1O35A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o35A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o35A02
3A81A 3TGIE 1FN6A 1ABJH 2B8OH 2KAIA 3Q00A 4O9VA 1A2CH 1SLUB 2FIRH 2XRCA 3F9HA 1TX7A 1C5OH 3E3TA 1T8MA 2ZG0H 1GCDA 4X2WA 3A82A 4BAQB 3ATKA 2V3OH 2PTNA 4I8GA 4GAWA 2FI4E 2STAE 3MU8A 1LQEA 3SJKA 2VJ1A 4DCDA 1MMJN 3UY9A 1ZJKA 1ZJDA 2BXTH 1EJNA 1GVKB 1YPKH 1NFYA 1W14U 1N1LA 4ZH8A 1O5BB 1O2WA 2BDYA 4JYVH 5ESTE 3U9AH 1LPGB 2VWLA 2GP9B 3LGVA 2D26C 1DY8A 2UWLA 4AZ2B 1ELGA 1TQ7B 2WINI 3FVFB 2GDDA 4B2AA 1S6FA 3SZNA 1HB0B 3LH3A 1FIZA 5HM9A 4FUDA 1FY4A 3RXRA 4GUXA 4J2YB 1HJ9A 2R0KA 3BF6H 4A7IB 6ESTA 3ATLA 1NRNH 1AZ8A 2ANWA 3KCGH 4MNWA 1O2RA 2SNVA 1AMHA 3P70B 3UTUH 4DG4A 5FHTA 1KDQA 1CA0B 1Z6EA 4B2CA 4NSVA 2V3HH 3QK1A 1Y5BT 1QBVH 1Z1IA 1P11E 3QTVH 2Z9LA 3RXBA 1QURH 6CHAB 2FOEA 3PWCA 4KTCA 1FPCH 1W3CA 3V12A 5DP6A 4X8TH 1DT2A 1T4VH 2OUAA 1T8OA 3TITA 4D8NA 1VITF 2WPHS 4WWYA 2BOKA 1K1JA 2XWBI 4UFEH 4Y8YA 2FOMB 1YPHC 2GV7A 4LOYH 4B76A 1FDPA 4AG2A 2AERH 1DUEA 2ALPA 1HYLA 4CH8B 1DLKB 4K1EA 3GCTF 4BANB 2TRMA 3QX5H 3GOVB 4U2WA 5FCKA 1XUFA 1HDTH 2ZEBA 5C1YA 7GCHG 1SQOA 2P94A 2SGQE 3MHWU 5A09A 1P2OA 2OP9A 3M7UA 4INHA 1NO9H 2I6QA 3RXQA 2ZGHA 2ZFFH 4QT8C 1TRNA 3Q3XA 4NIVA 5JBBS 3SN8A 1T7CA 3ZZAA 5DG6A 2HLCA 2BY9X 2PKSC 4A5TS 4ZAEA 2ZQ1A 3LC3A 1C2JA 2A4GA 1TONA 1TNIA 1HIAB 3LDXH 3LC5A 2BLWA 1K1PA 2EC9H 5AF9H 1YP9A 3H5CB 4I8KA 1PPGE 5DP8A 2BHGA 2I6SA 3VEQB 1O30A 1BZXE 1C1QA 1TGTA 1UTPA 1G2LA 6GCHG 1C1SA 1P9SA 2BVXH 1XVMA 2XCFA 1D3QB 3HK6B 2DE8A 2HNTE 3O8BA 2R2MB 1MZDA 3LKWA 1AVXA 5A0AE 1EASA 4B73A 3ENSB 1QBOA 2Z7FE 3GCHC 3UUZA 1Y8TA 5A8YA 3SNBA 2WPLS 3V13A 4FUGA 2JH5D 1TB6H 2C90B 4DJZB 1SPJA 1XX9A 3QDZB 2ZFSA 2P8OC 5EG4A 3ZZ9A 1VCWA 3MO9A 2BD3A 2FPZA 3T2NA 2ZCKP 4LK4A 2FP7B 3QTOH 1CHOG 2QF3A 1TOMH 1KXCA 2OC0A 2QAAA 2JH6D 1ESAA 3I77A 1HAIH 5CHAC 5JBTA 2XBVA 1SG8B 1HPGA 1D9IA 3ODDA 1T8NA 3A86A 3GDVA 1K2I1 1HAHH 1AGJA 1KXDA 3E91A 2P59A 2P95A 3GDSA 3JZ2B 4FUBA 2HPPH 4K1SA 1WOFA 1WYKA 1NFUA 2F91A 3W94A 3URCA 5JDUB 2IJOB 3QGJA 2ZTZA 3T25A 4K8YA 1EX3A 1CHGA 4X6PA 4MVNA 1Z71A 3BG4C 2OC8A 4F49A 2FM2A 4ISHH 3PMJA 3MU4A 4A1VA 3SI3H 1ELBA 1EAIA 3SQHE 3D62A 4H6TA 3T28A 1THRH 2VH6A 2BY8X 3SV7A 1ZRKA 1WSSH 3AW1A 2C8WB 1SGCA 2ZPSA 3OU0A 1O2OA 2BXUH 4WF8A 3RLYH 3MNCA 3MFJA 3M35A 2AMDA 4ZHLU 1EZUC 1XUJA 2B7DH 1PPHE 1DSUA 3DUXH 3PYHA 3MU0A 3VGCC 2BDIA 2XBWA 1F0UA 1GBTA 1TNHA 1BTUA 3OY5U 4IC6A 4Y79A 1SLVB 7GCHF 3LGUA 1LPKB 1O38A 1O5AB 2PWXA 4CHAC 1GVZA 3TH4H 1ZMNA 3PTBA 2FLBH 3VXFH 1O37A 5A0BA 2ZDLA 2V0BA 1HAOH 3FZDA 4NA9H 2D2DA 3GYMA 1BRCE 2F3CE 2V6NA 4ISIH 2H1UA 1C2DA 4GCHF 4TYDA 1O31A 4OS2A 3SJ8A 1O36A 2QC2A 3GICB 1C2HA 2D1JA 1P02A 4Q7ZA 2OLGA 4E7RG 3DD2H 8LPRA 4H6SB 1O2VA 1F5RA 3S0NA 1K22H 5GCHF 1VR1H 1ZPZA 1RJXB 1W2KH 3ZVFA 1MBQA 3BEUA 1ESBA 1D6WA 2ZU4A 2PSXA 1O2PA 1O3NA 3CS0A 6GCHF 4BTIB 1V2VT 4RKJB 4MTBA 4IN1A 1BTPA 1DANH 4NCYA 2ODQA 1W13U 2XBXA 2ZU2A 1RD3B 3LU9B 4K3JA 1EXFA 3GCOA 3ELAH 1XM1A 2JETC 2BB4A 3VXEH 3SHAH 1LHCH 4NWLA 1ZMLA 1TMBH 2PW8H 1O3HA 3QN7A 4ABJA 1VGCB 1O2SA 3RXLA 3UNQA 4K5ZA 3BTDE 5FPSA 3BEFB 2FEQH 1OOKB 5LPEA 1YPLH 1FXYA 1YPMH 1CBWC 1C5QA 1TE0A 2H9EH 2VGCC 1GI1A 2GX4A 3AAVA 1G36A 1THSH 1NRRH 3UOPA 2D8WA 3PO1B 5LPFA 3QWCH 4MLFB 4OS1A 2CF8H 1TQ0B 4UEHH 4X2YA 3BTME 1EPTB 2SNWA 1HCGA 1QL8A 3LPRA 1GJCB 2LPRA 3M61U 1V3XA 4JZEH 4XE4A 4DURA 1Z8IB 1PQ5A 1BITA 4X8SH 1FZZA 3DA9B 3SHCH 1UJ1A 1VZQH 1BMLA 1EZQA 3M7TA 1DXPA 5E2PA 2OXSA 2Z9KA 4ZKOU 3NPSA 2P3FH 2WYGA 3ZZDA 2HNTC 3VB3A 1W8BH 3IITA 1F5LA 2ZDKA 2UWOA 2YNAA 2EEKA 4BNRA 1U6QA 1WQVH 1TNKA 2W7UA 1O3KA 3PM3A 4R0IA 3FANA 1NM6A 3K9XB 3RMLH 3F1SB 5TJXA 2RDLA 3RXSA 3TPIZ 4E05H 3D49H 5HM2A 3SU6A 4I8LA 5FX6A 5GIBA 2ZWLH 3K2UA 1JOUB 3E0NB 2TPIZ 3TNSA 3R0FA 1S5SA 5K0HA 5PTPA 3VFEA 2GDEH 1G30B 2VB0A 1XVOA 3FP7E 2QXIA 2QGRA 2BOHB 1Z6JH 3A7XA 3TGJE 1MH0A 4ZMAH 3ZV8A 5GXPA 4BAMB 2A4OA 1MKXH 4J1YA 1SHHB 5I46H 5EW2H 2ZU1A 2AH4X 2YNBA 3MTYA 4MPVA 4UE7H 1PQAA 1F7ZA 2QXGA 1X7AC 4VGCC 1C2LA 1ANBA 5FXLA 1RIWB 1SGIB 2XYAA 2PKSB 1E38B 1RRKA 2Y5GA 4YLQH 2FOCA 1BQYA 1H9IE 3SUEA 4O3UA 5LH8A 1GBMA 3RU4T 1C2FA 3SV2H 1C5MD 1YCPH 1BT7A 1BBRE 2PKAA 1MBMA 2XC0A 3ZZ8A 1ARCA 1NRPH 4TWYA 1O2JA 1TPOA 3VB6A 3UQVA 1V2OT 1OXGA 2TGDA 3F68H 4CH2B 5SGAE 2BD2A 3BG8A 4NSYA 1IQFA 1KLIH 1W7XH 1WQSA 1KXAA 2O9QA 1CT2E 2BD7A 3FFGA 4IW4E 4ASHA 3GCHB 1GWAA 4X1PU 3IWMA 4MPWA 1OWEA 1AFQC 2C3SA 2BLQA 4IN2A 1O34A 1CSOE 1DVAH 1AO5A 1O3JA 3UNRA 2C8ZB 1C9PA 1MKXK 1ZRBA 2O8MA 3A8CA 1DWBH 4GPGA 3UWJH 4Q7XA 3RXFA 1LHGH 3M5LA 1DXWA 1WBGB 3S9AA 1YLDA 2J2UA 4MNVA 3KQDA 1P2QA 3ZVGA 3Q76A 3SNEA 5CHAB 1RS0A 2Q6GA 1BBRH 1T31A 2ALVA 2VWOA 1UO6A 1SOTA 4D7FA 3EA8A 1SGFA 2ANMH 1HAXB 3CP7A 1YCPK 2CJIA 1JMOH 1Z7KA 1E0FD 1C5YB 2FODA 2CGAA 4UONA 1QGFA 2FTMA 4I33A 3RDZA 3S69A 1TYNA 3M3VA 3L3TA 4YLUA 5E0HA 3UIRA 2A31A 3DHKH 3N7OA 4YESB 1TNLA 1EAXA 3STIA 4ABHA 3SUDA 1P10A 1C5PA 2SGAA 2C4FH 3C1KA 1YF4A 1ZSLA 1F0RA 3FAOA 2UUKB 3RLWH 1GHBG 1UTJA 2EA3A 2FLRH 3MH6A 2NU4E 3SV8A 1LTOA 1GMHF 1TALA 4WMEA 4FUJA 5C5OA 2EI6A 1BRAA 