1O2YA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2yA02
3A7ZA 3RXJA 1ZGVA 4X2VA 4XFQA 1HXFH 4K1EA 3RU4T 3KL6A 3JZ2B 4TWWA 1OYQA 1W11U 3EA8A 4X6MA 1EAWA 1DM4B 3S0NA 2FLRH 2J38A 1KXAA 2QXHA 2ZWLH 1N6XA 1G9IE 3L3TA 3A7YA 2AS9A 2STAE 3GCHC 4ZKOU 1KLIH 3K65B 3GICB 3STIA 1AVWA 1MTNB 1CHOF 2G5NA 2C90B 2F91A 2AYWA 1W0ZU 4IC5A 2W7UA 1UHBA 1O2IA 1A46H 3SGQE 1BA8B 5F8ZA 3CS0A 4Y0ZE 2GDEH 2BOKA 3PLPA 2ZP0H 2GMTB 5PTPA 2B7DH 1OYTH 2FZZA 1AD8H 3MO6A 1P2IA 1L4DA 1ZLRA 2OC1A 1GHAG 1EPTC 3SN8A 3ELAH 3NXPA 1A3BH 1Z71A 1A5GH 3D49H 1V2JT 2R9PA 1Y5BT 4K2YA 5DPAA 1LO6A 1C5ZB 2BVSH 1MKXK 2QN5T 1QA7A 5HXFA 2FI3E 2UWPA 5TCCA 3FP7E 1PYTD 2VWOA 2ILNA 3SUGA 1THPB 3TGKE 3Q00A 4BNRA 1C2MA 2BQ7B 2Q1JA 1UTPA 1NRRH 2QC2A 1BB0B 4CR5A 1JMOH 3TJVA 4A5TS 3HGPA 2XWBI 1C1QA 5DP9A 1LHCH 3ZVDA 5DP6A 1KTSB 3VGCC 1W10U 3ATMA 3S69A 1DS2E 4UE7H 2A4OA 2G4TA 1P12E 1G3BA 4FUCA 5ABWA 1NRSH 3F9GA 1O5CB 2VIOA 2ZFQH 1D3DB 1EAUA 2GGVB 4CR9A 1ESAA 4E06H 2BD7A 2GZ8A 2XC0A 3M5LA 1FY5A 1OWDA 4NFEA 3S9BA 1GPZA 3QTOH 2TRMA 3D65E 5EXLA 3QZRA 1EJNA 3E16B 4ZKSU 1HRTH 4NSYA 2ZFTA 1SGFA 4D9RA 1GVZA 1GI0A 4Q7ZA 2FYQA 1HJ9A 1V2RT 1P01A 2VIQA 1ELGA 3RMNH 3F6UH 5JBTA 2ZIQH 3T26A 4B2AA 3KQCA 2SGEE 3BG4C 1EOLA 1JXPA 2A45B 1CGHA 1SLXB 1V2VT 1FAXA 3LGVA 1EASA 1PPGE 4YT6H 2Q6DA 4ISIH 4ZMAH 1D9IA 1G3EA 2ODYB 3KIDU 1Q31A 1O34A 2ZPQA 1ZPBA 3TNTA 1PPBH 1TNKA 5DG6A 2G8TA 2FI4E 1FY1A 1GBKA 1O2LA 4CRDA 4GCHG 1UHBB 1DSTA 2O9QA 1VGCB 2Z9KA 3UY9A 3B9FH 1WYKA 1F5RA 1CBWC 1IAUA 3TGJE 3P17H 4WXIA 1C1RA 2HPPH 5L2ZH 4NIWA 1FPCH 1YPGH 1GGDC 4D7FA 3SJOA 3BIUH 4JYUH 3P95A 4I31A 3SU0A 1QQ4A 4Y8XA 3PO1C 1O2OA 1GBDA 2ZGCA 2ZGHA 4X8UH 1ZHMA 1GHBF 5ESTE 1EJMA 1NY22 1D4PB 2BOHB 2ZG0H 5LPRA 1CHOG 1HAIH 3E0NB 1BTUA 3M3TA 3A8DA 3LGIA 1BCUH 3RLYH 4E05H 1HIAB 1VITF 4AYVB 4OS5A 3U1IB 3QTVH 1HDTH 4WMDA 2H1UA 3UQVA 1GI9B 1Z7KA 4BAQB 2HNTE 4AN7A 4BTTB 3PB1E 1TQ7B 1SGCA 1O2MA 3A89A 1DXWA 3UNRA 2QA9E 2C93B 4YTAA 1EB2A 1GBBA 3ZYEA 2HNTC 2BD4A 1ZYOA 1ANDA 1HBTH 4O03A 3RXPA 2GCHG 4A7IB 1D3TB 4ZKRU 2ZC9H 5GXPA 2HGTH 3ZZ9A 4DCDA 1CGJE 3BTEE 4Q7YA 1J15A 3F68H 2OD3B 3RXMA 8ESTE 4Y8YA 3BTQE 2I6SA 3K2UA 3UWJH 4H6TA 1G37A 1Z8RA 4F49A 3VB5A 4CRGA 3LJJA 1Y8TA 3RMOH 1QCPA 1WAYB 1GJ4H 3SORA 4AGJA 1FIWA 2VIWA 4X1PU 3RXVA 1PQ7A 1EZSC 2O8MA 3BG8A 4ISNA 4OS2A 1BRCE 2FOHA 1TBQH 3GCHB 1A5IA 2ZU2A 3GYLB 3A8AA 5JBCS 2GV7A 1GVKB 1IQHA 1GDQA 1D6WA 4YOJA 4B75A 2EI8A 4JMYA 4UFGH 1H8IH 5EGMA 1GHVH 3TNSA 3RUOA 4AFZA 3Q3KA 1Z8IB 2ANWA 2BTCE 4Y8ZA 5GDSH 2TIOA 2BLQA 2ZTZA 1IQGA 1UTKA 3QN7A 1BBRK 1YLCA 3RMLH 2F9BH 3B23B 1V6DA 1HAXB 5HM9A 3PMAB 2QF0A 1S81A 1AQ7A 2A5AA 2D1JA 1A0JA 2FM2A 4ABIA 1NU9A 4KGAA 1ELAA 4KTCA 5LH8A 2P3TB 1EPTB 1W2KH 1O3MA 1NROH 3AVZA 3FP6E 3SQEE 2P95A 4ABHA 1B7XB 3DFLA 5CE1A 2P94A 1UK4A 3F9HA 1BTWA 2FOFA 3TJUA 2Z3EA 1DLKB 2XWAA 1EX3A 3UTUH 1A1RA 1W8BH 3BTFE 3U1JB 2Z6BD 5EQRA 5HM2A 1KTTB 3RM0H 1XVMA 1IQJA 2FPZA 2BM2A 1EKBB 3GISB 5BRRE 1F0RA 3A83A 2PSXA 2WUBA 1QB1A 1K21H 1YGCH 1MZAA 1T4UH 1S82A 2B0FA 3ESTA 5BPEA 1RS0A 2Z3DA 3VGCB 2Z9LA 1GJ7B 4CBOA 3Q3YA 3RXSA 2BD8A 4B74A 1O3AA 3R0FA 3CS7A 4ISOA 2Y81A 1QBOA 2FO9A 3STJA 4YLUA 2F9PA 4U2WA 3MI4A 1SFQB 3QLPH 1SMFE 1WCZA 1ZHRA 4GHTA 2F83A 2YNAA 1DDJA 3M7TA 1O3EA 4XBBA 1SGIB 3NWUA 2A4GA 4Y7BA 5FBEA 2BY5X 4IMQA 3URCA 1P03A 2VB0A 2ZZUH 1ELBA 3BSQA 3UNSA 1UVUH 5EXMA 2RA3A 5EOKA 1UO6A 2Z7FE 2LNCA 4AOQA 1SHHB 3ENSB 1GHBG 1SI5H 4AX9H 3K9XB 2VWMA 1O2GH 2AMDA 1AHTH 3LDXH 4ZXXH 1CO7E 3BG4B 3P92A 3HK6B 1AE5A 4K1SA 1SQTA 5F8TA 2AIQA 2WUCA 2PWXA 2BZ6H 1GJ5H 1SGRE 2NU0E 2OBQA 1KXCA 4X8TH 4X2XA 2GTBA 1JWTA 1AKSB 3MYWA 3T62A 3FAOA 2FX6A 3HGNA 2R0LA 3V3MA 3MO9A 1C1OA 1QR3E 5ESBA 3T25A 4CH8B 2GV6A 3A85A 2VJ1A 1OKXA 3ODFA 2KAIA 3U8RH 1N6YA 1LCYA 2ZDVH 1QURH 2Y7ZA 1LHDH 1NTPA 4ABJA 2STBE 3M61U 1CBWB 3TU7H 1ZTLA 3MFJA 3SGBE 3ZVFA 3PLKA 2R3YA 1OWIA 2AGIX 1GGDB 2AGGX 2GX4A 2GCTC 1GI6A 3KNXA 5FPYA 4YOIA 3B8JA 3NPSA 1RTLA 4INHA 2Y7XA 4O3UA 1DITH 3PO1B 4O3TA 5I25A 1LHGH 1NPMA 2ZGBH 1YPHE 3M3SA 1ZTJA 4FUGA 4JYTA 3Q77A 3SU4A 1HJAC 1JIRA 2WV4A 1GL0E 2PUXB 4TWYA 1UTLM 1EATA 4J2YB 1MD7A 2QCYA 1CA8B 3AW1A 1T7CA 3LH1A 1YPHC 2PW8H 2Z9GA 1O32A 4Q80A 1EQ9A 5C5OA 1RTFB 2VH0A 1UVSH 3QX5H 4B76A 2G00A 2BD3A 4BXWA 5J4QA 4OS1A 2W26A 4I8HA 2PTCE 4CH2B 2G81E 2ZHQH 1A61H 2J92A 4I33A 3MU5A 1OWEA 9ESTA 2ZGXH 3BTGE 3UR9A 1CQQA 3W94A 2A7CA 4A1TA 1T8LA 4E7RG 2FDAA 1RD3B 4Y0YE 1DUAA 1OP8A 1Q3XA 1O5GH 5FPSA 4TPYA 5H4IB 1GVLA 4I8KA 1P9SA 1T32A 2ALVA 3UOPA 5AHGH 2R2MB 4MDSA 3AASA 1K1LA 1LKBA 3OYPA 3P8FA 1T8OA 4TY7A 2FS8A 1YC0A 2GDDA 2F9VA 2AGEX 1KDQB 2P8OC 3F9FA 1RJXB 3LGUA 2M5TA 3SU1A 3LC3A 2XBYA 1O2NA 4DURA 1O2TA 1VCQA 2O8LA 4K3JA 3LT3A 2FLBH 3VXFH 5JBAS 3ZZ4A 3MU4A 3NZIA 3SU2A 1C5OH 3KCGH 3TGIE 3FFGA 1LPKB 2P3UB 5C1UA 1IQEA 1BZXE 1L4ZA 5A0BA 2FOBA 2ZDLA 3KN2A 3SOSA 1ETTH 2BD5A 2XCNA 1ESTA 3BF6H 4MVNA 1O31A 1EOJA 1P2NA 2QYIA 2KAIB 3CP7A 5GCHF 4B71A 3MTYA 2FP7B 1VZQH 3T28A 3ATKA 5HYOA 1O0DH 1NRNH 1GI8B 1AB9B 3ZZ8A 4K8BA 3ZVGA 1IHTH 2ZU5A 2A1DB 2NWNA 1O3DA 1YM0A 1YPEH 2A0QB 1PJPA 5DK1A 4HZHA 