1O2YA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2yA02
3UPEA 3ZVFA 2ZHDA 1BCUH 3ZZCA 4B2BA 2XW9A 3GDUA 1EPTB 1UVTH 3U1JB 1LVBA 1DITH 8LPRA 4FUDA 1WTHD 3FAOA 1BTHH 1MTNB 2Y7ZA 1UVUH 1CVWH 5HM9A 2TGAA 3GY8A 1D6RA 2BXUH 4AFQA 2G81E 1P3CA 3M7TA 2Y5HA 5DO4H 2A31A 3AASA 1FN6A 3O8BA 1Z6JH 1EAWA 3TH2H 3TH4H 1EJNA 1IAUA 1NU7B 3M3SA 1BRBE 2VIQA 2HALA 4X1NU 1C2LA 3D23A 1TGCA 1TBQH 2J38A 1YBWA 1D3DB 1T8MA 1GI5A 3SHCH 1AE5A 2TIOA 3W95A 3M5NA 2AGIX 2VVVA 1Y5UT 3HKJB 3KQBA 4A7IB 1VZQH 1PPCE 1GL0E 1O2KA 1AWHB 1G37A 4MNVA 3JZ1B 1AFEH 1UHBA 1DE7H 1A0HB 3ZYEA 1BTYA 3KQEA 3MU4A 4KKDA 1O36A 4X8UH 7GCHG 4HTCH 1QRWA 4NA8A 3A85A 1T7CA 1P02A 2W5EA 1OP2A 2A1DB 4H6SB 1DICA 3HK3B 3LH1A 1THSH 4K1EA 1QA0A 1ESBA 1NT1A 1UHBB 1CHOF 1N8OB 3QGJA 1GBAA 3PYHA 5LPRA 2I6SA 3BG8A 3OTJE 4UONA 4JZFH 4X8VH 1DSUA 1KXBA 4UDWH 1UTPA 2ZFFH 3SO3A 3R0FA 1O2XA 3TJNA 1A5GH 1GI7B 1GMDG 1QBVH 4MPVA 1MCTA 3VFEA 4ABEA 1NFWA 3AAVA 2XRCA 3U98H 5DP8A 1IHSH 2A5IA 1GG6B 3QTVH 3RXPA 4YOJA 1EXFA 2BLQA 2BD7A 1QL7A 4IW4E 2B8OH 1O2RA 3A7TA 4ABAA 1SFQB 1SVPA 3RU4E 5C5NA 1NS3A 4ZXYH 1C1NA 1FZZA 4E05H 2FEQH 2A7HA 1B0FA 1C1MA 1OWJA 1TX8A 1EOJA 2HVXA 3SU2A 3V3MA 1BTWA 4Y8XA 1AE8H 1TGNA 1TBRH 2FOBA 3FP6E 4Y8YA 3P6ZB 1ABJH 2P95A 3P8FA 2AEIH 2NU0E 2ZEBA 2ZHQH 1HAZB 3FFGA 1LQDB 3Q77A 3E0PB 2OC0A 1MKWK 1MKWH 1P01A 2AIQA 3MNXA 2SGFE 4A5TS 4Y79A 2Z3DA 4Y0YE 2F9OA 1DWDH 1ID5H 3SGBE 3MOCA 3RM0H 4FUJA 3SQHE 1IQKA 1UMAH 2ODPA 2VWMA 4J2YB 4YESB 3VB5A 1V3XA 4DIIH 1GBDA 3P70B 4ZROA 2D1JA 1W11U 1GI0A 4Q7XA 4I8LA 1MTVA 2ALVA 2VWOA 1GHAG 1O5EH 1PPFE 1DX5M 2ZCHP 4BTUB 2BLWA 1C5OH 1NRNH 3RXBA 3UTUH 3A83A 3SBKA 3GY4A 4B71A 3ATLA 1FXYA 1O30A 1TA2A 1CT2E 2R0LA 1RS0A 4FVDA 2CN0H 5A8ZA 1BUIA 4FVBA 4WH8A 2Q6GA 1HJAB 4BXSA 1JWTA 4R8TB 2JH0D 1ZOMA 4K5ZA 1W7XH 2H6MA 1ANCA 3RM2H 4Q7YA 3VXFH 4ABFA 3KF2A 1NRRH 4JMYA 3MMGA 2FLBH 2H1UA 1BOQA 1YC0A 1TMUH 3SU1A 5F8ZA 1CSOE 3ZZ4A 1NESE 4GPGA 1O3NA 1CGIE 3M37A 2TBSA 1Z1IA 4GVUA 1SMFE 3RXFA 2BY9X 2C4FH 1QURH 3GOVB 4X8SH 1C5YB 1EKBB 4VGCB 4NIWA 1FY5A 3UREA 3PMHB 3SNBA 1BMLA 2HNTF 2BDBA 2ZPQA 3UR6A 1O3MA 2A2QH 1MZDA 2I6QA 2EA3A 2DE8A 3KIDU 3RXVA 1GBFA 1LPGB 4THNH 1WQVH 3SV9A 4FUBA 5L2ZH 2ZFPH 1SQOA 4ABDA 4CHAB 1QHRB 2GMTB 1FY1A 1YLDA 2OC8A 4Y8ZA 2ZGHA 2VVUA 3VEQB 2C8ZB 3NZIA 5G4BA 2ZDKA 1LKBA 2XC4A 4OGYA 1TYNA 3SUEA 1ZTKA 3HK6B 3ATMA 2F9PA 2O9QA 3PTBA 1ARBA 1O5GH 3EA8A 1GBHA 4LZ4B 3PM3A 2OQUA 1AU8A 1EX3A 2BX3A 2HRVA 2VIPA 2JH5D 1UVPA 4DJZB 5LPEA 3PO1B 1AQ7A 5DP3A 1GHBF 1H8DH 1IQMA 2G5NA 5L2YH 5ETXA 3EE0B 1GGDC 3I77A 1OWEA 4ZUHA 1NU9A 4X2YA 1V2VT 2ZQ1A 3DD2H 3SUGA 5HXFA 2CXVA 1C2KA 1ZSKA 2R3YA 2TGPZ 4HGCA 2GV6A 2PLXA 4XFQA 5T6GA 3ZZ6A 2ZU3A 2KAIA 4YM9A 4J1YA 4IMQA 4JK5A 1O31A 3ENSB 1SLUB 2A4OA 3LKWA 2OQ5A 3ELAH 3RLYH 2IJOB 4X6PA 1EP6A 5FBIA 3BTQE 3T29A 3BTFE 1CHOG 4I8GA 2ZNKH 5LPFA 1C2HA 1B7XB 2KAIB 4B1TA 5EG4A 2BY7X 1TQ7B 2ZQ2A 1BBRE 1Y5AT 4MNYA 3V7TA 4MPWA 2FOCA 1GBTA 1O2JA 2JETC 2VVCA 2PKAA 2VINA 3BSQA 2WPLS 3SI3H 1OP8A 1WOFA 1BBRH 1BMMH 1XUGA 5GCHF 3LJOA 5DG6A 3V12A 4YZUA 1SFIA 1SL3A 4NA9H 4Y71A 2BOKA 2GP9B 1QTFA 2ZZUH 1AZ8A 3NUMA 1SBWA 1Y5BT 3BTDE 2PKAB 3SNCA 1Y3WA 3M35A 4E06H 3P8GA 1HIAA 1DT2A 1YPMH 1Z8IB 2CMYA 5FBEA 2RDLA 4IBLH 3C1KA 4FU7A 1TRNA 2QXJA 4ZH8A 4NFEA 3ATWA 3VGCB 2BZ6H 4RKOB 2XC5A 1FNIA 1GI8B 1GBKA 2GCTB 3Q00A 1P05A 2P3TB 3RXUA 5T6FA 1K2I1 1MD8A 1O2NA 1V2QT 1VGCB 1MTSA 3RMOH 1HIAB 4X1QU 1V2MT 1K1OA 2O8WA 5AFYH 5C2ZA 1O3AA 4BAQB 5T3HA 5FHTA 1GCDA 2CF9H 1S6FA 4SGBE 1KTSB 1T8NA 3M5LA 2FOAA 1KXFA 2PUXB 3E6PH 2WPKS 3F9EA 1PPEE 1A4WH 2QY0B 1AWFH 2VIVA 2XBWA 1SPJA 2HWLB 1P11E 1VITF 2VH0A 3EA7A 5FCRA 6ESTA 2VWNA 4BOHA 3PLPA 3PMAB 1HAXB 4Y11E 1LVOA 3HKIB 1TA6A 3ZZ5A 5I46H 4JZDH 4SGAE 6CHAC 4NIVA 2HPPH 2SGQE 1V2JT 1C1UH 1TNLA 3MYWA 1RFNA 1K1MA 2BD3A 1E35B 1WCZA 1HXFH 1V6DA 3SJOA 2G4TA 1JXPA 3ZYDA 1SGEE 3VB6A 1FAKH 1PFXC 4K3JA 1C4U2 1O5DH 2BD5A 2FPZA 2GV7A 3T5FH 2UWLA 5E0GA 1DXWA 5ESTE 3TITA 3BG4C 3LGYA 1V2ST 3I29A 2ZGJA 1AFQB 5E8EH 1D3PB 1OWDA 3A7VA 2RG3A 1UVSH 2SNWA 2Z3EA 1YPEH 2XNIA 3ZV9A 4H6TA 3RXLA 1O3DA 1MKXK 1MKXH 3F9HA 2BHGA 1PPBH 2ANWA 2FYQA 2ZU1A 3M61U 4X2VA 5A0CA 3ODFA 2H9EH 1P2IA 3QZQA 2PTCE 1BTPA 1LPZB 1A0LA 1O33A 1O39A 1T4VH 4MDSA 1KXAA 2O8UA 2A4QA 2FOMB 2TPIZ 3SNEA 4MNXA 4NSYA 2RA3A 2JKHA 1A3BH 3M5OA 2GZ9A 1YYY1 3M3TA 2Q6DA 1QFKH 3SQEE 1AVGH 1W8BH 2F9NA 1GJ4H 5HMAA 1EB1H 4IC5A 1PQ5A 2QCYA 1CO7E 2QXGA 3A86A 1HAYB 4MVNA 4ABIA 1QBOA 2PWXA 1Q3XA 1ZHRA 3IG6B 1KXDA 3K9XB 4XDEA 1G2LA 2AFQB 9ESTA 2BDIA 4JZEH 2R3UA 1CU1A 3FP8E 1C1QA 1C5TA 5ESBA 2BY8X 3QO6A 1BRCE 3RXKA 4ZKSU 3OY6U 2SGEE 3OSYA 1AKSA 1ELTA 3URCA 4ASHA 1C1VH 3LGVA 2FP7B 1H1BA 3ZVEA 3LIWA 3QK1A 2ZGCA 2ZFSA 2PV9B 4NWLA 1Z1JA 2BTCE 1S0QA 5GJ4B 1QNJA 5CE1A 3MTYA 1DY9A 4JYUH 5DJ7A 4IMZA 2ZU4A 2H9HA 1CA0B 5C5OA 1AKSB 4A1TA 3S9BA 1QJ7B 2C8YB 2R2MB 2TGTA 5EPNA 1TOMH 3BIUH 1XM1A 3MNSA 2YOLA 1O2MA 3MH6A 2AH4X 1W0ZU 5GDSH 1SGRE 2BDCA 3CS0A 5BPEA 1OOKB 3ATKA 3SJIA 1C5PA 3LGWA 1O2VA 2FS8A 3KEEA 3LC5A 4NWKA 1P04A 1CQQA 4E7NA 1QQUA 1C5QA 1TMBH 3QTOH 5EQSA 1C1WH 