3F9EA 2GZ7A 5FX5A 1QRZA 1C5RA 1V2TT 3LJOA 1TLDA 2W26A 1HJ8A 2FX4A 1V2WT 1GJ4H 1HXFH 1PYTC 5EQRA 3E8LA 3MMGA 1SGQE 3KHVA 1HBTH 1CT0E 3SJIA 2ZGXH 2ZZUH 1AHTH 1AKSB 1BBRK 1EB2A 3SUGA 5DP7A 1B0FA 6LPRA 1EZXC 2F9NA 2BD8A 3CENA 3P8GA 4B1TA 1WV7H 1HFDA 4AFQA 1CO7E 1K28D 1QB6A 2FDAA 2ZHEH 5EXMA 2J4IA 1JIMA 2CN0H 1MD7A 3RXUA 4YOJA 1GL0E 1ANDA 2Y7ZA 1S84A 3EGKH 3Q3YA 1GJ9B 1KTSB 2PTCE 4JYUH 4X6MA 3VPKA 5TCAA 4I7YH 2G4UA 1TNJA 4KTUA 3DFJA 1P9UA 2OQUA 3SU1A 1BA8B 1XUKA 4HTCH 5CMXH 1MD8A 2GZ9A 1O3GA 4YO9A 2VWMA 1XMNB 1L0ZA 1Y5AT 2G00A 2ZFQH 4MNXA 1O5FH 3MI4A 2STBE 1RTLA 4NIYA 3RXDA 4YT7H 2HALA 1AQ7A 3MH4A 5FPYA 1UTKA 2DE9A 2ZHQH 5EQQA 1O39A 1C1VH 4U01A 3K65B 1MKWH 1ZTJA 3E1XB 2THFB 4Y11E 2BQWB 4TY7A 3G01A 4XBBA 4UFGH 2PLXA 1SBWA 4WMDA 3GY6A 4ISLA 1P06A 3ZZCA 2WPKS 1GJ7B 2ZFTA 1QR3E 4BAOB 1VCPA 3H7TA 1BTZA 3UR6A 2O8UA 1OP8A 2Q6FA 2GCHF 2VGCB 3FP6E 1UVSH 3RXEA 4Z0KA 3RXHA 3SQEE 1A5IA 4GVUA 4B71A 1O3MA 3TNTA 4BTTB 3HKIB 1O3AA 2BMGB 3V0XA 4KELA 1TOCB 2G81E 4HGCA 3UR9A 2QXHA 1OWHA 1O2YA 4DIIH 1C1TA 2XBYA 4ABEA 5EOKA 2ZGCA 1ELVA 2J9NA 2BZ6H 1HJAB 1W0ZU 1C5LH 3JZ1B 5ETXA 1BJUA 3M5MA 1GJ5H 1DSTA 1MKWK 1A3EH 2CHAB 3OTJE 1NRQH 1O0DH 5DJ7A 2WPJS 3M5NA 5FCRA 4AFZA 4UD9H 1NFXA 4Z6AH 3A89A 3VB5A 2ILNA 3ESTA 1S0RA 1EB1H 1O2UA 1HAZB 1HNEE 4DY7B 2A5AA 4X1QU 1P01A 1YLCA 2EI8A 4IMZA 2VVUA 2VIOA 4A1TA 1C5NH 2P3UB 1GCTC 3P6ZB 2QY0B 5C1XA 2F9UA 1G3EA 4Q80A 1QIXB 1L1GA 5BPEA 1SLWB 2TBSA 1EPTA 1H1BA 3EA9A 1GBAA 1EQ9A 2GGVB 1GJ8B 5CE1A 1UVUH 2AIQA 3E6PH 1QY6A 3SORA 5E2OA 1LQDB 1QA0A 3TU7H 2UUYA 1HV7A 3E90B 3TIUA 1ELCA 1V2MT 2A0QB 4Y76A 1P8VC 4H42U 2BDHA 1F0TA 1JRSA 5ABWA 1M9UA 1CE5A 3BTKE 3ATMA 1NZQH 1A4WH 3NKKA 1C1MA 1HAVB 1QJ1B 3TGKE 1O2ZA 4ABAA 2FXRA 4WJG2 2A5KA 2ZDAH 2XW9A 1MU6B 1W7GH 1SHYA 1JBUH 3SU4A 4CR5A 1N6YA 1D6RA 1MUEB 3B23B 3S7HB 1S85A 3NXPA 1AB9B 3MWIU 3SGBE 1GGDB 4AYYB 1AVGH 2J38A 4ZKSU 1KTTB 4DW2U 1E36B 2P93A 3P8NA 1SC8U 2P16A 1MCTA 1RXPA 3KEEA 1SGTA 1P12E 3HK3B 2NU0E 4O3TA 3SGAE 3SOSA 1C5WB 1ZLRA 4CRBA 1T32A 4HFPB 4DVAU 5EPYA 2Q6DA 1TAWA 3OYPA 2BY5X 1UTLM 4ZXXH 1QHRB 1GVLA 1IHSH 1O2NA 1ZSJA 2PGQB 1LPZB 2HVXA 2RCEA 1YPEH 1AN1E 2GMTC 1C2KA 1O2IA 5DP5A 1OKXA 1EJMA 3TVJB 2ZCLP 4CR9A 5B6OA 1TX8A 5DP4A 1OWIA 1ZHMA 2KAIB 2IOTA 2O8TA 2XC5A 2ANKH 1EKBB 1O3DA 1ETTH 4ABFA 1A0HB 1FI8A 2J95A 2BD9A 2BD4A 5EXNA 1TGCA 1OWJA 3Q77A 1SGRE 4K60A 5HYOA 3MH7A 3A8DA 2Z6BD 4UFFH 3ZV9A 1QB1A 3T27A 1FPHH 1V6DA 3TJOA 2H9TH 1L1JA 3ZVCA 3ZVAA 2HWLB 2ZP0H 2HGTH 1GI4A 1P05A 2OCVB 1TIOA 3BTWE 3LH1A 1GJAB 1GBJA 1O3LA 8GCHG 1C5UA 2NWNA 1YYY1 3TH2H 3UFAA 2FOFA 3MO6A 4I32A 5JYIA 4I31A 1W11U 1LHFH 3RC6A 2PUXB 1WTGH 2SGDE 3A8BA 1SGEE 3UREA 3NUMA 2PHBA 1BRBE 4NIXA 1C5TA 1TBRH 4FUEA 3QZQA 5DKMA 5C67A 2GCTC 1EP6A 3U8RH 5DP3A 3RC4A 1BTHH 1FY3A 3VB4A 3EAJA 3LJJA 1GHYH 1C5ZB 4K8BA 1RGQA 1W10U 3GY2A 3KN2A 3EE0B 1AUJA 3RU4E 1KDQB 2A7HA 3A7ZA 1G3BA 1G3CA 1MQ5A 2FS8A 1BTXA 2FOHA 2Y5HA 4SGAE 4FXGH 3LGTA 1LDTT 2GZ8A 1MTNC 2NU2E 1NT1A 3LONA 2VINA 1ANCA 1KXEA 5EXLA 3C27B 1DITH 2A1DB 5DK1A 2VIDA 2OD3B 1OX1A 2FYRA 1F0SA 3HATH 4WY3A 1AWFH 1OYQA 3S9CA 2AMQA 1IQLA 2QYIA 3FZZA 1CHOF 1GHWH 1GMCG 1RFNA 3PMAB 4U30A 1MQ6A 3M3TA 5J4QA 4A6LA 3ZZ6A 5DP9A 4KTSA 2Z9GA 3RXMA 3RXVA 2OBQA 4ZROA 1O3OA 3GCNA 2ZQ2A 3RM2H 2BZAA 2AMPA 1KIGH 2V35A 1UHBB 1YCPM 1IQNA 4AX9H 1NS3A 1TMUH 2TGAA 4D9RA 1A5GH 3SNAA 4CRFA 4YM9A 1GG6C 1LHEH 1ABIH 2F9OA 4HI3A 1AKSA 1O5EH 4ZHMU 1CA0C 2A2QH 1BHXF 4NGAH 1K9OE 1O2GH 2CXVA 2G51A 4THNH 3AASA 1PQ8A 2J92A 2ZCHP 3ITIA 1G32B 3SU0A 1K1MA 6CHAC 1PPBH 1ELDE 3RXPA 1LKBA 4IGDA 2VH0A 1C1NA 3I78A 2VIVA 4X2VA 4GLYA 1SR5C 4NFEA 4RSPA 1C4Y2 2OQ5A 3U1IB 1SB1H 1XUIA 4XBDA 1J9CH 1F92A 3KGPA 1GMDG 1ZOMA 1P2IA 2PUQH 1GDNA 4JMYA 1BOQA 3RXOA 1V2KT 1GPZA 2ZKSA 5T6DA 1GI5A 1L2EA 1AD8H 1CGIE 3O8CA 4K2YA 2ASUB 1AFEH 1QTFA 3URDA 1BB0B 1QL7A 2DUCA 2W7SA 3HGPA 2BY6X 1PYTD 2C8XB 1L4ZA 3GY5A 1XUHA 3KL6A 1TX6A 3GY8A 5C1UA 4O03A 2R3UA 3F9FA 3BTQE 3ZVEA 3DFLA 1TA2A 5DO4H 1O3BA 2P3TB 1VCQA 3WY8A 4NA8A 1E35B 1AVWA 1Y3WA 1SGFG 5EQSA 2ZPQA 2RA3A 1Y59T 4XDEA 2BDAA 2H9HA 4Q7YA 2IPHA 2ZHWH 3BV9B 1ELAA 1A0JA 4ABDA 2A2XH 2FX6A 1ZMJA 3GYLB 2O8WA 3S7KB 2QF0A 2RA0A 3E16B 1S6HA 1CGJE 1DWEH 2BDBA 2ZGBH 4FU9A 4YT6H 4JK5A 4YTAA 5L30H 3FP8E 1YPGH 1T8LA 1DWCH 3KQEA 4X1NU 3EQ0H 3M3SA 1GBLA 1A46H 1GI8B 3ZYDA 2QV1A 1CVWH 1SGDE 3GDUA 1ELEE 1EP5A 1IAUA 3SI4H 1DOJA 4FU8A 2G4TA 4AGJA 4ESTE 3T29A 5E0GA 2R2WU 4IS5A 3K6YA 1OP0A 5JB8S 1SQTA 2B9LA 2ZFRH 1SGPE 3RP2A 2VNTA 1W12U 1NC6A 4CRDA 1KY9A 4I8HA 1DICA 2ANYA 1O2XA 3ZZ5A 1ZGIA 1ID5H 1HUTH 1Q31A 2A7JA 4JZFH 2P8OB 2BM2A 4D9QA 3LIWA 3RMNH 3SU2A 3TK5A 1XKAC 1UVPA 5GPIB 4ABGA 3BN9A 2FYQA 4NG9H 1UK2A 1NU7B 4AB9A 1SGYE 1UMAH 1AY6H 1HIAA 2HNTF 3SO3A 3ZZBA 1PPEE 3NZIA 5HXFA 1O5CB 3MO3A 5F8ZA 3SNCA 2OINA 2W3KA 2QXJA 4XBCA 1FY1A 1O5GH 2WUCA 1GHVH 3RXTA 1C2EA 1ZTLA 2M5TA 4PROA 1IQIA 2CF9H 2H6MA 3SNDA 4K69A 1N6XA 1O2QA 1JXPA 2BTCE 3LGIA 1AWHB 1K1OA 4A92A 4BTUB 3ATIA 1TNGA 1Y3YA 1S83A 1DUAA 3BG4B 4X0WU 2BVSH 2FI5E 3GY3A 4AFUA 2GMTB 1YGCH 3W95A 1SSXA 1ELTA 2ZPRA 1TRMA 