7GCHG 2BHGA 2TGTA 5FXLA 1RXPA 2J2UA 4IN2A 1BQYA 2ZFPH 1BHXF 2Y80A 1WTHD 2AEIH 3MH4A 2H6MA 1NM6A 1SL3A 2IPHA 2NU2E 4B1TA 1HXEH 1P3EA 2WPLS 3NKKA 3PMHB 3SU5A 1LVOA 1TNGA 2H2ZA 4CHAC 1BRBE 1SFIA 3ITIA 1NC6A 1W13U 1XM1A 1TRYA 5JB8S 5IDKA 3O8RA 1O5AB 2AIPA 3LGYA 1E38B 1E35B 1G3CA 2EEKA 3HATH 3QGJA 1N8OC 1P2JA 2ZCLP 1SR5C 5EQSA 2GP9B 3DD2H 1O3FA 1TFXA 1W12U 1QJ7B 3A82A 1HUTH 1GJ9B 1JBUH 4OGYA 1OP2A 2GCHF 1G32B 1FQ3A 4MNXA 2BDBA 4H6SB 5FX6A 3RXKA 3MU0A 2FTMA 1FZZA 4AG2A 1CT0E 2ZTXA 3TPIZ 3R3GB 3VB7A 3NCLA 5EPNA 4XOJA 2IOTA 2ZHFH 4UEHH 2CHAC 3A80A 1SGTA 4JCNA 1UTNA 3HKIB 1DY8A 1HGTH 4U30A 3T5FH 5GJ4B 3E6PH 4FUIA 3EQ0H 5LPEA 1DVAH 2VINA 8GCHG 1NFUA 1YCPH 3V7TA 1JRSA 4LZ1H 1DLEA 1C1UH 4JZEH 4I8LA 2AMPA 3FP8E 1GJBB 1PQ5A 2V0BA 1DWDH 4ISLA 1O5BB 1WOFA 3QUMP 4ABFA 1TPPA 1ELCA 3TK9A 3OY5U 3KQBA 1H1BA 2EI6A 3BEIB 3PMBB 1OP0A 3PWBA 2GCTB 4YLQH 2VVVA 1T8NA 3BTDE 2ZGJA 1BUIA 2BMGB 3JZ1B 4K1TA 3U98H 3EGKH 4O97A 3SUFA 2PKAB 4UDWH 1SGYE 1AUJA 4D9QA 1TNJA 1T4VH 4UFFH 4A6LA 2JETC 3LH3A 7LPRA 2DE8A 1QRWA 1HJAB 5DP8A 5C20A 3OY6U 4NG9H 2D26C 3A7XA 1ACBE 3M36A 1WSSH 3ZZ5A 5A09A 2H9EH 1RIWB 1C9TA 1AIXH 3SJ8A 4O9VA 4CRFA 3A7WA 3RXUA 3UQOA 2ASUB 1C1TA 3ZZ7A 3F1SB 2FODA 1K1OA 4IMZA 1VCWA 5K0HA 2H5DA 4SGBE 1VITH 3QDZB 1OSSA 4HGCA 1K22H 2B9LA 5GCHG 1GBEA 4NA7A 1SB1H 3SNEA 1BTHH 3MO3A 4DGJA 1INCA 4AFQA 1D6RA 1GWAA 2O8TA 2G4UA 2JH6D 3A86A 3FANA 3RC4A 3ZZBA 1D3QB 1K1JA 2H9HA 1ZR0A 1ESBA 1GL1A 1P8VC 1K1IA 1TNIA 4AYYB 3EDXB 3P70B 2Y82A 1C5VA 1T31A 2BDCA 4MNYA 2C3SA 1GMHF 4RN6A 2CXVA 4NSVA 5C3NA 1IQLA 1HJ8A 4NCYA 2H5CA 1CA0C 3I78A 4BAMB 2G55A 1C5NH 1YPLH 1LVYA 1TGSZ 2SGPE 4MPVA 1C5LH 2BDIA 2OBOA 3N7OA 2BLOA 4NIXA 4GUXA 4Y11E 1C5UA 2YOLA 1FY4A 1O2QA 4YO9A 5L2YH 2P8OB 3ATWA 2WPIS 1DWBH 3D23A 1TQ0B 2V3OH 3MU8A 2A32A 5EPYA 3UPEA 1L1GA 4GSOA 5CHAC 3S9AA 2OP9A 1AFQC 4KTSA 2XCFA 4Y79A 2Z9IA 4Z6AH 2P3FH 2ZKSA 1G2MA 1S84A 1BJUA 4ABEA 1O2JA 1FI8A 3L6PA 4LK4A 1DX5M 2ODQA 2A31A 2GKVE 1MU8B 3MNSA 2ZHEH 1DPOA 1TNHA 1K2I1 2ZF0H 2VNTA 3E8LA 1KXDA 3L33A 4M7GA 3RC6A 4FUJA 5DJ7A 3VB3A 1ZZZA 1GBAA 1P11E 5DP5A 1HB0B 4DOQA 1O2XA 1NT1A 1XXFA 1FY8E 1OWJA 3LOXA 4FU7A 1GI7B 1SGDE 1H9IE 1EP6A 2V3HH 3SV8A 3KHVA 1F5KU 1NO9H 1EZUC 3RU4D 1WBGB 2A7JA 1ABIH 5DO4H 1FJSA 5DP4A 3EA9A 2XC4A 1V3XA 1IQKA 1AMHA 4OS7A 3ZZ3A 5JBBS 1IQMA 4X8SH 1XMNB 2F9OA 3SJIA 1O5DH 1LKAA 1C9PA 1XXDA 1J9CH 1O3JA 4CHAB 1LTOA 3O8CA 2OQUA 3RXDA 2CN0H 2WPJS 1V2QT 3SGAE 1P2OA 1GJCB 3ATIA 3SUEA 5E0HA 3KF2A 4AORA 3FZZA 1ZTKA 3MOCA 2AERH 1MQ6A 1TRNA 1QTFA 2OC7A 1FDPA 2ZHDA 3VEQB 4AZ2B 1O3NA 2R3UA 1ABJH 1C2LA 2BD2A 2UUFB 2YNBA 1OX1A 4INKA 2GD4B 3NUMA 4DIIH 3ZV8A 1N8OB 1XUGA 1O3KA 1H8DH 4I7YH 1C1WH 2BDAA 2F3CE 3QO6A 1DFPA 1F2SE 1ZMNA 1BMLA 1NZQH 3OX7U 3ZZAA 4IBLH 3ZZ6A 1H4WA 2C8WB 1GMDF 3SQHE 1GHWH 2UWOA 1TA2A 3HPTB 2QIQA 2ZFFH 2WYGA 4FU9A 3TH3H 2GZ9A 3H5CB 1TGNA 3I29A 1MU6B 2CHAB 1KY9A 2SGDE 3ZVEA 1CSOE 1P10A 1QB9A 3MWIU 4JK5A 1SLWB 3TIUA 1G3DA 4HTCH 1FUJA 3E1XB 4LXBH 1PQ8A 4U01A 4ABBA 5EW1H 3MU1A 1TA6A 3GY5A 5T6FA 3F9EA 5JB9S 1CE5A 2G5VA 2C8XB 5E0GA 3TK5A 1ZRBA 1O37A 2XW9A 5CMXH 1WQVH 3EYDA 2ANYA 1WV7H 3ZZDA 1XUHA 1SPJA 2Y5GA 4UFEH 1DWEH 1MD8A 1FN8A 1J16A 3M3VA 3BTME 3H7TA 2OXSA 1VCPA 1HV7A 3M5NA 1ZJDA 4NFFA 2WYJA 1UK3A 1Z1IA 4WH8A 2W5EA 1GMHG 3E3TA 1DY9A 1ZGIA 4MG3A 2F9UA 4X1RU 2HWLB 3URDA 4NZQA 3ATLA 1SLUB 3GY6A 1RRKA 2ANMH 1FMGA 2ZU1A 1Z6EA 4GPGA 2Q6FA 1ELEE 1MTNC 4NA9H 4ABGA 2VIVA 2QAAA 1TMTH 2ZFRH 3M35A 3MNCA 1A0LA 3E0PB 1P02A 1QQUA 2BY6X 1VJAU 4I8GA 3GCOA 1GJ8B 1LVMA 4TPIZ 1O2HA 2JETB 5A0CA 1KXEA 2J95A 2C4FH 2PKSC 5G4BA 2BXUH 2OTVA 1TPAE 3OTJE 1U6QA 1HAVA 1WU1A 3GY2A 4AB9A 1SQAA 5DP3A 7GCHF 5JYIA 1DICA 4IS5A 2UWLA 4Q7XA 2B8OH 3RXGA 4XDEA 3K6YA 1HAZB 1D3PB 1THRH 1VJ9U 1O3IA 1YKTA 1GJAB 1ZOMA 1H9LB 2FOAA 1E36B 1DUEA 2A2QH 5F03A 1GJ6A 1GI2A 1FXYA 2LPRA 3VPKA 1SG8B 1DSUA 4INLA 5E2OA 3UNQA 2ZDKA 4TY6A 2WPKS 5EQQA 4JZFH 4K60A 2ZEBA 3SBKA 3SI4H 3KEEA 3A8BA 1UVPA 1LQEA 3BTHE 1GHZA 2H9TH 3U8OH 2ZCKP 1MUEB 4LOYH 2QXJA 3RXFA 1CA0B 5HGGA 5DGJA 3TJNA 2CF8H 1PFXC 4E7NA 1G36A 1FNIA 1H9HE 2D8WA 2FX4A 3QK1A 6ESTA 2CGAA 3LU9B 4AB8A 1Z8GA 3PLBA 1MTSA 1GBIA 1ORFA 1C4Y2 1YCPK 3RXIA 1ZPZA 1GBFA 2PTNA 3DFJA 1C1NA 3I77A 5CHAB 2PHBA 4SGAE 3ZYDA 2OCVB 2BYAX 1AFQB 1C5WB 1C2IA 1EAIA 1OWHA 1QJ6B 2FYRA 1FV9A 2FEQH 4X1SU 2PV9B 1P04A 1AZ8A 1F0TA 1BHXB 1NN6A 2SFAA 2VGCC 4Y6DA 4DW2U 2ZU4A 1PQAA 1GBTA 1CT2E 1QB6A 1UCYE 2ODPA 3GY3A 1QL7A 1FIZA 1ID5H 3BEUA 1YPJH 2QV1A 3O8BA 1XUIA 6LPRA 3AAUA 3RMMH 2R0KA 2HPQH 1S85A 7KMEH 1TONA 1V2OT 1SHYA 1SSXA 3PWCA 8GCHF 1C2DA 1C1MA 1THSH 2ZHWH 1GMDG 2P59A 2ZI2H 1ZMJA 2ZTYA 4MTBA 4WXVA 1V2PT 2HRVA 1QBNA 4NIVA 1O2VA 2BVXH 1QA0A 1BOQA 4NWKA 6GCHF 4RSPA 3RXHA 3SNAA 4DJZB 1TGCA 3E90B 4I8JA 2DUCA 3SNDA 2PSYA 5K7RA 1CVWH 3ZV9A 2WV5A 1NS3A 5T6DA 1YLDA 1AFEH 1TX8A 3SV9A 2XBVA 1TALA 2GZ7A 3A87A 4CBNA 2WPMS 5B6OA 3RXCA 1G30B 1UVOA 1SGEE 1A4WH 1C4V2 1GJDB 1Y3WA 5L6NH 5EW2H 1OS8A 1C5TA 2OC0A 2FMJA 1BTPA 4IC6A 3DHKH 2RCEA 2VIDA 3V0XA 2A5KA 2A2XH 4X6OA 2OUAA 8LPRA 1O5EH 1ETSH 1HAYB 1V2KT 