1O35A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o35A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o35A02
1N6XA 2KAIB 1A4WH 3M5OA 1VITF 1Z8GA 1K21H 2ZWLH 2P8OB 3A8DA 1ZZZA 1BUIA 4MNYA 4OS1A 5CHAB 5EOKA 4FUHA 2B8OH 3BTWE 1GHAG 3SU5A 3CP7A 2PFEA 2O8WA 3GY8A 1D3TB 3W95A 1T32A 3M7UA 1DLKB 1WQSA 2VU8E 1IHSH 1S5SA 5HYOA 4Y7AA 4Q7XA 1O3AA 1LKBA 1T8MA 1VZQH 2ANMH 2XBWA 3RXDA 2FYRA 4BTUB 4I8KA 2ZU1A 3GY5A 3ATWA 5AVDA 2Y6TA 4UFFH 1AGJA 2OLGA 2BLOA 2PUQH 3RXVA 2EI7A 5DP3A 1BTUA 3BTME 1AI8H 1C5XB 4YLQH 1AFQC 1MZAA 1DY9A 3OU0A 1BHXB 1B0EA 3A7TA 3AAVA 1PYTC 4FUDA 1J17T 1FY5A 2XCFA 2F9VA 5TCCA 1LKAA 2F3CE 3FANA 3SU1A 3T2NA 2BB4A 1UTOA 3A8CA 1SHYA 1SQTA 1XKAC 3LGYA 5F03A 5FAHA 3BEFB 4ISOA 1ACBE 2OCVB 3Q76A 4IMQA 4RKJB 3SGAE 1H9IE 2BYAX 3P70B 1V2JT 4ZKNU 1ZGVA 2TRMA 1K1IA 1ZPBA 4YLUA 3H5CB 2P3TB 5GDSH 3LH3A 2OUAA 4ZHLU 1N8OB 2QC2A 4X2XA 2B9LA 4NSYA 4ZROA 2ASUB 1OP8A 1QNJA 5C3NA 3ZV9A 1P02A 1W12U 2A4QA 3A88A 2BDBA 4AYVB 1UTPA 2BD2A 1TNIA 3A86A 3V7TA 5A0AE 1TA6A 4CR5A 1JMOH 1ESAA 3SU2A 4E7NA 1HAXB 1Z7KA 4AFZA 5HGGA 4IN2A 2EI6A 2DE8A 1S6FA 2AGEX 1C5UA 2Z9IA 4RKOB 2VH6A 1LHDH 1BTPA 1KDQB 2UWOA 2FLRH 4B2BA 1NRNH 2BTCE 3SV7A 3S7HB 3TGKE 2ZFQH 4D76A 1UCYH 1S82A 2BY9X 2FOHA 1BQYA 1NRSH 3BTDE 9ESTA 3E8LA 3D49H 2WINI 1GWAA 3M7TA 4YOGA 1TOCB 2J9NA 1LHGH 1GL0E 2AMQA 1LPKB 2BDIA 2VVUA 1W8BH 5F8XA 1WYKA 2A2QH 5GPIB 2R2WU 2DE9A 4XBDA 4NZLA 1OWDA 1PPFE 2G5VA 1QRWA 1QURH 3FFGA 3A87A 1QL7A 2BX3A 7LPRA 2BMGB 2NU1E 1SMFE 4IC5A 2GKVE 2Z9JA 3E16B 1W7GH 5BRRE 1N1LA 2EI8A 1T8OA 1F0SA 1C5NH 2FIRH 3PO1C 3F9HA 2PGBB 2O9QA 2ZU4A 2GCHF 3EA8A 5E0JA 3P92A 2XWAA 1QFKH 4ISLA 3IG6B 2BD7A 3R0FA 1A3BH 1CQQA 1SR5C 2AMPA 1TPOA 1EQ9A 1NY22 3QX5H 1KTSB 3KNXA 1SGRE 1AIXH 1BCUH 1O31A 1DWCH 1WTGH 1UTNA 1O2QA 2Z9KA 4E06H 1P01A 1SGNE 3RMOH 5E2PA 2V0BA 3NXPA 3CENA 3SJ8A 1C9PA 2BY7X 4B73A 1C5VA 2J95A 4I8GA 2J94A 3SJIA 1K1NA 3QO6A 4MVNA 4UD9H 3NCLA 2V35A 1Y5AT 1PPHE 1BBRH 2GDEH 5DP7A 4K3JA 3HGNA 4KELA 3SW2B 3P95A 2GV6A 2ZCHP 1TBRH 3ZVEA 3LPRA 1O39A 2H5DA 1PPCE 3BIUH 4UFGH 1A5HA 5JB9S 5A8XA 1F5RA 2P8OC 2HNTF 1NFXA 2XYAA 4BAKB 1GCTC 1YPKH 3BEUA 3ZVGA 1RFNA 1IQJA 1C2EA 2GZ7A 4ZKRU 1BTZA 4MG3A 1HV7A 2A4RA 1HXFH 1G3CA 3PM3A 4JYVH 3FP7E 5J4SA 1W10U 1QA0A 1V2VT 2FOEA 3MO3A 