2FTLE 1FJSA 3SBKA 3EYDA 1BHXB 2J94A 2VVVA 1LVYA 1C1PA 3A88A 2A4RA 1XXFA 4O97A 3A85A 1G9IE 4JCNA 1BMNH 1Z8JB 3O8DA 1AZZA 3IG6B 5A2MH 3MU1A 3VGCB 1OSSA 2XNIA 1SI5H 5GJ4B 3PROA 2ZU3A 1YPJH 3QGNB 2ZHFH 5EGMA 5H4IB 2G52A 2Z9IA 1LVOA 4CHAB 1FAKH 1O5DH 1PFXC 2LNCA 3STJA 3T5FH 4ABBA 3AAUA 5AVDA 3PMHB 3GCTG 5C5NA 2UUJB 4BXSA 3S9BA 1DX5M 1P0SH 4YOGA 1TPSA 3AW0A 1QB9A 4Y6DA 1ACBE 4KGAA 4ZKRU 8KME2 3OY6U 1NROH 1THPB 2BLOA 2Z3EA 1O2MA 1MZAA 1AU8A 1UCYE 4M7GA 2ZDMA 1IQHA 5J4SA 2ZF0H 1SMFE 1O33A 2XXLA 1FLEE 3PLPA 1YBWA 1K21H 5IYTA 3PV4A 3SV9A 3QZRA 4AOQA 1KSNA 1QQUA 1JIRA 2GCTB 1PPZA 4WVPE 1G3DA 1OWDA 1P3CA 4TWWA 3LGYA 1KLTA 3TK6A 2GV6A 1C4U2 4D7GA 4R8TB 2HRVA 1J14A 3BTTE 3TJVA 1L1NA 1OPHB 1DS2E 4K1TA 3A7YA 1P57B 1CU1A 2VIWA 5F6MA 2TGTA 3HGNA 2VIPA 4X6OA 2QN5T 3HKJB 3EA7A 1FIWA 1MTNB 1IQMA 1NPMA 1C1RA 3U1JB 1T4UH 4NWKA 4BXWA 4FUFA 1KLJH 5A8XA 5I25A 2JETB 5IDKA 1VGCC 1TFXA 4TY6A 1MCVA 1MAYA 2SGPE 1O2KA 2ODYB 4ZXYH 7KMEH 1IQJA 2BDCA 4Y8XA 2FS9A 2RG3A 2Y81A 1TGBA 2FESH 5A8ZA 2FZZA 3SU3A 1UCYH 3ATWA 1B0EA 2Y80A 5HGGA 1S81A 2QA9E 2BQ7B 2Z94A 5E0JA 2C93B 3GY4A 3PO1C 2ODPA 2Y82A 1CBWB 1HAGE 4BAHB 4UFDH 2ZI2H 1EPTC 3T26A 1S0QA 2Y5FA 4B2BA 1ZSKA 1ZR0A 1J15A 1V2JT 1GHAG 4LZ1H 5BRRE 4OGXA 2VWNA 1IQKA 1GG6B 2SGEE 4AN7A 3TLOA 4MG3A 1N8OC 1CGHA 2QIQA 1EOLA 1SFQB 2TGPZ 1RTFB 3GISB 2BY7X 5L2YH 2J34A 2XTTB 1GI2A 4XFQA 1GJBB 1GDQA 1GHBF 1DY9A 3SV6A 1TABE 1VJAU 3QLPH 1QJ6B 3UQOA 4KP0A 3GY7A 2WV4A 2G5VA 3BTFE 3DT0H 2FO9A 2PKAB 1NN6A 3K6ZA 3BIUH 1P04A 2IN2A 1EJAA 5AFYH 5FBEA 1HAYB 2EI7A 1Z1JA 1BUIA 3B8JA 1UCYK 3A83A 1UK4A 2BQ6B 3F6UH 1P03A 4AG1A 1BCUH 4TPYA 4Q2KA 2GT7A 1J8AA 1BIOA 1C5XB 5JB9S 1ETRH 1UHBA 3HPTB 3KF2A 1PQ7A 1O32A 5C20A 2ZTYA 3AVZA 1O3IA 4X1SU 1EAUA 1GBIA 1WAYB 4AB8A 1C2IA 1C5SA 5DPAA 9LPRA 5K7RA 1O2HA 3D65E 3P95A 4Y71A 4DOQA 1GI9B 1DDJA 3RXAA 1UVOA 1RIWC 5A0CA 1P3EA 2PV9B 3PMBB 4GCHG 2A32A 1AI8H 4INKA 1Z8RA 4VGCB 4YOIA 4Y7AA 3MH5A 1HXEH 1FY5A 3U69H 2FMJA 1VJ9U 4IBLH 4SGBE 2R3YA 4AYVB 5GCHG 1EZSC 1QFKH 3RXJA 1GBFA 1INCA 4ISNA 3RXIA 1D3DB 1MAXA 3TJNA 4IC5A 5HMAA 4MPUA 1UK3A 4UDWH 3RC5A 2ULLA 3A84A 1PPFE 1G2MA 1P2JA 1QRXA 2A4QA 2C8YB 1UTMA 3UPEA 1PPCE 4JZIA 5LPRA 3SUFA 4H4FA 1D3PB 3ZVBA 1ZHRA 1HGTH 2Z9JA 5T6GA 3U8TH 2A7CA 3BSQA 1EAWA 2WV5A 1Y3VA 4AORA 5T6FA 2W3IA 3E0PB 1WCZA 3P8OA 3QO6A 4B74A 2GTBA 2Y7XA 2F9PA 1AFQB 4NZLA 2BX3A 2G5NA 2R0LA 4FUIA 1AE8H 2OC1A 3QUMP 1GHAF 2B0FA 2BLVA 4GHQA 2Q1JA 2TIOA 5T3HA 3P8FA 1O3FA 1QA7A 4CRCA 2FOGA 5JPMH 5F8TA 1D4PB 1E34B 1V2NT 2AEIH 2ZO3H 3BTHE 3RMOH 2CMYA 1ESTA 1MTWA 1CQQA 4OS4A 5EW1H 2ZDNA 1FAXA 1Q2WA 1XUGA 1MTSA 3L6PA 3KIDU 2AIPA 1J16A 1GBCA 1QQ4A 3BTGE 2AFQB 1DM4B 1KXBA 1A0LA 2F83A 4E06H 3M37A 4NZQA 4X1RU 3LOXA 4RKOB 3PTNA 4MPXA 1CA8B 1J17T 1LCYA 1TGSZ 2ZFPH 3ZYEA 5EODA 4DIHH 3A8AA 4MQAA 2JH0D 3V7TA 1AIXH 1V2UT 2WPMS 1YKTA 4JZDH 2A5IA 4LXBH 4Y7BA 1ZHPA 4Y0YE 1NTPA 3U98H 1EUFA 5GWZA 2BX4A 1V2ST 5E8EH 1TMTH 3I29A 3MNSA 1C2GA 3OSYA 4ZUHA 2AYWA 1OWKA 4BOHA 1IQEA 1V2PT 2AGIX 1DPOA 3D23A 3RXGA 4ZHAA 1HAPH 2BDGA 1O2LA 3A80A 4Y8ZA 1DE7H 4X8VH 1ETSH 2JKHA 1WUNH 3R3GB 3SU5A 3PLBA 4YZUA 2XCNA 3PLKA 4KKDA 1ZZZA 1SOZA 1TWXB 1UVTH 2ZTXA 3Q3KA 4FVBA 2W5EA 1YC0A 2NU1E 1JRTA 1V2LT 3LT3A 1K1IA 3TK9A 5AHGH 7LPRA 1GI0A 4DT7B 1TPPA 1PJPA 2B5TB 1FUJA 1QBNA 3UWIA 2G8TA 1QL9A 1S82A 1A7SA 2AGEX 2UUFB 1L4DA 5AFZH 1GL1A 1YM0A 2ZECA 2YOLA 1C4V2 3F9GA 2GVFA 2VVCA 3SJOA 1O3CA 1AUTC 2A45B 1H9HE 4Y0ZE 4OS7A 3SGQE 1GBBA 4D76A 3O8RA 4X8UH 4ISOA 2G55A 1IOEA 1C1WH 1GI6A 4OS6A 1UTNA 1Y3XA 1MU8B 1LVBA 2AGGX 1K1LA 1C5VA 1A5HA 3BIVH 2ZU5A 3NK8A 5FAHA 3BEIB 1V2RT 1RTKA 2ESTE 5F8XA 1SLXB 5L6NH 3MU5A 1K1NA 2XWAA 1ZYOA 1TRYA 1UTOA 1GI7B 2WPIS 4XOJA 4X6NA 1SVPA 3RUOA 1Z8GA 3MYWA 4B75A 3SW2B 8ESTE 4IMQA 2ZC9H 3RU4D 1H9LB 2HPQH 1P09A 4TPIZ 1GHZA 3H7OA 2CV3A 4AGKA 1DFPA 4WXVA 1XKBC 5L2ZH 1G37A 5GDSH 3RXCA 4ZKNU 4JYTA 1B7XB 2UWPA 1LHDH 4FU7A 4FVDA 4JK6A 4WMFA 3OX7U 1F2SE 4CBOA 1ZTKA 1N8OB 4CBNA 1CT4E 1HJAC 4WH8A 1TBZH 3KQBA 3ZVDA 1VITH 2CHAC 2QCYA 2PR3A 3A7WA 2FI3E 5TCCA 1TPAE 4OS5A 3SJ9A 1FV9A 1NFWA 5ESBA 8GCHF 3P17H 4RN6A 1C2MA 1SGNE 4XSKU 5LGOA 1OYTH 1TA6A 1P2KA 2FWWA 1H4WA 1ORFA 1D3TB 1LKAA 2PGBB 1BMAA 3UNSA 2WYJA 3VB7A 1FY8E 1GMHG 3BTEE 1V2QT 1LO6A 4OGYA 4AFSA 2H2ZA 1GCTB 1IHTH 3A7VA 3RM0H 5JBCS 1A61H 1ANEA 5EPNA 2F9VA 1FMGA 1JWTA 3V3MA 2ZNKH 1AE5A 1BTYA 3EDXB 4CREA 4HZHA 3P92A 4MNYA 3T62A 3NCLA 2H5DA 1NU9A 5C3NA 7ESTE 1C1OA 1NRSH 3B9FH 5FPTA 1GJDB 3M36A 1E37B 4NIWA 1BMMH 1A3BH 1Y3UA 1Y5UT 2ZIQH 1GMCF 2SFAA 1O2TA 2VU8E 1QRWA 5DGJA 2BD5A 3MNXA 1GI3A 5G4BA 1ZGVA 1BJVA 4CRAA 1P2MA 4ABIA 3TJUA 3ZZ3A 1B5GH 1MTUA 1YPHE 1AB9C 3PB1E 2FOBA 1KYNA 1F5KU 3ODFA 1GGDC 1FN8A 3RXKA 1HLTH 4U32A 3NWUA 5JBAS 1O35A 1A1RA 1OP2A 2F9BH 2SGFE 1QCPA 1C1UH 3CS7A 1FNIA 2Z3CA 4WXIA 1DWDH 4GHTA 1GBKA 1QNJA 2GT8A 9ESTA 1C9TA 1MTVA 2HOBA 1BTWA 5F03A 3KNXA 4LZ4B 1FQ3A 2OBOA 1SFIA 3TH3H 3RMMH 3M7QA 2R9PA 3ZZ4A 1QJ7B 3MOCA 4NA7A 1FONA 4MDSA 5C2ZA 2PSYA 2OTVA 4E7NA 2WUBA 1XXDA 1SL3A 4INLA 2BVRH 1TGNA 1P2NA 3A87A 1GMDF 1OS8A 2GCHG 1GBHA 3M5OA 1GBDA 2AS9A 4WH6A 1WU1A 1HRTH 1HAVA 1GBEA 1ARBA 1BRUP 3UOUA 2ZA5A 3ZZ7A 1BDAA 1GJ6A 4GSOA 1VITG 1H8DH 5EU8A 4NFFA 1Q3XA 1KXFA 2GKVE 2NU3E 1IQGA 4FUHA 2FOAA 2ZDVH 4A1XA 2OC7A 1TBQH 2Y6TA 3KQCA 1GDUA 2BYAX 1SQAA 1ZPCA 4BAKB 1LMWB 4FUCA 4CRGA 2ZHDA 4DGJA 4X2XA 4F4OC 1NY22 2XC4A 1EOJA 2ZGJA 2Z3DA 3A7TA 3U8OH 4I8JA 1O3PB 2GD4B 1EATA 3L33A 1ELFA 1DLEA 3LGWA 2O8LA 1ZPBA 1UTQA 3MNBA 1W0YH 2VIQA 1NESE 4Y10E 5FBIA 2H5CA 1GHXH 2K1QA 4JZ1A 1LVMA 1WTHD 1H8IH 1O3EA 3PWBA 2PFEA
