1O2YA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2yA02
1HAGE 4K2YA 1L1GA 2GDEH 5DGJA 3U1JB 4OS6A 2FLRH 4A1VA 1M9UA 1MD8A 2F83A 5FBEA 4GLYA 2QXHA 2FI4E 2STAE 1AFQB 1JXPA 2HNTE 2PGBB 1TPAE 1V2WT 1QQUA 1UVOA 3W95A 3VB3A 3ZV8A 3MU5A 2XW9A 4BNRA 5EQRA 1UO6A 2C93B 4X1QU 1SGFG 1BMAA 1OP2A 3PO1C 1RTKA 3RXPA 4Q7ZA 2ZIQH 1VGCC 1O5BB 2YOLA 2J94A 1YPHE 2VWOA 1GJCB 1XMNB 1V2OT 2GDDA 1WQSA 2Z9IA 1PPHE 2VH6A 5I25A 1BOQA 3DFLA 1VITF 1C1TA 1E34B 1UVSH 4YT6H 2CHAB 3T62A 3MO6A 1SPJA 2ZQ2A 2SGDE 1QBVH 5E0JA 2QCYA 2ASUB 3ZZ7A 1DOJA 2P94A 1L1NA 1LHEH 1HAXB 1Y5UT 4A92A 2BXUH 3KGPA 1EUFA 1BBRK 1UTQA 1YYY1 5EPYA 1GI6A 2H2ZA 2QF3A 3PTBA 1BMMH 2AERH 1C2EA 1SGCA 1O3LA 3IITA 1SLWB 1TMUH 3MFJA 4X1PU 1P03A 5AF9H 4WMDA 1TQ7B 1O5GH 1O2NA 3GYMA 2WPHS 1GBKA 1TPSA 3MHWU 4RKJB 3SJOA 5C1UA 1EJAA 1QBOA 2ZFPH 1NFWA 4O97A 2XBWA 1C5PA 1MAYA 2C90B 7GCHF 3E6PH 3LJOA 3TH4H 1LHCH 1ETTH 3KCGH 2ZDAH 4K60A 1BMNH 1QGFA 2ZDLA 5ABWA 3ZZAA 1HFDA 3Q3YA 2CV3A 2BD9A 2GMTC 3TK6A 1DT2A 1QHRB 3BTDE 2BY5X 1EX3A 3M5MA 2FOHA 1H9IE 2FM2A 1PPCE 1ANBA 1Q2WA 3A81A 5DP7A 5FCKA 4IC5A 3SNBA 1BHXF 2R2MB 5CHAB 3QK1A 2BQ6B 3TNTA 2A7HA 3E91A 3FP6E 4CBOA 2WPJS 3SUEA 1GMCF 1MTNC 2ZCHP 2IPHA 3A85A 3MNSA 1OWEA 3RXCA 3SGQE 1V2ST 2VWMA 4H6SB 1IQNA 1AZ8A 5TCAA 1N1LA 1NPMA 4I8GA 1SGTA 2ZHQH 3HPTB 3V7TA 1T8OA 1V2KT 3SNEA 9LPRA 1LPGB 5GCHG 3K9XB 4MNVA 1DY9A 4CREA 1IQLA 1XKBC 1YCPK 2FXRA 1NN6A 1GVZA 1LHDH 2WV4A 4ZXYH 1ZRBA 4DY7B 2AMQA 3GY2A 4GUXA 3BTGE 2H9TH 3GY4A 1CBWC 1CT4E 1ZSJA 2BDBA 4WXIA 8GCHG 2IOTA 5BRRE 2ZFTA 3P8FA 3SNAA 1BDAA 4K69A 1GDUA 4AB8A 1Z8IB 1MKXK 1EP5A 2XCNA 1NRQH 2FI3E 2XBVA 3ZYDA 3ZVGA 4UFDH 4MQAA 5C1YA 1DICA 1Y59T 5AHGH 4XBDA 4Y76A 1N6YA 2Z9JA 2ZHWH 1UK4A 1TFXA 4D9RA 4B76A 5LPEA 1QR3E 2ZDMA 1DE7H 3FZZA 3QTVH 4B75A 4HGCA 5C20A 1P2OA 2FOAA 1MCVA 4AYYB 2TGPZ 3O8BA 1ELCA 1J14A 4CHAB 1TPPA 1BB0B 2I6SA 1K1MA 1Y3VA 2FEQH 4K8BA 4FUIA 5FX6A 2A31A 1P04A 4ZROA 2FTMA 1AO5A 2FI5E 4NA9H 1OP8A 5FXLA 2BTCE 1T8MA 1OYTH 2LNCA 3B9FH 4K1EA 4INKA 4GCHG 5K7RA 1C1RA 4MVNA 1ANCA 4KTCA 2PKSC 4O3TA 4I8JA 2PHBA 2EC9H 1W13U 4FU8A 1SGPE 2OD3B 2FOFA 1EQ9A 1AKSB 4IW4E 1IQHA 1ESAA 4ABDA 1YKTA 2D2DA 3A8CA 3GCNA 1IQKA 2TIOA 4RKOB 4WH8A 1EATA 2YNBA 3ATMA 3DHKH 4AB9A 2BD8A 1EKBB 1RS0A 2ESTE 2FS9A 1HAOH 4U01A 4DT7B 2Z94A 3GDUA 1QRWA 4YOJA 3MU1A 3KIDU 3RXJA 1GGDB 4ISLA 2Z6BD 2V3OH 1TMTH 1H9LB 1TNJA 1Z7KA 1YC0A 4BAQB 4DW2U 1YM0A 3UFAA 1FQ3A 2ZDKA 1MUEB 4X1RU 3OY6U 1TOCB 1F5KU 4OS2A 1OWDA 2PW8H 2PWXA 4UONA 3SQHE 4UFGH 3IWMA 3SUGA 3KF2A 2P3UB 2HOBA 1ZRKA 1QURH 4AN7A 4X1SU 2ODYB 3MNXA 3SW2B 4OS4A 1S82A 4DG4A 5K0HA 1CGJE 1GHBG 4FUFA 1D3TB 4WWYA 3UWIA 3SI4H 1P06A 3ATWA 3KQDA 4TY7A 2TBSA 1QA7A 4KKDA 3SU4A 1TRYA 3NZIA 2KAIA 3PMBB 1H8DH 5EW2H 1AE8H 1CHOG 4BXSA 3UQVA 4RN6A 4AYVB 1GJBB 3A7YA 1C2LA 3LDXH 1ARCA 3M36A 1K22H 3RXKA 4B2AA 1VZQH 3RXRA 3U8TH 2GGVB 2HALA 3QZQA 1O2SA 4ZXXH 1O3HA 5LH8A 1K2I1 4AG2A 3A7ZA 1BTPA 1S5SA 1V2PT 1EJNA 5PTPA 1G2MA 1ZLRA 4DIHH 4LZ4B 3ZZBA 1O2XA 2UUKB 4YT7H 5EW1H 2P93A 1HJ9A 1MMJN 4NSVA 1HNEE 3PLPA 1BUIA 1ZR0A 1J15A 1C1OA 2BOKA 4ABEA 1P8VC 3HATH 1QY6A 3NPSA 3SJ9A 3C27B 2SGQE 1OSSA 3M3VA 3P17H 1KXFA 4WMEA 3QO6A 1BITA 4R0IA 3TPIZ 2A1DB 2ZI2H 2VVUA 1O2RA 5JBBS 2AH4X 1TRNA 3Q77A 1XUIA 3UUZA 1FY4A 1QTFA 1AQ7A 4Y8ZA 1ELDE 3SHCH 4YM9A 1OOKB 2GCTB 2ZFSA 3M3SA 1P10A 1O2JA 1GI2A 1FJSA 3SI3H 1KDQB 1BT7A 1P57B 1LMWB 1THPB 2UWPA 4ZHLU 3UIRA 3ZVDA 4J1YA 2JH5D 1BZXE 2BYAX 4BTIB 1E36B 1HPGA 2RG3A 4E7NA 1DWDH 1GCDA 1RRKA 3OY5U 4JZDH 4ZKOU 3KQBA 8KME2 4JYTA 2WPLS 1UVPA 1LQDB 1TOMH 1FY5A 3T28A 3A7WA 5J4SA 2VH0A 1DANH 5GXPA 1INCA 2ZGBH 1QA0A 1XXDA 2OC0A 2AIPA 1NRPH 3LT3A 1O2YA 1NFXA 5JB8S 2A0QB 1CA0C 2Q6GA 4AOQA 4XE4A 2ZFQH 1UJ1A 3R0FA 2GT8A 3S0NA 1ZPBA 2H9HA 2VIDA 2BVXH 2RA0A 1THSH 1Z71A 2AIQA 2R0KA 1CBWB 1H9HE 5A2MH 1OWKA 2TPIZ 2C8ZB 4M7GA 1GI5A 2FDAA 3UR9A 5CHAC 5T6FA 3SHAH 3S7HB 2AGGX 5A09A 1CSOE 1GVKB 1WTGH 2WPKS 7KMEH 3TGIE 1MTNB 3QTOH 3I77A 1C5UA 3AVZA 2OXSA 1P01A 2ZPSA 1CO7E 1YLDA 1DXWA 4B73A 3BEIB 4FU9A 1C5TA 4MPWA 3PROA 1NO9H 1KYNA 2XTTB 4Z0KA 1RTLA 3A7XA 1G36A 1GJAB 1KLJH 1NROH 1PYTD 3LIWA 1O3FA 2NU2E 2OP9A 1YCPM 3I78A 3FAOA 4IGDA 4Z6AH 1UCYH 9ESTA 1GDNA 4GSOA 2P8OB 5TJXA 1SMFE 3CS7A 2ANYA 4I32A 4IC6A 1Z8RA 2ZO3H 1A1RA 3E1XB 1O2HA 4FUHA 3SU3A 3K6YA 1ORFA 1QBNA 1C1PA 1T32A 1XUJA 5GJ4B 1O3BA 1KY9A 4X1NU 1ZTLA 4THNH 1GBTA 3GY8A 2J92A 3VB6A 1JIRA 1FAXA 1B5GH 5BPEA 1XM1A 4SGBE 3SO3A 1K9OE 3GCTF 5EOKA 3TIUA 3MH4A 4AGKA 3QUMP 2CJIA 1TBQH 1Q3XA 1GBDA 2BX4A 1CQQA 1EZQA 1F0UA 4UD9H 2G52A 2BY9X 2BD2A 3TNSA 1GBFA 1HJAC 1A3BH 3GCHB 1DX5M 1HAIH 1FV9A 4Y0ZE 3BG8A 3ZVEA 4LXBH 3SU0A 2VIWA 4MNYA 4I7YH 3M35A 1C1MA 3SJKA 1UK2A 1HRTH 1QCPA 1QJ6B 1TNLA 3PMAB 2G81E 1S6FA 3RP2A 1SOZA 2TGAA 1LVMA 1TE0A 4CRAA 1VCPA 3SZNA 5DP4A 4LZ1H 1W7GH 1MKWH 1P11E 2FESH 2UWOA 2CMYA 4JK6A 1TAWA 1LTOA 2BXTH 2R3UA 3OX7U 4FUJA 1FY3A 1F7ZA 5DG6A 2ZU5A 4U30A 3T26A 3EGKH 3RUOA 1SGDE 4CBNA 1C4Y2 2ZDNA 3MWIU 4FUGA 3CP7A 3DA9B 1AVXA 3AAVA 1L4DA 3UPEA 4B71A 4JZIA 1XUKA 5ESTE 5F03A 5F8ZA 2O8WA 4JZ1A 1WQVH 