CE1A 3EA8A 1GI2A 2V0BA 1JXPA 1MQ5A 1TAWA 1DT2A 2AEIH 1HAIH 2GKVE 2GCHG 3QUMP 3M3TA 4CRDA 7LPRA 4IMZA 1P3CA 1TABE 2ANWA 4H4FA 1P2OA 2G55A 5FCKA 1IQEA 1TRYA 1GMDG 1GHWH 1P9UA 2XRCA 2F9NA 5T6GA 2ZIQH 3NK8A 3ZZ5A 3TJNA 4UE7H 3V7TA 3A7ZA 1ZZZA 3GCHB 3A88A 1F0TA 1EZUC 1Q3XA 2OC7A 1O30A 4LOYH 3ZYDA 4FVBA 1EATA 2W7SA 1RS0A 4CR9A 1UK3A 4AG1A 4INLA 2BY6X 2ZHWH 1ELAA 3ZZ3A 2BD5A 1IQMA 4GPGA 2R0LA 3DFLA 1S6HA 2RA3A 1CHOF 1CA8B 1O2XA 1Y3XA 2BD8A 1TRMA 1P10A 1MBQA 1K1PA 2DE9A 2OLGA 1VITF 1MAXA 2FTMA 2FI5E 4KTSA 4A1TA 2LPRA 2ZP0H 1MKWK 4ZHMU 1TGTA 1HB0B 4YTAA 1FN6A 1EZXC 4K5ZA 1PPZA 2ZCHP 3SU2A 3ZVCA 1AZZA 2C8YB 1O3BA 4NWKA 3SV6A 2Z7FE 3BTEE 1A0JA 1C1VH 2H9HA 2BVSH 1UVUH 1LPGB 1SFIA 2C8XB 1O3JA 1CQQA 3A7YA 4DG4A 4K60A 5DKMA 1C5UA 5L6NH 1CBWC 1J9CH 2PSXA 3GDUA 2OBQA 1BTPA 2BZAA 3O8BA 4NCYA 2WPMS 2ZDAH 1YGCH 3RXQA 1O2UA 1RRKA 1QB1A 2QF3A 2G81E 4BXSA 1O2TA 2VGCB 2STBE 4DOQA 3RP2A 5AF9H 1X7AC 1GI9B 4DIIH 1GI4A 5LGOA 2EA3A 1KXCA 3QZRA 1AB9C 1C5PA 1O33A 2Z9LA 4Y6DA 1ELEE 3QTOH 2ZFFH 2A7JA 3RXLA 3LGVA 3UNRA 5EGMA 1HNEE 4AFSA 1HBTH 1L1NA 4WMFA 1OWDA 5DK1A 5EU8A 1ZMLA 5GCHG 1AI8H 1QB6A 1HXEH 1SGQE 1AU8A 1UO6A 1IQFA 1BIOA 1QBNA 3TIUA 1H9LB 1KXDA 1LMWB 4ZH8A 1HYLA 1NT1A 3BEIB 2VWLA 1RTLA 2ZQ1A 4FU9A 4FUGA 3FP6E 5AHGH 2DE8A 2BMGB 1BBRE 1BHXF 4XDEA 4ABHA 2VGCC 4X8UH 1FY8E 4GCHG 6GCHG 1G9IE 3M5LA 2SGDE 1HIAA 3SU1A 4A5TS 2ZGXH 1T32A 1DUAA 2B7DH 3PWCA 1C5QA 4ISOA 1UVTH 4BAQB 4CHAC 5I46H 1K22H 4XFQA 3ZZ6A 4ZUHA 1PQ7A 1PQAA 1KLTA 3VB7A 4AFUA 1HJAB 1CGIE 1PFXC 2GDDA 2Z6BD 3KHVA 1GBDA 2NU4E 2ZFQH 2P93A 2ZFRH 4XSKU 4ZHAA 5EQRA 1LPZB 2BY5X 2FI4E 1WUNH 4AFZA 