chains in the Genus database with same CATH superfamily
3A81A 1W0KD 3TGIE 1FN6A 1ABJH 2B8OH 2KAIA 3Q00A 4O9VA 1A2CH 1SLUB 2FIRH 2XRCA 3F9HA 3KQ5A 1TX7A 1C5OH 3E3TA 1T8MA 2ZG0H 1GCDA 4X2WA 3A82A 4BAQB 3ATKA 2V3OH 2PTNA 4I8GA 4GAWA 2FI4E 4ACBA 2STAE 3MU8A 1LQEA 3SJKA 2VJ1A 4DCDA 1MMJN 4Q63A 3UY9A 1ZJKA 1ZJDA 2BXTH 1EJNA 1GVKB 1YPKH 1NFYA 1W14U 1N1LA 3OAAD 4ZH8A 1O5BB 1O2WA 2BDYA 4JYVH 5ESTE 3U9AH 1LPGB 2VBCA 2VWLA 2GP9B 3LGVA 2D26C 1DY8A 2UWLA 4AZ2B 1ELGA 1TQ7B 2WINI 3FVFB 2GDDA 4B2AA 1S6FA 3SZNA 1HB0B 3LH3A 1FIZA 5HM9A 4FUDA 1FY4A 3RXRA 3FN8A 4GUXA 4J2YB 1HJ9A 2R0KA 3BF6H 4A7IB 4F48B 3ATLA 6ESTA 1NRNH 1AZ8A 2ANWA 3KCGH 4MNWA 1O2RA 2SNVA 1AMHA 3P70B 3UTUH 4DG4A 5FHTA 1KDQA 1CA0B 1Z6EA 4B2CA 4NSVA 2V3HH 3QK1A 1Y5BT 1QBVH 1Z1IA 1P11E 3QTVH 2Z9LA 4AC9A 3RXBA 1QURH 6CHAB 2FOEA 3PWCA 4KTCA 1FPCH 1W3CA 3V12A 5DP6A 4X8TH 1DT2A 1T4VH 2OUAA 1T8OA 3TITA 4D8NA 1VITF 2WPHS 4WWYA 2BOKA 1K1JA 2XWBI 4UFEH 4Y8YA 2FOMB 1YPHC 2GV7A 4LOYH 4B76A 1FDPA 4AG2A 2AERH 1DUEA 2ALPA 1HYLA 4CH8B 1DLKB 4K1EA 3GCTF 4BANB 2TRMA 3QX5H 3GOVB 4U2WA 5FCKA 1XUFA 1HDTH 2ZEBA 5C1YA 7GCHG 1SQOA 2P94A 2SGQE 3MHWU 5A09A 5EJ1A 1P2OA 2OP9A 3M7UA 4INHA 1NO9H 2I6QA 3RXQA 2ZGHA 2ZFFH 4QT8C 1TRNA 3Q3XA 4NIVA 5JBBS 3SN8A 3H09A 1T7CA 3ZZAA 5DG6A 2HLCA 2BY9X 2PKSC 1H8ED 4A5TS 4ZAEA 2W6JD 2ZQ1A 3LC3A 1C2JA 2A4GA 1TONA 1TNIA 1HIAB 3LDXH 3LC5A 2BLWA 1K1PA 2EC9H 5AF9H 1YP9A 3H5CB 4I8KA 1PPGE 5DP8A 2BHGA 5EJZA 2I6SA 3VEQB 3F0OA 1O30A 3OEHD 3F2FA 1BZXE 1C1QA 1TGTA 1UTPA 1G2LA 6GCHG 1C1SA 1P9SA 2BVXH 1XVMA 2XCFA 1D3QB 3HK6B 2DE8A 2HNTE 3O8BA 2R2MB 5FL7D 3LKWA 1AVXA 5A0AE 4ACAA 1EASA 4B73A 3ENSB 1QBOA 2Z7FE 3GCHC 3UUZA 1Y8TA 5A8YA 3SNBA 2WPLS 3V13A 4FUGA 2JH5D 1TB6H 4M9FA 2C90B 4DJZB 1SPJA 1XX9A 3QDZB 1MABB 2ZFSA 2P8OC 5EG4A 3ZZ9A 1VCWA 3MO9A 2BD3A 2FPZA 3T2NA 2ZCKP 4LK4A 2FP7B 3QTOH 1CHOG 2J5UA 2QF3A 1TOMH 2F43B 1KXCA 1SKYE 2OC0A 2QAAA 2JH6D 1ESAA 3I77A 1HAIH 5CHAC 5JBTA 2XBVA 2J98A 1SG8B 1HPGA 1D9IA 3ODDA 1T8NA 3A86A 3GDVA 1K2I1 1HAHH 3FOAA 1AGJA 1KXDA 3E91A 2P59A 2P95A 3GDSA 3JZ2B 4FUBA 2HPPH 4K1SA 1WOFA 1WYKA 1NFUA 2F91A 3W94A 3URCA 5JDUB 2IJOB 3QGJA 2ZTZA 3T25A 4K8YA 1EX3A 1CHGA 4X6PA 4MVNA 1Z71A 3BG4C 2OC8A 4F49A 2FM2A 4ISHH 3PMJA 3MU4A 4A1VA 3SI3H 1ELBA 1EAIA 3SQHE 3D62A 4H6TA 3T28A 1THRH 2VH6A 2BY8X 3SV7A 1ZRKA 1WSSH 3AW1A 2C8WB 1SGCA 2ZPSA 3OU0A 4TT3D 1O2OA 2BXUH 4WF8A 3RLYH 3MNCA 3MFJA 3M35A 2AMDA 4ZHLU 1EZUC 1XUJA 2B7DH 1PPHE 1DSUA 3DUXH 3PYHA 3MU0A 3VGCC 2BDIA 2XBWA 1F0UA 1GBTA 1SQRA 1TNHA 1BTUA 3OY5U 4IC6A 4Y79A 1SLVB 7GCHF 3LGUA 1LPKB 1O38A 1O5AB 2PWXA 4CHAC 1GVZA 3TH4H 1ZMNA 3PRBA 3PTBA 4OM9A 3PV5A 2FLBH 3VXFH 1O37A 5A0BA 2ZDLA 2V0BA 1HAOH 3FZDA 4NA9H 2D2DA 3GYMA 1BRCE 2F3CE 2V6NA 4ISIH 2H1UA 1C2DA 4GCHF 4TYDA 1O31A 4OS2A 3SJ8A 1O36A 2QC2A 3GICB 1C2HA 2D1JA 3PV2A 4HG6A 1P02A 4Q7ZA 2OLGA 4E7RG 3DD2H 8LPRA 4H6SB 1O2VA 1F5RA 3S0NA 1K22H 5GCHF 2KX4A 1VR1H 3KYGA 1ZPZA 1RJXB 1W2KH 3ZVFA 1MBQA 3BEUA 1ESBA 1D6WA 2ZU4A 2PSXA 3N7EA 1O2PA 1O3NA 3CS0A 6GCHF 4BTIB 1V2VT 4RKJB 4MTBA 4IN1A 1BTPA 1DANH 4NCYA 2ODQA 1W13U 2XBXA 2ZU2A 1RD3B 3LU9B 2KCYA 4K3JA 1EXFA 3GCOA 3ELAH 1XM1A 2JETC 2BB4A 3VXEH 3SHAH 1LHCH 4NWLA 1ZMLA 1TMBH 2PW8H 1O3HA 3QN7A 4ABJA 1VGCB 1O2SA 3RXLA 3OFND 3UNQA 4K5ZA 3BTDE 5FPSA 3BEFB 1H8HD 2FEQH 1OOKB 5LPEA 1YPLH 1FXYA 1YPMH 1CBWC 1C5QA 1TE0A 2H9EH 2JDID 2VGCC 1GI1A 2GX4A 3AAVA 1G36A 1THSH 1NRRH 3UOPA 2IPQX 2D8WA 3PO1B 5LPFA 3QWCH 4MLFB 4OS1A 2CF8H 1TQ0B 4UEHH 4X2YA 3BTME 1EPTB 2SNWA 1HCGA 1QL8A 3LPRA 1GJCB 2LPRA 3M61U 1V3XA 4JZEH 4XE4A 4DURA 1Z8IB 2L74A 1PQ5A 1BITA 4X8SH 1FZZA 3DA9B 3SHCH 1UJ1A 1VZQH 3SZEA 1BMLA 1EZQA 3M7TA 1DXPA 5E2PA 2OXSA 2Z9KA 4ZKOU 3NPSA 2P3FH 2WYGA 3ZZDA 2HNTC 3VB3A 1W8BH 3IITA 1F5LA 2ZDKA 2UWOA 2YNAA 2EEKA 4BNRA 1U6QA 2RFKC 1WQVH 1TNKA 2W7UA 1O3KA 3PM3A 4R0IA 3FANA 1NM6A 3K9XB 3RMLH 3F1SB 5TJXA 2RDLA 3RXSA 3TPIZ 4E05H 3D49H 5HM2A 3SU6A 4I8LA 5FX6A 4Q4LA 5GIBA 2ZWLH 1WXRA 3K2UA 2K8IA 1JOUB 5EIYA 3E0NB 2TPIZ 3TNSA 3R0FA 1S5SA 5K0HA 5PTPA 3VFEA 2GDEH 5DN6D 1G30B 2VB0A 1XVOA 3FP7E 2QXIA 2QGRA 2BOHB 1Z6JH 3A7XA 3TGJE 1MH0A 4ZMAH 3ZV8A 5GXPA 4BAMB 2A4OA 1MKXH 4J1YA 1SHHB 5I46H 5EW2H 2ZU1A 2AH4X 2YNBA 3MTYA 4MPVA 4UE7H 1PQAA 1F7ZA 4RT0A 2QXGA 1X7AC 1YLNA 4VGCC 1C2LA 1ANBA 5FXLA 1RIWB 1SGIB 2XYAA 2PKSB 1E38B 1RRKA 2Y5GA 4YLQH 2FOCA 1BQYA 1H9IE 3SUEA 4O3UA 5LH8A 1GBMA 5HIZA 3RU4T 1C2FA 3SV2H 1C5MD 1YCPH 1BT7A 1BBRE 2PKAA 1MBMA 2XC0A 3ZZ8A 1ARCA 1NRPH 4TWYA 1O2JA 1TPOA 3VB6A 3UQVA 1V2OT 1OXGA 2TGDA 3F68H 4CH2B 5SGAE 2BD2A 4F55A 3BG8A 4NSYA 1IQFA 1KLIH 