3AW0A 1P2NA 1SGFA 1YGCH 1GHZA 1SLUB 2VWLA 5SGAE 2QY0B 2AMDA 2WPMS 1TA2A 1MU8B 5ESBA 4IMZA 2SNWA 5JB9S 1C1SA 4R8TB 3RU4T 2O8UA 3MH5A 2QA9E 1HAVA 1QRZA 2Z9KA 1Y3YA 2A7CA 1QQ4A 2ZTZA 1O3KA 1G37A 1P12E 1GL0E 2A5KA 3UREA 1UK3A 1O30A 2XNIA 3RXQA 4A1XA 5FX5A 2BMGB 1YPMH 1O2PA 2Y7ZA 3RMOH 1BTXA 1ELVA 5A8ZA 1KXCA 3UWJH 4ZAEA 1S6HA 2R9PA 1C5VA 2ZWLH 5F8XA 4TWWA 2GD4B 1CT2E 2WINI 1O2KA 2EA3A 1UCYE 4ASHA 1FIZA 3NUMA 4JYVH 2EI8A 3RXIA 1NC6A 3A80A 4ABGA 3LJJA 2ZQ1A 2DE9A 1WBGB 5C5NA 1E35B 1ZPZA 4O3UA 1BTZA 3B8JA 3RXLA 4WY3A 3U98H 1HUTH 4CH2B 1Y3UA 5C1XA 2BHGA 2GX4A 1SC8U 2GV6A 2BQ7B 1EPTC 1C2GA 2P59A 3Q76A 2QN5T 1C1WH 1GMHF 3SJ8A 4GPGA 1W0ZU 1NT1A 1EP6A 1GI1A 3SNDA 3K2UA 4FU7A 1C5QA 2OBOA 1H4WA 3BTQE 2Z3CA 1JOUB 5EGMA 1BBRE 3T2NA 1GHBF 1IQIA 1JRTA 1PQ7A 2D26C 1MQ6A 1AUJA 1JRSA 1OXGA 6ESTA 1CHGA 3GISB 3C1KA 1AZZA 3VB5A 3ZZ3A 1C2IA 4A1TA 1MTVA 1ZTJA 5E2OA 2JH6D 3RM0H 1P2QA 2FOBA 3GY7A 4NA8A 2BD4A 4Y10E 5C5OA 3MI4A 3LONA 1EAXA 1BCUH 2ZA5A 1EOJA 1OWJA 2ZPQA 3RM2H 2ZHFH 4CRBA 3SV8A 2ZDVH 1ZHPA 3S9CA 8LPRA 1A4WH 3A8AA 5HXFA 2FO9A 1Z8JB 2XWBI 3MOCA 1IAUA 1O3NA 3SU2A 3BV9B 2FYQA 5DP3A 3MH6A 1VGCB 1VR1H 1GHYH 1Z8GA 2HPPH 2VIPA 1V2JT 3LPRA 5FPYA 3BTHE 2J4IA 1GI8B 2BVSH 3EA9A 1PPFE 2H1UA 3RLYH 2CN0H 3D49H 2FIRH 5DJ7A 1WYKA 1D6RA 5JBAS 4IN1A 4UFEH 4FUDA 1O5FH 1GJ6A 1U6QA 2ZU3A 2PR3A 3TJVA 2B8OH 3KN2A 3FZDA 2H5DA 1C4U2 1C5RA 2G4UA 2Q1JA 4ABAA 4JZEH 2G8TA 1IQMA 4NIXA 1SHHB 5LGOA 3KL6A 4ISNA 1GBAA 2ZHEH 1DDJA 1B0FA 1EZUC 2QC2A 3HKJB 3PLBA 3UOPA 3QLPH 4YESB 3MO3A 1MKWK 3LGYA 2GTBA 5E2PA 4YZUA 2A4QA 2HGTH 2I6QA 3FANA 1XUFA 1PQ5A 1TALA 2FLBH 3R3GB 1SGYE 2ULLA 2BM2A 1KTSB 4ZHMU 4OGYA 3OU0A 4WXVA 3GCOA 3BEUA 3GOVB 2XBXA 5C2ZA 1O3EA 1NM6A 4X8TH 3UY9A 5A8YA 4ZUHA 2TGDA 2H5CA 5EPNA 1ZMNA 4IS5A 3BTKE 4U32A 3RXTA 1C5SA 2ZFRH 4WH6A 1EPTA 2WYGA 1LKBA 3SU5A 2A4GA 3ESTA 1Y5AT 1NS3A 4ZKRU 4HFPB 3K6ZA 4TPYA 1C2MA 3GYLB 1W7XH 3BTTE 3L3TA 4MTBA 1S0QA 1MH0A 1NTPA 1O36A 1QJ7B 3RXOA 1EB2A 4NCYA 1VCWA 1EAUA 3BSQA 1OS8A 1V6DA 5JBCS 4AZ2B 1TGSZ 3TJUA 1WOFA 1MBQA 1UTMA 1C5YB 3NXPA 4ZMAH 3E90B 3ZZ8A 2SGFE 3PO1B 1O3GA 2BQWB 1GMDF 2VNTA 4U2WA 3T29A 3SV9A 1E37B 5AVDA 1A5HA 1P9SA 3AASA 2SNVA 1HB0B 2FODA 4NZLA 2CHAC 1GPZA 2JKHA 3EYDA 1A46H 2ZG0H 1V2VT 3VXEH 1XX9A 2V0BA 1K21H 3EA8A 1ZGIA 3QZRA 2BDGA 2ILNA 3V3MA 3U69H 1Z6JH 1ETSH 1O2MA 1W2KH 1AVGH 1C5ZB 3LGIA 5EXNA 3EA7A 3Q3KA 1OP0A 2ZKSA 2LPRA 1A0LA 3URDA 1TX7A 3EDXB 1W10U 3BF6H 3RLWH 1SOTA 1Y3WA 1IQEA 7GCHG 1LPZB 1T7CA 1EASA 2H6MA 3A88A 3HK3B 3E3TA 4UE7H 3MNBA 1NZQH 1BRUP 3U8RH 3A83A 2SGPE 3VFEA 1HXFH 1K1PA 1UTOA 1E0FD 1GMDG 2O8TA 2PTCE 1HAZB 1GI3A 1YPHC 3MU8A 4X2VA 3UNRA 2O8LA 2CF9H 2VU8E 4AG1A 3SV2H 2TRMA 2PSXA 3VEQB 2BZ6H 1TBZH 2PV9B 4TYDA 2HRVA 4NFEA 2XCFA 1KXAA 3PB1E 1AY6H 1HAPH 3PMJA 2C3SA 4YLUA 2BDYA 3Q3XA 1YLCA 3BTME 1RFNA 1V2RT 2ZECA 2FOMB 2Y7XA 1TA6A 4FUCA 1UCYK 2Z3DA 1G3DA 2QGRA 1HV7A 1C1VH 4F4OC 4XBBA 1H1BA 2ZZUH 3RDZA 3NK8A 3ZZ6A 1A0HB 3UNSA 1ANEA 2F9BH 1N8OC 1HCGA 1CA8B 1Z1IA 2ZGCA 4AX9H 1C2FA 1O5EH 3IG6B 1HLTH 1Q31A 4ABFA 1ZOMA 4OS5A 4H4FA 4Q2KA 3BIVH 3ZZCA 4XSKU 1Z1JA 4UFFH 4Y6DA 2GKVE 3SGAE 1S83A 1AHTH 1HXEH 2WUCA 1J17T 4UDWH 3U1IB 3PWBA 2Y80A 1SHYA 4AFQA 3SV6A 5E0GA 1C1UH 1Z6EA 3VB4A 2NU4E 5EODA 3ZVAA 3AAUA 4KELA 3AW1A 1V2LT 3SU1A 1JBUH 3MU4A 1W3CA 1XVOA 2GV7A 1A0JA 2G55A 2PKSB 1O3OA 4H42U 3TGJE 2RCEA 4SGAE 1HGTH 5CMXH 5LPFA 1P3CA 3ZZ5A 1TWXB 1O2WA 2JH0D 4OS7A 1MBMA 1C9PA 1BTHH 1AVWA 2PUQH 3SN8A 1D3DB 1G3BA 1VJAU 4K5ZA 3TK5A 3OTJE 2XYAA 1BIOA 1SGRE 2VIQA 1O2GH 2PKAB 2OBQA 5HM2A 3OSYA 5E0HA 1GDQA 3H7OA 2HVXA 2NWNA 2PSYA 1TX8A 3RU4D 3PLKA 1RD3B 1D4PB 4JMYA 1C5LH 4DOQA 1G32B 1ID5H 1TGTA 1NFYA 1HAVB 2A2XH 2G5VA 1RJXB 4NSYA 2P16A 1MZDA 3STJA 4A5TS 4YO9A 1OWIA 1GBJA 1BMLA 1YPKH 1BQYA 3M37A 3LC3A 1OKXA 1AB9C 1LKAA 1PYTC 2BDIA 1DWEH 1KXBA 3M7TA 3RXGA 1A3EH 3G01A 1G3CA 1P2IA 1JMOH 4JZFH 3JZ2B 2PGQB 2V6NA 2XXLA 1WV7H 2VVVA 3UQOA 3LGTA 1J16A 2ZFFH 1J8AA 1TRMA 1O35A 1GJDB 2A2QH 3CENA 1FPHH 2ZU2A 3PYHA 3RXEA 4FVDA 5A0CA 2SGEE 4FUEA 3F1SB 1O0DH 2A7JA 5B6OA 4DCDA 4HTCH 2HNTF 3UR6A 4BAMB 1DSTA 3P6ZB 4GHTA 1F5LA 5L2ZH 1K1IA 1RXPA 4TWYA 4WMFA 1LVYA 2STBE 3A87A 3BG4B 1MAXA 1O33A 2UUYA 4X6PA 4ZH8A 1CU1A 4WF8A 1TNHA 4KTUA 2W26A 4ZKSU 6LPRA 1EAIA 5T6DA 4B74A 3BTWE 2AFQB 4LK4A 1HIAA 3H7TA 5DP6A 1DWBH 1O2QA 4AGJA 4K8YA 1F0SA 4E06H 1O2IA 4MPXA 3RMLH 1TIOA 2NU1E 1YF4A 4ABBA 4CRDA 3NKKA 1ELGA 3RMNH 1O3IA 1O2VA 1C5NH 5DK1A 3PMHB 3M61U 3VGCB 1ZTKA 3S9BA 1G3EA 3Q00A 3SNCA 1T8NA 2ODQA 4Q7YA 3PWCA 4X6NA 2W3KA 1KSNA 1YPEH 2QXJA 1A5IA 2ZC9H 4BANB 4AFZA 1G9IE 3URCA 2GCHF 1N8OB 4JCNA 2BD3A 1O34A 1VJ9U 4NIVA 2Y5GA 2B5TB 1SG8B 1JWTA 3QWCH 1TABE 4GVUA 3UTUH 1ELAA 2J34A 3MYWA 1A2CH 2C8XB 5FPSA 3RC6A 2P8OC 2OCVB 4BOHA 4BXWA 2XBYA 1O3JA 3HK6B 3MH7A 1O2ZA 3SOSA 1TYNA 2B0FA 3ZVBA 4MNXA 1MTWA 4XOJA 1CE5A 1UVUH 1ZYOA 4ZKNU 4IBLH 3GICB 1WTHD 3F9FA 4IN2A 1LVBA 1LHGH 2EI7A 5FHTA 1YP9A 1DPOA 3P8NA 5EXMA 1GCTC 1H8IH 4X6MA 3UOUA 5IDKA 7LPRA 4FUBA 2G51A 5T3HA 1PPBH 1EOLA 1FY1A 1TNGA 3QDZB 1SSXA 1ABIH 1HYLA 1TX6A 2A32A 