1CU1A 1HAGE 2UUJB 1GCDA 2A4RA 4BTUB 2IN2A 1IHSH 1O3PB 1AWFH 1PPCE 2ZA5A 2XRCA 3TJOA 2OC8A 3LONA 1GG6C 1TPOA 1K1NA 2BLVA 2ZDAH 1AY6H 3Q76A 3SV6A 5E8EH 1LMWB 3LIWA 1GCTC 3P8NA 5FCKA 3LC5A 1L1JA 2C8YB 1YBWA 1AVGH 3EA7A 4QT8C 3UOUA 1XUKA 1Y3VA 2C8ZB 4DY7B 1VR1H 1Y3YA 1YPKH 1MQ5A 3SU3A 2VWNA 3QZQA 3PTNA 4U32A 3RU4E 1SGFG 1NESE 3A84A 4YT7H 5C67A 3SHAH 2VU8E 1NFWA 1EXFA 1MBMA 4NGAH 2D2DA 3LJOA 3RXTA 2A7HA 3BTKE 3KQDA 3BEFB 2VVCA 2ZECA 4GLYA 1MTVA 1ARBA 1TABE 3RXBA 2QY0B 1S0QA 3U69H 1C2KA 3TVJB 5A8ZA 1C2HA 2BY7X 2RDLA 4F4OC 2ZCHP 4NZLA 1JOUB 2JH0D 3S9CA 1QRXA 1BTZA 1Y59T 3U8TH 1AI8H 1O2YA 4X0WU 2VWLA 1QIXB 1P2KA 2CMYA 4MPWA 2XBWA 4MNVA 1O2ZA 1O2UA 4DIHH 2TGAA 1GBMA 3OSYA 2HNTF 1A0HB 1IQFA 1JRTA 2AFQB 1GBLA 1EJAA 2G52A 1NRPH 2W3IA 3RLWH 3UIRA 4CREA 1F92A 1MZDA 1LPZB 1JIMA 4JZIA 1TRMA 5TJXA 4ZUHA 2PKSB 1XX9A 3A7VA 1C2JA 2NU3E 4GHQA 1RGQA 4B2CA 1DE7H 2EI7A 3SJKA 1ANBA 5A8YA 5EU8A 4XSKU 4XE4A 1AUTC 1RTKA 1XKBC 1FY3A 4HFPB 4ABDA 4ZHMU 4FUFA 1QL8A 1AZZA 1GMCG 2FI5E 2AMQA 1P2QA 5DKMA 2JH5D 1MAXA 3RM2H 2BX4A 4MPXA 4BOHA 1PPFE 2FIRH 1B5GH 1HAPH 1BRAA 3PMJA 2ALPA 2K1QA 1A5HA 3DT0H 3MH5A 1C5PA 3IITA 2FESH 3GY7A 1HIAA 2VH6A 1AE8H 1LQDB 5AF9H 6GCHG 4H42U 3UWIA 1HYLA 4X8VH 1P0SH 1YF4A 2BB4A 3A8CA 1QRZA 1DT2A 1S6FA 4JK6A 5EXNA 5EODA 3DUXH 2Z3CA 5AVDA 4ZAEA 1Z8JB 2V6NA 4Y76A 1P3CA 1KXFA 1O3BA 5AFYH 1SGPE 4LZ4B 2J34A 1MKWH 5FCRA 2ZDNA 2GVFA 1O3LA 4BXSA 1FN6A 4OS6A 1O39A 1BT7A 4FXGH 4A1VA 1KLJH 1TMBH 4KP0A 4D76A 4R8TB 1TB6H 2ZDMA 2VGCB 1QHRB 1TGBA 1BMAA 1ANCA 2O8UA 3SHCH 1J17T 5JDUB 1V2NT 2XBXA 3IWMA 4NIYA 3PROA 1BDAA 4ZKNU 4I32A 2BQ6B 1L2EA 3W95A 3WY8A 1TGTA 2AH4X 1TX6A 1E34B 2OQ5A 2V35A 2BD9A 4AFUA 1EP5A 1EZXC 3SNCA 3UFAA 1XKAC 2ULLA 2SGFE 4BANB 1W0YH 3VB4A 5JPMH 1SOTA 3UUZA 1OWKA 2FTLE 5F6MA 1EZQA 6CHAC 1ANEA 1C5SA 2TBSA 1MCVA 1GDNA 1GI3A 1O5FH 1O38A 1W7XH 2ZPSA 4MPUA 4WJG2 1TOCB 1EPTA 1C4U2 4ASHA 3C27B 3GYMA 1BIOA 4JYVH 3QWCH 2G51A 4FVDA 1HNEE 1C2FA 3SUDA 1BBRE 1ZSJA 1PPHE 1Q2WA 3MH6A 3ODDA 4DVAU 1P9UA 1TIOA 4WWYA 3SJ9A 3ZVCA 4OGXA 4NWLA 3V13A 2FOGA 3FVFB 5ETXA 1P06A 2SNVA 2RA0A 1Y5UT 4K5ZA 1QL9A 1C1SA 1O2KA 1Z6JH 4ZHLU 1UCYH 1F0SA 3KGPA 2P16A 1A3EH 3RP2A 1V2UT 1HPGA 4B73A 2CJIA 1O33A 1C5YB 1SQOA 2QXIA 1GG6B 1CGIE 1WQSA 1TNLA 2QGRA 3PYHA 2BQWB 3VXEH 1G2LA 1GCTB 3DA9B 3GDSA 1MBQA 1SC8U 2QF3A 4VGCC 1ELVA 1UTMA 1KYNA 4CRCA 3M5OA 1MAYA 2NU1E 3GDUA 3GCTF 1RFNA 1V2LT 2UUYA 1KLTA 2EC9H 4GVUA 2OLGA 1TOMH 1YP9A 4WMFA 2BVRH 3TK6A 2BX3A 4X1QU 4BAKB 2DE9A 1SGQE 1QGFA 1SVPA 1LHFH 1NFXA 4MNWA 2TGDA 1IOEA 2Q6GA 2OINA 1KSNA 1DOJA 2BXTH 3RXQA 1NRQH 2ZQ1A 1S83A 4FUDA 5L30H 1BMNH 1W7GH 4K8YA 4AFSA 5T3HA 1NU7B 2ZO3H 5FBIA 4X2YA 2EA3A 4Z0KA 3ZVAA 2SNWA 4NA8A 3BTTE 2HVXA 3BN9A 1AKSA 1C5QA 4ESTE 3HKJB 3A81A 3SNBA 1MKXH 1DWCH 3RXLA 1NFYA 1KIGH 3D62A 1C2GA 1YPMH 4FUEA 1XVOA 3M5MA 1M9UA 3NK8A 2HLCA 2P93A 4CRAA 1ELDE 1ZPCA 1FONA 1HFDA 2Z9JA 5C1YA 4IW4E 1ARCA 1TPSA 2FWWA 3PV4A 1GI5A 1TYNA 5GIBA 1J14A 3O8DA 1BTXA 1LHEH 2ZQ2A 1GDUA 1UTJA 2ZU3A 4J1YA 2ZPRA 4YM9A 5I46H 4FUBA 5C5NA 1QFKH 1AB9C 1SOZA 5AFZH 4YESB 1C5MD 1BMMH 1PPZA 1XUFA 3T2NA 1C5RA 1P2MA 4D7GA 3SV7A 3LKWA 3EAJA 1Y5AT 1GBHA 4UONA 4K69A 3UREA 4JZDH 2CV3A 3P8GA 2XXLA 4ZH8A 1P05A 1MMJN 4Y10E 1W3CA 1HAOH 1O30A 2A4QA 1TWXB 3SO3A 4BAOB 1P09A 3TLOA 4WY3A 3T29A 5FPTA 1QY6A 4JZ1A 5HMAA 3ZZCA 1A7SA 2HOBA 5A0AE 1SLVB 1K9OE 4ZHAA 1LDTT 1B0EA 1GBJA 3SI3H 1C2EA 3TH4H 1L1NA 1O2RA 4IN1A 1FLEE 4HI3A 2PLXA 2GMTC 1LPGB 1N1LA 2PR3A 2Y5HA 1F0UA 2Z94A 5C1XA 3RC5A 1BITA 1O35A 4TYDA 4YOGA 4OS4A 1B0FA 1O2PA 1EUFA 1C1VH 1KXBA 2FXRA 3OU0A 2WINI 2XNIA 4XBDA 2XC5A 4X6NA 5LPFA 1ZSKA 1KDQA 1MTWA 4WH6A 3A7TA 5E2PA 1WTGH 4WMEA 2ANKH 1TAWA 4Y71A 2SGQE 5TCAA 4XBCA 1O3CA 1UVTH 1WUNH 3PM3A 4RKJB 1VITG 2BZAA 1FAKH 5C2ZA 3EE0B 4FUHA 4DT7B 1UTQA 2PUQH 3MH7A 1XUJA 1HCGA 2QXGA 2UUKB 3BTWE 1UTOA 2JKHA 1PYTC 2BY8X 3GCTG 8KME2 6CHAB 1Y3UA 2VVUA 1TE0A 4DG4A 1T8MA 3IG6B 1DANH 2BDGA 4A92A 1CT4E 1QBVH 5FHTA 4UD9H 2VIPA 1TBRH 3CENA 2PGBB 5EG4A 1DXPA 1AU8A 1O2WA 3P6ZB 1TX7A 1MTUA 2WPHS 3LGTA 3M7UA 1QJ1B 2BDYA 1UMAH 4R0IA 2J94A 1IQNA 1A2CH 2TGPZ 2Y5FA 3LPRA 1PPEE 4IGDA 3RXRA 1MH0A 1L0ZA 3TH2H 3C1KA 3BV9B 1ZRKA 5GWZA 2CF9H 1S0RA 1GHAF 1K1MA 4YZUA 1HAHH 1S6HA 2BLWA 4MQAA 1ETRH 5A2MH 1MCTA 1GBCA 1EAXA 2W3KA 5T6GA 4A1XA 2NU4E 3GCNA 4H4FA 1V2MT 1GMCF 1BJVA 2SGAA 3GOVB 1OXGA 4CRBA 4THNH 2A5IA 4PROA 3SW2B 1ZSLA 5FX5A 1CHGA 3MNXA 2ZNKH 1RIWC 2FOMB 2O8WA 1TMUH 1O2SA 1J8AA 1GI4A 1MKWK 1TLDA 1X7AC 3MNBA 1GHXH 2TPIZ 1AO5A 1YCPM 1S5SA 1C5XB 3RDZA 1AN1E 4VGCB 3ZVBA 3SV2H 1F7ZA 4AGKA 2J4IA 3Q3XA 3SZNA 1SGNE 3V12A 5SGAE 1O3HA 2B5TB 1V2ST 1AVXA 2I6QA 2F9NA 3E91A 4X2WA 1OPHB 2BDHA 3QGNB 1OOKB 3M37A 1P57B 1VGCC 1IQIA 1Y3XA 2Y6TA 1LVBA 4BAHB 4ISHH 3SU6A 7ESTE 2FOCA 1ELFA 1E37B 1W14U 2J9NA 2HALA 4AG1A 1AWHB 3LGWA 1O3GA 1BRUP 2FOEA 2GT7A 2PFEA 1C1PA 2XYAA 3UR6A 1BBRH 1Z1JA 1GI1A 1HAVB 5A8XA 1O3OA 4D8NA 2IJOB 4WVPE 1BTYA 3MHWU 1O36A 5E0JA 1K28D 2XTTB 4X6PA 1ZMLA 1FPHH 3P8OA 5F8XA 4FVBA 3M7QA 1UJ1A 3FZDA 4FU8A 5GPIB 2BY9X 1ZJKA 1ELTA 4KKDA 3GDVA 3TITA 2PGQB 9LPRA 4RKOB 4MLFB 5DP7A 4WF8A 2THFB 3VFEA 5FAHA 2W7SA 2ESTE 5IYTA 3AW0A 3GY8A 3T27A 3RXOA 3PTBA 1AGJA 3U9AH 4ABAA 1TBZH 4ZXYH 4KELA 1E0FD 5LGOA 3KQEA 1YYY1 4ZROA 3RXEA 4X1NU 3K6ZA 4BTIB 1HLTH 2ZFSA 1UCYK 1UK2A 3BIVH 2R2WU 4GCHF 2RG3A 1ZHPA 4Y7AA 2PKAA 4B2BA 3S7KB 2FS9A 5J4SA 3VB6A 3AAVA 3G01A 4GAWA 3GY4A 3H7OA 1F5LA 3MMGA 1K1PA 4KTUA 1EB1H 1QNJA 3A88A 1SBWA 1GHYH 1V2TT 3RXAA 1V2WT 4UFDH 3S7HB 3HK3B 2GT8A 4Q2KA