1DLKB 1YCPK 1YPHC 1Z8GA 2C8XB 1V2OT 4ZMAH 3KL6A 2YNBA 1G36A 3TGIE 5TCAA 1TB6H 3UNQA 1XXDA 3LDXH 4YLQH 2H5DA 1OKXA 1QR3E 1FY8E 1ELAA 2NWNA 3RUOA 3SU4A 4Z6AH 3AVZA 4NGAH 3SW2B 1C5MD 1J14A 2F9BH 1YP9A 2WYJA 1SOTA 1UO6A 1BMAA 1YLCA 4AB8A 3GCOA 4DURA 3VPKA 4FU9A 1V2PT 1JIMA 1GJ7B 3BV9B 3DUXH 4ABHA 1S0RA 1XX9A 4MNWA 4X1SU 1O5BB 1O2QA 3SJKA 2P3FH 2ODQA 5GCHG 2H9TH 1O3EA 1BTUA 5FX6A 1VJ9U 3HPTB 4KTUA 2BB4A 5GXPA 4JCNA 4D9QA 3DFJA 1SGQE 4OS7A 3PWCA 3AW0A 1K1LA 2SFAA 3UUZA 2EC9H 1ETRH 1ELFA 1ELGA 4AGJA 4AX9H 1TAWA 4U30A 2QF3A 3AW1A 5EOKA 4BTIB 1NPMA 2NU2E 2DE9A 1QL8A 4CR9A 3QZRA 1DXPA 4UEHH 3KNXA 2WPIS 4D76A 3TLOA 2VJ1A 1LCYA 1IQIA 3PLKA 2AS9A 1O3PB 3S7HB 1FI8A 2ZO3H 3T62A 1FONA 2J95A 1KXEA 5JBTA 3RXGA 9LPRA 2FM2A 2SGPE 2W3IA 3QWCH 1O2ZA 2CHAC 4WMEA 2FIRH 1C1TA 1C2EA 2ALPA 2R9PA 5EXNA 2XTTB 1VITG 1GBMA 1O5CB 1CBWC 1GJ9B 4AGKA 1BDAA 2Q1JA 1S82A 4B74A 5DP7A 1N1LA 2BX4A 2RCEA 3A8CA 1PYTD 3KGPA 1ZR0A 1DUAA 4HI3A 1O3FA 1GI9B 2AMQA 4YT7H 4ABJA 3IITA 4A92A 3MO3A 3Q3XA 2QF0A 1AIXH 2TRMA 1AY6H 1GDUA 1RRKA 5F6MA 1V2NT 2WUBA 3NCLA 3MU5A 1HGTH 5JBCS 3R3GB 1TGTA 1TONA 1NFYA 2BVRH 3BEIB 5FX5A 4DGJA 1AUJA 1ESTA 1SGCA 2PSYA 5EQQA 1THRH 1O0DH 1YPKH 3M5MA 1MAXA 3BEFB 1OPHB 4TPYA 1BZXE 1A3EH 1HAVA 1V2WT 3ATIA 2VIDA 1SGFG 2W3KA 5JBBS 3V0XA 2STAE 1ZPBA 4X8TH 3BTKE 4K69A 3PB1E 1H4WA 1LHDH 1HAVB 3PWBA 4AYVB 1PQAA 2W7SA 1P10A 5C1UA 4YOGA 2GZ8A 1KXCA 3M7UA 1PPGE 1DPOA 1DS2E 2FTLE 1DSTA 1O3IA 3UNRA 1DVAH 1AVWA 1GBEA 1S84A 1XXFA 1V2TT 1HAGE 1YKTA 4O97A 4CBNA 2QC2A 2Y82A 1A61H 1IHTH 1D3TB 3TJVA 1DDJA 1FMGA 1TIOA 1DM4B 1HXEH 1HAOH 3SORA 3RC5A 1GHVH 1UK2A 2AGGX 1UTQA 4JZIA 3LJJA 4GCHF 4YLUA 1PQ7A 1Q2WA 4O3TA 3TK5A 3S7KB 4U2WA 1G9IE 5DGJA 2HPQH 3GY5A 1E34B 4Q80A 2PHBA 2WPMS 3TK6A 1SQAA 4CRDA 1A1RA 3RXQA 4Z0KA 2ZCKP 3TK9A 1SC8U 2BDGA 3MO9A 1WUNH 3MH5A 1TWXB 4B76A 4D9RA 3SV2H 2IOTA 4AORA 1DOJA 3ITIA 1AB9B 1C5UA 1RTKA 1ELCA 2NU4E 1GI3A 5EODA 1YPHE 3PTNA 4I8JA 1GDNA 4NFFA 1Y59T 3A8DA 4X0WU 3RXCA 1RJXB 3DT0H 2ODYB 2AMDA 1TFXA 2F91A 1VCPA 1UK3A 2ZFQH 2BD2A 1LHCH 4ISIH 5CMXH 3F9FA 1G32B 1SR5C 4AG1A 4A1VA 1C2JA 1ETTH 2XC0A 2PW8H 5GPIB 1C5NH 5EQRA 4LZ1H 1G3CA 1V2KT 1AB9C 1O2GH 4LXBH 3ZZBA 1ETSH 2HLCA 1KLTA 1BJVA 2D26C 1OYQA 2BLVA 4B2AA 3UR9A 1HAHH 1O2PA 2FZZA 1Z8JB 3BTWE 2P16A 2PSXA 4CREA 4WMDA 4Y6DA 2FI5E 3TNSA 5A8XA 3P17H 2BMGB 3ZVCA 1MAYA 2J94A 2QA9E 1GI4A 1OWIA 3PROA 5JPMH 4CRGA 3PMJA 2ZIQH 4CH2B 1KIGH 1LPKB 2ILNA 3S9AA 1AO5A 3BTGE 2OCVB 1ZMLA 1C2IA 1DY8A 1FV9A 1ZPCA 1XVMA 2FWWA 1O37A 2VGCC 1C2GA 1GGDB 1L1JA 4X6NA 4ZKNU 5K0HA 1IQHA 2ZPSA 1G3DA 1D9IA 1P9UA 2P8OC 4K2YA 2ZDVH 4I33A 4XE4A 3ZZ3A 2D2DA 3URDA 3GCTG 1MU8B 5FPSA 4ZHMU 3ZZ8A 5DK1A 4AB9A 3U8TH 3E90B 1UK4A 3RMLH 1TGBA 1WBGB 2AERH 2VNTA 1VJAU 3U1IB 1A5HA 2K1QA 1MUEB 1P8VC 2NU3E 4ISNA 4ZAEA 1F2SE 4TPIZ 1YF4A 3FZZA 1ZJKA 2UUYA 4YT6H 2OBOA 1XVOA 3LGUA 3Q3KA 5JB8S 1KYNA 2GZ7A 4TY7A 3D49H 1P2MA 4K1SA 3OY5U 3LOXA 4B75A 3MU0A 3ZZDA 2JETB 1AMHA 1ZGVA 2ZPRA 4XSKU 4ZHLU 3SV6A 3DA9B 5I25A 4DG4A 3U8RH 3O8CA 2F9UA 2GKVE 1GMCF 2WPJS 5DP9A 1ELVA 8GCHF 1QB6A 4GLYA 3UIRA 1FQ3A 2LPRA 2B7DH 4M7GA 3MHWU 1GDQA 1BITA 4KP0A 3T27A 2STBE 5JDUB 1OWHA 1ZSLA 4LOYH 4X2XA 3A7XA 3KQCA 4K60A 4BAOB 1JOUB 1L4ZA 3S9CA 1AD8H 3K6YA 2WUCA 4AOQA 3ZZAA 3EQ0H 2CJIA 1G2MA 1ZMNA 3D62A 1DLEA 3Q76A 5L30H 2G5VA 2Z9GA 3NXPA 1O2HA 3GICB 1S6HA 2G4UA 1C2MA 1P12E 2QN5T 4X6OA 2JH6D 1TNJA 3LU9B 3TH3H 1O3OA 2ZTXA 4MG3A 1JBUH 1T8LA 1ZHMA 2VH6A 1GVLA 1XUJA 2FTMA 3SGAE 1P0SH 2EI8A 1ANEA 2Y80A 3RMMH 4ESTE 1C5SA 3OYPA 2GCHG 4OS1A 5LGOA 4INKA 3ZV8A 3E8LA 1ARCA 4OGXA 5FAHA 1TPPA 3RXSA 1QIXB 3BTEE 6CHAB 1KLIH 2RA0A 2FYRA 2C3SA 3NKKA 5LH8A 1GI2A 1GWAA 4D7FA 3RXAA 3UQOA 3A8BA 2QAAA 1NRQH 3JZ2B 1E36B 3SOSA 2PKSC 1IQFA 1EJMA 2P3UB 3RXTA 3DFLA 1HJ9A 1C2DA 3A82A 4YTAA 2QXIA 1AN1E 2F9VA 4CR5A 1HJ8A 2BOHB 3F1SB 3GY2A 1SLVB 5TJXA 2FX6A 2ZHEH 1K21H 5DPAA 2P59A 1O3JA 4F4OC 3QLPH 4WJG2 1YGCH 4XBDA 1ORFA 4OS2A 1O3BA 3BG4B 1ELDE 4GCHG 1K9OE 1KLJH 1OS8A 4WWYA 1IQLA 4FU8A 1Y3YA 4U32A 5T6DA 1TBZH 3O8DA 3FVFB 1QL9A 5EPYA 1F5LA 1PPHE 2GVFA 3KN2A 5L6NH 1ZHPA 1SGIB 1EZSC 1VCWA 5EU8A 4I8HA 3FP7E 4Q7ZA 4AYYB 1ABIH 1TNIA 1QRXA 3RMNH 1SLXB 4GSOA 2B0FA 1RIWC 5DKMA 4JYVH 1KDQA 1Q31A 3ZZ7A 3Q3YA 1GJCB 3UNSA 4FUEA 1K1JA 1F5RA 1VR1H 4IGDA 3H7TA 4NA7A 2BXTH 4O03A 1EQ9A 4ZXXH 1O35A 1V2UT 1DWEH 3SI4H 1GJAB 1B5GH 1P2JA 2LNCA 3B9FH 3QDZB 2BY6X 4Y76A 4UFDH 2Z6BD 1AGJA 2BZAA 1HAIH 1EAUA 1KDQB 1ANDA 2ZDAH 3GCHC 3MFJA 5HGGA 3T26A 1ELEE 1UTKA 2O8TA 3A7YA 1JIRA 5B6OA 2ZECA 1LHGH 3BTME 2WYGA 4GUXA 3A80A 3EA9A 1Y8TA 1F92A 1GBJA 1NRSH 1ZTJA 2OP9A 1NM6A 2ZP0H 1C5WB 1Z71A 4AFUA 1ELBA 2FX4A 1T8OA 5A09A 2OD3B 1AI8H 1GBBA 1YPJH 3UY9A 3A84A 4E7RG 4BTTB 2GDDA 1UCYE 4IS5A 4BAMB 4CRBA 1FY4A 1MMJN 2EI7A 1W10U 3HATH 1AHTH 1GVKB 4ZKRU 3PLBA 3SNAA 2HNTE 3KQDA 1UCYK 5EXMA 1UTMA 2CV3A 2DUCA 3MWIU 4DCDA 1BTXA 3GYMA 1YCPM 1EJAA 1O32A 1SSXA 8KME2 4F49A 3SU0A 4MPUA 1MD7A 3NK8A 3OX7U 1QGFA 4GAWA 4KGAA 1HUTH 3SHAH 5FCKA 3ZVAA 4BNRA 1EZUC 3H5CB 4ISLA 1XUKA 2A45B 1SGPE 1GCTC 3B23B 1W14U 1JRTA 