1P09A 3D23A 3L6PA 3ZVCA 2P3TB 1UVTH 2C8WB 3EAJA 3RXSA 1CA0B 3LC5A 1BRAA 3LH3A 1IHTH 2FOCA 3TU7H 1W11U 3U8OH 3ATIA 1P05A 2SGAA 3SV7A 1EB1H 2GCHG 1L4ZA 1GBIA 1XVMA 5EG4A 4H6TA 5DKMA 1GHAF 2C4FH 4WJG2 1ELBA 1V3XA 1WUNH 1ZMLA 3P70B 2F3CE 1ZMJA 2BLOA 1P02A 2VIVA 2A45B 4QT8C 3M5LA 3GY3A 1IQFA 4X8UH 2W5EA 3RXMA 2W3IA 6CHAC 1ESBA 3SGBE 1PPZA 2P95A 5DP9A 1FIWA 2R3YA 2BLWA 1ELFA 1NU7B 4UEHH 1DXPA 2B9LA 2PUXB 3EQ0H 3GCHC 1GG6C 2AEIH 1NESE 3BTFE 5L6NH 4Q7XA 2WV5A 3HGPA 1KLTA 2BD7A 1C4V2 4BAHB 1EZSC 1NRRH 2DUCA 1T8LA 1DVAH 1FY8E 1ARBA 1ELEE 1D6WA 1TQ0B 1SB1H 2BVRH 2Y5HA 1O31A 2Y5FA 5JPMH 2C8YB 5HM9A 1O3MA 1FPCH 3A84A 3BG4C 3HKIB 3V12A 1GHVH 2HLCA 1ZHRA 4NIYA 4YOGA 2WUBA 2ZU1A 5DP5A 5JYIA 4BTTB 2BLQA 3EE0B 1YPJH 1XUHA 2VIOA 2ZGXH 5A8XA 5HMAA 1D3QB 1GJ4H 3CS0A 3P8GA 1E38B 1O2LA 1NRSH 1QJ1B 4XDEA 3RXVA 1SGNE 1TB6H 1C5OH 1PPEE 4MG3A 2QAAA 1O2OA 1OWHA 2W7UA 1XKAC 2ALVA 2ZNKH 1UHBB 3ITIA 4NGAH 3TVJB 1ZPCA 2BZAA 2F9OA 5IYTA 5F6MA 2GMTB 1C9TA 4JYUH 1GBHA 1UTLM 1D3PB 3DFJA 1IHSH 2TGTA 1TNIA 2ZGJA 4IMQA 3LGVA 5DPAA 1KXEA 1ZSLA 1P2MA 1DLEA 3S9AA 3RXDA 3LU9B 3S7KB 3NWUA 1ZJDA 3STIA 1FN6A 4XFQA 3RC5A 1UHBA 2FWWA 1GI9B 3ZZ9A 1QL7A 2W7SA 1W8BH 1GHWH 2J2UA 4K1TA 4ABIA 3FP8E 3ZYEA 1MTSA 3E16B 3B23B 1YPGH 2GZ8A 2G4TA 2WYJA 2V3HH 4NZQA 1O3DA 1MCTA 3TH2H 1C2HA 1ZZZA 3P8OA 1O32A 2KAIB 1QL9A 1MU6B 2F91A 3A82A 1PQAA 4YOIA 3F9EA 4I33A 4CH8B 4OS1A 2OUAA 5GPIB 3BEFB 1K28D 1EJMA 3KNXA 1BJVA 5FPTA 4NG9H 1EXFA 2YNAA 2D8WA 3VGCC 1TLDA 5GWZA 4Q80A 2BY8X 3JZ1B 4BAOB 1N6XA 1C2JA 1EPTB 2EI6A 1QB6A 2O9QA 1SFIA 1CGIE 1BHXB 2FYRA 3ATLA 4FXGH 1O38A 1D9IA 1F92A 3M5NA 1GWAA 1G2LA 1FXYA 3BTEE 4ABHA 1J9CH 1P0SH 5GDSH 2D1JA 1RIWC 3E8LA 4MPUA 5AFYH 2BX3A 4DURA 3VPKA 3M3TA 1BRCE 2UUFB 4NA7A 1GGDC 4AFSA 3TK9A 3M5OA 2OC7A 8ESTE 2A5AA 2ANKH 3GY6A 3PV4A 1GHAG 1THRH 1C1QA 3TH3H 3N7OA 2WPIS 4MPVA 1W12U 4Y79A 5E8EH 2PKAA 3QN7A 1C2KA 1VCQA 1ACBE 1VITG 3V13A 1KXDA 1GCTB 2K1QA 3PM3A 3SU6A 2RDLA 5EXLA 1KLIH 1C1NA 3RC4A 2OC8A 1A61H 1O5DH 3W94A 1GMHG 4GHQA 2VWNA 1OX1A 1GBCA 2ZF0H 2Q6DA 4DJZB 1MD7A 1AKSA 1ESTA 3SJIA 1TMBH 2VGCC 1GBEA 5CE1A 3LOXA 3BIUH 1K1NA 6GCHG 1GMCG 3D65E 2GCTC 3TITA 1IQGA 1T4VH 2HNTC 1AE5A 1MKXH 4Y11E 4OGXA 2BDHA 2BLVA 3TJNA 2OTVA 3HGNA 2THFB 4TY6A 5A0AE 1GJ9B 1CT0E 1AMHA 3ZVFA 1AU8A 3A8BA 1O5AB 3RXFA 1TPOA 1LO6A 3I29A 3TLOA 5FAHA 2F9PA 1QL8A 3P92A 3MNCA 2F9VA 3ODFA 1DWCH 3BN9A 3F6UH 2J9NA 3ELAH 1C5WB 1ZJKA 2XC5A 4DGJA 1PQ8A 1SLVB 2ZEBA 3A7TA 4GAWA 2ZCLP 2BY6X 1ETRH 1GHXH 1HIAB 4INHA 2J95A 5L2YH 4X2YA 1BRBE 3LGWA 1GG6B 1HAYB 4X0WU 1BJUA 1O3CA 5ETXA 1LHFH 3ODDA 1DITH 2A4OA 2ALPA 1IQJA 1P3EA 1YPLH 1V2NT 2GZ7A 1HDTH 2XC0A 2OLGA 1RTFB 3D62A 2QIQA 1DUAA 4Y8YA 2VVCA 3RXUA 1DLKB 4J2YB 2AS9A 6CHAB 1WU1A 3ZZDA 1HJ8A 3DT0H 4Y7AA 5JDUB 1EZXC 4X6OA 2IN2A 3KQEA 2ZHDA 2FX4A 2NU3E 5GCHF 2JETC 2Z7FE 1WAYB 4PROA 3FFGA 4I8LA 2RA3A 2ANWA 2BD5A 2ZU4A 4CR5A 4HZHA 1LPKB 3E0NB 3A8DA 1V2MT 3FVFB 1L1JA 3DUXH 1UTJA 1SQOA 5L30H 3O8CA 1O5CB 1DUEA 4E7RG 2Z9LA 1KTTB 3GCTG 1ZGVA 1AWFH 5C67A 4Y7BA 2PFEA 4KGAA 5DO4H 1KDQA 2GP9B 1P9UA 1O37A 1PJPA 2HWLB 2FPZA 5FBIA 1AFQC 1SFQB 3F68H 1F0RA 1GL1A 2F9UA 3SUFA 2R0LA 2A4RA 1HBTH 1Y5BT 3RU4E 3A7VA 4FVBA 1AD8H 2QV1A 1LVOA 2QF0A 1QNJA 1NFUA 2QXGA 1QB1A 1T31A 1AFEH 4LOYH 1ABJH 1TGCA 1F2SE 1JIMA 1HJAB 2UWLA 1TGNA 1AI8H 4ISHH 3P95A 4F49A 1UMAH 2FX6A 2FTLE 1RGQA 1K1JA 2UUJB 4GCHF 7ESTE 3LH1A 4ISOA 1FNIA 1K1OA 1TNKA 1W14U 3H5CB 1LCYA 1YBWA 1MTUA 2R2WU 1BTYA 2AGIX 1DFPA 4K3JA 1ANDA 4DVAU 2VJ1A 4BTUB 1YCPH 2ANMH 3RXAA 3QX5H 4O03A 4WVPE 2XWAA 4O9VA 1L2EA 3KHVA 3MO9A 2BY7X 1QIXB 3LGUA 1S0RA 2ZCKP 3FP7E 4CRCA 4D76A 2CXVA 1FAKH 4NWLA 4YLQH 2VINA 4NWKA 2AYWA 2V35A 1AUTC 2G00A 1SLXB 3T27A 2GZ9A 2P3FH 1CVWH 3ATKA 2H9EH 3ZV9A 4INLA 1CGHA 3A89A 1BTUA 4B2BA 1AB9B 1F0TA 5HYOA 1V2QT 1RIWB 3L33A 5G4BA 3MU0A 3QGNB 1IOEA 4TPIZ 1X7AC 1AIXH 1GI7B 2F9NA 2GT7A 1CHOF 3KQCA 2ZTYA 5EU8A 2VB0A 1UTPA 4I31A 1O2UA 4K1SA 1KIGH 1ZSKA 2Q6FA 2FMJA 1S85A 1W0YH 3GDSA 5TCCA 3UNQA 2IJOB 4D7GA 1GJ8B 3LKWA 4Y0YE 3M7QA 4NFFA 2NU0E 1O3AA 5H4IB 2QYIA 1QB9A 4DIIH 4VGCC 3S69A 4I8KA 1C5XB 5DP8A 3SQEE 1T4UH 2AMPA 2O8MA 1LDTT 2ZGHA 1S84A 1SGEE 4ZHAA 3OYPA 2DE8A 2BB4A 1FN8A 1C2DA 3SORA 2ZPRA 4HI3A 1FI8A 5F8TA 2AGEX 2G5NA 4JK5A 1BBRH 1FZZA 3NCLA 4ISIH 5FCRA 4D9QA 1BA8B 1Y3XA 1AWHB 3ENSB 3O8DA 4CRFA 2PLXA 2Z3EA 1GBMA 1MZAA 1O2TA 1TBRH 4KP0A 3MTYA 3RXBA 2M5TA 1C5MD 1V2TT 4X2WA 3RMMH 1WSSH 4I8HA 4D7FA 3GDVA 1QFKH 2XRCA 2BOHB 1DM4B 1AN1E 1NU9A 2OQUA 2SFAA 1QRXA 2FOGA 4YTAA 3T25A 4A6LA 2HPQH 3KEEA 2CF8H 4ESTE 1VITH 3GY5A 1GJ7B 1SQTA 1SGIB 4CR9A 1S81A 5GIBA 1B7XB 1TGBA 1NY22 1PFXC 1UTKA 1TONA 4CHAC 2VGCB 2FP7B 1GJ5H 3VB7A 1GI0A 1OPHB 1SBWA 2A5IA 3DD2H 1UTNA 5HGGA 3T5FH 1DSUA 1HAHH 4B1TA 4Y8XA 4Y71A 1P2JA 1BTWA 5EQSA 5I46H 1F5RA 5A0BA 1FDPA 3VXFH 3F9GA 1DY8A 1Y8TA 4ABJA 4D8NA 3E0PB 1NRNH 1SL3A 1GBBA 3PTNA 1ZHMA 2J38A 1XXFA 3QGJA 1SI5H 4X8SH 3V0XA 2OQ5A 4X2XA 2OC1A 2FZZA 4CRGA 3TGKE 1DS2E 2Z9GA 3A86A 1GI4A 2JETB 1ELTA 2ZP0H 3SBKA 1A7SA 2FOEA 4RSPA 3WY8A 1SR5C 2Y6TA 3F9HA 2GVFA 4MDSA 1P2KA 1FLEE 8GCHF 2ZTXA 2QXIA 2PTNA 1G30B 4KTSA 5J4QA 1SVPA 2CGAA 3TJOA 4BAKB 1EAWA 1K1LA 3M7UA 1FMGA 1WCZA 3U9AH 1LQEA 3MMGA 1A5GH 2BDCA 4XBCA 2Y81A 2B7DH 2XC4A 1L0ZA 1SQAA 1OYQA 4B2CA 2BDAA 4NIWA 2EEKA 5AFZH 1MQ5A 6GCHF 1GVLA 1PPGE 4MNWA 2OINA 2FS8A 5JBTA 4E05H 4AORA 5T6GA 2Y82A 4X8VH 3K65B 3RXHA 1O39A 3SUDA 1FONA 5C3NA 1XUGA 1GBLA 4VGCB 3ZZ4A 1V2UT 1B0EA 2ODPA 1O3PB 4A7IB 5EQQA 4AFUA 5LPRA 3O8RA 1FUJA 4MLFB 1SGQE 1AGJA