chains in the Genus database with same CATH superfamily
3A7ZA 3RXJA 1ZGVA 4X2VA 4XFQA 1HXFH 4K1EA 3RU4T 3KL6A 3JZ2B 4TWWA 1OYQA 1W11U 3EA8A 4X6MA 1EAWA 1DM4B 3S0NA 2FLRH 2J38A 1KXAA 2QXHA 2ZWLH 1N6XA 1G9IE 3L3TA 3A7YA 3SYJA 2W6ID 2AS9A 2STAE 3GCHC 4ZKOU 1KLIH 3K65B 3GICB 3STIA 1AVWA 1MTNB 1CHOF 2G5NA 2C90B 2F91A 2AYWA 1YLNA 1W0ZU 4IC5A 2W7UA 1UHBA 1O2IA 1A46H 2J5UA 3SGQE 1BA8B 5F8ZA 3CS0A 2AHME 4Y0ZE 2GDEH 2BOKA 3PLPA 2ZP0H 2GMTB 5PTPA 2B7DH 1OYTH 2FZZA 1AD8H 3MO6A 3UB0A 1P2IA 1L4DA 1ZLRA 2OC1A 1GHAG 1EPTC 2KCPA 3PV5A 3SN8A 3ELAH 3NXPA 1A3BH 1Z71A 1A5GH 3D49H 1V2JT 2R9PA 1Y5BT 4K2YA 5DPAA 1LO6A 1C5ZB 2BVSH 1MKXK 2QN5T 1QA7A 5HXFA 2FI3E 2UWPA 5TCCA 3FP7E 1PYTD 5FL7D 2V3MA 2VWOA 2ILNA 3SUGA 1THPB 3TGKE 3Q00A 4BNRA 1C2MA 2BQ7B 2Q1JA 3OAAD 1UTPA 1NRRH 2QC2A 1BB0B 4CR5A 1JMOH 3TJVA 4A5TS 3HGPA 2XWBI 1C1QA 5DP9A 1LHCH 3ZVDA 5DP6A 1KTSB 3VGCC 1W10U 3ATMA 3S69A 1DS2E 4UE7H 2A4OA 2G4TA 1P12E 1G3BA 4FUCA 5ABWA 1NRSH 3F9GA 1NBMD 2WPDD 1O5CB 2VIOA 2ZFQH 1D3DB 1EAUA 2GGVB 4CR9A 1ESAA 4E06H 2BD7A 2GZ8A 2XC0A 3M5LA 1FY5A 1OWDA 4NFEA 3S9BA 1GPZA 4TT3D 3QTOH 2TRMA 3D65E 5EXLA 3QZRA 1EJNA 3E16B 4ZKSU 1HRTH 4NSYA 2ZFTA 1SGFA 4D9RA 1GVZA 1GI0A 4Q7ZA 2FYQA 3N7DA 1HJ9A 1V2RT 1P01A 2VIQA 1ELGA 3RMNH 3F6UH 5JBTA 3FO8D 2ZIQH 3VG8A 3T26A 4B2AA 3KQCA 2SGEE 3BG4C 1EOLA 1JXPA 2A45B 1CGHA 1SLXB 1V2VT 1FAXA 3LGVA 1EASA 1PPGE 4YT6H 2Q6DA 4ISIH 4ZMAH 1D9IA 1G3EA 2ODYB 3KIDU 1Q31A 1O34A 2ZPQA 2WZQA 1ZPBA 3TNTA 1PPBH 1TNKA 5DG6A 2G8TA 2FI4E 1FY1A 1GBKA 1O2LA 4CRDA 4M9FA 2K8IA 4GCHG 1UHBB 4TSFD 1DSTA 2O9QA 4F55A 1VGCB 1E1QD 2Z9KA 3UY9A 3B9FH 1WYKA 1F5RA 1CBWC 3PRBA 1IAUA 3TGJE 3P17H 4WXIA 1C1RA 2HPPH 5L2ZH 4NIWA 1FPCH 1YPGH 1GGDC 4D7FA 3SJOA 3BIUH 4JYUH 3P95A 4I31A 3SU0A 1QQ4A 4Y8XA 3PO1C 1O2OA 1GBDA 2ZGCA 2ZGHA 4X8UH 1ZHMA 1GHBF 5ESTE 1EJMA 1NY22 1D4PB 2BOHB 2ZG0H 5LPRA 1CHOG 1HAIH 3E0NB 1BTUA 3M3TA 3A8DA 3LGIA 3N99A 1BCUH 4OM9A 3RLYH 3DCLA 4E05H 5IK2D 1HIAB 1VITF 3F0PA 4AYVB 4OS5A 3U1IB 3QTVH 1HDTH 4WMDA 2H1UA 3UQVA 1GI9B 1Z7KA 4BAQB 2HNTE 4AN7A 4BTTB 3PB1E 1TQ7B 1SGCA 1O2MA 3A89A 1DXWA 3UNRA 2QA9E 2C93B 4YTAA 1EB2A 1GBBA 3ZYEA 2HNTC 2BD4A 1ZYOA 1ANDA 1HBTH 4O03A 3RXPA 2GCHG 4A7IB 1D3TB 4ZKRU 2ZC9H 5GXPA 2HGTH 3ZZ9A 2IJD1 4DCDA 1CGJE 3BTEE 4Q7YA 1J15A 3F68H 2OD3B 3RXMA 8ESTE 4Y8YA 1SKYE 3BTQE 2I6SA 3K2UA 3UWJH 4H6TA 2L74A 1G37A 1Z8RA 4F49A 3VB5A 4CRGA 3LJJA 1Y8TA 3RMOH 1QCPA 1WAYB 1GJ4H 3SORA 4AGJA 1FIWA 2M2AA 2YMSC 2VIWA 4X1PU 3RXVA 1PQ7A 1EZSC 2O8MA 3BG8A 4I86A 4ISNA 4OS2A 1S6LA 1BRCE 2FOHA 1TBQH 3GCHB 1A5IA 2ZU2A 3GYLB 4XD7D 3A8AA 5JBCS 2GV7A 1GVKB 1IQHA 1GDQA 1D6WA 4YOJA 4B75A 2EI8A 4JMYA 4UFGH 1H8IH 5EGMA 1GHVH 3TNSA 4Q4LA 3RUOA 4AFZA 3Q3KA 1Z8IB 2ANWA 2BTCE 4Y8ZA 5GDSH 2TIOA 2BLQA 2ZTZA 1IQGA 1UTKA 3QN7A 1BBRK 1YLCA 3RMLH 2F9BH 3B23B 1V6DA 1HAXB 5HM9A 3PMAB 2QF0A 1S81A 1AQ7A 2A5AA 2D1JA 1A0JA 2FM2A 4ABIA 1NU9A 4KGAA 1ELAA 4KTCA 5LH8A 2P3TB 1EPTB 1W2KH 1O3MA 1NROH 3AVZA 3FP6E 3SQEE 2P95A 4ABHA 1B7XB 3PRDA 3DFLA 5CE1A 2P94A 1UK4A 3F9HA 1BTWA 2FOFA 3TJUA 2Z3EA 1DLKB 2XWAA 1EX3A 3UTUH 1A1RA 1W8BH 3BTFE 3U1JB 2Z6BD 5EQRA 5HM2A 1KTTB 3RM0H 1XVMA 1IQJA 2FPZA 2BM2A 1EKBB 3GISB 5BRRE 1F0RA 3A83A 2PSXA 2WUBA 1QB1A 1K21H 1YGCH 1MZAA 1T4UH 1S82A 2B0FA 3ESTA 5BPEA 5B6LA 1RS0A 2Z3DA 3VGCB 2Z9LA 1GJ7B 4CBOA 3Q3YA 4XRNA 3RXSA 2BD8A 4B74A 1O3AA 3R0FA 3CS7A 4ISOA 2Y81A 1QBOA 2FO9A 3STJA 4YLUA 2F9PA 4U2WA 3MI4A 1SFQB 3QLPH 1SMFE 1WCZA 1ZHRA 4GHTA 2F83A 2YNAA 1DDJA 3M7TA 1O3EA 4XBBA 1SGIB 3NWUA 2A4GA 4Y7BA 5FBEA 2BY5X 4IMQA 3URCA 1P03A 2VB0A 2ZZUH 1ELBA 3BSQA 3UNSA 1UVUH 2HVYB 5EXMA 2RA3A 5EOKA 3WWFA 1UO6A 2Z7FE 1H8HD 2LNCA 4AOQA 1SHHB 3ENSB 1GHBG 1SI5H 4AX9H 3K9XB 2VWMA 1O2GH 2AMDA 1AHTH 3LDXH 4ZXXH 1CO7E 3BG4B 3P92A 5DN6D 3HK6B 1AE5A 4K1SA 1SQTA 5F8TA 2AIQA 3MQKC 2WUCA 2PWXA 2BZ6H 1GJ5H 1SGRE 2NU0E 2OBQA 1KXCA 4X8TH 4X2XA 2GTBA 1JWTA 1AKSB 3MYWA 4HG6A 3T62A 3FAOA 2FX6A 3HGNA 2EY4C 2R0LA 3V3MA 3MO9A 1C1OA 1QR3E 3F3BA 5ESBA 3T25A 4CH8B 2GV6A 3A85A 2VJ1A 1OKXA 3ODFA 2KAIA 3U8RH 1N6YA 1LCYA 2ZDVH 1QURH 2Y7ZA 1LHDH 1NTPA 4ABJA 2STBE 3M61U 1CBWB 1NBME 3TU7H 1ZTLA 3MFJA 2F4LA 3SGBE 3ZVFA 3PLKA 2R3YA 1OWIA 2AGIX 1GGDB 2AGGX 2GX4A 2GCTC 1GI6A 3KNXA 5FPYA 4YOIA 3B8JA 3NPSA 1RTLA 4INHA 2Y7XA 4O3UA 1DITH 3PO1B 4O3TA 5I25A 1LHGH 1NPMA 2ZGBH 1YPHE 3M3SA 1ZTJA 4FUGA 4JYTA 3Q77A 3SU4A 1HJAC 1JIRA 2WV4A 1GL0E 2PUXB 4TWYA 1UTLM 1EATA 4J2YB 1MD7A 2QCYA 1CA8B 3AW1A 1T7CA 3LH1A 1YPHC 2PW8H 2Z9GA 2KZ4A 1O32A 4Q80A 1EQ9A 5C5OA 1RTFB 2VH0A 1UVSH 3QX5H 4B76A 2G00A 2BD3A 4BXWA 5J4QA 4OS1A 2W26A 3OEED 4I8HA 2PTCE 4CH2B 2G81E 