1A7SA 1EP5A 3D65E 3RP2A 2BQWB 3P8OA 5SGAE 1TQ0B 1BA8B 1HAPH 4B2CA 4FUFA 4IN2A 1W0YH 1SHHB 2HGTH 1OWKA 2VIOA 4BANB 4WXIA 1FLEE 3A88A 2ULLA 3VB4A 2V3HH 5BRRE 4WXVA 1GBCA 1TGSZ 1GMCG 2XBVA 1YCPH 8GCHG 2GGVB 1IQNA 2WINI 4X2WA 2J34A 1EAIA 1O2YA 2Y7XA 1TNGA 1S85A 2J92A 5FPTA 2A32A 4X6MA 3RLWH 2O8LA 5DP4A 1GI6A 2BYAX 1QB1A 1QJ6B 1GI1A 1C5RA 2VB0A 1FJSA 5CHAC 3UOPA 2BVXH 5E0JA 3UWIA 3ZVBA 1K1NA 2HOBA 1S5SA 3M3VA 3E16B 4KTCA 2OLGA 4FUGA 2P93A 3W94A 4I7YH 2V35A 1TOCB 1ZMJA 1GJ5H 1J9CH 1SB1H 1U6QA 1C4Y2 2ZTYA 1EPTA 3TGKE 4U01A 1HYLA 3U69H 1EAXA 1O3HA 4K1TA 2ZTZA 1L2EA 2AGEX 3GCTF 1O2SA 3I78A 1IQJA 2CHAB 2G51A 4Y7BA 2A4RA 2FI4E 1HPGA 2PR3A 1L1NA 1CBWB 4GHQA 5EW1H 2R0KA 1IQEA 3SV8A 1BMNH 4TWYA 3MNCA 3SUFA 1FIZA 1CT4E 1TALA 3SNDA 3SV7A 2QIQA 3SJ8A 3TU7H 1C2FA 1LKAA 3OU0A 4X1PU 2UUJB 1J15A 3AAUA 3GCNA 4MLFB 2F3CE 1HV7A 1Z6EA 3NPSA 3EAJA 4CBOA 2GDEH 1UTLM 3BN9A 1TX7A 1TRYA 4CRFA 3FANA 1WSSH 1EPTC 1TPAE 1RTFB 1QY6A 1MTNC 1C5ZB 3EDXB 4A1XA 4UE7H 6GCHF 1C1OA 3SJ9A 1MQ5A 4NZQA 1O2TA 1QJ1B 1VITH 1SGNE 1LVYA 4BAKB 1EATA 4WMFA 3UOUA 4XBCA 4OS5A 1K1IA 2ASUB 1A46H 3LT3A 2FOEA 3SU3A 2Y5FA 2XBXA 2ZDMA 2OXSA 1V2RT 3U9AH 4OS4A 1J8AA 1UVOA 3N7OA 3V13A 4INLA 3BIVH 1C1PA 5GIBA 3E91A 2ZU5A 1W7GH 3CS7A 2G55A 4FUIA 5EGMA 1TPSA 4HFPB 2BY5X 1DWBH 2GCHF 4K8BA 3VXEH 1WV7H 4LK4A 1G3EA 1T32A 3SUDA 2XCFA 3RXDA 4RN6A 5AVDA 4CH8B 1O3CA 3BTHE 5JB9S 4MPXA 1Y3XA 3E0NB 3ZVGA 1ZJDA 1C5VA 2SGDE 4NIYA 2FLRH 3NWUA 1BTZA 4TYDA 1LTOA 1HB0B 3LONA 1RGQA 1C5XB 1EB2A 1N8OC 3S0NA 1LQEA 1BJUA 1TNHA 5AFZH 4I31A 3U8OH 3RXRA 1QBNA 2QV1A 1W13U 2ZF0H 2BM2A 4AZ2B 4DIHH 2FS9A 3M36A 1ACBE 1KTTB 1P2KA 4WH6A 1HBTH 1P2QA 1GHZA 1PYTC 5EXLA 4RSPA 1E37B 5C1YA 3QGNB 1GJBB 1BIOA 4JK6A 1UTNA 1P2NA 3RXMA 4O9VA 1ZLRA 5HM2A 1GG6C 5F8TA 2WV4A 1SI5H 1L1GA 2UWPA 3RDZA 5EW2H 1O34A 1P9SA 1BHXB 4D7GA 5JBAS 2EI6A 1MTUA 3H7OA 1IQGA 3MU8A 1JRSA 1SG8B 2IPHA 1SLWB 5H4IB 3MH7A 1GHXH 2ESTE 1GJDB 1XMNB 1CE5A 1SGDE 1AVXA 4YO9A 4Y7AA 1K1PA 4FUCA 2W26A 1L0ZA 2Y5GA 3BTTE 1BHXF 1FIWA 2UUFB 4TY6A 3K6ZA 1DWCH 1O2UA 4Q2KA 1FDPA 1YPGH 1GHWH 2J2UA 4MTBA 2GTBA 1WAYB 3RXIA 2AYWA 1M9UA 1K28D 2XWBI 3ZVDA 5HYOA 5DP6A 2B9LA 2Z7FE 2A4GA 1EASA 1TPOA 1GPZA 1HNEE 5AHGH 4NSVA 3T2NA 2GT8A 1FUJA 1HFDA 1QA7A 3PMBB 2WV5A 3STJA 5C1XA 1OYTH 3GYLB 2VGCB 1SQTA 4WF8A 3P95A 2ZDNA 3L3TA 1X7AC 1QRZA 1RTLA 2FODA 3TNTA 4X1RU 5J4SA 2AIPA 2Z3CA 3T25A 2J4IA 4JZ1A 1F0RA 2P8OB 1D3QB 1H9HE 1LMWB 1WQSA 3A7ZA 2Z94A 5TCCA 1GMHF 3ESTA 4ABGA 5IDKA 3PV4A 3RU4T 2XBYA 4A6LA 1DFPA 2XWAA 2J9NA 1C9PA 1MQ6A 4I8KA 1INCA 3MI4A 2ZU2A 1O2OA 2C93B 4YOIA 5A2MH 1LHFH 1UTJA 3KCGH 2Z9IA 3TJOA 1P2OA 3SU6A 1HJAC 2THFB 1P09A 3VB3A 2CF8H 2B5TB 5FXLA 3GDSA 4XOJA 1O3KA 3RXEA 1YM0A 2FDAA 3UFAA 3FZDA 1F0TA 2NU1E 4DY7B 1E38B 3B8JA 1TE0A 2ZA5A 4OS6A 2BDHA 2ANKH 4FXGH 2HNTC 1Z7KA 3UQVA 1SGTA 1NRPH 1LHEH 3MU1A 2A7CA 5K7RA 4Y0ZE 2G8TA 2F83A 3TVJB 1DANH 2ZGBH 1GJ8B 3LC3A 2VWLA 4VGCC 1B0EA 3E1XB 2Q6FA 1BQYA 1ANBA 3GY7A 3QX5H 4XBBA 1BRUP 5C20A 1QCPA 1F7ZA 2Z9KA 2OUAA 1S83A 5AF9H 1O2WA 3DHKH 3BEUA 1N6YA 4AG2A 4CHAC 1MCVA 8ESTE 3RC4A 1GL1A 1T4UH 2GMTC 2BDYA 4MQAA 1OX1A 3LGIA 2AMPA 4ISHH 4KELA 3CENA 3GY3A 6GCHG 2BD9A 2ZI2H 1H8IH 1EZXC 1O5FH 3TPIZ 3VB7A 3SGQE 2GT7A 4AFZA 3A7WA 2A7JA 1UJ1A 1A2CH 1NO9H 3UWJH 3M7QA 1O2LA 3IWMA 2PTNA 4DW2U 1P03A 5GWZA 1TRMA 3PO1C 2R2WU 1N6XA 1C4V2 1OXGA 2BD8A 3RC6A 1MH0A 1BRAA 1ZRBA 2PKSB 1C1RA 2ZHWH 3G01A 3C27B 5E0HA 1FN8A 1LO6A 2OTVA 1CGHA 4UD9H 1J17T 1A5IA 1MZAA 3A89A 1C5LH 3ODDA 2ZCLP 4UFGH 4IC6A 1ZPZA 1BBRK 4TWWA 4H4FA 5DP5A 3LGTA 2A5AA 4BAHB 2P94A 1C9TA 5E2OA 2FOFA 3QUMP 1MTWA 4RKJB 4O3UA 4ISOA 2G00A 2VU8E 1V2LT 4ZKOU 3EYDA 2OC1A 1FAXA 1HCGA 2ZG0H 3ZZ9A 2GX4A 1EOLA 1HDTH 4HZHA 4AFSA 2PGBB 1XUFA 1O3LA 1P57B 3LPRA 4INHA 1RIWB 4NCYA 5C67A 5JYIA 3RXOA 1NFXA 1TMTH 3MO6A 1RD3B 4UFEH 2M5TA 4Y10E 2FOHA 3GY6A 1GBIA 2ZHFH 5ABWA 1NFUA 1ZGIA 1ZZZA 7GCHF 1S81A 2O8MA 1LVMA 3QN7A 1T31A 2PFEA 1EUFA 1H9IE 3GCHB 3T28A 1Z8RA 1XKBC 1GBLA 1GVZA 1PJPA 1O2IA 1BB0B 2D8WA 3K65B 1BT7A 1WTGH 3VGCC 1E0FD 1NY22 1W2KH 2QGRA 4DOQA 2ANYA 1D6WA 1L4DA 1SGFA 4PROA 2H5CA 3GDVA 3RU4D 2GCTC 2Y81A 3O8RA 3A87A 2XYAA 1NROH 3A8AA 1CT0E 1VGCC 5A0AE 1TX6A 5A8YA 2EEKA 3RXHA 1W3CA 2IN2A 4B73A 4CRAA 2FXRA 4DT7B 1TLDA 2UUKB 1XKAC 1GMDF 1CGJE 2BQ7B 2Z9LA 2YNAA 5J4QA 4DVAU 5E2PA 1NC6A 2H2ZA 2A2XH 1YPLH 1Y3UA 2Y6TA 3S69A 4FUHA 2TGDA 2OBQA 1ZTLA 2ZDLA 2UWOA 1F0UA 1J16A 4WY3A 1PPZA 1UTOA 1FPHH 1DUEA 1XUIA 1MU6B 1AUTC 2FMJA 3EGKH 4NIXA 1KY9A 1MBQA 1G3BA 2GD4B 3K2UA 1O38A 3TIUA 2FO9A 2ZC9H 1CHGA 2G52A 4K8YA 1ZRKA 2SNVA 2QXHA 2ZKSA 1D4PB 1GMHG 3WY8A 1FY3A 1H9LB 2QYIA 4BXWA 1C1SA 1QQ4A 1AZZA 1O5AB 1PQ8A 1MBMA 1KSNA 1TABE 1GCTB 1LDTT 4ZHAA 2BDAA 1UCYH 2A0QB 4NZLA 5PTPA 3HGPA 2BQ6B 3BF6H 5F03A 3KHVA 1VCQA 5IYTA 5A0BA 1Y3VA 1W12U 4KTSA 7KMEH 2XXLA 3GISB 2V0BA 3L6PA 4QT8C 2VIWA 2FESH 3MNBA 1AFQC 2SGAA 1WU1A 4UFFH 1THPB 1HLTH 2V3OH 2XCNA 3RXJA 4R0IA 2CGAA 3MH4A 1FPCH 3E3TA 3P8NA 2Z9JA 1F5KU 5F8XA 1GHAF 4WVPE 5C3NA 1OSSA 1A0JA 4NG9H 2A5KA 4IN1A 2BLOA 4GHTA 4CRCA 2ZWLH 3F9GA 1HRTH 3SN8A 5CHAB 3F68H 1SGYE 1P06A 3CP7A 1CA8B 3F6UH 2V6NA 2OC7A 1OP0A 4JYTA 1F0SA 2C90B 3SU5A 6LPRA 1EZQA 1RXPA 3STIA 1QB9A 1O3GA 1P3EA 1XUHA 1GHBG 3HGNA 7ESTE 3TGJE 4ABBA 4I32A 3L33A 2FOGA 1NZQH 4H42U 1SHYA 2ZFTA 3LH3A 2W7UA 2PGQB 4D8NA 2ZFRH 1GHYH 1GJ6A 2ZGXH 2WPHS 5FPYA 1G30B 1SOZA 2BD4A 2ANMH 1ZYOA 1WYKA 2FI3E 1NTPA 3TJUA 2BVSH 1ZSJA 1JMOH 3A81A 1CA0C 2OINA 1NN6A 4AN7A 3P92A 3SZNA 1TNKA 7LPRA 2C8WB 2PUQH 1K22H 1ESAA 1IOEA