chains in the Genus database with same CATH superfamily
1HAGE 4K2YA 1L1GA 2GDEH 5DGJA 3U1JB 4FETA 4OS6A 2FLRH 4A1VA 1M9UA 1MD8A 2F83A 3PRBA 5FBEA 4GLYA 2QXHA 2FI4E 2STAE 1AFQB 1JXPA 2HNTE 2PGBB 1TPAE 1V2WT 1QQUA 1UVOA 3W95A 3VB3A 3ZV8A 3MU5A 2XW9A 4BNRA 5EQRA 1UO6A 2C93B 4X1QU 1SGFG 1BMAA 1OP2A 3PO1C 1RTKA 3RXPA 4Q7ZA 2ZIQH 1VGCC 1O5BB 2YOLA 2J94A 1YPHE 2VWOA 1GJCB 1XMNB 1V2OT 2GDDA 1WQSA 2Z9IA 1PPHE 2VH6A 5I25A 1BOQA 3DFLA 1VITF 1C1TA 1E34B 1UVSH 4YT6H 2CHAB 3T62A 3MO6A 1SPJA 2ZQ2A 2SGDE 1QBVH 5E0JA 2QCYA 2ASUB 4TSFD 3ZZ7A 1DOJA 2P94A 1L1NA 1LHEH 1HAXB 5C94A 1Y5UT 4A92A 2L6OA 2BXUH 3KGPA 1EUFA 1BBRK 1UTQA 1YYY1 5EPYA 1GI6A 2H2ZA 2QF3A 3PTBA 1BMMH 2AERH 1C2EA 1SGCA 1O3LA 3IITA 1SLWB 1TMUH 3MFJA 4X1PU 1P03A 3DSOA 5AF9H 4WMDA 1TQ7B 1O5GH 1O2NA 3GYMA 2WPHS 1GBKA 1TPSA 3MHWU 4RKJB 3SJOA 5C1UA 1EJAA 1QBOA 2ZFPH 1NFWA 4O97A 2XBWA 1C5PA 1MAYA 2C90B 7GCHF 3E6PH 3LJOA 3TH4H 1LHCH 1ETTH 2JJ1D 3KCGH 2ZDAH 2J98A 4K60A 1BMNH 1QGFA 2ZDLA 5ABWA 3ZZAA 1HFDA 3Q3YA 2CV3A 2BD9A 2GMTC 3TK6A 1DT2A 1QHRB 3BTDE 2BY5X 1EX3A 3M5MA 2FOHA 1H9IE 2WZQA 2FM2A 1PPCE 1ANBA 1Q2WA 3A81A 5DP7A 5FCKA 4IC5A 3SNBA 1BHXF 1KMHB 2R2MB 5CHAB 3QK1A 2BQ6B 2RDEA 3TNTA 2A7HA 3E91A 4XD7D 3FP6E 4CBOA 2WPJS 1EFRD 3SUEA 1GMCF 1MTNC 2ZCHP 2IPHA 3A85A 2YMSB 3MNSA 1OWEA 3RXCA 3SGQE 1V2ST 2VWMA 4H6SB 1IQNA 1YY3A 1AZ8A 5TCAA 1N1LA 1NPMA 4I8GA 1SGTA 2ZHQH 3HPTB 3V7TA 1T8OA 1V2KT 3SNEA 4B6EA 1LPGB 9LPRA 2KCAA 5GCHG 3FKSD 3K9XB 4MNVA 1DY9A 4CREA 1IQLA 1XKBC 1YCPK 2FXRA 1NN6A 1GVZA 1LHDH 2WV4A 4ZXYH 1ZRBA 4DY7B 2AMQA 3GY2A 4GUXA 3BTGE 2H9TH 3GY4A 1CBWC 1CT4E 1ZSJA 2BDBA 4WXIA 8GCHG 3F2GA 2IOTA 5BRRE 2ZFTA 3P8FA 3SNAA 1BDAA 4K69A 1GDUA 4AB8A 1Z8IB 1MKXK 1EP5A 2XCNA 1NRQH 2FI3E 2XBVA 3ZYDA 3ZVGA 4UFDH 4MQAA 5C1YA 1DICA 1Y59T 5AHGH 4XBDA 4Y76A 1N6YA 2Z9JA 2ZHWH 1UK4A 1TFXA 4D9RA 4B76A 5LPEA 1QR3E 2ZDMA 1DE7H 3FZZA 3QTVH 4B75A 4HGCA 5C20A 1P2OA 2FOAA 3KQ5A 1MCVA 4AYYB 2TGPZ 3O8BA 1ELCA 1J14A 4CHAB 1TPPA 1BB0B 5T1VA 4ACBA 2I6SA 1K1MA 1Y3VA 2FEQH 4K8BA 4FUIA 5FX6A 2A31A 3MQKC 1P04A 4ZROA 2FTMA 1AO5A 2FI5E 4P00A 4NA9H 1OP8A 5FXLA 2BTCE 1T8MA 1OYTH 2LNCA 3B9FH 4K1EA 4INKA 5KGOA 4GCHG 5K7RA 1C1RA 4MVNA 1ANCA 4KTCA 2PKSC 4O3TA 4I8JA 2PHBA 3PV2A 2EC9H 5C0TA 1W13U 4FU8A 1SGPE 2OD3B 2FOFA 1EQ9A 1AKSB 4IW4E 1IQHA 1ESAA 4ABDA 1YKTA 2CK3D 2D2DA 3A8CA 3GCNA 1IQKA 2TIOA 4RKOB 4WH8A 1EATA 2YNBA 3ATMA 3DHKH 4AB9A 2BD8A 3PRDA 1EKBB 1RS0A 2ESTE 2FS9A 1HAOH 4U01A 4DT7B 2Z94A 3GDUA 1QRWA 4YOJA 3MU1A 3KIDU 3RXJA 1GGDB 4ISLA 2Z6BD 2V3OH 1TMTH 1H9LB 1TNJA 1Z7KA 1YC0A 4BAQB 4DW2U 1YM0A 3UFAA 1FQ3A 2ZDKA 1MUEB 4X1RU 3OY6U 1TOCB 1F5KU 4OS2A 1OWDA 2PW8H 2PWXA 4UONA 3SQHE 4UFGH 3IWMA 3SUGA 3KF2A 2P3UB 2HOBA 1ZRKA 1QURH 4AN7A 4X1SU 2ODYB 3MNXA 3SW2B 4OS4A 1S82A 4DG4A 5K0HA 1CGJE 1GHBG 4FUFA 1D3TB 4WWYA 3UWIA 3SI4H 1P06A 3ATWA 3KQDA 4TY7A 2TBSA 1QA7A 2KCPA 2XNDD 4KKDA 3SU4A 1TRYA 3NZIA 2KAIA 3PMBB 1H8DH 5EW2H 1AE8H 1CHOG 4BXSA 3UQVA 4RN6A 4AYVB 4RT0A 1GJBB 3A7YA 1C2LA 3LDXH 1ARCA 3M36A 1K22H 3RXKA 4B2AA 1VZQH 3RXRA 3U8TH 2GGVB 2HALA 3QZQA 1O2SA 4ZXXH 1O3HA 5LH8A 1K2I1 4AG2A 3A7ZA 1BTPA 1S5SA 1V2PT 1EJNA 5PTPA 1G2MA 1ZLRA 4DIHH 4LZ4B 3ZZBA 1O2XA 2UUKB 4YT7H 5EW1H 2P93A 1HJ9A 1MMJN 1WDIA 1HNEE 3PLPA 4NSVA 1BUIA 1ZR0A 1J15A 1C1OA 2BOKA 4ABEA 1P8VC 3HATH 1QY6A 3NPSA 3SJ9A 3C27B 2JIZD 2SGQE 1OSSA 3M3VA 3P17H 1KXFA 4WMEA 3QO6A 1BITA 4R0IA 3TPIZ 1YWUA 3OEHD 2A1DB 2ZI2H 2VVUA 1O2RA 5JBBS 2AH4X 1TRNA 1FX0B 3Q77A 1XUIA 3UUZA 1FY4A 1QTFA 1AQ7A 4Y8ZA 1ELDE 3SHCH 4YM9A 1OOKB 2GCTB 2ZFSA 4ASUD 3M3SA 1P10A 1O2JA 1GI2A 1FJSA 3SI3H 1KDQB 1BT7A 1P57B 1LMWB 1THPB 2UWPA 4ZHLU 3UIRA 3W1EA 3ZVDA 4J1YA 2JH5D 1BZXE 2BYAX 4BTIB 1E36B 1HPGA 2RG3A 3KYFA 4E7NA 1DWDH 1GCDA 1RRKA 3OY5U 4JZDH 4ZKOU 2QF4A 3KQBA 8KME2 4JYTA 2WPLS 1UVPA 1LQDB 1TOMH 1FY5A 3T28A 3A7WA 5J4SA 2VH0A 1DANH 5GXPA 1INCA 2ZGBH 1QA0A 1XXDA 2OC0A 2W6JD 2AIPA 1NRPH 3LT3A 1O2YA 1NFXA 5JB8S 2A0QB 1CA0C 2Q6GA 4AOQA 4XE4A 2ZFQH 1UJ1A 3R0FA 2GT8A 3S0NA 1ZPBA 2H9HA 2BVXH 2VIDA 2RA0A 3OFND 1THSH 1Z71A 2AIQA 2R0KA 1CBWB 1H9HE 5A2MH 1OWKA 2TPIZ 2C8ZB 4M7GA 1GI5A 2FDAA 3UR9A 5CHAC 5T6FA 3SHAH 3S7HB 2AGGX 5A09A 1CSOE 1GVKB 1WTGH 2WPKS 7KMEH 3TGIE 1MTNB 3QTOH 3I77A 1C5UA 3AVZA 2OXSA 1P01A 5KEDA 2ZPSA 1CO7E 1YLDA 1DXWA 4B73A 3BEIB 4FU9A 1C5TA 4MPWA 3PROA 5FL7D 1NO9H 1KYNA 2XTTB 4Z0KA 1RTLA 3A7XA 2L74A 1G36A 1GJAB 1KLJH 1NROH 1PYTD 3LIWA 1O3FA 2NU2E 2OP9A 1YCPM 3I78A 3FAOA 1COWD 4IGDA 4Z6AH 1UCYH 9ESTA 1H8ED 1GDNA 4GSOA 2P8OB 5TJXA 1SMFE 3CS7A 2ANYA 4I32A 4IC6A 1Z8RA 2ZO3H 1A1RA 3E1XB 1O2HA 4FUHA 3SU3A 3K6YA 1ORFA 1QBNA 