4JZEH 1MU8B 4ISNA 1XMNB 4YLQH 2FYRA 3GYLB 1BQYA 1YP9A 2ASUB 1UVPA 1XVOA 1BHXB 1WV7H 1GJ9B 1WTHD 2XXLA 5FX6A 3LIWA 3SGAE 2BD9A 4HGCA 4DY7B 3RXPA 2VJ1A 3RXVA 1P06A 1IQNA 2Y82A 1SGRE 3RXIA 1T31A 1V2KT 4YT7H 4B2CA 3FZDA 1VCPA 2PSYA 3ATWA 4NIWA 2FOBA 4RSPA 1AWFH 1C5SA 3FP7E 4MG3A 1HAYB 1BMMH 2VVUA 1C1UH 1HV7A 2ALVA 3QK1A 4NIXA 5EW1H 1V2QT 2ZI2H 1GVZA 4J1YA 2FIRH 2CXVA 2A7CA 3U8OH 2P8OC 1O32A 1FAXA 4MNVA 2FWWA 3K6YA 4AG2A 5E0JA 1OYQA 5JBBS 3RXEA 4BXWA 1AE5A 3ZZCA 6LPRA 1S6FA 4WXIA 2VWNA 4OS4A 2ZU2A 3BIVH 1OX1A 1NRQH 2VIWA 1O2OA 1OOKB 4BNRA 2STAE 2H6MA 1TWXB 2HPPH 3SI3H 1ZTJA 4AYYB 1ZR0A 2QF0A 1BZXE 1KTTB 1XUIA 3UQVA 1JWTA 3DHKH 1O2VA 5FX5A 5HGGA 3UTUH 4INHA 1DPOA 2PKAA 2J9NA 1HUTH 1DSUA 1RIWC 3LT3A 5E0GA 5A2MH 5F8XA 2ZFSA 1O5FH 1G3DA 3P70B 2ULLA 1SLUB 2ESTE 3GOVB 2A0QB 2OQ5A 2NU2E 1S0QA 1W0ZU 1XKAC 4TWWA 3RXOA 2D8WA 1A1RA 1S0RA 1QCPA 3VGCB 3RU4T 4D9RA 1ELGA 2OINA 2BD4A 1XKBC 5ESBA 1ABIH 1KXFA 2A32A 3B9FH 2BQ6B 1SGFA 4IGDA 3L6PA 1YCPM 1HAZB 5EXNA 1TE0A 1DM4B 1GBIA 2HRVA 1KLIH 3TVJB 4AB8A 1TA6A 2FOMB 2Q1JA 1JRTA 1V2TT 2BOKA 1J15A 1SB1H 3P8FA 3IWMA 1TPSA 1YPLH 4QT8C 1QY6A 4WVPE 2QAAA 1LVYA 2ZQ2A 2QXIA 3LJOA 2G5NA 4ZAEA 1K1MA 1A0HB 1IHTH 5F8TA 4INKA 2BVRH 2SGFE 4K2YA 1ZTKA 1NRNH 4MNWA 7GCHF 1UCYH 1LTOA 4UFDH 2ZTZA 4AGJA 2OC8A 5E0HA 3KNXA 1V2ST 1BRCE 2Y6TA 1T8MA 3M37A 1QB9A 1BMAA 1ELCA 4ZMAH 1NZQH 1Z71A 2FXRA 4NGAH 2G4UA 2Z9KA 1O34A 2YOLA 3UQOA 1C5MD 4IMQA 1ZTLA 1THPB 1OWHA 3ESTA 4GUXA 2FX6A 1P02A 1EPTA 1YPMH 3BTFE 1RXPA 4X6MA 3SNBA 5EOKA 1HLTH 1KTSB 1BBRH 2QIQA 4Y8YA 1FY3A 1K1LA 1M9UA 1B5GH 2PKSC 1DWDH 3HGNA 4K3JA 3BTTE 1BTYA 2WPIS 3IITA