2ZHQH 1A61H 2J92A 4I33A 3MU5A 1OWEA 9ESTA 2ZGXH 3BTGE 3UR9A 1CQQA 3W94A 2A7CA 4A1TA 1T8LA 4E7RG 2FDAA 1RD3B 4Y0YE 2WV9A 1DUAA 1OP8A 1Q3XA 1O5GH 5FPSA 4TPYA 2YMSD 5H4IB 1GVLA 4I8KA 1P9SA 1T32A 2ALVA 3UOPA 5AHGH 2R2MB 4MDSA 3AASA 1K1LA 1LKBA 3OYPA 3P8FA 1KMHB 2YMSB 1T8OA 4TY7A 2FS8A 1YC0A 2GDDA 2F9VA 2AGEX 1KDQB 2P8OC 3F9FA 1RJXB 3LGUA 2M5TA 3SU1A 3LC3A 2XBYA 1O2NA 4DURA 1O2TA 1VCQA 2O8LA 4K3JA 3DSGA 4ASUD 3LT3A 2FLBH 3VXFH 5JBAS 3KQ5A 3ZZ4A 3MU4A 3NZIA 3SU2A 1C5OH 3KCGH 3TGIE 3FFGA 1LPKB 2P3UB 5C1UA 1IQEA 1BZXE 1L4ZA 5A0BA 2FOBA 2ZDLA 3KN2A 3SOSA 1ETTH 2BD5A 2XCNA 1ESTA 3BF6H 4MVNA 1O31A 1EOJA 1P2NA 2QYIA 2KAIB 3CP7A 5GCHF 4B71A 3MTYA 2FP7B 4FETA 1VZQH 3T28A 4DT4A 3F0OA 3ATKA 5HYOA 3KYFA 1O0DH 1NRNH 1GI8B 1AB9B 3ZZ8A 4K8BA 3ZVGA 1IHTH 2ZU5A 2A1DB 2NWNA 1O3DA 2KR7A 1YM0A 1YPEH 2A0QB 1PJPA 5DK1A 4HZHA 7GCHG 2BHGA 2TGTA 5FXLA 1RXPA 2J2UA 4IN2A 1BQYA 2KFWA 2ZFPH 1YWUA 1BHXF 4Q63A 2Y80A 1WTHD 2AEIH 3MH4A 2H6MA 2IPHA 1NM6A 1OHHD 1SL3A 2NU2E 4B1TA 1HXEH 1P3EA 2WPLS 3NKKA 3PMHB 3SU5A 1LVOA 4Z1MD 3FOAA 1TNGA 2H2ZA 3WW7A 5C0UA 4CHAC 1BRBE 1SFIA 3ITIA 1NC6A 1W13U 1XM1A 1TRYA 5JB8S 5IDKA 3O8RA 1O5AB 2AIPA 3LGYA 1E38B 1E35B 1G3CA 2EEKA 3HATH 3QGJA 1N8OC 1P2JA 2ZCLP 1SR5C 5EQSA 2GP9B 3DD2H 1O3FA 1TFXA 1W12U 1QJ7B 3A82A 1HUTH 1GJ9B 1JBUH 4OGYA 1OP2A 2GCHF 1G32B 2V7QD 1FQ3A 4MNXA 2BDBA 4H6SB 5FX6A 2KX4A 3RXKA 3MU0A 2FTMA 1FZZA 4AG2A 1CT0E 2ZTXA 3TPIZ 3R3GB 3VB7A 3NCLA 5EPNA 4XOJA 2IOTA 2K0QA 2ZHFH 4UEHH 2CHAC 3A80A 1SGTA 4JCNA 1UTNA 3UAIC 3HKIB 1DY8A 1HGTH 4U30A 3T5FH 5GJ4B 3E6PH 4FUIA 3EQ0H 5LPEA 1DVAH 2VINA 8GCHG 1NFUA 1YCPH 3V7TA 1JRSA 4LZ1H 1DLEA 1C1UH 4JZEH 4I8LA 2AMPA 3FP8E 1GJBB 1PQ5A 2V0BA 1DWDH 5DSFA 4ISLA 1O5BB 1WOFA 3QUMP 4ABFA 1TPPA 1ELCA 3TK9A 3OY5U 3KQBA 1H1BA 2EI6A 3BEIB 2JJ1D 3PMBB 1OP0A 3PWBA 2GCTB 4YLQH 2VVVA 1T8NA 3BTDE 2ZGJA 1BUIA 2BMGB 3JZ1B 4K1TA 3U98H 3EGKH 4O97A 3SUFA 2PKAB 4UDWH 1SGYE 1AUJA 4D9QA 1TNJA 1SQRA 1T4VH 4UFFH 4A6LA 2JETC 3LH3A 7LPRA 2DE8A 1QRWA 1HJAB 5DP8A 5C20A 3OY6U 4NG9H 2D26C 3A7XA 1ACBE 3M36A 1WSSH 3ZZ5A 5A09A 2H9EH 1RIWB 1C9TA 1AIXH 3SJ8A 3N7EA 4O9VA 4CRFA 3A7WA 3RXUA 3UQOA 2ASUB 1C1TA 3ZZ7A 3F1SB 2FODA 1K1OA 4IMZA 1VCWA 5K0HA 2GJGA 2H5DA 4SGBE 1VITH 3QDZB 1OSSA 4HGCA 3DSOA 2XNDD 1K22H 2B9LA 5GCHG 1GBEA 4NA7A 1SB1H 3SNEA 1BTHH 3MO3A 4DGJA 1INCA 4AFQA 1D6RA 1GWAA 2O8TA 2G4UA 2JH6D 3A86A 3FANA 3RC4A 3SZEA 1D3QB 3ZZBA 1K1JA 2H9HA 1ZR0A 1ESBA 1GL1A 1P8VC 1K1IA 1TNIA 4AYYB 3EDXB 3P70B 1VKYA 2Y82A 1C5VA 1T31A 2BDCA 4MNYA 2C3SA 1GMHF 4RN6A 2CXVA 4NSVA 5C3NA 1IQLA 1HJ8A 4NCYA 2H5CA 1CA0C 3I78A 4BAMB 2G55A 1C5NH 1YPLH 1LVYA 1TGSZ 2SGPE 4MPVA 1C5LH 2BDIA 2OBOA 3N7OA 2BLOA 4NIXA 4GUXA 4Y11E 1C5UA 2YOLA 1FY4A 1O2QA 4YO9A 5L2YH 2P8OB 3ATWA 2WPIS 1DWBH 3D23A 1TQ0B 2V3OH 3MU8A 2A32A 5EPYA 3UPEA 1L1GA 4GSOA 5CHAC 3S9AA 2OP9A 1AFQC 5KGOA 4KTSA 2XCFA 4Y79A 2Z9IA 4Z6AH 2P3FH 2ZKSA 1G2MA 1S84A 1BJUA 4ABEA 1O2JA 1FI8A 2HLDD 3L6PA 4LK4A 1DX5M 5KEDA 2W6JD 2A31A 2ODQA 2GKVE 1MU8B 3MNSA 2ZHEH 1DPOA 1TNHA 1K2I1 2ZF0H 2VNTA 3E8LA 1KXDA 3L33A 4M7GA 3RC6A 4FUJA 5DJ7A 3VB3A 1ZZZA 1GBAA 1P11E 5DP5A 1HB0B 5EJLA 4DOQA 1O2XA 1NT1A 1XXFA 1FY8E 1OWJA 3LOXA 2L6OA 4FU7A 1GI7B 1SGDE 1H9IE 1EP6A 2V3HH 3SV8A 3KHVA 1F5KU 1NO9H 1EZUC 3RU4D 1WBGB 2A7JA 1ABIH 5DO4H 1FJSA 5DP4A 3OFND 3EA9A 2XC4A 1V3XA 1IQKA 1AMHA 4OS7A 3ZZ3A 5JBBS 1IQMA 4X8SH 1XMNB 2F9OA 3SJIA 1O5DH 1LKAA 1C9PA 1XXDA 2JIZD 1J9CH 1O3JA 4ZCNA 4CHAB 1LTOA 3O8CA 2OQUA 3RXDA 2CN0H 2WPJS 1V2QT 3SGAE 1P2OA 1GJCB 3ATIA 5F53A 5E0HA 3KF2A 3SUEA 3FZZA 1ZTKA 4AORA 3MOCA 2AERH 1MQ6A 1TRNA 1QTFA 2OC7A 1FDPA 2ZHDA 3VEQB 4AZ2B 1O3NA 2R3UA 1ABJH 1C2LA 2BD2A 2UUFB 2YNBA 1OX1A 4INKA 2GD4B 3NUMA 4DIIH 3ZV8A 1N8OB 1XUGA 1O3KA 1H8DH 4I7YH 1H8ED 1C1WH 2BDAA 2F3CE 3QO6A 1DFPA 1F2SE 1ZMNA 1BMLA 1NZQH 3OX7U 3ZZAA 4IBLH 3ZZ6A 1H4WA 2C8WB 1GMDF 1W0KD 3SQHE 1GHWH 2UWOA 1TA2A 3HPTB 2QIQA 2ZFFH 2WYGA 4FU9A 3TH3H 2GZ9A 3H5CB 1TGNA 3I29A 1MU6B 2CHAB 1KY9A 3OTPA 2SGDE 3ZVEA 1CSOE 1P10A 1QB9A 3MWIU 4JK5A 1SLWB 3TIUA 1G3DA 4HTCH 1FUJA 3E1XB 4LXBH 1PQ8A 4U01A 4ABBA 5EW1H 3MU1A 1TA6A 3GY5A 5T6FA 3F9EA 5JB9S 4B6EA 1CE5A 2G5VA 2C8XB 1WXRA 5E0GA 3TK5A 1ZRBA 1O37A 2XW9A 5CMXH 1WQVH 3EYDA 2ANYA 1WV7H 3ZZDA 1XUHA 1SPJA 2Y5GA 4UFEH 1DWEH 1MD8A 1FN8A 1J16A 3M3VA 3BTME 3H7TA 2OXSA 4RT1A 1VCPA 1HV7A 3M5NA 1ZJDA 4NFFA 2WYJA 1UK3A 1Z1IA 4WH8A 2W5EA 1GMHG 3E3TA 1DY9A 1ZGIA 4MG3A 2F9UA 4X1RU 2HWLB 3URDA 4NZQA 3ATLA 4RI0A 1SLUB 3GY6A 1RRKA 2ANMH 1FMGA 2ZU1A 3F2FA 1Z6EA 4GPGA 2Q6FA 1ELEE 1MTNC 4NA9H 4ABGA 2VIVA 2QAAA 1TMTH 2ZFRH 3FKSD 3M35A 3MNCA 1A0LA 3E0PB 1P02A 1QQUA 2BY6X 1VJAU 4I8GA 3GCOA 1GJ8B 1LVMA 4TPIZ 3PV2A 1O2HA 2JETB 5A0CA 1KXEA 2J95A 2C4FH 2PKSC 5G4BA 2BXUH 2OTVA 1TPAE 3OTJE 1U6QA 1HAVA 1WU1A 3GY2A 4AB9A 1SQAA 5DP3A 7GCHF 5JYIA 1DICA 4IS5A 2UWLA 4Q7XA 2B8OH 3RXGA 4XDEA 2J98A 3K6YA 1HAZB 1D3PB 1THRH 1VJ9U 1O3IA 1YKTA 1GJAB 1ZOMA 1H9LB 2FOAA 1E36B 1DUEA 2A2QH 5F03A 1GJ6A 1GI2A 1FXYA 2LPRA 3VPKA 1SG8B 1DSUA 4INLA 5E2OA 3UNQA 2ZDKA 4TY6A 1WDIA 2WPKS 5EQQA 4JZFH 4K60A 2ZEBA 