1W7XH 1WQSA 1KXAA 2O9QA 1CT2E 2BD7A 3FFGA 4IW4E 4ASHA 3GCHB 1GWAA 4X1PU 3IWMA 4MPWA 1OWEA 1AFQC 2C3SA 2BLQA 4IN2A 1O34A 1CSOE 1DVAH 1AO5A 1O3JA 3UNRA 2C8ZB 1C9PA 1MKXK 1ZRBA 2O8MA 3A8CA 5C94A 1DWBH 4GPGA 3UWJH 4Q7XA 3RXFA 1LHGH 3M5LA 1DXWA 1WBGB 2WSSD 4P02A 2W6ID 3S9AA 1YLDA 2J2UA 4MNVA 3KQDA 1P2QA 3ZVGA 3Q76A 3SNEA 1W0JD 5CHAB 1RS0A 2Q6GA 1BBRH 1T31A 2ALVA 2VWOA 1UO6A 1SOTA 4D7FA 3EA8A 1SGFA 2ANMH 1HAXB 3CP7A 1YCPK 2CJIA 1JMOH 1Z7KA 1E0FD 1C5YB 2FODA 2CGAA 3W1EA 4UONA 1QGFA 2FTMA 4I33A 3RDZA 3S69A 1TYNA 3M3VA 3L3TA 4YLUA 5E0HA 3UIRA 2A31A 3DHKH 3N7OA 4YESB 1TNLA 1EAXA 3STIA 4ABHA 3SUDA 1P10A 1C5PA 2SGAA 2C4FH 3C1KA 1YF4A 1ZSLA 1F0RA 3FAOA 2UUKB 3RLWH 1GHBG 1UTJA 2EA3A 2FLRH 3MH6A 2NU4E 3SV8A 1LTOA 1GMHF 1TALA 4WMEA 4FUJA 5C5OA 2EI6A 1BRAA 3F9EA 2GZ7A 5FX5A 1QRZA 1C5RA 1V2TT 3LJOA 1TLDA 2W26A 1HJ8A 2FX4A 1V2WT 1GJ4H 1HXFH 1PYTC 5EQRA 2RDEA 3E8LA 3MMGA 1SGQE 3KHVA 1HBTH 1CT0E 3SJIA 2ZGXH 2ZZUH 1AHTH 1AKSB 1BBRK 1EB2A 3SUGA 5DP7A 1B0FA 6LPRA 1EZXC 2F9NA 2BD8A 3CENA 3P8GA 4B1TA 1WV7H 1HFDA 4AFQA 1CO7E 1K28D 3EE7A 1QB6A 2FDAA 2ZHEH 5EXMA 2J4IA 1JIMA 2CN0H 1MD7A 3RXUA 4YOJA 1GL0E 1ANDA 2Y7ZA 1S84A 3EGKH 3Q3YA 1YWUA 1GJ9B 1KTSB 2PTCE 4JYUH 4X6MA 3VPKA 5TCAA 4I7YH 2G4UA 1TNJA 4KTUA 3DFJA 1P9UA 4XRNA 2OQUA 3SU1A 2HVYB 1BA8B 2KFWA 1XUKA 4HTCH 5CMXH 1MD8A 2GZ9A 1O3GA 4YO9A 2VWMA 1XMNB 1L0ZA 1Y5AT 2G00A 3GS9A 2ZFQH 4MNXA 1O5FH 3MI4A 2STBE 3OE7D 1RTLA 4NIYA 3RXDA 4YT7H 2HALA 1AQ7A 3MH4A 5FPYA 1UTKA 2DE9A 2ZHQH 5IK2D 2IJD1 5EQQA 1O39A 1C1VH 1E79D 4U01A 3K65B 1MKWH 1ZTJA 3E1XB 2THFB 2EQNA 4Y11E 2BQWB 4TY7A 3G01A 4XBBA 4UFGH 2PLXA 1SBWA 4WMDA 3GY6A 4ISLA 1P06A 3ZZCA 2WPKS 1GJ7B 2ZFTA 1QR3E 4BAOB 1VCPA 3H7TA 3AK5A 1BTZA 4RT1A 3UR6A 2O8UA 1OP8A 2Q6FA 2GCHF 2VGCB 3FP6E 1NBMD 1UVSH 3RXEA 4Z0KA 3RXHA 3SQEE 1A5IA 4GVUA 4B71A 2J97A 1O3MA 3TNTA 4BTTB 3HKIB 1O3AA 2BMGB 3V0XA 4KELA 4Z1MD 1TOCB 2G81E 4HGCA 3UR9A 4YXWD 2QXHA 4FETA 1OWHA 1O2YA 4DIIH 1C1TA 2XBYA 4ABEA 5EOKA 2ZGCA 2WPDD 1ELVA 2J9NA 3KYFA 2BZ6H 1HJAB 1W0ZU 1C5LH 3JZ1B 5ETXA 1BJUA 3M5MA 1GJ5H 1DSTA 1MKWK 1A3EH 2XOKD 2CHAB 3OTJE 1NRQH 1O0DH 5DJ7A 2WPJS 3M5NA 5FCRA 4AFZA 4UD9H 1NFXA 4Z6AH 3A89A 2KCOA 2F4LA 3VB5A 2ILNA 3ESTA 1S0RA 1EB1H 1O2UA 1HAZB 1HNEE 4DY7B 2A5AA 4X1QU 1P01A 1YLCA 2EI8A 4IMZA 2VVUA 2VIOA 4A1TA 1C5NH 2P3UB 1GCTC 3P6ZB 2QY0B 5C1XA 2F9UA 1G3EA 4Q80A 1QIXB 1L1GA 5BPEA 1SLWB 2TBSA 1EPTA 1H1BA 3EA9A 1GBAA 1EQ9A 4DT4A 2GGVB 1GJ8B 5CE1A 1UVUH 2AIQA 3E6PH 1QY6A 3SORA 5E2OA 1LQDB 5CDFE 1QA0A 3TU7H 2UUYA 1HV7A 3E90B 3TIUA 5EJLA 1ELCA 1V2MT 2A0QB 4Y76A 1P8VC 4H42U 2BDHA 1F0TA 1JRSA 2LELA 5ABWA 1M9UA 1CE5A 3BTKE 3ATMA 1NZQH 1A4WH 3NKKA 1C1MA 5CHBA 1HAVB 1QJ1B 3TGKE 1O2ZA 4ABAA 2FXRA 4WJG2 2A5KA 2ZDAH 3DSPA 4I86A 2XW9A 1MU6B 4B6EA 1W7GH 1SHYA 1JBUH 3SU4A 4CR5A 1N6YA 1D6RA 1MUEB 3B23B 3S7HB 1S85A 3NXPA 3N7DA 1AB9B 3MWIU 3SGBE 1GGDB 4AYYB 1AVGH 2J38A 4ZKSU 4B6FA 1KTTB 4DW2U 1E36B 2P93A 3P8NA 1SC8U 2P16A 1MCTA 1RXPA 3KEEA 1SGTA 2M2AA 1P12E 3HK3B 2NU0E 4O3TA 3SGAE 3SOSA 1C5WB 1WDIA 1ZLRA 4CRBA 1T32A 4HFPB 4DVAU 5EPYA 2Q6DA 1TAWA 3OYPA 2BY5X 1UTLM 4ZXXH 1QHRB 1GVLA 1IHSH 1O2NA 1ZSJA 2PGQB 1LPZB 2HVXA 2RCEA 1YPEH 1AN1E 2GMTC 1C2KA 1O2IA 5DP5A 1OKXA 1EJMA 3TVJB 2ZCLP 4CR9A 5B6OA 1TX8A 5DP4A 1OWIA 1ZHMA 2KAIB 2IOTA 2O8TA 2XC5A 2ANKH 1EKBB 3VG8A 1O3DA 1ETTH 4ABFA 1A0HB 1FI8A 2J95A 2K0QA 2BD9A 2BD4A 5EXNA 1TGCA 1OWJA 3Q77A 1SGRE 4K60A 5HYOA 3MH7A 3A8DA 2Z6BD 4UFFH 3ZV9A 1QB1A 3T27A 1FPHH 1V6DA 3TJOA 2H9TH 1L1JA 3ZVCA 3ZVAA 2HWLB 2ZP0H 2HGTH 1GI4A 1P05A 2OCVB 1TIOA 3BTWE 3LH1A 2GJGA 1GJAB 1GBJA 1O3LA 8GCHG 1C5UA 2NWNA 1YYY1 3TH2H 3UFAA 2FOFA 3MO6A 4I32A 5JYIA 4I31A 1W11U 1LHFH 3RC6A 5KGOA 2PUXB 1WTGH 2SGDE 3A8BA 1SGEE 3UREA 3NUMA 2PHBA 1BRBE 4NIXA 1C5TA 1TBRH 4FUEA 5GNDA 3QZQA 5DKMA 5C67A 2YMSC 2GCTC 1EP6A 3U8RH 5DP3A 3RC4A 1BTHH 1FY3A 3VB4A 3EAJA 3LJJA 1GHYH 1C5ZB 4K8BA 1RGQA 1W10U 3GY2A 3KN2A 3EE0B 1AUJA 3RU4E 1KDQB 2A7HA 3A7ZA 1G3BA 1G3CA 1MQ5A 2FS8A 1BTXA 2FOHA 2Y5HA 4SGAE 4FXGH 2KR7A 3LGTA 1LDTT 2GZ8A 1MTNC 2NU2E 1NT1A 3LONA 2VINA 1ANCA 1KXEA 5EXLA 3C27B 5C17A 1DITH 1KMHB 2A1DB 5DK1A 2VIDA 2OD3B 1OX1A 2FYRA 1F0SA 3HATH 4WY3A 1AWFH 1OYQA 3S9CA 2AMQA 1IQLA 2QYIA 3FZZA 1CHOF 1GHWH 1GMCG 1RFNA 3PMAB 4U30A 1MQ6A 3M3TA 5J4QA 4A6LA 3ZZ6A 5DP9A 4KTSA 2Z9GA 3RXMA 3RXVA 2OBQA 4ZROA 1O3OA 3GCNA 2ZQ2A 3RM2H 2BZAA 2AMPA 1KIGH 2V35A 1UHBB 1YCPM 1IQNA 4AX9H 1NS3A 1TMUH 2TGAA 4D9RA 1A5GH 1VKYA 3SNAA 4CRFA 2PFEA 4YM9A 1GG6C 1LHEH 1ABIH 2F9OA 4HI3A 1AKSA 1O5EH 4ZHMU 1CA0C 4ZCNA 2A2QH 1BHXF 4NGAH 1K9OE 1O2GH 2CXVA 2G51A 4THNH 3AASA 1PQ8A 2J92A 2ZCHP 3ITIA 1G32B 3SU0A 1K1MA 6CHAC 4XD7D 1PPBH 1ELDE 3RXPA 1LKBA 4IGDA 2VH0A 1C1NA 3I78A 2VIVA 4X2VA 4GLYA 1SR5C 4NFEA 4RSPA 1C4Y2 2OQ5A 3U1IB 1SB1H 1XUIA 4XBDA 1J9CH 1F92A 3KGPA 1GMDG 1ZOMA 1P2IA 2PUQH 1GDNA 4JMYA 1BOQA 3RXOA 1V2KT 1GPZA 2ZKSA 5T6DA 1GI5A 1L2EA 1AD8H 1CGIE 3O8CA 4K2YA 2ASUB 1AFEH 1QTFA 3URDA 1BB0B 2KM0A 1QL7A 2DUCA 2W7SA 3HGPA 2BY6X 1PYTD 5KEDA 2C8XB 1L4ZA 3GY5A 1XUHA 3KL6A 1TX6A 3GY8A 2KCAA 4O03A 2OK5A 5C1UA 