chains in the Genus database with same CATH superfamily
3UPEA 3ZVFA 2ZHDA 1BCUH 3ZZCA 4B2BA 2XW9A 2JJ1D 1H8ED 3GDUA 1EPTB 2VBCA 1UVTH 3U1JB 1LVBA 1DITH 8LPRA 4FUDA 1WTHD 3FAOA 3H09A 1BTHH 1MTNB 2Y7ZA 1UVUH 1CVWH 5HM9A 2TGAA 5EIYA 3GY8A 1D6RA 2BXUH 4AFQA 2G81E 1P3CA 3M7TA 2Y5HA 5DO4H 2A31A 3AASA 1FN6A 3O8BA 1Z6JH 5EJZA 1EAWA 3TH2H 3TH4H 1EJNA 1IAUA 1NU7B 2RFKC 3M3SA 1BRBE 2VIQA 2HALA 2GJGA 4X1NU 1C2LA 3D23A 1TGCA 1TBQH 2J38A 1YBWA 1D3DB 1T8MA 1GI5A 3SHCH 1AE5A 2TIOA 3W95A 3M5NA 2AGIX 2VVVA 4TT3D 1Y5UT 3HKJB 3KQBA 4A7IB 1VZQH 3F2HA 1PPCE 1GL0E 1O2KA 4FETA 1AWHB 1G37A 4MNVA 3JZ1B 1AFEH 1UHBA 1DE7H 1A0HB 3ZYEA 1BTYA 3KQEA 3MU4A 4KKDA 1O36A 4X8UH 7GCHG 4HTCH 1QRWA 4NA8A 3A85A 1T7CA 1P02A 2W5EA 1OP2A 2A1DB 4H6SB 1DICA 3KYFA 3HK3B 3LH1A 1THSH 4K1EA 1QA0A 1ESBA 1NT1A 1UHBB 1CHOF 1N8OB 2WZQA 3QGJA 1GBAA 3PYHA 5LPRA 2I6SA 3BG8A 3OTJE 4ACAA 4UONA 4JZFH 4X8VH 1DSUA 1KXBA 4UDWH 1UTPA 2ZFFH 3SO3A 3R0FA 1O2XA 3TJNA 1A5GH 1GI7B 1GMDG 1QBVH 4MPVA 1MCTA 3VFEA 4ABEA 1NFWA 3AAVA 2XRCA 3U98H 5DP8A 1IHSH 2A5IA 3N7DA 1GG6B 4Q63A 3QTVH 3RXPA 4YOJA 1EXFA 2BLQA 2BD7A 1QL7A 4IW4E 2B8OH 1O2RA 3A7TA 4ABAA 1SFQB 1SVPA 3RU4E 5C5NA 1NS3A 4ZXYH 1C1NA 1FZZA 4E05H 2FEQH 2A7HA 1B0FA 1C1MA 1OWJA 1TX8A 1EOJA 2HVXA 3SU2A 3V3MA 1BTWA 4Y8XA 1AE8H 1TGNA 1TBRH 2FOBA 3FP6E 3OTPA 4Y8YA 3P6ZB 1ABJH 2P95A 3P8FA 2AEIH 2NU0E 2ZEBA 2ZHQH 1HAZB 3FFGA 1LQDB 3Q77A 3E0PB 2OC0A 1MKWK 1MKWH 1P01A 2AIQA 3MNXA 2SGFE 4A5TS 3DSGA 2Z3DA 4Y0YE 4Y79A 2F9OA 5C17A 1DWDH 1ID5H 3SGBE 3MOCA 3RM0H 4FUJA 3SQHE 1IQKA 1UMAH 2ODPA 2VWMA 4J2YB 4YESB 3VB5A 1V3XA 4DIIH 1GBDA 3P70B 4ZROA 2D1JA 1W11U 1GI0A 4Q7XA 4I8LA 1MTVA 2ALVA 2WSSD 2VWOA 1GHAG 1O5EH 1PPFE 1DX5M 2ZCHP 4BTUB 2BLWA 1C5OH 1NRNH 3RXBA 2J97A 3UTUH 3A83A 3SBKA 3GY4A 4B71A 3ATLA 1FXYA 1O30A 1TA2A 1CT2E 2R0LA 1RS0A 4FVDA 2CN0H 5A8ZA 1BUIA 4FVBA 4WH8A 2Q6GA 1HJAB 4BXSA 1JWTA 4R8TB 2JH0D 1ZOMA 4K5ZA 3PV2A 1W7XH 2H6MA 1ANCA 3RM2H 4Q7YA 5KECA 3VXFH 4ABFA 3KF2A 1NRRH 5FL7D 4JMYA 3MMGA 2FLBH 2H1UA 1BOQA 1YC0A 1TMUH 3SU1A 5F8ZA 1CSOE 3ZZ4A 1NESE 4GPGA 1O3NA 1CGIE 3M37A 5KEDA 2TBSA 1Z1IA 4GVUA 2J5UA 4ASUD 1SMFE 3RXFA 2BY9X 2C4FH 3UB0A 1QURH 3GOVB 4X8SH 1C5YB 1EKBB 4VGCB 4NIWA 1FY5A 3UREA 3PMHB 3SNBA 1BMLA 2HNTF 2BDBA 2ZPQA 3UR6A 1O3MA 2A2QH 1MZDA 2I6QA 2EA3A 2DE8A 3KIDU 3RXVA 1GBFA 1LPGB 4THNH 1WQVH 3SV9A 1BMFD 4FUBA 5L2ZH 2ZFPH 1SQOA 4ABDA 4CHAB 3OFND 1QHRB 5IK2D 4Q4LA 2GMTB 1FY1A 1YLDA 2OC8A 4Y8ZA 2ZGHA 2VVUA 3VEQB 2C8ZB 3NZIA 5G4BA 2ZDKA 2XOKD 1LKBA 2XC4A 4OGYA 1TYNA 3SUEA 1ZTKA 3HK6B 3ATMA 2F43B 2F9PA 2O9QA 3PTBA 1ARBA 1O5GH 3EA8A 1GBHA 4LZ4B 3PM3A 2OQUA 1AU8A 1EX3A 2BX3A 2HRVA 2VIPA 2JH5D 3PRDA 1UVPA 4DJZB 5LPEA 3PO1B 1AQ7A 4RI0A 5DP3A 1GHBF 1H8DH 1IQMA 2G5NA 5L2YH 5ETXA 3EE0B 1GGDC 3I77A 1OWEA 4ZUHA 1NU9A 4X2YA 1V2VT 2ZQ1A 3DD2H 3SUGA 5HXFA 2CXVA 1C2KA 1ZSKA 2R3YA 2TGPZ 4HGCA 2GV6A 2PLXA 4XFQA 5T6GA 3ZZ6A 2ZU3A 2KAIA 4YM9A 4J1YA 4IMQA 4JK5A 1O31A 3ENSB 1SLUB 2A4OA 3LKWA 2OQ5A 3ELAH 3RLYH 2IJOB 4X6PA 1EP6A 5FBIA 3BTQE 3T29A 3BTFE 1CHOG 4I8GA 2ZNKH 5LPFA 1C2HA 1B7XB 2KAIB 4XD7D 3CNRA 4B1TA 5EG4A 2BY7X 1TQ7B 2ZQ2A 1BBRE 1Y5AT 4MNYA 2JIZD 3V7TA 4MPWA 2FOCA 1GBTA 1O2JA 2JETC 2VVCA 2PKAA 2VINA 3BSQA 2WPLS 3SI3H 1OP8A 1WOFA 1BBRH 1BMMH 1XUGA 5GCHF 3LJOA 5DG6A 3V12A 4YZUA 1SFIA 1SL3A 4NA9H 4Y71A 2BOKA 2GP9B 1QTFA 2ZZUH 1AZ8A 3NUMA 1SBWA 1Y5BT 3BTDE 2PKAB 3SNCA 1Y3WA 3M35A 4E06H 3P8GA 1HIAA 1DT2A 1YPMH 1Z8IB 2CMYA 5FBEA 2RDLA 4IBLH 3C1KA 4FU7A 1TRNA 2QXJA 4ZH8A 4NFEA 3N99A 3ATWA 3VGCB 2BZ6H 4RKOB 2XC5A 1FNIA 1GI8B 1GBKA 2GCTB 3Q00A 1P05A 2P3TB 3RXUA 5T6FA 1K2I1 1MD8A 5HIZA 1O2NA 1V2QT 1VGCB 1MTSA 3RMOH 1HIAB 4X1QU 1V2MT 1K1OA 2O8WA 5AFYH 5C2ZA 1O3AA 4BAQB 5T3HA 5FHTA 1GCDA 2CF9H 1S6FA 4SGBE 1KTSB 1T8NA 3M5LA 2FOAA 1KXFA 2PUXB 3E6PH 2WPKS 3F9EA 1PPEE 1A4WH 2QY0B 1AWFH 2VIVA 2XBWA 1SPJA 2HWLB 1P11E 1VITF 2VH0A 3EA7A 5FCRA 5B6LA 6ESTA 2VWNA 4BOHA 3PLPA 3PMAB 1HAXB 4Y11E 1LVOA 3HKIB 3MQKC 1TA6A 3ZZ5A 5I46H 4JZDH 4SGAE 6CHAC 4NIVA 2HPPH 2SGQE 1V2JT 1C1UH 1TNLA 3MYWA 1RFNA 1E1RD 1K1MA 2BD3A 1E35B 1WCZA 1HXFH 1V6DA 3SJOA 3F0OA 2G4TA 1JXPA 4RT0A 3ZYDA 1SGEE 3VB6A 1FAKH 1PFXC 4K3JA 1C4U2 1O5DH 2BD5A 4DT4A 2FPZA 3GS9A 2GV7A 3T5FH 2UWLA 5E0GA 1DXWA 5ESTE 3TITA 3BG4C 3LGYA 1V2ST 3I29A 2ZGJA 1AFQB 5E8EH 1D3PB 1OWDA 3A7VA 2RG3A 2AHME 1UVSH 2SNWA 1SKYE 1YPEH 2Z3EA 2XNIA 3ZV9A 4H6TA 3RXLA 1O3DA 1MKXK 1MKXH 2J98A 3F9HA 2BHGA 1PPBH 2ANWA 2FYQA 2XNDD 2ZU1A 3M61U 4X2VA 3KQ5A 4ZCNA 3ODFA 5A0CA 2H9EH 1P2IA 3QZQA 2PTCE 1BTPA 1LPZB 1A0LA 1O33A 1O39A 1T4VH 4MDSA 1KXAA 2O8UA 2A4QA 3DSOA 2FOMB 2TPIZ 3SNEA 