3SBKA 3SI4H 3KEEA 3A8BA 1UVPA 1LQEA 3BTHE 1GHZA 2H9TH 3U8OH 2ZCKP 1MUEB 4LOYH 2QXJA 3RXFA 1CA0B 5HGGA 5DGJA 3TJNA 2CF8H 1PFXC 4E7NA 1G36A 1FNIA 1H9HE 2D8WA 2FX4A 3QK1A 6ESTA 4ACBA 2CGAA 3LU9B 4AB8A 1Z8GA 3PLBA 1MTSA 1GBIA 1ORFA 1C4Y2 1YCPK 3RXIA 4F48B 1ZPZA 1GBFA 2PTNA 3DFJA 1C1NA 3I77A 5CHAB 2PHBA 4SGAE 3ZYDA 2OCVB 2BYAX 1AFQB 1C5WB 1C2IA 1EAIA 1OWHA 1QJ6B 2FYRA 1FV9A 2FEQH 4X1SU 2PV9B 1P04A 1AZ8A 1F0TA 1BHXB 1NN6A 2SFAA 2VGCC 4Y6DA 4DW2U 3DSPA 2RDEA 2ZU4A 1PQAA 1GBTA 1CT2E 1QB6A 1UCYE 2ODPA 3F2GA 1QL7A 3GY3A 1FIZA 1ID5H 3BEUA 1YPJH 2QV1A 3O8BA 1XUIA 6LPRA 3AAUA 3RMMH 2R0KA 2HPQH 1S85A 7KMEH 2KCYA 1TONA 3W1EA 1V2OT 1SHYA 1SSXA 3PWCA 8GCHF 2KCOA 2OK5A 1BMFD 1C1MA 1C2DA 1THSH 2ZHWH 1GMDG 2P59A 2ZI2H 1ZMJA 2ZTYA 4MTBA 4WXVA 1FX0B 1V2PT 2HRVA 1QBNA 4NIVA 1O2VA 1YY3A 2BVXH 1QA0A 1BOQA 4NWKA 6GCHF 4RSPA 3RXHA 3SNAA 4DJZB 1TGCA 3E90B 4I8JA 3AK5A 2DUCA 3H09A 1E79D 3SNDA 2PSYA 5K7RA 1CVWH 3ZV9A 2WV5A 1NS3A 5T6DA 1YLDA 1AFEH 1TX8A 3SV9A 2XBVA 1TALA 2GZ7A 3A87A 4CBNA 2WPMS 5B6OA 3RXCA 2QF4A 1G30B 1UVOA 1SGEE 1A4WH 1C4V2 1GJDB 1Y3WA 5GNDA 5L6NH 5EW2H 1OS8A 1C5TA 2OC0A 2FMJA 1BTPA 4IC6A 3DHKH 2RCEA 2VIDA 3V0XA 2A5KA 2KCAA 2A2XH 4X6OA 2OUAA 8LPRA 1O5EH 1ETSH 1HAYB 1V2KT 1CU1A 1HAGE 2UUJB 1GCDA 2A4RA 4BTUB 2IN2A 1IHSH 1O3PB 1AWFH 1PPCE 2ZA5A 2XRCA 3TJOA 2OC8A 3LONA 3F2HA 1GG6C 1TPOA 1K1NA 2BLVA 2ZDAH 1AY6H 3Q76A 3SV6A 5E8EH 1LMWB 3LIWA 1GCTC 3P8NA 5FCKA 3LC5A 1L1JA 2C8YB 1YBWA 1AVGH 2WHXA 3EA7A 4QT8C 3UOUA 1XUKA 1Y3VA 2C8ZB 4DY7B 1VR1H 1Y3YA 1YPKH 1MQ5A 3SU3A 2VWNA 3QZQA 3PTNA 4U32A 3RU4E 1SGFG 1NESE 3A84A 4YT7H 5C67A 3SHAH 2VU8E 1NFWA 1EXFA 1MBMA 4NGAH 2D2DA 3LJOA 3RXTA 2A7HA 3BTKE 3KQDA 3BEFB 2VVCA 2ZECA 4GLYA 1MTVA 1ARBA 5HIZA 1TABE 3RXBA 2QY0B 1S0QA 3U69H 1C2KA 3TVJB 5A8ZA 1C2HA 2BY7X 2RDLA 4F4OC 2ZCHP 4NZLA 1JOUB 2JH0D 3S9CA 1QRXA 1BTZA 1Y59T 3U8TH 1AI8H 2J97A 1O2YA 4X0WU 2VWLA 1QIXB 1P2KA 2CMYA 4MPWA 2XBWA 4MNVA 1O2ZA 1O2UA 1W0JD 4DIHH 2TGAA 1GBMA 3OSYA 2HNTF 1A0HB 1IQFA 1JRTA 1K0HA 2AFQB 1GBLA 1EJAA 2G52A 1NRPH 2W3IA 3RLWH 3UIRA 4CREA 1F92A 1MZDA 1LPZB 1JIMA 4JZIA 1TRMA 5TJXA 4ZUHA 2PKSB 5C17A 1XX9A 3A7VA 1C2JA 2NU3E 4GHQA 1RGQA 4B2CA 1DE7H 2EI7A 3SJKA 3ZIAD 1ANBA 5A8YA 5EU8A 4XSKU 4XE4A 1AUTC 1RTKA 2PP6A 1XKBC 1FY3A 4HFPB 4ABDA 4ZHMU 4FUFA 1QL8A 1AZZA 1GMCG 2FI5E 2AMQA 1P2QA 5DKMA 2JH5D 1MAXA 3RM2H 2BX4A 2CK3D 4MPXA 4BOHA 1PPFE 2FIRH 1B5GH 1HAPH 1BRAA 3PMJA 2ALPA 2K1QA 1A5HA 3DT0H 3MH5A 5HIYA 1C5PA 3IITA 2FESH 3GY7A 1HIAA 2VH6A 1AE8H 1LQDB 5AF9H 6GCHG 4H42U 3UWIA 1HYLA 4X8VH 1P0SH 1YF4A 2BB4A 3A8CA 1QRZA 1DT2A 1S6FA 4JK6A 5EXNA 5EODA 3DUXH 2Z3CA 5AVDA 4ZAEA 1Z8JB 3OEHD 2V6NA 4Y76A 1P3CA 1KXFA 1O3BA 5AFYH 1SGPE 4LZ4B 2J34A 2IPQX 1MKWH 5FCRA 2ZDNA 2GVFA 1O3LA 4BXSA 1FN6A 4OS6A 1O39A 1BT7A 4FXGH 4A1VA 5CHBA 1KLJH 1TMBH 4KP0A 4D76A 4R8TB 1TB6H 2ZDMA 2VGCB 1QHRB 1TGBA 1BMAA 1ANCA 2O8UA 3SHCH 1QZ8A 1J17T 5JDUB 1V2NT 2XBXA 3IWMA 4NIYA 3PROA 1BDAA 4ZKNU 4I32A 2BQ6B 1L2EA 3W95A 3WY8A 1TGTA 2AH4X 1TX6A 1E34B 2OQ5A 2V35A 2BD9A 4AFUA 1EP5A 1EZXC 3SNCA 3UFAA 4P02A 1XKAC 2ULLA 2SGFE 4BANB 1W0YH 3VB4A 5JPMH 1SOTA 3UUZA 1OWKA 2FTLE 5F6MA 1EZQA 6CHAC 1ANEA 1C5SA 2TBSA 1MCVA 2F43B 1GDNA 1GI3A 1O5FH 1O38A 1W7XH 2ZPSA 4MPUA 4WJG2 1TOCB 1EPTA 1C4U2 4ASHA 3C27B 3GYMA 1BIOA 4JYVH 3QWCH 2G51A 4FVDA 1HNEE 1C2FA 3SUDA 1BBRE 1ZSJA 1PPHE 3CNRA 1Q2WA 3MH6A 3ODDA 4DVAU 1P9UA 1TIOA 4WWYA 3SJ9A 3ZVCA 4OGXA 4NWLA 3V13A 2FOGA 3FVFB 5ETXA 1P06A 2SNVA 2RA0A 1Y5UT 4K5ZA 1QL9A 1C1SA 1O2KA 1Z6JH 4ZHLU 1UCYH 1F0SA 3KGPA 2P16A 1A3EH 3RP2A 1V2UT 1HPGA 4B73A 2CJIA 1O33A 1C5YB 1SQOA 2QXIA 1GG6B 5HKKD 1CGIE 1WQSA 1TNLA 2QGRA 3PYHA 2BQWB 3VXEH 1G2LA 1GCTB 3DA9B 3GDSA 1MBQA 1SC8U 2QF3A 4VGCC 1ELVA 1UTMA 1KYNA 4CRCA 3M5OA 1MAYA 2NU1E 3GDUA 3GCTF 1RFNA 1V2LT 2UUYA 5EIYA 1KLTA 2EC9H 4GVUA 2OLGA 1TOMH 1YP9A 4WMFA 2BVRH 3TK6A 2BX3A 4X1QU 4BAKB 2DE9A 1SGQE 1QGFA 1SVPA 1LHFH 1NFXA 2XOKD 4MNWA 2TGDA 1IOEA 2Q6GA 2OINA 1KSNA 1DOJA 2BXTH 3RXQA 1NRQH 2ZQ1A 1S83A 4FUDA 5L30H 1MABB 1BMNH 1W7GH 4K8YA 4AFSA 5T3HA 1NU7B 2ZO3H 5FBIA 4X2YA 2EA3A 5CDFE 4Z0KA 3ZVAA 2SNWA 4NA8A 3BTTE 3WWBA 2HVXA 3BN9A 1AKSA 1C5QA 4ESTE 3HKJB 3A81A 3SNBA 1MKXH 1DWCH 3RXLA 1NFYA 1KIGH 2EQNA 3D62A 1C2GA 1YPMH 4FUEA 1XVOA 3M5MA 1M9UA 3NK8A 2HLCA 2P93A 4CRAA 1ELDE 1ZPCA 1FONA 1HFDA 3OE7D 2Z9JA 5C1YA 4IW4E 5C0TA 1ARCA 1TPSA 2FWWA 3PV4A 1GI5A 1TYNA 5GIBA 1J14A 3O8DA 1BTXA 1LHEH 2ZQ2A 1GDUA 1UTJA 2ZU3A 4J1YA 2ZPRA 4YM9A 4AC9A 5I46H 4FUBA 5C5NA 1QFKH 2QE7D 1AB9C 1SOZA 5AFZH 4YESB 1C5MD 1BMMH 1PPZA 1XUFA 3T2NA 1C5RA 1P2MA 4D7GA 3SV7A 3LKWA 3EAJA 1Y5AT 1GBHA 4UONA 4K69A 4RT0A 3UREA 4JZDH 4YXWD 2CV3A 3P8GA 2XXLA 4ZH8A 1P05A 1MMJN 4Y10E 1W3CA 3EE7A 1HAOH 1O30A 2A4QA 1TWXB 3SO3A 4BAOB 1P09A 4ACAA 3TLOA 4WY3A 3T29A 5FPTA 2WSSD 1QY6A 4JZ1A 5HMAA 3ZZCA 1A7SA 2HOBA 5A0AE 1SLVB 1K9OE 4ZHAA 1LDTT 1B0EA 1GBJA 3SI3H 1C2EA 3TH4H 1L1NA 1O2RA 4IN1A 1FLEE 4HI3A 2PLXA 2GMTC 1LPGB 1N1LA 2PR3A 2Y5HA 1F0UA 2Z94A 5C1XA 3GS9A 3RC5A 1BITA 1O35A 4TYDA 4YOGA 4OS4A 1B0FA 1O2PA 1EUFA 1C1VH 1KXBA 2FXRA 