2R3UA 3F9FA 3BTQE 4RI0A 3ZVEA 3DFLA 1TA2A 5DO4H 1O3BA 2P3TB 1VCQA 3WY8A 4NA8A 1E35B 1AVWA 1Y3WA 1SGFG 5EQSA 2ZPQA 2RA3A 1Y59T 4XDEA 2BDAA 2H9HA 4Q7YA 2IPHA 2ZHWH 3BV9B 1ELAA 2J98B 2JIZD 1A0JA 4ABDA 2A2XH 2FX6A 1ZMJA 3GYLB 2O8WA 3S7KB 2QF0A 2RA0A 3E16B 1S6HA 1CGJE 1DWEH 2BDBA 2ZGBH 4FU9A 4YT6H 4JK5A 4YTAA 5L30H 3FP8E 1YPGH 1QZ8A 1T8LA 1DWCH 2HLDD 3KQEA 4X1NU 3EQ0H 3M3SA 1GBLA 1A46H 1GI8B 3ZYDA 2QV1A 1CVWH 1SGDE 3GDUA 1ELEE 1EP5A 1IAUA 3SI4H 1DOJA 4FU8A 2G4TA 4AGJA 4ESTE 3T29A 5E0GA 2R2WU 4IS5A 3K6YA 1OP0A 5JB8S 1SQTA 2B9LA 2ZFRH 1SGPE 3RP2A 2L6OA 2VNTA 1W12U 1NC6A 4CRDA 1KY9A 4I8HA 1DICA 2ANYA 1O2XA 3ZZ5A 1ZGIA 1ID5H 1HUTH 1Q31A 2A7JA 4JZFH 2P8OB 2BM2A 4D9QA 3LIWA 3RMNH 3SU2A 3TK5A 1XKAC 1UVPA 5GPIB 4ABGA 3BN9A 2FYQA 4NG9H 1UK2A 1NU7B 4AB9A 1SGYE 1UMAH 1AY6H 1HIAA 2HNTF 3SO3A 3ZZBA 1PPEE 3NZIA 5HXFA 1O5CB 5C0UA 3MO3A 5F8ZA 3SNCA 3FO8D 2OINA 2W3KA 2QXJA 4XBCA 1FY1A 1O5GH 2WUCA 1GHVH 3RXTA 1C2EA 1ZTLA 2M5TA 4PROA 1IQIA 2CF9H 2H6MA 3SNDA 3DCLA 4K69A 1N6XA 1O2QA 2XNDD 1JXPA 2BTCE 3LGIA 1AWHB 1K1OA 4A92A 4BTUB 3ATIA 1TNGA 1Y3YA 3N99A 1S83A 1DUAA 3BG4B 4X0WU 2BVSH 2FI5E 3GY3A 4AFUA 2GMTB 1YGCH 3W95A 1SSXA 1ELTA 2ZPRA 1TRMA 2FTLE 1FJSA 1COWD 3SBKA 3EYDA 3WWFA 1BHXB 2J94A 2VVVA 1LVYA 1C1PA 3A88A 4ASUD 2A4RA 1XXFA 4O97A 3A85A 1G9IE 4JCNA 1BMNH 1Z8JB 3O8DA 1AZZA 2AHME 3IG6B 5A2MH 3MU1A 3VGCB 1OSSA 2XNIA 1SI5H 5GJ4B 3PROA 2ZU3A 1YPJH 3QGNB 2ZHFH 5EGMA 5H4IB 2G52A 2Z9IA 1LVOA 3MQKC 4CHAB 1FAKH 1O5DH 1PFXC 2EY4C 2LNCA 3STJA 3T5FH 4ABBA 3AAUA 5AVDA 3PMHB 3GCTG 5C5NA 2UUJB 4BXSA 3S9BA 1DX5M 1P0SH 4YOGA 1TPSA 3AW0A 1QB9A 5HKKD 4Y6DA 1ACBE 4KGAA 4ZKRU 8KME2 3OY6U 1NROH 1THPB 2BLOA 2Z3EA 1O2MA 1MZAA 1AU8A 1UCYE 4M7GA 1FX0B 2ZDMA 1IQHA 5J4SA 2ZF0H 1SMFE 1O33A 2XXLA 1FLEE 3PLPA 1YBWA 1K21H 5IYTA 3PV4A 3SV9A 3QZRA 4AOQA 1KSNA 1QQUA 1JIRA 2GCTB 1PPZA 4WVPE 1G3DA 1OWDA 2V7QD 1P3CA 4TWWA 3LGYA 1KLTA 3TK6A 2GV6A 1C4U2 4D7GA 4R8TB 2HRVA 1J14A 2WV9A 3BTTE 3TJVA 1L1NA 1OPHB 1DS2E 4K1TA 3A7YA 1P57B 1CU1A 2VIWA 5F6MA 2TGTA 1S6LA 3HGNA 2VIPA 4X6OA 2QN5T 3HKJB 3EA7A 3PRDA 1FIWA 1MTNB 1IQMA 1NPMA 3FKSD 1C1RA 3U1JB 1T4UH 4NWKA 4BXWA 4FUFA 1KLJH 5A8XA 5I25A 2JETB 5IDKA 1VGCC 1TFXA 4TY6A 1MCVA 1MAYA 2SGPE 1O2KA 2ODYB 4ZXYH 7KMEH 1IQJA 2BDCA 4Y8XA 2FS9A 2RG3A 2Y81A 1TGBA 2FESH 5A8ZA 2FZZA 3SU3A 1UCYH 3ATWA 1B0EA 2Y80A 5HGGA 1S81A 2QA9E 2BQ7B 2Z94A 5E0JA 2C93B 5B6LA 3GY4A 3PO1C 2ODPA 2Y82A 1CBWB 1HAGE 4BAHB 4UFDH 2ZI2H 1EPTC 3T26A 1S0QA 2Y5FA 4B2BA 1ZSKA 1ZR0A 1J15A 1V2JT 1GHAG 4LZ1H 5BRRE 4OGXA 2VWNA 1IQKA 1GG6B 2SGEE 4AN7A 3TLOA 4MG3A 1N8OC 2WHXA 1CGHA 2QIQA 1EOLA 1SFQB 2TGPZ 1RTFB 1YY3A 3GISB 2BY7X 5L2YH 2J34A 2XTTB 5HIYA 1GI2A 4XFQA 1GJBB 1GDQA 1GHBF 1DY9A 3SV6A 1TABE 1VJAU 3QLPH 1QJ6B 3UQOA 4KP0A 3GY7A 2WV4A 2G5VA 3BTFE 3DT0H 2FO9A 2PKAB 1NN6A 3K6ZA 3BIUH 1P04A 2IN2A 1EJAA 5AFYH 5FBEA 1HAYB 2EI7A 1Z1JA 1BUIA 3B8JA 1UCYK 3A83A 1UK4A 2BQ6B 3F6UH 1P03A 4AG1A 1BCUH 4TPYA 4Q2KA 2GT7A 1J8AA 1BIOA 1C5XB 5JB9S 1ETRH 1UHBA 3HPTB 3KF2A 1PQ7A 1O32A 5C20A 2ZTYA 3AVZA 1O3IA 4X1SU 1EAUA 1GBIA 1WAYB 4AB8A 2YMSD 1C2IA 1C5SA 5DPAA 9LPRA 5K7RA 1OHHD 1O2HA 3D65E 3P95A 4Y71A 4DOQA 1GI9B 1DDJA 3RXAA 1UVOA 1RIWC 5A0CA 1P3EA 2PV9B 3PMBB 2LP6A 4GCHG 2A32A 1AI8H 4INKA 1Z8RA 4VGCB 4YOIA 4Y7AA 3MH5A 1HXEH 1FY5A 3U69H 2FMJA 1VJ9U 4IBLH 4SGBE 2R3YA 4AYVB 5GCHG 1EZSC 1QFKH 3RXJA 1GBFA 1INCA 4ISNA 3RXIA 1D3DB 1MAXA 3TJNA 4IC5A 5HMAA 4MPUA 1UK3A 4UDWH 3RC5A 2ULLA 3A84A 1PPFE 1G2MA 1P2JA 1QRXA 2A4QA 2C8YB 1UTMA 3UPEA 1PPCE 4JZIA 5LPRA 3SUFA 4H4FA 1D3PB 3ZVBA 1ZHRA 1HGTH 2Z9JA 5T6GA 3U8TH 2A7CA 3BSQA 3DSGA 1EAWA 2WV5A 1UW7A 1Y3VA 4AORA 5T6FA 2W3IA 3E0PB 1WCZA 3P8OA 3QO6A 4B74A 2GTBA 2Y7XA 2F9PA 1AFQB 4NZLA 2BX3A 2G5NA 2R0LA 4FUIA 1AE8H 2OC1A 3QUMP 1GHAF 2B0FA 2BLVA 4GHQA 2Q1JA 2TIOA 5T3HA 3P8FA 1O3FA 1QA7A 4CRCA 2FOGA 5JPMH 5F8TA 1D4PB 1E34B 1V2NT 2AEIH 2ZO3H 3BTHE 3RMOH 2CMYA 1ESTA 1MTWA 1CQQA 4OS4A 5EW1H 2ZDNA 1FAXA 1Q2WA 1XUGA 1MTSA 3L6PA 3KIDU 2AIPA 1J16A 1GBCA 1QQ4A 2PP6A 2AFQB 2CK3D 3BTGE 3NRLA 1DM4B 1KXBA 1A0LA 2F83A 4E06H 3M37A 4NZQA 4X1RU 3LOXA 4RKOB 3PTNA 4MPXA 1CA8B 1J17T 1LCYA 1TGSZ 2ZFPH 3ZYEA 5EODA 4DIHH 3A8AA 4MQAA 2JH0D 3V7TA 1AIXH 1V2UT 2WPMS 1YKTA 4JZDH 2A5IA 3DSOA 4LXBH 4Y7BA 1ZHPA 4Y0YE 1NTPA 3U98H 1EUFA 5GWZA 2BX4A 1V2ST 5E8EH 1TMTH 3I29A 3MNSA 1C2GA 3OSYA 4ZUHA 2AYWA 1OWKA 4BOHA 1IQEA 1EFRD 1V2PT 2AGIX 1DPOA 3D23A 3RXGA 4ZHAA 1HAPH 2BDGA 1O2LA 3A80A 4Y8ZA 1DE7H 4X8VH 1ETSH 2JKHA 1WUNH 3R3GB 3SU5A 3PLBA 4YZUA 2XCNA 3PLKA 4KKDA 1ZZZA 1SOZA 1TWXB 1UVTH 2ZTXA 3Q3KA 4FVBA 2W5EA 1YC0A 1JRTA 2NU1E 1V2LT 3LT3A 1K1IA 3TK9A 5AHGH 7LPRA 1GI0A 4DT7B 1TPPA 1PJPA 2B5TB 1FUJA 1QBNA 3UWIA 2G8TA 1QL9A 1S82A 1A7SA 2AGEX 2UUFB 1L4DA 5AFZH 1GL1A 1YM0A 2ZECA 2YOLA 1C4V2 3F9GA 2GVFA 2VVCA 3SJOA 1O3CA 1AUTC 2A45B 1H9HE 4Y0ZE 4OS7A 3SGQE 1GBBA 4D76A 3O8RA 4X8UH 4ISOA 2G55A 1IOEA 1C1WH 1E1RD 1GI6A 4OS6A 1UTNA 1Y3XA 1MU8B 1LVBA 2AGGX 1K1LA 1C5VA 3WW7A 1A5HA 3BIVH 2WZQA 2ZU5A 3NK8A 5FAHA 3BEIB 1V2RT 1RTKA 2ESTE 5F8XA 1SLXB 5L6NH 3MU5A 1K1NA 2XWAA 1ZYOA 