4MNXA 4NSYA 2RA3A 2JKHA 1A3BH 3M5OA 2GZ9A 1YYY1 2J98B 3M3TA 2Q6DA 2EQNA 1QFKH 3SQEE 1AVGH 1W8BH 2F9NA 1GJ4H 5HMAA 1EB1H 4IC5A 1PQ5A 2QCYA 1CO7E 2QXGA 3A86A 1HAYB 4MVNA 4ABIA 1QBOA 2PWXA 1Q3XA 1ZHRA 3IG6B 4OM9A 1KXDA 3K9XB 4XDEA 1G2LA 2AFQB 9ESTA 2BDIA 4JZEH 3F0PA 2R3UA 1CU1A 5F53A 3FP8E 1C1QA 1C5TA 5ESBA 2BY8X 3QO6A 1BRCE 3RXKA 4ZKSU 3OY6U 2SGEE 3OSYA 1AKSA 1ELTA 3URCA 4ASHA 1C1VH 3LGVA 2FP7B 1H1BA 3ZVEA 3LIWA 3QK1A 1MABB 2ZGCA 2ZFSA 2PV9B 4NWLA 1Z1JA 2BTCE 1S0QA 5GJ4B 1QNJA 5CE1A 3MTYA 1DY9A 4JYUH 5DJ7A 4IMZA 2ZU4A 2H9HA 1CA0B 5C5OA 1AKSB 4A1TA 3S9BA 1QJ7B 2C8YB 2R2MB 2TGTA 5EPNA 1TOMH 3BIUH 1XM1A 3MNSA 2YOLA 1O2MA 3MH6A 2AH4X 1W0ZU 5GDSH 1SGRE 2QE7D 2BDCA 3CS0A 5BPEA 1OOKB 1WDIA 3ATKA 3SJIA 1C5PA 3LGWA 1O2VA 2FS8A 3KEEA 3LC5A 4NWKA 1P04A 1CQQA 1YY3A 4E7NA 1QQUA 1C5QA 1TMBH 3QTOH 5EQSA 1C1WH 1DLKB 1YCPK 1YPHC 1Z8GA 2C8XB 1OHHD 1V2OT 5DSFA 4ZMAH 3KL6A 2YNBA 1G36A 3TGIE 5TCAA 1TB6H 3UNQA 1XXDA 3LDXH 4YLQH 2H5DA 1OKXA 1QR3E 4B6EA 1FY8E 1ELAA 2NWNA 3RUOA 3SU4A 4Z6AH 3AVZA 4NGAH 3SW2B 1C5MD 1J14A 2F9BH 1YP9A 2WYJA 2QF4A 1SOTA 1UO6A 1BMAA 1YLCA 4AB8A 3GCOA 4DURA 3VPKA 4FU9A 1V2PT 1JIMA 1GJ7B 3BV9B 3DUXH 4ABHA 1S0RA 1XX9A 4MNWA 4X1SU 1O5BB 1O2QA 3SJKA 2P3FH 2ODQA 5GCHG 2H9TH 1O3EA 1BTUA 5FX6A 1VJ9U 3HPTB 4KTUA 2BB4A 5GXPA 4JCNA 4D9QA 3DFJA 1SGQE 4OS7A 4AC9A 3PWCA 3AW0A 1K1LA 2SFAA 3OEED 3UUZA 2EC9H 1ETRH 1ELFA 1ELGA 4AGJA 4AX9H 1TAWA 4U30A 2QF3A 3DSPA 3AW1A 5EOKA 4BTIB 1NPMA 2NU2E 4ACBA 2DE9A 1QL8A 4CR9A 3QZRA 5C0TA 1DXPA 4UEHH 3KNXA 2WHXA 2WPIS 4D76A 3TLOA 2VJ1A 1LCYA 1IQIA 3PLKA 2AS9A 1O3PB 3S7HB 1FI8A 2ZO3H 3T62A 1FONA 2J95A 1KXEA 5JBTA 3RXGA 9LPRA 2FM2A 2SGPE 2W3IA 3QWCH 1O2ZA 2CHAC 4WMEA 2FIRH 1C1TA 1C2EA 2ALPA 2R9PA 5EXNA 2XTTB 3F2GA 1VITG 1GBMA 1O5CB 1CBWC 1GJ9B 3VG8A 4AGKA 1BDAA 2Q1JA 1S82A 4B74A 5DP7A 1N1LA 2BX4A 2RCEA 3A8CA 1PYTD 3KGPA 1ZR0A 1DUAA 4HI3A 1O3FA 1GI9B 3WWFA 2AMQA 4YT7H 4ABJA 3IITA 4A92A 3MO3A 2KCAA 1NBMD 3Q3XA 2QF0A 1AIXH 2TRMA 2LELA 1AY6H 1GDUA 5EJ1A 1RRKA 5F6MA 1V2NT 2WUBA 3NCLA 3MU5A 1HGTH 5JBCS 3R3GB 1TGTA 1TONA 1NFYA 2BVRH 3BEIB 5FX5A 4DGJA 1AUJA 1ESTA 1SGCA 2PSYA 5EQQA 1THRH 1O0DH 1YPKH 3M5MA 1MAXA 3BEFB 1OPHB 4TPYA 1BZXE 1A3EH 1HAVA 1V2WT 3ATIA 2VIDA 1SGFG 2W3KA 5JBBS 3V0XA 1WXRA 2STAE 1ZPBA 3EE7A 2CK3D 4X8TH 3BTKE 3DCLA 4K69A 3PB1E 1H4WA 1LHDH 3F2FA 1HAVB 3PWBA 4AYVB 1PQAA 2W7SA 1P10A 5C1UA 4YOGA 2GZ8A 1KXCA 3M7UA 1PPGE 1DPOA 1DS2E 2FTLE 1DSTA 1O3IA 2KCPA 3UNRA 4B6FA 1DVAH 3FN8A 1AVWA 1GBEA 1S84A 1XXFA 1V2TT 1HAGE 1YKTA 4O97A 4CBNA 2QC2A 2Y82A 1A61H 1IHTH 1D3TB 1KMHB 3TJVA 1DDJA 1FMGA 1TIOA 1DM4B 1FX0B 1HXEH 1HAOH 3SORA 3RC5A 1GHVH 1UK2A 2AGGX 1UTQA 4JZIA 3LJJA 4GCHF 4YLUA 1PQ7A 3WW7A 1Q2WA 4O3TA 3TK5A 3S7KB 4U2WA 1G9IE 5DGJA 2HPQH 3GY5A 1E34B 4Q80A 3N7EA 2WPDD 2PHBA 2WPMS 3TK6A 1SQAA 4CRDA 1A1RA 3RXQA 4Z0KA 2ZCKP 3TK9A 1SC8U 2BDGA 3MO9A 3SZEA 1WUNH 3MH5A 1TWXB 4B76A 4D9RA 3SV2H 2IOTA 4AORA 1DOJA 3ITIA 1AB9B 1C5UA 1RTKA 1ELCA 2NU4E 1GI3A 4M9FA 5EODA 2L74A 1YPHE 3PTNA 4I8JA 1GDNA 4NFFA 1Y59T 3A8DA 4X0WU 3RXCA 1RJXB 3DT0H 2ODYB 2AMDA 1TFXA 2F91A 1VCPA 1UK3A 2ZFQH 2BD2A 1LHCH 4ISIH 5CMXH 3F9FA 1G32B 1SR5C 4AG1A 4A1VA 1C2JA 1ETTH 2XC0A 2PW8H 5GPIB 1C5NH 5EQRA 4LZ1H 1G3CA 1V2KT 1AB9C 1O2GH 4LXBH 3ZZBA 1ETSH 2HLCA 1KLTA 1BJVA 2D26C 2JJ2D 1OYQA 2BLVA 4B2AA 3UR9A 1HAHH 1O2PA 2FZZA 1Z8JB 3BTWE 2P16A 2PSXA 4CREA 4WMDA 4Y6DA 2FI5E 3TNSA 5A8XA 3P17H 2BMGB 3ZVCA 1MAYA 2J94A 2QA9E 1GI4A 1OWIA 3PROA 5JPMH 4CRGA 3PMJA 2ZIQH 4CH2B 1KIGH 1LPKB 2ILNA 3S9AA 1AO5A 3BTGE 2OCVB 1ZMLA 1C2IA 1DY8A 1FV9A 1ZPCA 1XVMA 2FWWA 1O37A 2VGCC 1C2GA 1GGDB 1L1JA 4X6NA 4ZKNU 3OEHD 5K0HA 1IQHA 2ZPSA 1G3DA 1D9IA 1P9UA 2P8OC 4K2YA 2ZDVH 4I33A 4XE4A 3ZZ3A 2D2DA 3URDA 3GCTG 1MU8B 5FPSA 4ZHMU 3ZZ8A 5DK1A 4AB9A 3U8TH 3E90B 1UK4A 3RMLH 1TGBA 4HG6A 1WBGB 2AERH 2VNTA 1VJAU 3U1IB 1A5HA 2K1QA 1MUEB 1P8VC 2NU3E 4ISNA 4ZAEA 1F2SE 4TPIZ 1YF4A 3FZZA 5GNDA 1ZJKA 2UUYA 4YT6H 2OBOA 1XVOA 3LGUA 3Q3KA 5JB8S 1KYNA 2GZ7A 4TY7A 3D49H 1P2MA 4K1SA 3OY5U 3LOXA 4B75A 3MU0A 3ZZDA 2JETB 1AMHA 1ZGVA 2ZPRA 4XSKU 4ZHLU 3SV6A 3DA9B 5I25A 4DG4A 3U8RH 3O8CA 2F9UA 2GKVE 1GMCF 2WPJS 5DP9A 1ELVA 8GCHF 3NRLA 1QB6A 4GLYA 3UIRA 1FQ3A 2LPRA 2B7DH 4M7GA 3MHWU 1GDQA 1BITA 4KP0A 3T27A 2STBE 5JDUB 1OWHA 1ZSLA 4LOYH 4X2XA 3A7XA 3KQCA 4K60A 4BAOB 1JOUB 1L4ZA 3S9CA 1AD8H 3K6YA 2WUCA 4AOQA 3FO8D 3ZZAA 3EQ0H 3WWBA 2CJIA 1G2MA 1ZMNA 3D62A 1DLEA 3Q76A 5L30H 2G5VA 1QZ8A 2Z9GA 3NXPA 1O2HA 3GICB 1S6HA 2G4UA 1C2MA 1P12E 1W0KD 2QN5T 4X6OA 2JH6D 1EFRD 1TNJA 3LU9B 3TH3H 1O3OA 2ZTXA 4MG3A 1JBUH 1T8LA 1ZHMA 2VH6A 1GVLA 1XUJA 2FTMA 3SGAE 1P0SH 2EI8A 1ANEA 2Y80A 3RMMH 4ESTE 1C5SA 3OYPA 2GCHG 4OS1A 5LGOA 4INKA 3ZV8A 3E8LA 1ARCA 4OGXA 5FAHA 1TPPA 3RXSA 1QIXB 3BTEE 6CHAB 1KLIH 2RA0A 2FYRA 2YMSD 1NBME 2C3SA 3NKKA 5LH8A 1GI2A 1GWAA 4D7FA 3RXAA 3UQOA 3A8BA 2QAAA 1NRQH 3JZ2B 1E36B 3SOSA 2PKSC 2HVYB 4P00A 1IQFA 1EJMA 1S6LA 2P3UB 3RXTA 3DFLA 1HJ9A 1C2DA 3A82A 4YTAA 2QXIA 1AN1E 2F9VA 4CR5A 1HJ8A 2KCOA 2BOHB 2KZ4A 3F1SB 3GY2A 3OE7D 1SLVB 2KFWA 5TJXA 2FX6A 2ZHEH 