3OU0A 2WINI 5C94A 2XNIA 4XBDA 2JJ2D 2XC5A 4X6NA 5LPFA 1ZSKA 1KDQA 1MTWA 4WH6A 3A7TA 5E2PA 1WTGH 4WMEA 2ANKH 1TAWA 4Y71A 2SGQE 5TCAA 4XBCA 1O3CA 1UVTH 1WUNH 3PM3A 4RKJB 1VITG 3KYGA 2BZAA 1FAKH 5C2ZA 3EE0B 4FUHA 4DT7B 1UTQA 2PUQH 3MH7A 1XUJA 1HCGA 2QXGA 2UUKB 3BTWE 1UTOA 2JKHA 1PYTC 4FOUC 2BY8X 3GCTG 8KME2 6CHAB 1Y3UA 2VVUA 1TE0A 4DG4A 1T8MA 3IG6B 1DANH 2BDGA 4A92A 1CT4E 1QBVH 5FHTA 4UD9H 2VIPA 1TBRH 3CENA 2PGBB 5EG4A 1DXPA 1AU8A 1O2WA 2VBCA 1TX7A 1MTUA 3P6ZB 2WPHS 3LGTA 3M7UA 1QJ1B 2BDYA 2LP6A 1UMAH 4R0IA 2J94A 1IQNA 1A2CH 2TGPZ 2Y5FA 3LPRA 1PPEE 4IGDA 3RXRA 3U28C 1MH0A 1L0ZA 3TH2H 3C1KA 2JDID 3BV9B 1ZRKA 5GWZA 2CF9H 1S0RA 1GHAF 1K1MA 4YZUA 1HAHH 1S6HA 2BLWA 4MQAA 1ETRH 5A2MH 1MCTA 1GBCA 1EAXA 2W3KA 5T6GA 4A1XA 2NU4E 3GCNA 4H4FA 1V2MT 1GMCF 1BJVA 2SGAA 3GOVB 1OXGA 4CRBA 4THNH 2A5IA 4PROA 3SW2B 3FN8A 1ZSLA 5FX5A 1CHGA 3MNXA 2ZNKH 1RIWC 2FOMB 1TMUH 1O2SA 1J8AA 1GI4A 1TLDA 1MKWK 1X7AC 2O8WA 3MNBA 1GHXH 2TPIZ 1AO5A 1YCPM 1S5SA 1C5XB 5EJ1A 3RDZA 1AN1E 4VGCB 3ZVBA 3SV2H 1COWD 1F7ZA 4AGKA 2J4IA 3Q3XA 3SZNA 1EFRD 1SGNE 3V12A 5SGAE 1O3HA 2B5TB 1V2ST 1AVXA 2I6QA 2F9NA 3E91A 4X2WA 1OPHB 2KM0A 2BDHA 3QGNB 1OOKB 3M37A 1P57B 1VGCC 1IQIA 1Y3XA 2Y6TA 1LVBA 4BAHB 1UW7A 4ISHH 3SU6A 7ESTE 2FOCA 1ELFA 1E37B 1W14U 2J9NA 2HALA 4AG1A 1AWHB 3LGWA 1O3GA 1BRUP 2FOEA 2GT7A 2PFEA 4P00A 1C1PA 2XYAA 3UR6A 1BBRH 1Z1JA 1GI1A 1HAVB 5A8XA 1O3OA 4D8NA 2IJOB 4WVPE 1BTYA 5KECA 2J98B 3MHWU 1O36A 5E0JA 1K28D 2XTTB 4X6PA 1ZMLA 1FPHH 3P8OA 5F8XA 4FVBA 3M7QA 1UJ1A 3FZDA 4FU8A 2LELA 5GPIB 2BY9X 2RFKC 1ZJKA 1ELTA 4KKDA 4B6FA 3GDVA 3TITA 2PGQB 5EJZA 9LPRA 4RKOB 4MLFB 5DP7A 4WF8A 2THFB 3VFEA 5FAHA 2W7SA 2ESTE 1E1RD 5IYTA 3AW0A 3GY8A 5T1VA 3T27A 3RXOA 3PTBA 1AGJA 3U9AH 4ABAA 1TBZH 4ZXYH 4KELA 1E0FD 5LGOA 3KQEA 1YYY1 4ZROA 3RXEA 4X1NU 3K6ZA 4BTIB 1HLTH 2ZFSA 1UCYK 1UK2A 3BIVH 2R2WU 4GCHF 2RG3A 1ZHPA 4Y7AA 2PKAA 4B2BA 3S7KB 2FS9A 5J4SA 2QF5A 3VB6A 3AAVA 3G01A 4GAWA 3GY4A 3H7OA 1F5LA 3MMGA 1K1PA 4KTUA 1EB1H 1QNJA 3A88A 3NRLA 1SBWA 1GHYH 1V2TT 3RXAA 1V2WT 4UFDH 3S7HB 3HK3B 2GT8A 4Q2KA
chains in the Genus database with same CATH topology
3A7ZA 3RXJA 1ZGVA 4X2VA 4XFQA 1HXFH 4K1EA 3RU4T 3KL6A 3JZ2B 4TWWA 1OYQA 1W11U 3EA8A 4X6MA 1EAWA 1DM4B 3S0NA 2FLRH 2J38A 1KXAA 2QXHA 2ZWLH 1N6XA 1G9IE 3L3TA 3A7YA 2AS9A 2STAE 3GCHC 4ZKOU 1KLIH 3K65B 3GICB 3STIA 1AVWA 1MTNB 1CHOF 2G5NA 2C90B 2F91A 2AYWA 1W0ZU 4IC5A 2W7UA 1UHBA 1O2IA 1A46H 3SGQE 1BA8B 5F8ZA 3CS0A 4Y0ZE 2GDEH 2BOKA 3PLPA 2ZP0H 2GMTB 5PTPA 2B7DH 1OYTH 2FZZA 1AD8H 3MO6A 1P2IA 1L4DA 1ZLRA 2OC1A 1GHAG 1EPTC 3SN8A 3ELAH 3NXPA 1A3BH 1Z71A 1A5GH 3D49H 1V2JT 2R9PA 1Y5BT 4K2YA 5DPAA 1LO6A 1C5ZB 2BVSH 1MKXK 2QN5T 1QA7A 5HXFA 2FI3E 2UWPA 5TCCA 3FP7E 1PYTD 2VWOA 2ILNA 3SUGA 1THPB 3TGKE 3Q00A 4BNRA 1C2MA 2BQ7B 2Q1JA 1UTPA 1NRRH 2QC2A 1BB0B 4CR5A 1JMOH 3TJVA 4A5TS 3HGPA 2XWBI 1C1QA 5DP9A 1LHCH 3ZVDA 5DP6A 1KTSB 3VGCC 1W10U 3ATMA 3S69A 1DS2E 4UE7H 2A4OA 2G4TA 1P12E 1G3BA 4FUCA 5ABWA 1NRSH 3F9GA 1O5CB 2VIOA 2ZFQH 1D3DB 1EAUA 2GGVB 4CR9A 1ESAA 4E06H 2BD7A 2GZ8A 2XC0A 3M5LA 1FY5A 1OWDA 4NFEA 3S9BA 1GPZA 3QTOH 2TRMA 3D65E 5EXLA 3QZRA 1EJNA 3E16B 4ZKSU 1HRTH 4NSYA 2ZFTA 1SGFA 4D9RA 1GVZA 1GI0A 4Q7ZA 2FYQA 1HJ9A 1V2RT 1P01A 2VIQA 1ELGA 3RMNH 3F6UH 5JBTA 2ZIQH 3T26A 4B2AA 3KQCA 2SGEE 3BG4C 1EOLA 1JXPA 2A45B 1CGHA 1SLXB 1V2VT 1FAXA 3LGVA 1EASA 1PPGE 4YT6H 2Q6DA 4ISIH 4ZMAH 1D9IA 1G3EA 2ODYB 3KIDU 1Q31A 1O34A 2ZPQA 1ZPBA 3TNTA 1PPBH 1TNKA 5DG6A 2G8TA 2FI4E 1FY1A 1GBKA 1O2LA 4CRDA 4GCHG 1UHBB 1DSTA 2O9QA 1VGCB 2Z9KA 3UY9A 3B9FH 1WYKA 1F5RA 1CBWC 1IAUA 3TGJE 3P17H 4WXIA 1C1RA 2HPPH 5L2ZH 4NIWA 1FPCH 1YPGH 1GGDC 4D7FA 3SJOA 3BIUH 4JYUH 3P95A 4I31A 3SU0A 1QQ4A 4Y8XA 3PO1C 1O2OA 1GBDA 2ZGCA 2ZGHA 4X8UH 1ZHMA 1GHBF 5ESTE 1EJMA 1NY22 1D4PB 2BOHB 2ZG0H 5LPRA 1CHOG 1HAIH 3E0NB 1BTUA 3M3TA 3A8DA 3LGIA 1BCUH 3RLYH 4E05H 1HIAB 1VITF 4AYVB 4OS5A 3U1IB 3QTVH 1HDTH 4WMDA 2H1UA 3UQVA 1GI9B 1Z7KA 4BAQB 2HNTE 4AN7A 4BTTB 3PB1E 1TQ7B 1SGCA 1O2MA 3A89A 1DXWA 3UNRA 2QA9E 2C93B 4YTAA 1EB2A 1GBBA 3ZYEA 2HNTC 2BD4A 1ZYOA 1ANDA 1HBTH 4O03A 3RXPA 2GCHG 4A7IB 1D3TB 4ZKRU 2ZC9H 5GXPA 2HGTH 3ZZ9A 4DCDA 1CGJE 3BTEE 4Q7YA 1J15A 3F68H 2OD3B 3RXMA 8ESTE 4Y8YA 3BTQE 2I6SA 3K2UA 3UWJH 4H6TA 1G37A 1Z8RA 4F49A 3VB5A 4CRGA 3LJJA 1Y8TA 3RMOH 1QCPA 1WAYB 1GJ4H 3SORA 4AGJA 1FIWA 2VIWA 4X1PU 3RXVA 1PQ7A 1EZSC 2O8MA 3BG8A 4ISNA 4OS2A 1BRCE 2FOHA 1TBQH 3GCHB 1A5IA 2ZU2A 3GYLB 3A8AA 5JBCS 2GV7A 1GVKB 1IQHA 1GDQA 1D6WA 4YOJA 4B75A 2EI8A 4JMYA 4UFGH 1H8IH 5EGMA 1GHVH 3TNSA 3RUOA 4AFZA 3Q3KA 1Z8IB 2ANWA 2BTCE 4Y8ZA 5GDSH 2TIOA 2BLQA 2ZTZA 1IQGA 1UTKA 3QN7A 1BBRK 1YLCA 3RMLH 2F9BH 3B23B 1V6DA 1HAXB 5HM9A 3PMAB 2QF0A 1S81A 1AQ7A 2A5AA 2D1JA 1A0JA 2FM2A 4ABIA 1NU9A 4KGAA 1ELAA 4KTCA 5LH8A 2P3TB 1EPTB 1W2KH 1O3MA 1NROH 3AVZA 3FP6E 3SQEE 2P95A 4ABHA 1B7XB 3DFLA 5CE1A 2P94A 1UK4A 3F9HA 1BTWA 2FOFA 3TJUA 2Z3EA 1DLKB 2XWAA 1EX3A 3UTUH 1A1RA 1W8BH 3BTFE 3U1JB 2Z6BD 5EQRA 5HM2A 1KTTB 3RM0H 1XVMA 1IQJA 2FPZA 2BM2A 1EKBB 3GISB 5BRRE 1F0RA 3A83A 2PSXA 2WUBA 1QB1A 