1TRYA 1UTOA 1GI7B 2WPIS 4XOJA 4X6NA 1SVPA 3RUOA 1Z8GA 3MYWA 4B75A 5F53A 3SW2B 8ESTE 4IMQA 2ZC9H 3RU4D 1H9LB 2HPQH 1P09A 4TPIZ 1GHZA 3H7OA 4FOUC 2CV3A 4AGKA 1DFPA 4WXVA 1XKBC 5L2ZH 1G37A 5GDSH 3RXCA 4ZKNU 4JYTA 1B7XB 2UWPA 1LHDH 4FU7A 3SYJA 4FVDA 4JK6A 4WMFA 3OX7U 3UAIC 1F2SE 5DSFA 4CBOA 1ZTKA 1N8OB 4CBNA 1CT4E 1HJAC 4WH8A 1TBZH 3KQBA 3ZVDA 1VITH 2CHAC 2QCYA 2PR3A 3A7WA 3F2GA 2FI3E 5TCCA 1TPAE 4OS5A 3SJ9A 2KZ4A 1FV9A 1NFWA 5ESBA 8GCHF 2QF4A 3P17H 4RN6A 1C2MA 1SGNE 4XSKU 5LGOA 2KCPA 1OYTH 1TA6A 1P2KA 2FWWA 1H4WA 1ORFA 1D3TB 1LKAA 2PGBB 1BMAA 3UNSA 2WYJA 3VB7A 1FY8E 1GMHG 3BTEE 1V2QT 1LO6A 4OGYA 4AFSA 4P00A 2H2ZA 1GCTB 1IHTH 3A7VA 3RM0H 5JBCS 1A61H 1ANEA 5EPNA 2F9VA 1FMGA 1JWTA 3V3MA 2ZNKH 1AE5A 1BTYA 3EDXB 4CREA 4HZHA 3P92A 4MNYA 3T62A 3NCLA 2H5DA 2QF5A 1NU9A 5C3NA 3F0PA 7ESTE 1C1OA 1NRSH 3B9FH 5FPTA 1GJDB 3M36A 1E37B 4NIWA 1BMMH 1A3BH 1Y3UA 1Y5UT 2ZIQH 1GMCF 2SFAA 1O2TA 2VU8E 1QRWA 5DGJA 2BD5A 3MNXA 1GI3A 5G4BA 1ZGVA 1BJVA 4CRAA 1P2MA 4ABIA 3TJUA 5T1VA 3ZZ3A 3ZIAD 1B5GH 1MTUA 1YPHE 1AB9C 3PB1E 2FOBA 1KYNA 1F5KU 3ODFA 1GGDC 1FN8A 3RXKA 1HLTH 4U32A 3NWUA 3OTPA 5JBAS 1O35A 1A1RA 1OP2A 2F9BH 2SGFE 3F2HA 1QCPA 1C1UH 3CS7A 1FNIA 2Z3CA 4WXIA 1DWDH 4GHTA 1GBKA 1QNJA 2GT8A 9ESTA 1C9TA 1MTVA 2HOBA 1BTWA 5F03A 3KNXA 4LZ4B 1FQ3A 2OBOA 1SFIA 3WWBA 3TH3H 3RMMH 3M7QA 2R9PA 4TSFD 3ZZ4A 1QJ7B 3MOCA 4NA7A 1FONA 4MDSA 5C2ZA 2PSYA 2OTVA 4E7NA 2WUBA 1XXDA 3F3BA 1SL3A 4INLA 2BVRH 1TGNA 1P2NA 3A87A 2V3MA 1GMDF 1OS8A 2GCHG 1GBHA 3M5OA 1GBDA 2AS9A 4WH6A 1WU1A 1HRTH 1HAVA 1GBEA 1ARBA 1BRUP 3UOUA 2ZA5A 3CNRA 3ZZ7A 1BDAA 1GJ6A 4GSOA 1VITG 1H8DH 5EU8A 5KECA 4NFFA 1K0HA 1Q3XA 1KXFA 2GKVE 2NU3E 5C0TA 1IQGA 4FUHA 2FOAA 2ZDVH 4A1XA 2OC7A 1TBQH 2Y6TA 3KQCA 1GDUA 2BYAX 2JJ2D 1SQAA 1ZPCA 4BAKB 1LMWB 3U28C 4FUCA 4CRGA 2ZHDA 4DGJA 4X2XA 4F4OC 1NY22 2XC4A 1EOJA 2ZGJA 2Z3DA 3A7TA 3OEED 3U8OH 4I8JA 1O3PB 2QE7D 3UB0A 2GD4B 1BMFD 1EATA 3L33A 1ELFA 1DLEA 3LGWA 2O8LA 1ZPBA 1UTQA 3MNBA 1W0YH 2VIQA 2YMSB 2JJ1D 1NESE 1E1QD 4Y10E 5FBIA 2H5CA 1GHXH 2K1QA 1NBME 4JZ1A 1LVMA 1WTHD 1H8IH 1O3EA 3PWBA 1MZDA
chains in the Genus database with same CATH topology
3A81A 3TGIE 1FN6A 1ABJH 2B8OH 2KAIA 3Q00A 4O9VA 1A2CH 1SLUB 2FIRH 2XRCA 3F9HA 1TX7A 1C5OH 3E3TA 1T8MA 2ZG0H 1GCDA 4X2WA 3A82A 4BAQB 3ATKA 2V3OH 2PTNA 4I8GA 4GAWA 2FI4E 2STAE 3MU8A 1LQEA 3SJKA 2VJ1A 4DCDA 1MMJN 3UY9A 1ZJKA 1ZJDA 2BXTH 1EJNA 1GVKB 1YPKH 1NFYA 1W14U 1N1LA 4ZH8A 1O5BB 1O2WA 2BDYA 4JYVH 5ESTE 3U9AH 1LPGB 2VWLA 2GP9B 3LGVA 2D26C 1DY8A 2UWLA 4AZ2B 1ELGA 1TQ7B 2WINI 3FVFB 2GDDA 4B2AA 1S6FA 3SZNA 1HB0B 3LH3A 1FIZA 5HM9A 4FUDA 1FY4A 3RXRA 4GUXA 4J2YB 1HJ9A 2R0KA 3BF6H 4A7IB 6ESTA 3ATLA 1NRNH 1AZ8A 2ANWA 3KCGH 4MNWA 1O2RA 2SNVA 1AMHA 3P70B 3UTUH 4DG4A 5FHTA 1KDQA 1CA0B 1Z6EA 4B2CA 4NSVA 2V3HH 3QK1A 1Y5BT 1QBVH 1Z1IA 1P11E 3QTVH 2Z9LA 3RXBA 1QURH 6CHAB 2FOEA 3PWCA 4KTCA 1FPCH 1W3CA 3V12A 5DP6A 4X8TH 1DT2A 1T4VH 2OUAA 1T8OA 3TITA 4D8NA 1VITF 2WPHS 4WWYA 2BOKA 1K1JA 2XWBI 4UFEH 4Y8YA 2FOMB 1YPHC 2GV7A 4LOYH 4B76A 1FDPA 4AG2A 2AERH 1DUEA 2ALPA 1HYLA 4CH8B 1DLKB 4K1EA 3GCTF 4BANB 2TRMA 3QX5H 3GOVB 4U2WA 5FCKA 1XUFA 1HDTH 2ZEBA 5C1YA 7GCHG 1SQOA 2P94A 2SGQE 3MHWU 5A09A 1P2OA 2OP9A 3M7UA 4INHA 1NO9H 2I6QA 3RXQA 2ZGHA 2ZFFH 4QT8C 1TRNA 3Q3XA 4NIVA 5JBBS 3SN8A 1T7CA 3ZZAA 5DG6A 2HLCA 2BY9X 2PKSC 4A5TS 4ZAEA 2ZQ1A 3LC3A 1C2JA 2A4GA 1TONA 1TNIA 1HIAB 3LDXH 3LC5A 2BLWA 1K1PA 2EC9H 5AF9H 1YP9A 3H5CB 4I8KA 1PPGE 5DP8A 2BHGA 2I6SA 3VEQB 1O30A 1BZXE 1C1QA 1TGTA 1UTPA 1G2LA 6GCHG 1C1SA 1P9SA 2BVXH 1XVMA 2XCFA 1D3QB 3HK6B 2DE8A 2HNTE 3O8BA 2R2MB 1MZDA 3LKWA 1AVXA 5A0AE 1EASA 4B73A 3ENSB 1QBOA 2Z7FE 3GCHC 3UUZA 1Y8TA 5A8YA 3SNBA 2WPLS 3V13A 4FUGA 2JH5D 1TB6H 2C90B 4DJZB 1SPJA 1XX9A 3QDZB 2ZFSA 2P8OC 5EG4A 3ZZ9A 1VCWA 3MO9A 2BD3A 2FPZA 3T2NA 2ZCKP 4LK4A 2FP7B 3QTOH 1CHOG 2QF3A 1TOMH 1KXCA 2OC0A 2QAAA 2JH6D 1ESAA 3I77A 1HAIH 5CHAC 5JBTA 2XBVA 1SG8B 1HPGA 1D9IA 3ODDA 1T8NA 3A86A 3GDVA 1K2I1 1HAHH 1AGJA 1KXDA 3E91A 2P59A 2P95A 3GDSA 3JZ2B 4FUBA 2HPPH 4K1SA 1WOFA 1WYKA 1NFUA 2F91A 3W94A 3URCA 5JDUB 2IJOB 3QGJA 2ZTZA 3T25A 4K8YA 1EX3A 1CHGA 4X6PA 4MVNA 1Z71A 3BG4C 2OC8A 4F49A 2FM2A 4ISHH 3PMJA 3MU4A 4A1VA 3SI3H 1ELBA 1EAIA 3SQHE 3D62A 4H6TA 3T28A 1THRH 2VH6A 2BY8X 3SV7A 1ZRKA 1WSSH 3AW1A 2C8WB 1SGCA 2ZPSA 3OU0A 1O2OA 2BXUH 4WF8A 3RLYH 3MNCA 3MFJA 3M35A 2AMDA 4ZHLU 1EZUC 1XUJA 2B7DH 1PPHE 1DSUA 3DUXH 3PYHA 3MU0A 3VGCC 2BDIA 2XBWA 1F0UA 1GBTA 1TNHA 1BTUA 3OY5U 4IC6A 4Y79A 1SLVB 7GCHF 3LGUA 1LPKB 1O38A 1O5AB 2PWXA 4CHAC 1GVZA 3TH4H 1ZMNA 3PTBA 2FLBH 3VXFH 1O37A 5A0BA 2ZDLA 2V0BA 1HAOH 3FZDA 4NA9H 2D2DA 3GYMA 1BRCE 2F3CE 2V6NA 4ISIH 2H1UA 1C2DA 4GCHF 4TYDA 1O31A 4OS2A 3SJ8A 1O36A 2QC2A 3GICB 1C2HA 2D1JA 1P02A 4Q7ZA 2OLGA 4E7RG 3DD2H 8LPRA 4H6SB 1O2VA 1F5RA 3S0NA 1K22H 5GCHF 1VR1H 1ZPZA 1RJXB 1W2KH 3ZVFA 1MBQA 3BEUA 1ESBA 1D6WA 2ZU4A 2PSXA 1O2PA 1O3NA 3CS0A 6GCHF 4BTIB 1V2VT 4RKJB 4MTBA 4IN1A 1BTPA 1DANH 4NCYA 2ODQA 1W13U 2XBXA 2ZU2A 1RD3B 3LU9B 4K3JA 1EXFA 3GCOA 3ELAH 1XM1A 2JETC 2BB4A 3VXEH 3SHAH 1LHCH 4NWLA 