1K21H 5DPAA 2P59A 1O3JA 3FOAA 4F4OC 3QLPH 4WJG2 1YGCH 4XBDA 1ORFA 4OS2A 2W6JD 1O3BA 3BG4B 1ELDE 4GCHG 1K9OE 1KLJH 1OS8A 4WWYA 1IQLA 4FU8A 1Y3YA 4U32A 5T6DA 5HIYA 1TBZH 3O8DA 3FVFB 1QL9A 5EPYA 1F5LA 1PPHE 2GVFA 3KN2A 5L6NH 4I86A 1ZHPA 1SGIB 1EZSC 1VCWA 5EU8A 4I8HA 3FP7E 4Q7ZA 4AYYB 1ABIH 1TNIA 1QRXA 3RMNH 1SLXB 3F3BA 4GSOA 2B0FA 1RIWC 5DKMA 4JYVH 1KDQA 1Q31A 3ZZ7A 3Q3YA 1GJCB 3UNSA 4FUEA 1K1JA 1F5RA 2KX4A 1VR1H 4IGDA 3H7TA 4NA7A 2BXTH 4O03A 1EQ9A 4ZXXH 1O35A 1V2UT 1DWEH 4RT1A 1GJAB 3SI4H 1B5GH 1P2JA 2LNCA 3B9FH 2YMSC 3QDZB 2BY6X 4Y76A 4UFDH 2Z6BD 1AGJA 2BZAA 1HAIH 1EAUA 1KDQB 1ANDA 2ZDAH 3GCHC 3MFJA 5HGGA 3T26A 1ELEE 1UTKA 2O8TA 3A7YA 2K0QA 1JIRA 5B6OA 2ZECA 1LHGH 3BTME 2WYGA 4GUXA 3A80A 3EA9A 1Y8TA 1F92A 1GBJA 1NRSH 1ZTJA 2OP9A 1NM6A 2ZP0H 1C5WB 1Z71A 4AFUA 1ELBA 2FX4A 1T8OA 5A09A 2OD3B 1AI8H 1GBBA 1YPJH 3UY9A 3A84A 4E7RG 4BTTB 2GDDA 1UCYE 4IS5A 4BAMB 4CRBA 1FY4A 1MMJN 2EI7A 1W10U 3HATH 1AHTH 1GVKB 4ZKRU 3PLBA 3SNAA 2HNTE 3KQDA 1UCYK 5EXMA 1UTMA 2CV3A 2DUCA 3MWIU 4DCDA 1BTXA 3GYMA 1YCPM 1EJAA 1O32A 1SSXA 8KME2 4F49A 3SU0A 4MPUA 1MD7A 3NK8A 3OX7U 1QGFA 4GAWA 4KGAA 1HUTH 3SHAH 5FCKA 3ZVAA 4BNRA 1EZUC 3H5CB 4ISLA 1XUKA 2A45B 1SGPE 1GCTC 3B23B 2V3MA 1W14U 1JRTA 2KM0A 1A7SA 1EP5A 3D65E 3RP2A 2BQWB 3P8OA 5SGAE 3UAIC 1TQ0B 1BA8B 1HAPH 4B2CA 4FUFA 4IN2A 1W0YH 1SHHB 2HGTH 1OWKA 2VIOA 4BANB 4WXIA 1FLEE 3A88A 2ULLA 3VB4A 2V3HH 5BRRE 4WXVA 1GBCA 1TGSZ 1GMCG 2XBVA 1YCPH 8GCHG 2GGVB 1IQNA 2WINI 4X2WA 2J34A 1EAIA 1O2YA 2Y7XA 1TNGA 1S85A 2J92A 5FPTA 2A32A 4X6MA 3RLWH 2O8LA 5DP4A 1GI6A 2BYAX 1QB1A 1QJ6B 1GI1A 1C5RA 2VB0A 1FJSA 5CHAC 3UOPA 2BVXH 5E0JA 3UWIA 3ZVBA 1K1NA 2HOBA 3PRBA 1S5SA 3M3VA 3E16B 4KTCA 2OLGA 4FUGA 2P93A 3W94A 1K0HA 4P02A 4XRNA 4I7YH 2V35A 1TOCB 5KGOA 1ZMJA 1GJ5H 1J9CH 1SB1H 1U6QA 1C4Y2 2ZTYA 1EPTA 3TGKE 4U01A 1HYLA 3U69H 1EAXA 1O3HA 4K1TA 2ZTZA 1L2EA 2AGEX 3GCTF 1O2SA 2WV9A 3I78A 1IQJA 2CHAB 2G51A 4Y7BA 2A4RA 2FI4E 1HPGA 5C94A 2PR3A 4TSFD 1L1NA 1CBWB 4GHQA 5EW1H 2R0KA 1IQEA 3SV8A 1BMNH 4TWYA 3MNCA 3SUFA 1FIZA 1CT4E 1TALA 3SNDA 3SV7A 2QIQA 3SJ8A 3TU7H 2KR7A 1C2FA 1LKAA 3OU0A 4X1PU 2UUJB 1J15A 3AAUA 3GCNA 4MLFB 2F3CE 1HV7A 1Z6EA 3NPSA 3EAJA 4CBOA 2GDEH 1UTLM 3BN9A 1TX7A 1TRYA 4CRFA 3FANA 1WSSH 1EPTC 1TPAE 1RTFB 1QY6A 1MTNC 3OAAD 1C5ZB 3EDXB 4A1XA 3FKSD 4UE7H 6GCHF 1C1OA 3SJ9A 1MQ5A 2RDEA 4NZQA 1O2TA 1QJ1B 1VITH 2KCYA 1SGNE 1LVYA 4BAKB 1EATA 4WMFA 3UOUA 4XBCA 4OS5A 1K1IA 2ASUB 1A46H 3LT3A 2FOEA 3SU3A 2Y5FA 2XBXA 2ZDMA 2OXSA 1V2RT 3U9AH 4OS4A 1J8AA 1UVOA 3N7OA 3V13A 4INLA 3BIVH 1C1PA 5GIBA 3E91A 2ZU5A 1W7GH 3CS7A 3ZIAD 2G55A 4FUIA 5EGMA 1TPSA 4HFPB 2BY5X 1DWBH 2GCHF 4K8BA 3VXEH 1WV7H 4LK4A 1G3EA 1T32A 3SUDA 2XCFA 3RXDA 4RN6A 5AVDA 4CH8B 1O3CA 3BTHE 5JB9S 4MPXA 1Y3XA 3E0NB 3ZVGA 1ZJDA 1C5VA 2SGDE 4NIYA 2FLRH 3NWUA 1BTZA 4TYDA 1LTOA 1HB0B 3LONA 1RGQA 1C5XB 1EB2A 1N8OC 3S0NA 1LQEA 1BJUA 1TNHA 5AFZH 4I31A 3U8OH 3RXRA 1QBNA 2QV1A 1W13U 2ZF0H 2BM2A 4AZ2B 4DIHH 2FS9A 3M36A 5CDFE 1ACBE 1KTTB 1P2KA 4WH6A 1HBTH 1P2QA 1GHZA 1PYTC 5EXLA 4RSPA 1E37B 5C1YA 3QGNB 1GJBB 1BIOA 4JK6A 1UTNA 1P2NA 3RXMA 4O9VA 1ZLRA 5HM2A 1GG6C 5F8TA 2WV4A 1SI5H 1L1GA 2UWPA 3RDZA 5EW2H 1O34A 1P9SA 1YLNA 1BHXB 4D7GA 5JBAS 2EI6A 1MTUA 3H7OA 1IQGA 3MU8A 1JRSA 1SG8B 2IPHA 1SLWB 5H4IB 3MH7A 1GHXH 2ESTE 1GJDB 1XMNB 1CE5A 1SGDE 1AVXA 4YO9A 4Y7AA 1K1PA 4FUCA 2F4LA 2W26A 1L0ZA 2Y5GA 3BTTE 1BHXF 1FIWA 2UUFB 4TY6A 3K6ZA 1DWCH 1O2UA 4Q2KA 1FDPA 5CHBA 1YPGH 1GHWH 2J2UA 4MTBA 2GTBA 1WAYB 3RXIA 2AYWA 1M9UA 1K28D 2XWBI 3ZVDA 5HYOA 5DP6A 2B9LA 2Z7FE 2A4GA 1EASA 1TPOA 1GPZA 1W0JD 1HNEE 3PV5A 5AHGH 4NSVA 2IPQX 3T2NA 2GT8A 1FUJA 1HFDA 1QA7A 3PMBB 2WV5A 3STJA 5C1XA 1OYTH 3GYLB 2VGCB 1SQTA 4WF8A 3P95A 2ZDNA 3L3TA 1X7AC 1QRZA 1RTLA 2FODA 3TNTA 4X1RU 5J4SA 2AIPA 2Z3CA 3T25A 2J4IA 4JZ1A 1F0RA 2P8OB 1D3QB 1H9HE 1LMWB 1WQSA 3A7ZA 2Z94A 5TCCA 1GMHF 3ESTA 4ABGA 5IDKA 3PV4A 3RU4T 2XBYA 4A6LA 1DFPA 2XWAA 2J9NA 1C9PA 1MQ6A 4I8KA 1INCA 3U28C 3MI4A 2ZU2A 1O2OA 2C93B 4YOIA 5A2MH 1LHFH 1UTJA 3KCGH 2Z9IA 3TJOA 1P2OA 3SU6A 1HJAC 2THFB 1P09A 3VB3A 2CF8H 2B5TB 5FXLA 3GDSA 4XOJA 1O3KA 3RXEA 1YM0A 2FDAA 3UFAA 3FZDA 1F0TA 2NU1E 4F48B 4DY7B 1E38B 2IJD1 3B8JA 1TE0A 2ZA5A 4OS6A 2BDHA 2ANKH 4FXGH 2HNTC 1Z7KA 3UQVA 1SGTA 1NRPH 1LHEH 3MU1A 2A7CA 5K7RA 4Y0ZE 2G8TA 2F83A 3TVJB 1DANH 2ZGBH 1GJ8B 3LC3A 2VWLA 2W6ID 4VGCC 1B0EA 3E1XB 2Q6FA 1BQYA 1ANBA 3GY7A 3QX5H 4XBBA 1BRUP 5C20A 1QCPA 1F7ZA 2Z9KA 2OUAA 5EJLA 1S83A 5AF9H 1O2WA 2OK5A 3DHKH 3BEUA 3AK5A 1N6YA 4AG2A 4CHAC 1MCVA 8ESTE 3RC4A 1GL1A 1H8HD 1T4UH 2GMTC 2BDYA 4MQAA 5C0UA 1OX1A 3LGIA 1E1QD 2AMPA 4ISHH 4KELA 3CENA 3GY3A 6GCHG 2BD9A 2ZI2H 1H8IH 1EZXC 1O5FH 3TPIZ 3VB7A 1E79D 3SGQE 2GT7A 4AFZA 3A7WA 2A7JA 1UJ1A 1A2CH 1NO9H 3UWJH 3M7QA 1O2LA 3IWMA 2PTNA 4DW2U 1P03A 5GWZA 1TRMA 3PO1C 2R2WU 1N6XA 1C4V2 1OXGA 2BD8A 3RC6A 1MH0A 1BRAA 1ZRBA 2PKSB 1C1RA 2ZHWH 3G01A 3C27B 5E0HA 1FN8A 1COWD 1LO6A 2OTVA 1CGHA 4UD9H 1J17T 1A5IA 1MZAA 3A89A 1C5LH 3ODDA 2ZCLP 5HKKD 4UFGH 4IC6A 1ZPZA 1BBRK 4TWWA 4H4FA 5DP5A 3LGTA 2A5AA 4BAHB 2P94A 