1K21H 1YGCH 1MZAA 1T4UH 1S82A 2B0FA 3ESTA 5BPEA 1RS0A 2Z3DA 3VGCB 2Z9LA 1GJ7B 4CBOA 3Q3YA 3RXSA 2BD8A 4B74A 1O3AA 3R0FA 3CS7A 4ISOA 2Y81A 1QBOA 2FO9A 3STJA 4YLUA 2F9PA 4U2WA 3MI4A 1SFQB 3QLPH 1SMFE 1WCZA 1ZHRA 4GHTA 2F83A 2YNAA 1DDJA 3M7TA 1O3EA 4XBBA 1SGIB 3NWUA 2A4GA 4Y7BA 5FBEA 2BY5X 4IMQA 3URCA 1P03A 2VB0A 2ZZUH 1ELBA 3BSQA 3UNSA 1UVUH 5EXMA 2RA3A 5EOKA 1UO6A 2Z7FE 2LNCA 4AOQA 1SHHB 3ENSB 1GHBG 1SI5H 4AX9H 3K9XB 2VWMA 1O2GH 2AMDA 1AHTH 3LDXH 4ZXXH 1CO7E 3BG4B 3P92A 3HK6B 1AE5A 4K1SA 1SQTA 5F8TA 2AIQA 2WUCA 2PWXA 2BZ6H 1GJ5H 1SGRE 2NU0E 2OBQA 1KXCA 4X8TH 4X2XA 2GTBA 1JWTA 1AKSB 3MYWA 3T62A 3FAOA 2FX6A 3HGNA 2R0LA 3V3MA 3MO9A 1C1OA 1QR3E 5ESBA 3T25A 4CH8B 2GV6A 3A85A 2VJ1A 1OKXA 3ODFA 2KAIA 3U8RH 1N6YA 1LCYA 2ZDVH 1QURH 2Y7ZA 1LHDH 1NTPA 4ABJA 2STBE 3M61U 1CBWB 3TU7H 1ZTLA 3MFJA 3SGBE 3ZVFA 3PLKA 2R3YA 1OWIA 2AGIX 1GGDB 2AGGX 2GX4A 2GCTC 1GI6A 3KNXA 5FPYA 4YOIA 3B8JA 3NPSA 1RTLA 4INHA 2Y7XA 4O3UA 1DITH 3PO1B 4O3TA 5I25A 1LHGH 1NPMA 2ZGBH 1YPHE 3M3SA 1ZTJA 4FUGA 4JYTA 3Q77A 3SU4A 1HJAC 1JIRA 2WV4A 1GL0E 2PUXB 4TWYA 1UTLM 1EATA 4J2YB 1MD7A 2QCYA 1CA8B 3AW1A 1T7CA 3LH1A 1YPHC 2PW8H 2Z9GA 1O32A 4Q80A 1EQ9A 5C5OA 1RTFB 2VH0A 1UVSH 3QX5H 4B76A 2G00A 2BD3A 4BXWA 5J4QA 4OS1A 2W26A 4I8HA 2PTCE 4CH2B 2G81E 2ZHQH 1A61H 2J92A 4I33A 3MU5A 1OWEA 9ESTA 2ZGXH 3BTGE 3UR9A 1CQQA 3W94A 2A7CA 4A1TA 1T8LA 4E7RG 2FDAA 1RD3B 4Y0YE 1DUAA 1OP8A 1Q3XA 1O5GH 5FPSA 4TPYA 5H4IB 1GVLA 4I8KA 1P9SA 1T32A 2ALVA 3UOPA 5AHGH 2R2MB 4MDSA 3AASA 1K1LA 1LKBA 3OYPA 3P8FA 1T8OA 4TY7A 2FS8A 1YC0A 2GDDA 2F9VA 2AGEX 1KDQB 2P8OC 3F9FA 1RJXB 3LGUA 2M5TA 3SU1A 3LC3A 2XBYA 1O2NA 4DURA 1O2TA 1VCQA 2O8LA 4K3JA 3LT3A 2FLBH 3VXFH 5JBAS 3ZZ4A 3MU4A 3NZIA 3SU2A 1C5OH 3KCGH 3TGIE 3FFGA 1LPKB 2P3UB 5C1UA 1IQEA 1BZXE 1L4ZA 5A0BA 2FOBA 2ZDLA 3KN2A 3SOSA 1ETTH 2BD5A 2XCNA 1ESTA 3BF6H 4MVNA 1O31A 1EOJA 1P2NA 2QYIA 2KAIB 3CP7A 5GCHF 4B71A 3MTYA 2FP7B 1VZQH 3T28A 3ATKA 5HYOA 1O0DH 1NRNH 1GI8B 1AB9B 3ZZ8A 4K8BA 3ZVGA 1IHTH 2ZU5A 2A1DB 2NWNA 1O3DA 1YM0A 1YPEH 2A0QB 1PJPA 5DK1A 4HZHA 7GCHG 2BHGA 2TGTA 5FXLA 1RXPA 2J2UA 4IN2A 1BQYA 2ZFPH 1BHXF 2Y80A 1WTHD 2AEIH 3MH4A 2H6MA 1NM6A 1SL3A 2IPHA 2NU2E 4B1TA 1HXEH 1P3EA 2WPLS 3NKKA 3PMHB 3SU5A 1LVOA 1TNGA 2H2ZA 4CHAC 1BRBE 1SFIA 3ITIA 1NC6A 1W13U 1XM1A 1TRYA 5JB8S 5IDKA 3O8RA 1O5AB 2AIPA 3LGYA 1E38B 1E35B 1G3CA 2EEKA 3HATH 3QGJA 1N8OC 1P2JA 2ZCLP 1SR5C 5EQSA 2GP9B 3DD2H 1O3FA 1TFXA 1W12U 1QJ7B 3A82A 1HUTH 1GJ9B 1JBUH 4OGYA 1OP2A 2GCHF 1G32B 1FQ3A 4MNXA 2BDBA 4H6SB 5FX6A 3RXKA 3MU0A 2FTMA 1FZZA 4AG2A 1CT0E 2ZTXA 3TPIZ 3R3GB 3VB7A 3NCLA 5EPNA 4XOJA 2IOTA 2ZHFH 4UEHH 2CHAC 3A80A 1SGTA 4JCNA 1UTNA 3HKIB 1DY8A 1HGTH 4U30A 3T5FH 5GJ4B 3E6PH 4FUIA 3EQ0H 5LPEA 1DVAH 2VINA 8GCHG 1NFUA 1YCPH 3V7TA 1JRSA 4LZ1H 1DLEA 1C1UH 4JZEH 4I8LA 2AMPA 3FP8E 1GJBB 1PQ5A 2V0BA 1DWDH 4ISLA 1O5BB 1WOFA 3QUMP 4ABFA 1TPPA 1ELCA 3TK9A 3OY5U 3KQBA 1H1BA 2EI6A 3BEIB 3PMBB 1OP0A 3PWBA 2GCTB 4YLQH 2VVVA 1T8NA 3BTDE 2ZGJA 1BUIA 2BMGB 3JZ1B 4K1TA 3U98H 3EGKH 4O97A 3SUFA 2PKAB 4UDWH 1SGYE 1AUJA 4D9QA 1TNJA 1T4VH 4UFFH 4A6LA 2JETC 3LH3A 7LPRA 2DE8A 1QRWA 1HJAB 5DP8A 5C20A 3OY6U 4NG9H 2D26C 3A7XA 1ACBE 3M36A 1WSSH 3ZZ5A 5A09A 2H9EH 1RIWB 1C9TA 1AIXH 3SJ8A 4O9VA 4CRFA 3A7WA 3RXUA 3UQOA 2ASUB 1C1TA 3ZZ7A 3F1SB 2FODA 1K1OA 4IMZA 1VCWA 5K0HA 2H5DA 4SGBE 1VITH 3QDZB 1OSSA 4HGCA 1K22H 2B9LA 5GCHG 1GBEA 4NA7A 1SB1H 3SNEA 1BTHH 3MO3A 4DGJA 1INCA 4AFQA 1D6RA 1GWAA 2O8TA 2G4UA 2JH6D 3A86A 3FANA 3RC4A 3ZZBA 1D3QB 1K1JA 2H9HA 1ZR0A 1ESBA 1GL1A 1P8VC 1K1IA 1TNIA 4AYYB 3EDXB 3P70B 2Y82A 1C5VA 1T31A 2BDCA 4MNYA 2C3SA 1GMHF 4RN6A 2CXVA 4NSVA 5C3NA 1IQLA 1HJ8A 4NCYA 2H5CA 1CA0C 3I78A 4BAMB 2G55A 1C5NH 1YPLH 1LVYA 1TGSZ 2SGPE 4MPVA 1C5LH 2BDIA 2OBOA 3N7OA 2BLOA 4NIXA 4GUXA 4Y11E 1C5UA 2YOLA 1FY4A 1O2QA 4YO9A 5L2YH 2P8OB 3ATWA 2WPIS 1DWBH 3D23A 1TQ0B 2V3OH 3MU8A 2A32A 5EPYA 3UPEA 1L1GA 4GSOA 5CHAC 3S9AA 2OP9A 1AFQC 4KTSA 2XCFA 4Y79A 2Z9IA 4Z6AH 2P3FH 2ZKSA 1G2MA 1S84A 1BJUA 4ABEA 1O2JA 1FI8A 3L6PA 4LK4A 1DX5M 2ODQA 2A31A 2GKVE 1MU8B 3MNSA 2ZHEH 1DPOA 1TNHA 1K2I1 2ZF0H 2VNTA 3E8LA 1KXDA 3L33A 4M7GA 3RC6A 4FUJA 5DJ7A 3VB3A 1ZZZA 1GBAA 1P11E 5DP5A 1HB0B 4DOQA 1O2XA 1NT1A 1XXFA 1FY8E 1OWJA 3LOXA 4FU7A 1GI7B 1SGDE 1H9IE 1EP6A 2V3HH 3SV8A 3KHVA 1F5KU 1NO9H 1EZUC 3RU4D 1WBGB 2A7JA 1ABIH 5DO4H 1FJSA 5DP4A 3EA9A 2XC4A 1V3XA 1IQKA 1AMHA 4OS7A 3ZZ3A 5JBBS 1IQMA 4X8SH 1XMNB 2F9OA 3SJIA 1O5DH 1LKAA 1C9PA 1XXDA 1J9CH 1O3JA 4CHAB 1LTOA 3O8CA 2OQUA 3RXDA 2CN0H 2WPJS 1V2QT 3SGAE 1P2OA 1GJCB 3ATIA 3SUEA 5E0HA 3KF2A 4AORA 3FZZA 1ZTKA 3MOCA 2AERH 1MQ6A 1TRNA 1QTFA 2OC7A 1FDPA 2ZHDA 3VEQB 4AZ2B 1O3NA 2R3UA 1ABJH 1C2LA 2BD2A 2UUFB 2YNBA 1OX1A 4INKA 2GD4B 3NUMA 4DIIH 3ZV8A 1N8OB 1XUGA 1O3KA 1H8DH 4I7YH 1C1WH 2BDAA 2F3CE 3QO6A 1DFPA 1F2SE 1ZMNA 1BMLA 1NZQH 3OX7U 3ZZAA 4IBLH 3ZZ6A 1H4WA 2C8WB 1GMDF 3SQHE 1GHWH 2UWOA 1TA2A 3HPTB 2QIQA 2ZFFH 2WYGA 4FU9A 3TH3H 2GZ9A 3H5CB 1TGNA 3I29A 1MU6B 2CHAB 1KY9A 2SGDE 3ZVEA 1CSOE 1P10A 1QB9A 3MWIU 4JK5A 1SLWB 3TIUA 1G3DA 4HTCH 1FUJA 3E1XB