1C1PA 1T32A 1XUJA 5GJ4B 1O3BA 1KY9A 4X1NU 1ZTLA 4THNH 1GBTA 3GY8A 2J92A 3VB6A 1JIRA 1FAXA 1B5GH 5BPEA 1XM1A 4SGBE 3SO3A 1K9OE 3GCTF 5EOKA 3TIUA 3MH4A 4AGKA 3QUMP 2CJIA 1TBQH 1Q3XA 1GBDA 2BX4A 1CQQA 1EZQA 3SZEA 1F0UA 4UD9H 2G52A 2BY9X 2BD2A 3TNSA 1GBFA 1HJAC 1A3BH 3GS9A 3GCHB 1DX5M 1HAIH 1FV9A 4Y0ZE 3BG8A 3WWFA 3ZVEA 4LXBH 3SU0A 2VIWA 4MNYA 4I7YH 3M35A 1C1MA 4ACAA 3SJKA 1UK2A 1HRTH 1QCPA 1QJ6B 1TNLA 3PMAB 4TT3D 2G81E 1S6FA 3RP2A 1SOZA 2TGAA 1LVMA 1TE0A 4CRAA 1VCPA 3SZNA 5DP4A 4LZ1H 1W7GH 1MKWH 1P11E 2FESH 2UWOA 2CMYA 4JK6A 1TAWA 1LTOA 2BXTH 2R3UA 3OX7U 4FUJA 1FY3A 1F7ZA 5DG6A 2ZU5A 4U30A 3T26A 3EGKH 3RUOA 1SGDE 4CBNA 1C4Y2 2ZDNA 3MWIU 5HKKD 4FUGA 3CP7A 3DA9B 1AVXA 3AAVA 1L4DA 3UPEA 4B71A 4JZIA 1XUKA 5ESTE 3DCLA 5F03A 5F8ZA 2O8WA 4JZ1A 1WQVH 3AW0A 1P2NA 1SGFA 3H09A 1YGCH 1GHZA 1SLUB 2VWLA 5SGAE 2QY0B 2AMDA 2WPMS 1OHHD 1MU8B 1TA2A 5ESBA 2JDID 4IMZA 2SNWA 5JB9S 2F4LA 1C1SA 4R8TB 3RU4T 2O8UA 3MH5A 2QA9E 2IPQX 2RFKC 1HAVA 1QRZA 2Z9KA 1Y3YA 2A7CA 1QQ4A 2ZTZA 1O3KA 1G37A 1P12E 1GL0E 2A5KA 3UREA 1UK3A 1O30A 2XNIA 3RXQA 4A1XA 5FX5A 2LP6A 2BMGB 1YPMH 1O2PA 2Y7ZA 3RMOH 1BTXA 1ELVA 5A8ZA 1KXCA 3UWJH 4ZAEA 1S6HA 2R9PA 1C5VA 2ZWLH 5F8XA 4TWWA 2GD4B 1CT2E 2WINI 1O2KA 2EA3A 1UCYE 4ASHA 1FIZA 3NUMA 4JYVH 2EI8A 5DSFA 3RXIA 1NC6A 3A80A 2AHME 4ABGA 3LJJA 2ZQ1A 2DE9A 1WBGB 5C5NA 1E35B 1W0JD 1ZPZA 4O3UA 1BTZA 3B8JA 3RXLA 4WY3A 3U98H 1HUTH 4CH2B 1Y3UA 5C1XA 2BHGA 1E1QD 2GX4A 1SC8U 2GV6A 2BQ7B 1EPTC 1C2GA 2P59A 3Q76A 2QN5T 1C1WH 1GMHF 3SJ8A 4GPGA 1W0ZU 1NT1A 1EP6A 1GI1A 3SNDA 3K2UA 4FU7A 1C5QA 2OBOA 1H4WA 3BTQE 2Z3CA 1JOUB 3DSPA 5EGMA 1BBRE 3T2NA 1GHBF 1IQIA 1JRTA 1PQ7A 2D26C 1MQ6A 5B6LA 1AUJA 1JRSA 1OXGA 3NRLA 6ESTA 1CHGA 3GISB 5KECA 3C1KA 1AZZA 3VB5A 3ZZ3A 1C2IA 4A1TA 1MTVA 1ZTJA 5E2OA 2JH6D 3RM0H 5CDFE 1P2QA 2FOBA 2YMSD 3GY7A 4NA8A 2BD4A 4Y10E 5C5OA 3MI4A 3LONA 1EAXA 1BCUH 2ZA5A 1EOJA 1OWJA 2ZPQA 3RM2H 2ZHFH 4CRBA 3SV8A 3F0PA 2ZDVH 1ZHPA 3S9CA 8LPRA 1A4WH 3A8AA 5HXFA 2FO9A 1Z8JB 2XWBI 3MOCA 1IAUA 1O3NA 3SU2A 3BV9B 2FYQA 5DP3A 3MH6A 1VGCB 1VR1H 1GHYH 1Z8GA 2HPPH 2VIPA 1V2JT 3LPRA 3WW7A 5FPYA 3BTHE 2J4IA 1GI8B 2BVSH 3EA9A 1PPFE 2H1UA 1E79D 3RLYH 2CN0H 3D49H 2FIRH 5DJ7A 1WYKA 1D6RA 5JBAS 4IN1A 4UFEH 4FUDA 1O5FH 1GJ6A 1U6QA 2ZU3A 2PR3A 3TJVA 2B8OH 3KN2A 3FZDA 2H5DA 1C4U2 1C5RA 2G4UA 2Q1JA 4ABAA 4JZEH 2G8TA 1IQMA 4NIXA 1SHHB 5LGOA 3KL6A 4ISNA 1GBAA 2ZHEH 1DDJA 1B0FA 1EZUC 2QC2A 3HKJB 3PLBA 3UOPA 3QLPH 4YESB 3MO3A 1MKWK 3LGYA 5IK2D 2GTBA 5E2PA 4YZUA 2A4QA 2HGTH 2I6QA 3FANA 1XUFA 1PQ5A 1TALA 2FLBH 2KCOA 3R3GB 1SGYE 2ULLA 2BM2A 1KTSB 4ZHMU 4OGYA 3OU0A 4WXVA 3GCOA 3BEUA 3GOVB 2XBXA 2WV9A 1O3EA 2GJGA 1NM6A 5C2ZA 4X8TH 3UY9A 5A8YA 4ZUHA 2TGDA 2H5CA 2J5UA 5EJZA 5EPNA 1ZMNA 3UAIC 4IS5A 3BTKE 4U32A 3RXTA 1C5SA 2ZFRH 4WH6A 1EPTA 2WYGA 1LKBA 3SU5A 2A4GA 3ESTA 1Y5AT 1H8HD 1BMFD 1NS3A 3FN8A 4ZKRU 4HFPB 3K6ZA 4TPYA 1C2MA 3GYLB 1W7XH 4XRNA 3BTTE 3L3TA 4MTBA 1S0QA 1MH0A 1NTPA 1O36A 1QJ7B 3RXOA 1EB2A 4NCYA 1W0KD 1VCWA 1EAUA 3BSQA 1OS8A 1V6DA 5JBCS 4AZ2B 1TGSZ 3TJUA 1WOFA 4B6FA 1MBQA 1UTMA 1C5YB 3NXPA 4ZMAH 2QF5A 3E90B 3ZZ8A 2SGFE 3PO1B 1O3GA 2BQWB 1GMDF 2VNTA 4U2WA 3T29A 4M9FA 3SV9A 2QE7D 1E37B 5AVDA 1A5HA 1P9SA 3AASA 2SNVA 1HB0B 2FODA 4NZLA 2JKHA 1GPZA 2CHAC 3EYDA 1A46H 2ZG0H 1V2VT 3VXEH 1XX9A 2V0BA 1K21H 3EA8A 1ZGIA 3QZRA 2BDGA 2ILNA 3V3MA 3U69H 1Z6JH 1ETSH 1O2MA 1W2KH 1AVGH 1C5ZB 3LGIA 5EXNA 3EA7A 3Q3KA 1OP0A 2ZKSA 2LPRA 1A0LA 3URDA 1TX7A 3EDXB 1W10U 3BF6H 3RLWH 1SOTA 3CNRA 1Y3WA 1IQEA 7GCHG 1LPZB 1T7CA 1EASA 2H6MA 3A88A 3HK3B 3E3TA 4UE7H 3MNBA 1NZQH 1BRUP 3U8RH 3N7DA 1NBMD 3A83A 2SGPE 3VFEA 1HXFH 1K1PA 1UTOA 1E0FD 1GMDG 2O8TA 2PTCE 1HAZB 1GI3A 1YPHC 3MU8A 4X2VA 3UNRA 2O8LA 2CF9H 2VU8E 4AG1A 3SV2H 2TRMA 2PSXA 3VEQB 2BZ6H 1TBZH 2PV9B 4TYDA 2HRVA 4NFEA 2XCFA 1KXAA 3PB1E 1AY6H 1HAPH 3PMJA 2C3SA 4YLUA 2BDYA 3Q3XA 1YLCA 3BTME 1RFNA 1V2RT 2ZECA 2FOMB 2Y7XA 1TA6A 4FUCA 1UCYK 2Z3DA 1G3DA 2QGRA 1HV7A 1C1VH 4F4OC 1SQRA 4XBBA 1H1BA 2ZZUH 3RDZA 3NK8A 3ZZ6A 1A0HB 3UNSA 1ANEA 2F9BH 2EY4C 1N8OC 1HCGA 4Q4LA 1CA8B 1Z1IA 2ZGCA 4AX9H 1C2FA 1O5EH 3IG6B 1HLTH 1Q31A 4ABFA 1ZOMA 4OS5A 4H4FA 4Q2KA 3BIVH 3ZZCA 4XSKU 5C17A 1Z1JA 4UFFH 4Y6DA 2GKVE 3SGAE 1S83A 1AHTH 1HXEH 2WUCA 1J17T 4UDWH 3U1IB 3PWBA 2Y80A 1SHYA 4AFQA 3SV6A 5E0GA 1C1UH 1Z6EA 3VB4A 2NU4E 5EODA 3ZVAA 3AAUA 4KELA 3AW1A 1V2LT 3SU1A 1JBUH 3MU4A 1W3CA 1XVOA 2GV7A 1A0JA 2G55A 4Z1MD 2PKSB 1O3OA 4H42U 3TGJE 2RCEA 4SGAE 1HGTH 5CMXH 5LPFA 1P3CA 3ZZ5A 1TWXB 1O2WA 2JH0D 4OS7A 1MBMA 1C9PA 1BTHH 1AVWA 2PUQH 3SN8A 1D3DB 1G3BA 1VJAU 4K5ZA 3F2HA 3OEED 3TK5A 3OTJE 2XYAA 1BIOA 1SGRE 2VIQA 1O2GH 1QZ8A 2PKAB 2OBQA 5HM2A 3OSYA 5E0HA 1GDQA 3H7OA 2HVXA 2NWNA 2PSYA 1TX8A 3RU4D 3PLKA 1RD3B 1D4PB 4JMYA 1C5LH 4DOQA 1G32B 1ID5H 1TGTA 1NFYA 1HAVB 2A2XH 2G5VA 1RJXB 4NSYA 2P16A 1MZDA 3STJA 4A5TS 4YO9A 3EE7A 4OM9A 1OWIA 1GBJA 1BMLA 1YPKH 3F3BA 1BQYA 3M37A 3LC3A 1OKXA 1AB9C 1LKAA 1PYTC 2BDIA 1DWEH 1KXBA 3M7TA 3RXGA 1A3EH 3G01A 4AC9A 1G3CA 1P2IA 1JMOH 4JZFH 3JZ2B 2PGQB 2V6NA 2XXLA 1WV7H 2VVVA 3UQOA 3LGTA 1J16A 