4Z1MD 1C9TA 3KYGA 5E2OA 2FOFA 3QUMP 1MTWA 4RKJB 4O3UA 4ISOA 2G00A 2VU8E 1V2LT 4ZKOU 3EYDA 2OC1A 1FAXA 1HCGA 2ZG0H 3ZZ9A 2GX4A 1EOLA 1HDTH 4HZHA 4AFSA 2PGBB 1XUFA 1O3LA 1P57B 3LPRA 4FOUC 4INHA 1RIWB 4NCYA 5C67A 1VKYA 5JYIA 3RXOA 1NFXA 1TMTH 3MO6A 1RD3B 4UFEH 2M5TA 4Y10E 2FOHA 3GY6A 1GBIA 2ZHFH 2YMSB 5ABWA 1NFUA 1ZGIA 1ZZZA 7GCHF 1S81A 2O8MA 1LVMA 3QN7A 1T31A 2PFEA 1EUFA 1H9IE 3GCHB 3T28A 1Z8RA 1XKBC 1GBLA 1GVZA 1PJPA 2EY4C 1O2IA 1BB0B 2D8WA 3K65B 1BT7A 1WTGH 3VGCC 1E0FD 1NY22 1W2KH 2QGRA 2V7QD 2ANYA 1D6WA 4DOQA 1L4DA 1SGFA 2L6OA 4PROA 2H5CA 3GDVA 3RU4D 2GCTC 2Y81A 3O8RA 3A87A 2XYAA 1NROH 3A8AA 1CT0E 1VGCC 5A0AE 1TX6A 5DN6D 5A8YA 2EEKA 3RXHA 1W3CA 2IN2A 4B73A 4CRAA 2FXRA 4DT7B 1TLDA 2UUKB 1XKAC 1GMDF 1CGJE 2BQ7B 2Z9LA 2YNAA 5J4QA 4DVAU 5E2PA 1NC6A 2H2ZA 3W1EA 2A2XH 1YPLH 1Y3UA 4YXWD 2Y6TA 3S69A 4FUHA 2TGDA 2OBQA 1ZTLA 2ZDLA 2UWOA 1F0UA 1J16A 4WY3A 1PPZA 1UTOA 1FPHH 1DUEA 1XUIA 1MU6B 1AUTC 2FMJA 3EGKH 4NIXA 1KY9A 1MBQA 1G3BA 2GD4B 3K2UA 1O38A 2PP6A 3TIUA 2FO9A 2ZC9H 1CHGA 2G52A 4K8YA 1ZRKA 2SNVA 2QXHA 2ZKSA 1D4PB 1GMHG 3WY8A 1FY3A 1H9LB 2QYIA 4BXWA 1C1SA 1QQ4A 1AZZA 1O5AB 1PQ8A 1MBMA 1KSNA 1TABE 1GCTB 1LDTT 4ZHAA 2BDAA 1UCYH 2A0QB 4NZLA 5PTPA 3HGPA 2BQ6B 3BF6H 5F03A 3KHVA 1VCQA 5T1VA 5IYTA 5A0BA 1Y3VA 1W12U 4KTSA 7KMEH 2XXLA 3GISB 2V0BA 3L6PA 4QT8C 2VIWA 2FESH 3MNBA 1AFQC 2SGAA 1WU1A 4UFFH 1THPB 1HLTH 2V3OH 2XCNA 3RXJA 4R0IA 2CGAA 3MH4A 1FPCH 3E3TA 3P8NA 2Z9JA 1F5KU 5F8XA 1GHAF 4WVPE 5C3NA 1OSSA 1A0JA 4NG9H 2A5KA 4IN1A 2K8IA 2BLOA 4GHTA 4CRCA 2ZWLH 3F9GA 1HRTH 3SN8A 5CHAB 3F68H 1SGYE 1P06A 3CP7A 1CA8B 3F6UH 2V6NA 2OC7A 1OP0A 4JYTA 1F0SA 2C90B 3SU5A 6LPRA 1EZQA 1SQRA 2LP6A 1RXPA 3STIA 1QB9A 1O3GA 3SYJA 1P3EA 1XUHA 1GHBG 3HGNA 7ESTE 3TGJE 4ABBA 4I32A 3L33A 1UW7A 2FOGA 1NZQH 2QF5A 4H42U 1YWUA 1SHYA 2ZFTA 3LH3A 2W7UA 2PGQB 4D8NA 2ZFRH 1GHYH 1GJ6A 2ZGXH 2WPHS 5FPYA 1G30B 1SOZA 2BD4A 2ANMH 1ZYOA 1WYKA 2FI3E 1NTPA 3TJUA 2BVSH 2JDID 1ZSJA 1JMOH 4F55A 3A81A 1CA0C 2M2AA 2OINA 1NN6A 4AN7A 3P92A 3SZNA 2HLDD 1TNKA 7LPRA 2C8WB 2PUQH 1K22H 1ESAA 1IOEA
chains in the Genus database with same CATH topology
3UPEA 3ZVFA 2ZHDA 1BCUH 3ZZCA 4B2BA 2XW9A 3GDUA 1EPTB 1UVTH 3U1JB 1LVBA 1DITH 8LPRA 4FUDA 1WTHD 3FAOA 1BTHH 1MTNB 2Y7ZA 1UVUH 1CVWH 5HM9A 2TGAA 3GY8A 1D6RA 2BXUH 4AFQA 2G81E 1P3CA 3M7TA 2Y5HA 5DO4H 2A31A 3AASA 1FN6A 3O8BA 1Z6JH 1EAWA 3TH2H 3TH4H 1EJNA 1IAUA 1NU7B 3M3SA 1BRBE 2VIQA 2HALA 4X1NU 1C2LA 3D23A 1TGCA 1TBQH 2J38A 1YBWA 1D3DB 1T8MA 1GI5A 3SHCH 1AE5A 2TIOA 3W95A 3M5NA 2AGIX 2VVVA 1Y5UT 3HKJB 3KQBA 4A7IB 1VZQH 1PPCE 1GL0E 1O2KA 1AWHB 1G37A 4MNVA 3JZ1B 1AFEH 1UHBA 1DE7H 1A0HB 3ZYEA 1BTYA 3KQEA 3MU4A 4KKDA 1O36A 4X8UH 7GCHG 4HTCH 1QRWA 4NA8A 3A85A 1T7CA 1P02A 2W5EA 1OP2A 2A1DB 4H6SB 1DICA 3HK3B 3LH1A 1THSH 4K1EA 1QA0A 1ESBA 1NT1A 1UHBB 1CHOF 1N8OB 3QGJA 1GBAA 3PYHA 5LPRA 2I6SA 3BG8A 3OTJE 4UONA 4JZFH 4X8VH 1DSUA 1KXBA 4UDWH 1UTPA 2ZFFH 3SO3A 3R0FA 1O2XA 3TJNA 1A5GH 1GI7B 1GMDG 1QBVH 4MPVA 1MCTA 3VFEA 4ABEA 1NFWA 3AAVA 2XRCA 3U98H 5DP8A 1IHSH 2A5IA 1GG6B 3QTVH 3RXPA 4YOJA 1EXFA 2BLQA 2BD7A 1QL7A 4IW4E 2B8OH 1O2RA 3A7TA 4ABAA 1SFQB 1SVPA 3RU4E 5C5NA 1NS3A 4ZXYH 1C1NA 1FZZA 4E05H 2FEQH 2A7HA 1B0FA 1C1MA 1OWJA 1TX8A 1EOJA 2HVXA 3SU2A 3V3MA 1BTWA 4Y8XA 1AE8H 1TGNA 1TBRH 2FOBA 3FP6E 4Y8YA 3P6ZB 1ABJH 2P95A 3P8FA 2AEIH 2NU0E 2ZEBA 2ZHQH 1HAZB 3FFGA 1LQDB 3Q77A 3E0PB 2OC0A 1MKWK 1MKWH 1P01A 2AIQA 3MNXA 2SGFE 4A5TS 4Y79A 2Z3DA 4Y0YE 2F9OA 1DWDH 1ID5H 3SGBE 3MOCA 3RM0H 4FUJA 3SQHE 1IQKA 1UMAH 2ODPA 2VWMA 4J2YB 4YESB 3VB5A 1V3XA 4DIIH 1GBDA 3P70B 4ZROA 2D1JA 1W11U 1GI0A 4Q7XA 4I8LA 1MTVA 2ALVA 2VWOA 1GHAG 1O5EH 1PPFE 1DX5M 2ZCHP 4BTUB 2BLWA 1C5OH 1NRNH 3RXBA 3UTUH 3A83A 3SBKA 3GY4A 4B71A 3ATLA 1FXYA 1O30A 1TA2A 1CT2E 2R0LA 1RS0A 4FVDA 2CN0H 5A8ZA 1BUIA 4FVBA 4WH8A 2Q6GA 1HJAB 4BXSA 1JWTA 4R8TB 2JH0D 1ZOMA 4K5ZA 1W7XH 2H6MA 1ANCA 3RM2H 4Q7YA 3VXFH 4ABFA 3KF2A 1NRRH 4JMYA 3MMGA 2FLBH 2H1UA 1BOQA 1YC0A 1TMUH 3SU1A 5F8ZA 1CSOE 3ZZ4A 1NESE 4GPGA 1O3NA 1CGIE 3M37A 2TBSA 1Z1IA 4GVUA 1SMFE 3RXFA 2BY9X 2C4FH 1QURH 3GOVB 4X8SH 1C5YB 1EKBB 4VGCB 4NIWA 1FY5A 3UREA 3PMHB 3SNBA 1BMLA 2HNTF 2BDBA 2ZPQA 3UR6A 1O3MA 2A2QH 1MZDA 2I6QA 2EA3A 2DE8A 3KIDU 3RXVA 1GBFA 1LPGB 4THNH 1WQVH 3SV9A 4FUBA 5L2ZH 2ZFPH 1SQOA 4ABDA 4CHAB 1QHRB 2GMTB 1FY1A 1YLDA 2OC8A 4Y8ZA 2ZGHA 2VVUA 3VEQB 2C8ZB 3NZIA 5G4BA 2ZDKA 1LKBA 2XC4A 4OGYA 1TYNA 3SUEA 1ZTKA 3HK6B 3ATMA 2F9PA 2O9QA 3PTBA 1ARBA 1O5GH 3EA8A 1GBHA 4LZ4B 3PM3A 2OQUA 1AU8A 1EX3A 2BX3A 2HRVA 2VIPA 2JH5D 1UVPA 4DJZB 5LPEA 3PO1B 1AQ7A 5DP3A 1GHBF 1H8DH 1IQMA 2G5NA 5L2YH 5ETXA 3EE0B 1GGDC 3I77A 1OWEA 4ZUHA 1NU9A 4X2YA 1V2VT 2ZQ1A 3DD2H 3SUGA 5HXFA 2CXVA 1C2KA 1ZSKA 2R3YA 2TGPZ 4HGCA 2GV6A 2PLXA 4XFQA 5T6GA 3ZZ6A 2ZU3A 2KAIA 4YM9A 4J1YA 4IMQA 4JK5A 1O31A 3ENSB 1SLUB 2A4OA 3LKWA 2OQ5A 3ELAH 3RLYH 2IJOB 4X6PA 1EP6A 5FBIA 3BTQE 3T29A 3BTFE 1CHOG 4I8GA 2ZNKH 5LPFA 1C2HA 1B7XB 2KAIB 4B1TA 5EG4A 2BY7X 1TQ7B 2ZQ2A 1BBRE 1Y5AT 4MNYA 3V7TA 4MPWA 2FOCA 1GBTA 1O2JA 2JETC 2VVCA 2PKAA 2VINA 3BSQA 