1ZMLA 1TMBH 2PW8H 1O3HA 3QN7A 4ABJA 1VGCB 1O2SA 3RXLA 3UNQA 4K5ZA 3BTDE 5FPSA 3BEFB 2FEQH 1OOKB 5LPEA 1YPLH 1FXYA 1YPMH 1CBWC 1C5QA 1TE0A 2H9EH 2VGCC 1GI1A 2GX4A 3AAVA 1G36A 1THSH 1NRRH 3UOPA 2D8WA 3PO1B 5LPFA 3QWCH 4MLFB 4OS1A 2CF8H 1TQ0B 4UEHH 4X2YA 3BTME 1EPTB 2SNWA 1HCGA 1QL8A 3LPRA 1GJCB 2LPRA 3M61U 1V3XA 4JZEH 4XE4A 4DURA 1Z8IB 1PQ5A 1BITA 4X8SH 1FZZA 3DA9B 3SHCH 1UJ1A 1VZQH 1BMLA 1EZQA 3M7TA 1DXPA 5E2PA 2OXSA 2Z9KA 4ZKOU 3NPSA 2P3FH 2WYGA 3ZZDA 2HNTC 3VB3A 1W8BH 3IITA 1F5LA 2ZDKA 2UWOA 2YNAA 2EEKA 4BNRA 1U6QA 1WQVH 1TNKA 2W7UA 1O3KA 3PM3A 4R0IA 3FANA 1NM6A 3K9XB 3RMLH 3F1SB 5TJXA 2RDLA 3RXSA 3TPIZ 4E05H 3D49H 5HM2A 3SU6A 4I8LA 5FX6A 5GIBA 2ZWLH 3K2UA 1JOUB 3E0NB 2TPIZ 3TNSA 3R0FA 1S5SA 5K0HA 5PTPA 3VFEA 2GDEH 1G30B 2VB0A 1XVOA 3FP7E 2QXIA 2QGRA 2BOHB 1Z6JH 3A7XA 3TGJE 1MH0A 4ZMAH 3ZV8A 5GXPA 4BAMB 2A4OA 1MKXH 4J1YA 1SHHB 5I46H 5EW2H 2ZU1A 2AH4X 2YNBA 3MTYA 4MPVA 4UE7H 1PQAA 1F7ZA 2QXGA 1X7AC 4VGCC 1C2LA 1ANBA 5FXLA 1RIWB 1SGIB 2XYAA 2PKSB 1E38B 1RRKA 2Y5GA 4YLQH 2FOCA 1BQYA 1H9IE 3SUEA 4O3UA 5LH8A 1GBMA 3RU4T 1C2FA 3SV2H 1C5MD 1YCPH 1BT7A 1BBRE 2PKAA 1MBMA 2XC0A 3ZZ8A 1ARCA 1NRPH 4TWYA 1O2JA 1TPOA 3VB6A 3UQVA 1V2OT 1OXGA 2TGDA 3F68H 4CH2B 5SGAE 2BD2A 3BG8A 4NSYA 1IQFA 1KLIH 1W7XH 1WQSA 1KXAA 2O9QA 1CT2E 2BD7A 3FFGA 4IW4E 4ASHA 3GCHB 1GWAA 4X1PU 3IWMA 4MPWA 1OWEA 1AFQC 2C3SA 2BLQA 4IN2A 1O34A 1CSOE 1DVAH 1AO5A 1O3JA 3UNRA 2C8ZB 1C9PA 1MKXK 1ZRBA 2O8MA 3A8CA 1DWBH 4GPGA 3UWJH 4Q7XA 3RXFA 1LHGH 3M5LA 1DXWA 1WBGB 3S9AA 1YLDA 2J2UA 4MNVA 3KQDA 1P2QA 3ZVGA 3Q76A 3SNEA 5CHAB 1RS0A 2Q6GA 1BBRH 1T31A 2ALVA 2VWOA 1UO6A 1SOTA 4D7FA 3EA8A 1SGFA 2ANMH 1HAXB 3CP7A 1YCPK 2CJIA 1JMOH 1Z7KA 1E0FD 1C5YB 2FODA 2CGAA 4UONA 1QGFA 2FTMA 4I33A 3RDZA 3S69A 1TYNA 3M3VA 3L3TA 4YLUA 5E0HA 3UIRA 2A31A 3DHKH 3N7OA 4YESB 1TNLA 1EAXA 3STIA 4ABHA 3SUDA 1P10A 1C5PA 2SGAA 2C4FH 3C1KA 1YF4A 1ZSLA 1F0RA 3FAOA 2UUKB 3RLWH 1GHBG 1UTJA 2EA3A 2FLRH 3MH6A 2NU4E 3SV8A 1LTOA 1GMHF 1TALA 4WMEA 4FUJA 5C5OA 2EI6A 1BRAA 3F9EA 2GZ7A 5FX5A 1QRZA 1C5RA 1V2TT 3LJOA 1TLDA 2W26A 1HJ8A 2FX4A 1V2WT 1GJ4H 1HXFH 1PYTC 5EQRA 3E8LA 3MMGA 1SGQE 3KHVA 1HBTH 1CT0E 3SJIA 2ZGXH 2ZZUH 1AHTH 1AKSB 1BBRK 1EB2A 3SUGA 5DP7A 1B0FA 6LPRA 1EZXC 2F9NA 2BD8A 3CENA 3P8GA 4B1TA 1WV7H 1HFDA 4AFQA 1CO7E 1K28D 1QB6A 2FDAA 2ZHEH 5EXMA 2J4IA 1JIMA 2CN0H 1MD7A 3RXUA 4YOJA 1GL0E 1ANDA 2Y7ZA 1S84A 3EGKH 3Q3YA 1GJ9B 1KTSB 2PTCE 4JYUH 4X6MA 3VPKA 5TCAA 4I7YH 2G4UA 1TNJA 4KTUA 3DFJA 1P9UA 2OQUA 3SU1A 1BA8B 1XUKA 4HTCH 5CMXH 1MD8A 2GZ9A 1O3GA 4YO9A 2VWMA 1XMNB 1L0ZA 1Y5AT 2G00A 2ZFQH 4MNXA 1O5FH 3MI4A 2STBE 1RTLA 4NIYA 3RXDA 4YT7H 2HALA 1AQ7A 3MH4A 5FPYA 1UTKA 2DE9A 2ZHQH 5EQQA 1O39A 1C1VH 4U01A 3K65B 1MKWH 1ZTJA 3E1XB 2THFB 4Y11E 2BQWB 4TY7A 3G01A 4XBBA 4UFGH 2PLXA 1SBWA 4WMDA 3GY6A 4ISLA 1P06A 3ZZCA 2WPKS 1GJ7B 2ZFTA 1QR3E 4BAOB 1VCPA 3H7TA 1BTZA 3UR6A 2O8UA 1OP8A 2Q6FA 2GCHF 2VGCB 3FP6E 1UVSH 3RXEA 4Z0KA 3RXHA 3SQEE 1A5IA 4GVUA 4B71A 1O3MA 3TNTA 4BTTB 3HKIB 1O3AA 2BMGB 3V0XA 4KELA 1TOCB 2G81E 4HGCA 3UR9A 2QXHA 1OWHA 1O2YA 4DIIH 1C1TA 2XBYA 4ABEA 5EOKA 2ZGCA 1ELVA 2J9NA 2BZ6H 1HJAB 1W0ZU 1C5LH 3JZ1B 5ETXA 1BJUA 3M5MA 1GJ5H 1DSTA 1MKWK 1A3EH 2CHAB 3OTJE 1NRQH 1O0DH 5DJ7A 2WPJS 3M5NA 5FCRA 4AFZA 4UD9H 1NFXA 4Z6AH 3A89A 3VB5A 2ILNA 3ESTA 1S0RA 1EB1H 1O2UA 1HAZB 1HNEE 4DY7B 2A5AA 4X1QU 1P01A 1YLCA 2EI8A 4IMZA 2VVUA 2VIOA 4A1TA 1C5NH 2P3UB 1GCTC 3P6ZB 2QY0B 5C1XA 2F9UA 1G3EA 4Q80A 1QIXB 1L1GA 5BPEA 1SLWB 2TBSA 1EPTA 1H1BA 3EA9A 1GBAA 1EQ9A 2GGVB 1GJ8B 5CE1A 1UVUH 2AIQA 3E6PH 1QY6A 3SORA 5E2OA 1LQDB 1QA0A 3TU7H 2UUYA 1HV7A 3E90B 3TIUA 1ELCA 1V2MT 2A0QB 4Y76A 1P8VC 4H42U 2BDHA 1F0TA 1JRSA 5ABWA 1M9UA 1CE5A 3BTKE 3ATMA 1NZQH 1A4WH 3NKKA 1C1MA 1HAVB 1QJ1B 3TGKE 1O2ZA 4ABAA 2FXRA 4WJG2 2A5KA 2ZDAH 2XW9A 1MU6B 1W7GH 1SHYA 1JBUH 3SU4A 4CR5A 1N6YA 1D6RA 1MUEB 3B23B 3S7HB 1S85A 3NXPA 1AB9B 3MWIU 3SGBE 1GGDB 4AYYB 1AVGH 2J38A 4ZKSU 1KTTB 4DW2U 1E36B 2P93A 3P8NA 1SC8U 2P16A 1MCTA 1RXPA 3KEEA 1SGTA 1P12E 3HK3B 2NU0E 4O3TA 3SGAE 3SOSA 1C5WB 1ZLRA 4CRBA 1T32A 4HFPB 4DVAU 5EPYA 2Q6DA 1TAWA 3OYPA 2BY5X 1UTLM 4ZXXH 1QHRB 1GVLA 1IHSH 1O2NA 1ZSJA 2PGQB 1LPZB 2HVXA 2RCEA 1YPEH 1AN1E 2GMTC 1C2KA 1O2IA 5DP5A 1OKXA 1EJMA 3TVJB 2ZCLP 4CR9A 5B6OA 1TX8A 5DP4A 1OWIA 1ZHMA 2KAIB 2IOTA 2O8TA 2XC5A 2ANKH 1EKBB 1O3DA 1ETTH 4ABFA 1A0HB 1FI8A 2J95A 2BD9A 2BD4A 5EXNA 1TGCA 1OWJA 3Q77A 1SGRE 4K60A 5HYOA 3MH7A 3A8DA 2Z6BD 4UFFH 3ZV9A 1QB1A 3T27A 1FPHH 1V6DA 3TJOA 2H9TH 1L1JA 3ZVCA 3ZVAA 2HWLB 2ZP0H 2HGTH 1GI4A 1P05A 2OCVB 1TIOA 3BTWE 3LH1A 1GJAB 1GBJA 1O3LA 8GCHG 1C5UA 2NWNA 1YYY1 3TH2H 3UFAA 2FOFA 3MO6A 4I32A 5JYIA 4I31A 1W11U 1LHFH 3RC6A 2PUXB 1WTGH 2SGDE 3A8BA 1SGEE 3UREA 3NUMA 2PHBA 1BRBE 4NIXA 1C5TA 1TBRH 4FUEA 3QZQA 5DKMA 5C67A 2GCTC 1EP6A 3U8RH 5DP3A 3RC4A 1BTHH 1FY3A 3VB4A 3EAJA 3LJJA 1GHYH 1C5ZB 4K8BA 1RGQA 1W10U 3GY2A 3KN2A 3EE0B 1AUJA 3RU4E 1KDQB 2A7HA 3A7ZA 1G3BA 1G3CA 1MQ5A 2FS8A 1BTXA 2FOHA 2Y5HA 4SGAE 4FXGH 3LGTA 1LDTT 2GZ8A 1MTNC 2NU2E 1NT1A 3LONA 2VINA 1ANCA 1KXEA 5EXLA 3C27B 1DITH