2ZFFH 1J8AA 1TRMA 1O35A 1S6LA 1GJDB 2A2QH 3CENA 1FPHH 2ZU2A 3PYHA 3RXEA 4FVDA 5A0CA 2SGEE 4FUEA 3F1SB 1O0DH 2A7JA 5B6OA 4DCDA 4HTCH 2HNTF 3UR6A 4BAMB 1DSTA 3P6ZB 4GHTA 1F5LA 5L2ZH 1K1IA 4F55A 3OTPA 1RXPA 4TWYA 4WMFA 1LVYA 2STBE 3A87A 3BG4B 1MAXA 1O33A 2UUYA 4X6PA 4ZH8A 1CU1A 4WF8A 1TNHA 4KTUA 2W26A 4ZKSU 6LPRA 1EAIA 5T6DA 4B74A 3BTWE 2AFQB 4LK4A 1HIAA 3H7TA 2K0QA 5DP6A 1DWBH 1O2QA 4AGJA 4K8YA 1F0SA 4E06H 1O2IA 4MPXA 5EJLA 1TIOA 3RMLH 2NU1E 1YF4A 4ABBA 4CRDA 1E1RD 3NKKA 1ELGA 3RMNH 1O3IA 1O2VA 1C5NH 5DK1A 3PMHB 3M61U 3VGCB 1ZTKA 3S9BA 1G3EA 3Q00A 3SNCA 1T8NA 2ODQA 4Q7YA 3PWCA 4X6NA 2W3KA 1KSNA 1YPEH 2QXJA 1A5IA 2ZC9H 4BANB 4AFZA 1G9IE 3URCA 2GCHF 1N8OB 2KR7A 4JCNA 2BD3A 1O34A 1VJ9U 4NIVA 2Y5GA 2B5TB 4F48B 1SG8B 1JWTA 3QWCH 1TABE 4GVUA 3UTUH 1ELAA 2J34A 3MYWA 1A2CH 2C8XB 5FPSA 3RC6A 2P8OC 2OCVB 4BOHA 2JJ2D 4BXWA 2XBYA 1O3JA 3HK6B 3MH7A 1O2ZA 3SOSA 1TYNA 2B0FA 3ZVBA 4MNXA 1MTWA 4XOJA 1CE5A 1UVUH 1ZYOA 4ZKNU 4IBLH 3GICB 1WTHD 3F9FA 4IN2A 1LVBA 1LHGH 2EI7A 5FHTA 1YP9A 1DPOA 3P8NA 5EXMA 1GCTC 1H8IH 4X6MA 3UOUA 5IDKA 7LPRA 4FUBA 2G51A 5T3HA 1PPBH 1EOLA 1FY1A 1TNGA 3QDZB 1SSXA 1ABIH 1HYLA 1TX6A 1VKYA 2A32A 1P09A 3D23A 3L6PA 3ZVCA 2P3TB 1UVTH 2C8WB 3EAJA 3RXSA 1CA0B 3LC5A 1BRAA 4DT4A 3LH3A 1IHTH 2FOCA 3TU7H 1W11U 3U8OH 3ATIA 1P05A 2SGAA 3SV7A 1EB1H 2GCHG 1L4ZA 1GBIA 1XVMA 5EG4A 4H6TA 5DKMA 1GHAF 2C4FH 4WJG2 1ELBA 1V3XA 1WUNH 1ZMLA 5EIYA 3P70B 2F3CE 1ZMJA 2BLOA 3WWBA 1P02A 2VIVA 2A45B 4QT8C 3M5LA 3GY3A 1IQFA 4X8UH 2W5EA 3RXMA 4RI0A 2W3IA 2YMSC 6CHAC 1ESBA 3SGBE 1PPZA 2P95A 5DP9A 1FIWA 2R3YA 2BLWA 1ELFA 1NU7B 4UEHH 2OK5A 1DXPA 2B9LA 2PUXB 3EQ0H 3GCHC 1GG6C 2AEIH 1NESE 2KZ4A 3BTFE 5L6NH 4Q7XA 2WV5A 3HGPA 3OAAD 1KLTA 2BD7A 1C4V2 4BAHB 1EZSC 1NRRH 2DUCA 4P02A 1T8LA 1DVAH 1FY8E 1ARBA 1ELEE 1D6WA 1TQ0B 1SB1H 2BVRH 2Y5HA 1O31A 2Y5FA 5JPMH 2C8YB 5HM9A 1O3MA 1FPCH 3A84A 3BG4C 3HKIB 3V12A 1GHVH 2HLCA 1ZHRA 4NIYA 4YOGA 2WUBA 5GNDA 2ZU1A 5DP5A 5JYIA 4BTTB 2BLQA 3EE0B 1YPJH 1XUHA 2VIOA 2ZGXH 5A8XA 5HMAA 1D3QB 1GJ4H 3CS0A 3P8GA 5DN6D 1E38B 1O2LA 1NRSH 1QJ1B 4XDEA 3RXVA 1SGNE 1TB6H 3AK5A 2J98B 1C5OH 1PPEE 4MG3A 2QAAA 1O2OA 1OWHA 2W7UA 1XKAC 2ALVA 2ZNKH 1UHBB 3ITIA 4NGAH 3TVJB 1ZPCA 2BZAA 2F9OA 5IYTA 5F6MA 2GMTB 1C9TA 4JYUH 1GBHA 1UTLM 1D3PB 3DFJA 1IHSH 2TGTA 3ZIAD 1TNIA 2ZGJA 4IMQA 3LGVA 5DPAA 1KXEA 1ZSLA 1P2MA 1DLEA 3S9AA 3RXDA 2KFWA 3LU9B 3S7KB 3NWUA 1ZJDA 3STIA 1FN6A 4XFQA 3RC5A 1UHBA 1MABB 2FWWA 4I86A 3UB0A 1GI9B 3ZZ9A 1QL7A 2W7SA 1W8BH 1GHWH 2J2UA 4K1TA 4ABIA 3FP8E 3ZYEA 1MTSA 3E16B 3FOAA 3B23B 1YPGH 2GZ8A 2G4TA 2WYJA 2V3HH 4NZQA 1O3DA 1MCTA 3TH2H 1C2HA 1ZZZA 3P8OA 1O32A 2KAIB 1QL9A 1MU6B 2F91A 3A82A 1PQAA 4YOIA 3F9EA 4I33A 4CH8B 4OS1A 2OUAA 5GPIB 3BEFB 1K28D 1EJMA 3KNXA 1BJVA 5FPTA 4NG9H 1EXFA 2YNAA 2D8WA 3VGCC 1TLDA 5GWZA 4Q80A 2BY8X 3JZ1B 4BAOB 1N6XA 1C2JA 1EPTB 2EI6A 1QB6A 2O9QA 1SFIA 1CGIE 1BHXB 2FYRA 3ATLA 4FXGH 1O38A 1D9IA 1F92A 3M5NA 1GWAA 1G2LA 1FXYA 3BTEE 4ABHA 1J9CH 1P0SH 5GDSH 2D1JA 1RIWC 3E8LA 4MPUA 5AFYH 2BX3A 4DURA 3VPKA 3M3TA 1BRCE 2UUFB 4NA7A 1GGDC 4RT1A 4AFSA 3TK9A 3M5OA 2OC7A 8ESTE 2A5AA 2ANKH 3GY6A 3PV4A 1GHAG 1THRH 1C1QA 3TH3H 3N7OA 2WPIS 4MPVA 1W12U 4Y79A 5E8EH 2PKAA 3QN7A 1C2KA 1VCQA 2VBCA 1ACBE 1UW7A 1VITG 3V13A 1KXDA 1GCTB 2K1QA 3PM3A 3SU6A 2RDLA 5EXLA 1KLIH 1C1NA 3FO8D 4FOUC 3RC4A 2OC8A 1A61H 1O5DH 3W94A 1GMHG 4GHQA 2VWNA 1WXRA 1OX1A 1GBCA 2ZF0H 2Q6DA 4DJZB 1MD7A 1AKSA 1ESTA 3SJIA 1TMBH 3F0OA 2VGCC 1GBEA 5CE1A 3LOXA 3BIUH 1K1NA 6GCHG 3F2FA 2W6ID 1GMCG 3D65E 2GCTC 3TITA 1IQGA 1T4VH 2HNTC 1AE5A 1MKXH 4Y11E 2XOKD 4OGXA 2BDHA 2BLVA 3TJNA 2OTVA 3HGNA 2THFB 4TY6A 5A0AE 1GJ9B 1CT0E 1AMHA 3ZVFA 1AU8A 3A8BA 1O5AB 3PV5A 3RXFA 1TPOA 1LO6A 3I29A 3TLOA 5FAHA 2F9PA 1QL8A 3P92A 3MNCA 2F9VA 3ODFA 1DWCH 3BN9A 3F6UH 2J9NA 3ELAH 1C5WB 1ZJKA 2XC5A 4DGJA 5C0UA 1PQ8A 1SLVB 2PP6A 2ZEBA 3A7TA 4GAWA 2ZCLP 2BY6X 1ETRH 1GHXH 1HIAB 4INHA 2J95A 5L2YH 4X2YA 1BRBE 3LGWA 1GG6B 1HAYB 4X0WU 1BJUA 1O3CA 5ETXA 1LHFH 3ODDA 1DITH 2A4OA 2ALPA 2HLDD 1IQJA 1P3EA 1YPLH 1V2NT 2GZ7A 1HDTH 2XC0A 2OLGA 5HIYA 1RTFB 3D62A 2QIQA 1DUAA 4Y8YA 2VVCA 3RXUA 1DLKB 4J2YB 4ZCNA 2AS9A 6CHAB 1WU1A 3ZZDA 1HJ8A 3DT0H 4Y7AA 5JDUB 1NBME 1EZXC 4X6OA 2IN2A 3KQEA 2ZHDA 2FX4A 2NU3E 5GCHF 2JETC 2Z7FE 2KCYA 1WAYB 3N7EA 4PROA 3FFGA 4I8LA 2RA3A 2ANWA 2BD5A 4Q63A 2ZU4A 4CR5A 4HZHA 1LPKB 3E0NB 3A8DA 1V2MT 3FVFB 1L1JA 3DUXH 1UTJA 1SQOA 5L30H 3O8CA 3SYJA 1O5CB 1DUEA 2WPDD 4E7RG 2Z9LA 1KTTB 3GCTG 1ZGVA 1AWFH 5C67A 4Y7BA 2PFEA 4KGAA 5DO4H 1KDQA 2GP9B 1P9UA 1O37A 1PJPA 2HWLB 2FPZA 5FBIA 1AFQC 1SFQB 3F68H 1F0RA 4YXWD 1GL1A 2F9UA 3SUFA 2R0LA 2A4RA 1HBTH 1Y5BT 3RU4E 3A7VA 4FVBA 1AD8H 2QV1A 1LVOA 2QF0A 1QNJA 1NFUA 2QXGA 1QB1A 1T31A 1AFEH 4LOYH 2J97A 1ABJH 1TGCA 1F2SE 1JIMA 3DSGA 1HJAB 2UWLA 1TGNA 1AI8H 1K0HA 4ISHH 3P95A 4F49A 1UMAH 2FX6A 2FTLE 1RGQA 1K1JA 2UUJB 2EQNA 4GCHF 7ESTE 3LH1A 4ISOA 1FNIA 1K1OA 1TNKA 1W14U 2IJD1 2V3MA 3H5CB 1LCYA 1YBWA 1MTUA 2R2WU 1BTYA 2AGIX 1DFPA 4K3JA 1ANDA 4DVAU 2VJ1A 4BTUB 1YCPH 2ANMH 3RXAA 3QX5H 4O03A 2WSSD 4WVPE 2XWAA 