2WPLS 3SI3H 1OP8A 1WOFA 1BBRH 1BMMH 1XUGA 5GCHF 3LJOA 5DG6A 3V12A 4YZUA 1SFIA 1SL3A 4NA9H 4Y71A 2BOKA 2GP9B 1QTFA 2ZZUH 1AZ8A 3NUMA 1SBWA 1Y5BT 3BTDE 2PKAB 3SNCA 1Y3WA 3M35A 4E06H 3P8GA 1HIAA 1DT2A 1YPMH 1Z8IB 2CMYA 5FBEA 2RDLA 4IBLH 3C1KA 4FU7A 1TRNA 2QXJA 4ZH8A 4NFEA 3ATWA 3VGCB 2BZ6H 4RKOB 2XC5A 1FNIA 1GI8B 1GBKA 2GCTB 3Q00A 1P05A 2P3TB 3RXUA 5T6FA 1K2I1 1MD8A 1O2NA 1V2QT 1VGCB 1MTSA 3RMOH 1HIAB 4X1QU 1V2MT 1K1OA 2O8WA 5AFYH 5C2ZA 1O3AA 4BAQB 5T3HA 5FHTA 1GCDA 2CF9H 1S6FA 4SGBE 1KTSB 1T8NA 3M5LA 2FOAA 1KXFA 2PUXB 3E6PH 2WPKS 3F9EA 1PPEE 1A4WH 2QY0B 1AWFH 2VIVA 2XBWA 1SPJA 2HWLB 1P11E 1VITF 2VH0A 3EA7A 5FCRA 6ESTA 2VWNA 4BOHA 3PLPA 3PMAB 1HAXB 4Y11E 1LVOA 3HKIB 1TA6A 3ZZ5A 5I46H 4JZDH 4SGAE 6CHAC 4NIVA 2HPPH 2SGQE 1V2JT 1C1UH 1TNLA 3MYWA 1RFNA 1K1MA 2BD3A 1E35B 1WCZA 1HXFH 1V6DA 3SJOA 2G4TA 1JXPA 3ZYDA 1SGEE 3VB6A 1FAKH 1PFXC 4K3JA 1C4U2 1O5DH 2BD5A 2FPZA 2GV7A 3T5FH 2UWLA 5E0GA 1DXWA 5ESTE 3TITA 3BG4C 3LGYA 1V2ST 3I29A 2ZGJA 1AFQB 5E8EH 1D3PB 1OWDA 3A7VA 2RG3A 1UVSH 2SNWA 2Z3EA 1YPEH 2XNIA 3ZV9A 4H6TA 3RXLA 1O3DA 1MKXK 1MKXH 3F9HA 2BHGA 1PPBH 2ANWA 2FYQA 2ZU1A 3M61U 4X2VA 5A0CA 3ODFA 2H9EH 1P2IA 3QZQA 2PTCE 1BTPA 1LPZB 1A0LA 1O33A 1O39A 1T4VH 4MDSA 1KXAA 2O8UA 2A4QA 2FOMB 2TPIZ 3SNEA 4MNXA 4NSYA 2RA3A 2JKHA 1A3BH 3M5OA 2GZ9A 1YYY1 3M3TA 2Q6DA 1QFKH 3SQEE 1AVGH 1W8BH 2F9NA 1GJ4H 5HMAA 1EB1H 4IC5A 1PQ5A 2QCYA 1CO7E 2QXGA 3A86A 1HAYB 4MVNA 4ABIA 1QBOA 2PWXA 1Q3XA 1ZHRA 3IG6B 1KXDA 3K9XB 4XDEA 1G2LA 2AFQB 9ESTA 2BDIA 4JZEH 2R3UA 1CU1A 3FP8E 1C1QA 1C5TA 5ESBA 2BY8X 3QO6A 1BRCE 3RXKA 4ZKSU 3OY6U 2SGEE 3OSYA 1AKSA 1ELTA 3URCA 4ASHA 1C1VH 3LGVA 2FP7B 1H1BA 3ZVEA 3LIWA 3QK1A 2ZGCA 2ZFSA 2PV9B 4NWLA 1Z1JA 2BTCE 1S0QA 5GJ4B 1QNJA 5CE1A 3MTYA 1DY9A 4JYUH 5DJ7A 4IMZA 2ZU4A 2H9HA 1CA0B 5C5OA 1AKSB 4A1TA 3S9BA 1QJ7B 2C8YB 2R2MB 2TGTA 5EPNA 1TOMH 3BIUH 1XM1A 3MNSA 2YOLA 1O2MA 3MH6A 2AH4X 1W0ZU 5GDSH 1SGRE 2BDCA 3CS0A 5BPEA 1OOKB 3ATKA 3SJIA 1C5PA 3LGWA 1O2VA 2FS8A 3KEEA 3LC5A 4NWKA 1P04A 1CQQA 4E7NA 1QQUA 1C5QA 1TMBH 3QTOH 5EQSA 1C1WH 1DLKB 1YCPK 1YPHC 1Z8GA 2C8XB 1V2OT 4ZMAH 3KL6A 2YNBA 1G36A 3TGIE 5TCAA 1TB6H 3UNQA 1XXDA 3LDXH 4YLQH 2H5DA 1OKXA 1QR3E 1FY8E 1ELAA 2NWNA 3RUOA 3SU4A 4Z6AH 3AVZA 4NGAH 3SW2B 1C5MD 1J14A 2F9BH 1YP9A 2WYJA 1SOTA 1UO6A 1BMAA 1YLCA 4AB8A 3GCOA 4DURA 3VPKA 4FU9A 1V2PT 1JIMA 1GJ7B 3BV9B 3DUXH 4ABHA 1S0RA 1XX9A 4MNWA 4X1SU 1O5BB 1O2QA 3SJKA 2P3FH 2ODQA 5GCHG 2H9TH 1O3EA 1BTUA 5FX6A 1VJ9U 3HPTB 4KTUA 2BB4A 5GXPA 4JCNA 4D9QA 3DFJA 1SGQE 4OS7A 3PWCA 3AW0A 1K1LA 2SFAA 3UUZA 2EC9H 1ETRH 1ELFA 1ELGA 4AGJA 4AX9H 1TAWA 4U30A 2QF3A 3AW1A 5EOKA 4BTIB 1NPMA 2NU2E 2DE9A 1QL8A 4CR9A 3QZRA 1DXPA 4UEHH 3KNXA 2WPIS 4D76A 3TLOA 2VJ1A 1LCYA 1IQIA 3PLKA 2AS9A 1O3PB 3S7HB 1FI8A 2ZO3H 3T62A 1FONA 2J95A 1KXEA 5JBTA 3RXGA 9LPRA 2FM2A 2SGPE 2W3IA 3QWCH 1O2ZA 2CHAC 4WMEA 2FIRH 1C1TA 1C2EA 2ALPA 2R9PA 5EXNA 2XTTB 1VITG 1GBMA 1O5CB 1CBWC 1GJ9B 4AGKA 1BDAA 2Q1JA 1S82A 4B74A 5DP7A 1N1LA 2BX4A 2RCEA 3A8CA 1PYTD 3KGPA 1ZR0A 1DUAA 4HI3A 1O3FA 1GI9B 2AMQA 4YT7H 4ABJA 3IITA 4A92A 3MO3A 3Q3XA 2QF0A 1AIXH 2TRMA 1AY6H 1GDUA 1RRKA 5F6MA 1V2NT 2WUBA 3NCLA 3MU5A 1HGTH 5JBCS 3R3GB 1TGTA 1TONA 1NFYA 2BVRH 3BEIB 5FX5A 4DGJA 1AUJA 1ESTA 1SGCA 2PSYA 5EQQA 1THRH 1O0DH 1YPKH 3M5MA 1MAXA 3BEFB 1OPHB 4TPYA 1BZXE 1A3EH 1HAVA 1V2WT 3ATIA 2VIDA 1SGFG 2W3KA 5JBBS 3V0XA 2STAE 1ZPBA 4X8TH 3BTKE 4K69A 3PB1E 1H4WA 1LHDH 1HAVB 3PWBA 4AYVB 1PQAA 2W7SA 1P10A 5C1UA 4YOGA 2GZ8A 1KXCA 3M7UA 1PPGE 1DPOA 1DS2E 2FTLE 1DSTA 1O3IA 3UNRA 1DVAH 1AVWA 1GBEA 1S84A 1XXFA 1V2TT 1HAGE 1YKTA 4O97A 4CBNA 2QC2A 2Y82A 1A61H 1IHTH 1D3TB 3TJVA 1DDJA 1FMGA 1TIOA 1DM4B 1HXEH 1HAOH 3SORA 3RC5A 1GHVH 1UK2A 2AGGX 1UTQA 4JZIA 3LJJA 4GCHF 4YLUA 1PQ7A 1Q2WA 4O3TA 3TK5A 3S7KB 4U2WA 1G9IE 5DGJA 2HPQH 3GY5A 1E34B 4Q80A 2PHBA 2WPMS 3TK6A 1SQAA 4CRDA 1A1RA 3RXQA 4Z0KA 2ZCKP 3TK9A 1SC8U 2BDGA 3MO9A 1WUNH 3MH5A 1TWXB 4B76A 4D9RA 3SV2H 2IOTA 4AORA 1DOJA 3ITIA 1AB9B 1C5UA 1RTKA 1ELCA 2NU4E 1GI3A 5EODA 1YPHE 3PTNA 4I8JA 1GDNA 4NFFA 1Y59T 3A8DA 4X0WU 3RXCA 1RJXB 3DT0H 2ODYB 2AMDA 1TFXA 2F91A 1VCPA 1UK3A 2ZFQH 2BD2A 1LHCH 4ISIH 5CMXH 3F9FA 1G32B 1SR5C 4AG1A 4A1VA 1C2JA 1ETTH 2XC0A 2PW8H 5GPIB 1C5NH 5EQRA 4LZ1H 1G3CA 1V2KT 1AB9C 1O2GH 4LXBH 3ZZBA 1ETSH 2HLCA 1KLTA 1BJVA 2D26C 1OYQA 2BLVA 4B2AA 3UR9A 1HAHH 1O2PA 2FZZA 1Z8JB 3BTWE 2P16A 2PSXA 4CREA 4WMDA 4Y6DA 2FI5E 3TNSA 5A8XA 3P17H 2BMGB 3ZVCA 1MAYA 2J94A 2QA9E 1GI4A 1OWIA 3PROA 5JPMH 4CRGA 3PMJA 2ZIQH 4CH2B 1KIGH 1LPKB 2ILNA 3S9AA 1AO5A 3BTGE 2OCVB 1ZMLA 1C2IA 1DY8A 1FV9A 1ZPCA 1XVMA 2FWWA 1O37A 2VGCC 1C2GA 1GGDB 1L1JA 4X6NA 4ZKNU 5K0HA 1IQHA 2ZPSA 1G3DA 1D9IA 1P9UA 2P8OC 4K2YA 2ZDVH 4I33A 4XE4A 3ZZ3A 2D2DA 3URDA 3GCTG 1MU8B 5FPSA 4ZHMU 3ZZ8A 5DK1A 4AB9A 3U8TH 3E90B 1UK4A 3RMLH 1TGBA 1WBGB 2AERH 2VNTA 1VJAU 3U1IB 1A5HA 2K1QA 1MUEB 1P8VC 2NU3E 4ISNA 4ZAEA 1F2SE 4TPIZ 1YF4A 3FZZA 1ZJKA 2UUYA 4YT6H 2OBOA 1XVOA 3LGUA 3Q3KA 5JB8S 1KYNA 2GZ7A 4TY7A 3D49H 1P2MA 4K1SA 3OY5U 3LOXA 4B75A 3MU0A 3ZZDA 2JETB 1AMHA 1ZGVA 2ZPRA