4O9VA 1L2EA 3KHVA 3MO9A 2BY7X 1QIXB 3LGUA 1S0RA 2ZCKP 2HVYB 3FP7E 4CRCA 4D76A 1SKYE 1FAKH 2CXVA 4NWLA 4YLQH 2VINA 4NWKA 2AYWA 2V35A 1AUTC 2G00A 1SLXB 3T27A 2GZ9A 2P3FH 1CVWH 3ATKA 2H9EH 3ZV9A 5CHBA 4INLA 1CGHA 3A89A 1BTUA 4B2BA 1AB9B 1F0TA 5HYOA 1V2QT 1RIWB 3L33A 5G4BA 3MU0A 3QGNB 1IOEA 4TPIZ 1X7AC 3VG8A 1AIXH 1GI7B 2F9NA 2GT7A 1CHOF 3KQCA 2ZTYA 5EU8A 5HIZA 2VB0A 1UTPA 4I31A 1O2UA 4K1SA 1YLNA 1KIGH 4HG6A 1ZSKA 2Q6FA 2FMJA 1S85A 1W0YH 3GDSA 5TCCA 3UNQA 2IJOB 4D7GA 1GJ8B 3LKWA 4Y0YE 3OE7D 3M7QA 4NFFA 2NU0E 2LELA 1O3AA 5H4IB 2QYIA 1QB9A 4DIIH 4VGCC 3S69A 4I8KA 1C5XB 5DP8A 3SQEE 1T4UH 2AMPA 2F43B 2O8MA 1LDTT 2ZGHA 1S84A 1SGEE 4ZHAA 3OYPA 2DE8A 2BB4A 1FN8A 1C2DA 3SORA 2WHXA 2ZPRA 4HI3A 1FI8A 5F8TA 2AGEX 2G5NA 4JK5A 1BBRH 1FZZA 3NCLA 4ISIH 5FCRA 2KM0A 4D9QA 1BA8B 1Y3XA 1AWHB 3ENSB 3O8DA 4CRFA 2PLXA 2Z3EA 1GBMA 1MZAA 1O2TA 1TBRH 4KP0A 3MTYA 3RXBA 2M5TA 1C5MD 1V2TT 4X2WA 3RMMH 1WSSH 4I8HA 4D7FA 3GDVA 1QFKH 2XRCA 2BOHB 1DM4B 1AN1E 1NU9A 2OQUA 2SFAA 1QRXA 2FOGA 4YTAA 3T25A 4A6LA 2HPQH 3KEEA 2CF8H 3N99A 4ESTE 1VITH 3GY5A 2K8IA 1GJ7B 1SQTA 1SGIB 2V7QD 2KX4A 4CR9A 1S81A 5GIBA 1B7XB 1TGBA 1NY22 1PFXC 1UTKA 1TONA 4CHAC 2VGCB 2FP7B 1GJ5H 3VB7A 1GI0A 1OPHB 1SBWA 2A5IA 3DD2H 1UTNA 5HGGA 3T5FH 1DSUA 1HAHH 4B1TA 4Y8XA 4Y71A 1P2JA 1BTWA 5EQSA 5I46H 1F5RA 5A0BA 1FDPA 3VXFH 3F9GA 1DY8A 1Y8TA 4ABJA 4D8NA 3E0PB 2M2AA 3U28C 1NRNH 1SL3A 1GBBA 3PTNA 1ZHMA 2J38A 1XXFA 3QGJA 1SI5H 4X8SH 3V0XA 2OQ5A 4X2XA 2OC1A 2FZZA 4CRGA 3TGKE 1DS2E 2Z9GA 3A86A 1GI4A 2JETB 1ELTA 2ZP0H 3SBKA 1A7SA 2FOEA 4RSPA 3WY8A 1SR5C 2Y6TA 3F9HA 2GVFA 4MDSA 1P2KA 1FLEE 8GCHF 5F53A 2ZTXA 2QXIA 2PTNA 1G30B 4KTSA 5J4QA 1SVPA 2CGAA 3TJOA 4BAKB 1EAWA 1K1LA 3M7UA 1FMGA 1WCZA 3U9AH 1LQEA 3MMGA 1A5GH 2BDCA 5EJ1A 4XBCA 2Y81A 2B7DH 2XC4A 1L0ZA 1SQAA 1OYQA 3KYGA 4B2CA 2BDAA 4NIWA 2EEKA 5AFZH 1MQ5A 6GCHF 1GVLA 1PPGE 4MNWA 2OINA 2FS8A 5JBTA 4E05H 4AORA 5T6GA 2Y82A 4X8VH 3K65B 3RXHA 1O39A 3SUDA 1FONA 5C3NA 1XUGA 1GBLA 4VGCB 3ZZ4A 1V2UT 1B0EA 2ODPA 1O3PB 4A7IB 5EQQA 4AFUA 5LPRA 3O8RA 1FUJA 4MLFB 1SGQE 1AGJA
chains in the Genus database with same CATH topology
1HAGE 4K2YA 1L1GA 2GDEH 5DGJA 3U1JB 4OS6A 2FLRH 4A1VA 1M9UA 1MD8A 2F83A 5FBEA 4GLYA 2QXHA 2FI4E 2STAE 1AFQB 1JXPA 2HNTE 2PGBB 1TPAE 1V2WT 1QQUA 1UVOA 3W95A 3VB3A 3ZV8A 3MU5A 2XW9A 4BNRA 5EQRA 1UO6A 2C93B 4X1QU 1SGFG 1BMAA 1OP2A 3PO1C 1RTKA 3RXPA 4Q7ZA 2ZIQH 1VGCC 1O5BB 2YOLA 2J94A 1YPHE 2VWOA 1GJCB 1XMNB 1V2OT 2GDDA 1WQSA 2Z9IA 1PPHE 2VH6A 5I25A 1BOQA 3DFLA 1VITF 1C1TA 1E34B 1UVSH 4YT6H 2CHAB 3T62A 3MO6A 1SPJA 2ZQ2A 2SGDE 1QBVH 5E0JA 2QCYA 2ASUB 3ZZ7A 1DOJA 2P94A 1L1NA 1LHEH 1HAXB 1Y5UT 4A92A 2BXUH 3KGPA 1EUFA 1BBRK 1UTQA 1YYY1 5EPYA 1GI6A 2H2ZA 2QF3A 3PTBA 1BMMH 2AERH 1C2EA 1SGCA 1O3LA 3IITA 1SLWB 1TMUH 3MFJA 4X1PU 1P03A 5AF9H 4WMDA 1TQ7B 1O5GH 1O2NA 3GYMA 2WPHS 1GBKA 1TPSA 3MHWU 4RKJB 3SJOA 5C1UA 1EJAA 1QBOA 2ZFPH 1NFWA 4O97A 2XBWA 1C5PA 1MAYA 2C90B 7GCHF 3E6PH 3LJOA 3TH4H 1LHCH 1ETTH 3KCGH 2ZDAH 4K60A 1BMNH 1QGFA 2ZDLA 5ABWA 3ZZAA 1HFDA 3Q3YA 2CV3A 2BD9A 2GMTC 3TK6A 1DT2A 1QHRB 3BTDE 2BY5X 1EX3A 3M5MA 2FOHA 1H9IE 2FM2A 1PPCE 1ANBA 1Q2WA 3A81A 5DP7A 5FCKA 4IC5A 3SNBA 1BHXF 2R2MB 5CHAB 3QK1A 2BQ6B 3TNTA 2A7HA 3E91A 3FP6E 4CBOA 2WPJS 3SUEA 1GMCF 1MTNC 2ZCHP 2IPHA 3A85A 3MNSA 1OWEA 3RXCA 3SGQE 1V2ST 2VWMA 4H6SB 1IQNA 1AZ8A 5TCAA 1N1LA 1NPMA 4I8GA 1SGTA 2ZHQH 3HPTB 3V7TA 1T8OA 1V2KT 3SNEA 9LPRA 1LPGB 5GCHG 3K9XB 4MNVA 1DY9A 4CREA 1IQLA 1XKBC 1YCPK 2FXRA 1NN6A 1GVZA 1LHDH 2WV4A 4ZXYH 1ZRBA 4DY7B 2AMQA 3GY2A 4GUXA 3BTGE 2H9TH 3GY4A 1CBWC 1CT4E 1ZSJA 2BDBA 4WXIA 8GCHG 2IOTA 5BRRE 2ZFTA 3P8FA 3SNAA 1BDAA 4K69A 1GDUA 4AB8A 1Z8IB 1MKXK 1EP5A 2XCNA 1NRQH 2FI3E 2XBVA 3ZYDA 3ZVGA 4UFDH 4MQAA 5C1YA 1DICA 1Y59T 5AHGH 4XBDA 4Y76A 1N6YA 2Z9JA 2ZHWH 1UK4A 1TFXA 4D9RA 4B76A 5LPEA 1QR3E 2ZDMA 1DE7H 3FZZA 3QTVH 4B75A 4HGCA 5C20A 1P2OA 2FOAA 1MCVA 4AYYB 2TGPZ 3O8BA 1ELCA 1J14A 4CHAB 1TPPA 1BB0B 2I6SA 1K1MA 1Y3VA 2FEQH 4K8BA 4FUIA 5FX6A 2A31A 1P04A 4ZROA 2FTMA 1AO5A 2FI5E 4NA9H 1OP8A 5FXLA 2BTCE 1T8MA 1OYTH 2LNCA 3B9FH 4K1EA 4INKA 4GCHG 5K7RA 1C1RA 4MVNA 1ANCA 4KTCA 2PKSC 4O3TA 4I8JA 2PHBA 2EC9H 1W13U 4FU8A 1SGPE 2OD3B 2FOFA 1EQ9A 1AKSB 4IW4E 1IQHA 1ESAA 4ABDA 1YKTA 2D2DA 3A8CA 3GCNA 1IQKA 2TIOA 4RKOB 4WH8A 1EATA 2YNBA 3ATMA 3DHKH 4AB9A 2BD8A 1EKBB 1RS0A 2ESTE 2FS9A 1HAOH 4U01A 4DT7B 2Z94A 3GDUA 1QRWA 4YOJA 3MU1A 3KIDU 3RXJA 1GGDB 4ISLA 2Z6BD 2V3OH 1TMTH 1H9LB 1TNJA 1Z7KA 1YC0A 4BAQB 4DW2U 1YM0A 3UFAA 1FQ3A 2ZDKA 1MUEB 4X1RU 3OY6U 1TOCB 1F5KU 4OS2A 1OWDA 2PW8H 2PWXA 4UONA 3SQHE 4UFGH 3IWMA 3SUGA 3KF2A 2P3UB 2HOBA 1ZRKA 1QURH 4AN7A 4X1SU 2ODYB 3MNXA 3SW2B 4OS4A 1S82A 4DG4A 5K0HA 1CGJE 1GHBG 4FUFA 1D3TB 4WWYA 3UWIA 3SI4H 1P06A 3ATWA 3KQDA 4TY7A 2TBSA 1QA7A 4KKDA 3SU4A 1TRYA 3NZIA 2KAIA 3PMBB 1H8DH 5EW2H 1AE8H 1CHOG 4BXSA 3UQVA 4RN6A 4AYVB 1GJBB 3A7YA 1C2LA 3LDXH 1ARCA 3M36A 1K22H 3RXKA 4B2AA 1VZQH 3RXRA 3U8TH 2GGVB 2HALA 3QZQA 1O2SA 4ZXXH 1O3HA 5LH8A 1K2I1 4AG2A 3A7ZA 1BTPA 1S5SA 1V2PT 1EJNA 5PTPA 1G2MA 1ZLRA 4DIHH 4LZ4B 3ZZBA 1O2XA 2UUKB 4YT7H 5EW1H 2P93A 1HJ9A 1MMJN 4NSVA 1HNEE 3PLPA 1BUIA 1ZR0A 1J15A 1C1OA 2BOKA 4ABEA 1P8VC 3HATH 1QY6A 3NPSA 3SJ9A 3C27B 2SGQE 1OSSA 3M3VA 3P17H 1KXFA 4WMEA 3QO6A 1BITA 4R0IA 3TPIZ 2A1DB 2ZI2H 2VVUA 1O2RA 5JBBS 2AH4X 1TRNA 3Q77A 1XUIA 3UUZA 1FY4A 1QTFA 1AQ7A 4Y8ZA 1ELDE 3SHCH 4YM9A 1OOKB 2GCTB 2ZFSA 3M3SA 1P10A 1O2JA 1GI2A 1FJSA 3SI3H 1KDQB 1BT7A 1P57B 1LMWB 1THPB 2UWPA 4ZHLU 3UIRA 3ZVDA 4J1YA 2JH5D 1BZXE 2BYAX 4BTIB 1E36B 1HPGA 2RG3A 4E7NA 1DWDH 1GCDA 1RRKA 3OY5U 4JZDH 4ZKOU 3KQBA 8KME2 4JYTA 2WPLS 1UVPA 1LQDB 1TOMH 1FY5A 3T28A 3A7WA 5J4SA 2VH0A 1DANH 5GXPA 1INCA 2ZGBH 1QA0A 1XXDA 2OC0A 2AIPA 1NRPH 3LT3A 1O2YA 1NFXA 5JB8S 2A0QB 1CA0C 2Q6GA 4AOQA 4XE4A 2ZFQH 1UJ1A 3R0FA 2GT8A 3S0NA 1ZPBA 2H9HA 2VIDA 2BVXH 2RA0A 1THSH 1Z71A 2AIQA 2R0KA 1CBWB 1H9HE 5A2MH 1OWKA 2TPIZ 2C8ZB 4M7GA 1GI5A 2FDAA 3UR9A 5CHAC 5T6FA 3SHAH 3S7HB 2AGGX 5A09A 1CSOE 1GVKB 1WTGH 2WPKS 7KMEH 3TGIE 1MTNB 3QTOH 3I77A 1C5UA 3AVZA 2OXSA 1P01A 2ZPSA 1CO7E 1YLDA 1DXWA 4B73A 3BEIB 4FU9A 1C5TA 4MPWA 3PROA 1NO9H 1KYNA 2XTTB 4Z0KA 1RTLA 3A7XA 1G36A 1GJAB 1KLJH 1NROH 1PYTD 3LIWA 1O3FA 2NU2E 2OP9A 1YCPM 3I78A 3FAOA 4IGDA 4Z6AH 1UCYH 9ESTA 1GDNA 4GSOA 2P8OB 5TJXA 1SMFE 3CS7A 2ANYA 4I32A 4IC6A 1Z8RA 2ZO3H 1A1RA 3E1XB 1O2HA 4FUHA 3SU3A 3K6YA 1ORFA 1QBNA 1C1PA 1T32A 1XUJA 5GJ4B 1O3BA 1KY9A 4X1NU 1ZTLA 4THNH 1GBTA 3GY8A 2J92A 3VB6A 1JIRA 1FAXA 1B5GH 5BPEA 1XM1A 4SGBE 3SO3A 1K9OE 3GCTF 5EOKA 3TIUA 3MH4A 4AGKA 3QUMP 2CJIA 1TBQH 1Q3XA 1GBDA 2BX4A 1CQQA 1EZQA 1F0UA 4UD9H 2G52A 2BY9X 2BD2A 3TNSA 1GBFA 1HJAC 1A3BH 3GCHB 1DX5M 1HAIH 1FV9A 4Y0ZE 3BG8A 3ZVEA 4LXBH 3SU0A 2VIWA 4MNYA 4I7YH 3M35A 1C1MA 3SJKA 1UK2A 1HRTH 1QCPA 1QJ6B 1TNLA 3PMAB 2G81E 1S6FA 3RP2A 1SOZA 2TGAA 1LVMA 1TE0A 4CRAA 1VCPA 3SZNA 5DP4A 4LZ1H 1W7GH 1MKWH 1P11E 2FESH 2UWOA 2CMYA 4JK6A 1TAWA 1LTOA 2BXTH 2R3UA 3OX7U 4FUJA 1FY3A 1F7ZA 5DG6A 2ZU5A 4U30A 3T26A 3EGKH 3RUOA 1SGDE 4CBNA 1C4Y2 2ZDNA 3MWIU 4FUGA 3CP7A 3DA9B 1AVXA 3AAVA 1L4DA 3UPEA 4B71A 4JZIA 1XUKA 5ESTE 5F03A 5F8ZA 2O8WA 4JZ1A 1WQVH 3AW0A 1P2NA 1SGFA 1YGCH 1GHZA 1SLUB 2VWLA 5SGAE 2QY0B 2AMDA 2WPMS 1TA2A 1MU8B 5ESBA 4IMZA 2SNWA 5JB9S 1C1SA 4R8TB 3RU4T 2O8UA 3MH5A 2QA9E 1HAVA 1QRZA 2Z9KA 1Y3YA 2A7CA 1QQ4A 2ZTZA 1O3KA 1G37A 1P12E 1GL0E 2A5KA 3UREA 1UK3A 1O30A 2XNIA 3RXQA 4A1XA 5FX5A 2BMGB 1YPMH 1O2PA 2Y7ZA 3RMOH 1BTXA 1ELVA 5A8ZA 1KXCA 3UWJH 4ZAEA 1S6HA 2R9PA 1C5VA 2ZWLH 5F8XA 4TWWA 2GD4B 1CT2E 2WINI 1O2KA 2EA3A 1UCYE 4ASHA 1FIZA 3NUMA 4JYVH 2EI8A 3RXIA 1NC6A 3A80A 4ABGA 3LJJA 2ZQ1A 2DE9A 1WBGB 5C5NA 1E35B 1ZPZA 4O3UA 1BTZA 3B8JA 3RXLA 4WY3A 3U98H 1HUTH 4CH2B 1Y3UA 5C1XA 2BHGA 2GX4A 1SC8U 2GV6A 2BQ7B 1EPTC 1C2GA 2P59A 3Q76A 2QN5T 1C1WH 1GMHF 3SJ8A 4GPGA 1W0ZU 1NT1A 1EP6A 1GI1A 3SNDA 3K2UA 4FU7A 1C5QA 2OBOA 1H4WA 3BTQE 2Z3CA 1JOUB 5EGMA 1BBRE 3T2NA 1GHBF 1IQIA 1JRTA 1PQ7A 2D26C 1MQ6A 1AUJA 1JRSA 1OXGA 6ESTA 1CHGA 3GISB 3C1KA 1AZZA 3VB5A 3ZZ3A 1C2IA 4A1TA 1MTVA 1ZTJA 5E2OA 2JH6D 3RM0H 1P2QA 2FOBA 3GY7A 4NA8A 2BD4A 4Y10E 5C5OA 3MI4A 3LONA 1EAXA 1BCUH 2ZA5A 1EOJA 1OWJA 2ZPQA 3RM2H 2ZHFH 4CRBA 3SV8A 2ZDVH 1ZHPA 3S9CA 8LPRA 1A4WH 3A8AA 5HXFA 2FO9A 1Z8JB 2XWBI 3MOCA 1IAUA 1O3NA 3SU2A 3BV9B 2FYQA 5DP3A 3MH6A 1VGCB 1VR1H 1GHYH 1Z8GA 2HPPH 2VIPA 1V2JT 3LPRA 5FPYA 3BTHE 2J4IA 1GI8B 2BVSH 3EA9A 1PPFE 2H1UA 3RLYH 2CN0H 3D49H 2FIRH 5DJ7A 1WYKA 1D6RA 5JBAS 4IN1A 4UFEH 4FUDA 1O5FH 1GJ6A 1U6QA 2ZU3A 2PR3A 3TJVA 2B8OH 3KN2A 3FZDA 2H5DA 1C4U2 1C5RA 2G4UA 2Q1JA 4ABAA 4JZEH 2G8TA 1IQMA 4NIXA 1SHHB 5LGOA 3KL6A 4ISNA 1GBAA 2ZHEH 1DDJA 1B0FA 1EZUC 2QC2A 3HKJB 3PLBA 3UOPA 3QLPH 4YESB 3MO3A 1MKWK 3LGYA 2GTBA 5E2PA 4YZUA 2A4QA 2HGTH 2I6QA 3FANA 1XUFA 1PQ5A 1TALA 2FLBH 3R3GB 1SGYE 2ULLA 2BM2A 1KTSB 4ZHMU 4OGYA 3OU0A 4WXVA 3GCOA 3BEUA 3GOVB 2XBXA 5C2ZA 1O3EA 1NM6A 4X8TH 3UY9A 5A8YA 4ZUHA 2TGDA 2H5CA 5EPNA 1ZMNA 4IS5A 3BTKE 4U32A 3RXTA 1C5SA 2ZFRH 4WH6A 1EPTA 2WYGA 1LKBA 3SU5A 2A4GA 3ESTA 1Y5AT 1NS3A 4ZKRU 4HFPB 3K6ZA 4TPYA 1C2MA 3GYLB 1W7XH 3BTTE 3L3TA 4MTBA 1S0QA 1MH0A 1NTPA 1O36A 1QJ7B 3RXOA 1EB2A 4NCYA 1VCWA 1EAUA 3BSQA 1OS8A 1V6DA 5JBCS 4AZ2B 1TGSZ 3TJUA 1WOFA 1MBQA 1UTMA 1C5YB 3NXPA 4ZMAH 3E90B 3ZZ8A 2SGFE 3PO1B 1O3GA 2BQWB 1GMDF 2VNTA 4U2WA 3T29A 3SV9A 1E37B 5AVDA 1A5HA 1P9SA 3AASA 2SNVA 1HB0B 2FODA 4NZLA 2CHAC 1GPZA 2JKHA 3EYDA 1A46H 2ZG0H 1V2VT 3VXEH 1XX9A 2V0BA 1K21H 3EA8A 1ZGIA 3QZRA 2BDGA 2ILNA 3V3MA 3U69H 1Z6JH 1ETSH 1O2MA 1W2KH 1AVGH 1C5ZB 3LGIA 5EXNA 3EA7A 3Q3KA 1OP0A 2ZKSA 2LPRA 1A0LA 3URDA 1TX7A 3EDXB 1W10U 3BF6H 3RLWH 1SOTA 1Y3WA 1IQEA 7GCHG 1LPZB 1T7CA 1EASA 2H6MA 3A88A 3HK3B 3E3TA 4UE7H 3MNBA 1NZQH 1BRUP 3U8RH 3A83A 2SGPE 3VFEA 1HXFH 1K1PA 1UTOA 1E0FD 1GMDG 2O8TA 2PTCE 1HAZB 1GI3A 1YPHC 3MU8A 4X2VA 3UNRA 2O8LA 2CF9H 2VU8E 4AG1A 3SV2H 2TRMA 2PSXA 3VEQB 2BZ6H 1TBZH 2PV9B 4TYDA 2HRVA 4NFEA 2XCFA 1KXAA 3PB1E 1AY6H 1HAPH 3PMJA 2C3SA 4YLUA 2BDYA 3Q3XA 1YLCA 3BTME 1RFNA 1V2RT 2ZECA 2FOMB 2Y7XA 1TA6A 4FUCA 1UCYK 2Z3DA 1G3DA 2QGRA 1HV7A 1C1VH 4F4OC 4XBBA 1H1BA 2ZZUH 3RDZA 3NK8A 3ZZ6A 1A0HB 3UNSA 1ANEA 2F9BH