4KTCA 2P94A 4WY3A 3S7KB 3SNDA 2OP9A 3SQEE 1FAXA 1KIGH 2C8ZB 2O8UA 9LPRA 2PSXA 1KSNA 1W0YH 1L1GA 4UDWH 4K1EA 3SUFA 4MDSA 3MO6A 3MFJA 5FBIA 2UWPA 3TH2H 3KIDU 5SGAE 1NU9A 3SZNA 1SBWA 1GHYH 3KCGH 1C2GA 1GJDB 1RTLA 3A89A 2ZF0H 3E3TA 4XE4A 1L4DA 1A5IA 1EJNA 1V2QT 2ANKH 4GPGA 3MO9A 1HB0B 1BRUP 1KXFA 1SLUB 2NU4E 2RG3A 2A7JA 3GOVB 3SJ9A 3M36A 4BAHB 1IQEA 1P9UA 3SU3A 1GBLA 2AS9A 4JK5A 1O2HA 2QF3A 3E90B 1AVWA 2Y82A 4WMDA 2GMTC 1F0UA 1KLJH 1DY8A 1WTHD 4XSKU 5GIBA 1O3HA 3MU1A 4GHQA 1ELCA 1MTWA 2FEQH 3LIWA 3L6PA 1UVOA 4WH6A 1P2OA 1GI8B 1XVMA 2B7DH 5K7RA 3GY7A 5LPRA 1JWTA 1DUEA 2W3IA 2FTLE 4I31A 1B5GH 3C27B 4Q2KA 1MMJN 1HAOH 1E35B 1H8IH 3LT3A 1DVAH 1QCPA 4AB9A 1ZRBA 3SU4A 3Q00A 5EGMA 4OS2A 1ZJDA 3DUXH 4JYUH 2VVVA 3RXGA 1O37A 1S81A 3ATLA 2OC0A 3SGBE 4I8LA 2Z3CA 3VXEH 3K2UA 5EQSA 2XW9A 2FTMA 2WUBA 5JBAS 4JZFH 1A46H 2GV7A 4XBCA 5DJ7A 1ETRH 2ZECA 3PLKA 3PMAB 4X6PA 5C1YA 1A1RA 3A7XA 1XUJA 1GGDB 1MTSA 1OS8A 1KXAA 2GT8A 2GTBA 2GVFA 1NESE 1BIOA 3DA9B 3VFEA 4PROA 1DS2E 2ZZUH 1V2RT 1YGCH 3AW1A 3GCOA 1LVYA 1SGPE 1GI0A 1TRNA 1V6DA 2UUFB 5F6MA 2W26A 4CH2B 1GJ9B 1FAKH 1V2TT 3SU6A 1FV9A 2F83A 3U69H 1EB2A 1EUFA 1Y3VA 1YPEH 3SGQE 3SI3H 3M35A 2BOHB 2ZTZA 3RP2A 3S9CA 2ZDKA 2JH0D 3LU9B 4B74A 3KQDA 2Z6BD 4IN1A 3LGWA 4HZHA 1O3FA 1YPLH 2BDCA 1Q2WA 2BQ7B 4MPWA 3RXPA 1AKSB 3TK6A 1TGNA 1OYTH 1DSUA 2IOTA 3M5MA 3UR9A 4NA9H 2YOLA 4YM9A 1W0ZU 1DLEA 2ZTXA 4NFEA 1ABIH 4QT8C 4LK4A 1CA8B 5A0CA 1NPMA 4CRAA 2ZDMA 3TNSA 3G01A 4WWYA 3TJNA 1EATA 1CT2E 2PTNA 1AZ8A 3K9XB 1XXDA 3K65B 3ZYDA 4IMZA 5IDKA 3TJVA 2XNIA 3ZZ3A 4ZAEA 1GI4A 2ZHEH 2GT7A 1CO7E 1RIWB 2FOCA 1C2FA 3SBKA 5B6OA 1AD8H 2P59A 1P2JA 1SI5H 4AFSA 3SO3A 2QXGA 1MZDA 1G3EA 1O3LA 1O2ZA 3H7OA 3U9AH 1LDTT 4HFPB 2FODA 1C2DA 1O36A 4ZH8A 3ZZCA 2ZI2H 3SQHE 1WOFA 2PSYA 2BD4A 4H42U 2JETC 1C1SA 1W2KH 4MQAA 3E0PB 3GCHB 2BZAA 3F1SB 4A1VA 3QZRA 1P10A 3SI4H 1IQLA 2A4GA 1HXEH 2F9NA 1OOKB 3MU0A 2Y7ZA 4KKDA 4CBNA 5CMXH 2ZO3H 1P2NA 3A80A 1AO5A 1QBOA 3DFJA 3ZZ6A 2QXHA 1SQAA 3BG8A 1MH0A 2XBYA 2ZFRH 2R0LA 1MKXK 2BLVA 4NIVA 1O3EA 2ZCKP 1IAUA 1DT2A 1UMAH 2ULLA 2W7SA 3Q77A 1J8AA 3U1IB 3I29A 3RXEA 3S0NA 3QZQA 2JKHA 5EQRA 4ABIA 1CHOG 1DX5M 1KLTA 1GI9B 2A5KA 1G2MA 3RMMH 1O2RA 3BN9A 1HJ9A 1MAYA 1TGSZ 1EXFA 2FESH 4HTCH 3U8RH 1F0TA 1O2KA 2PV9B 5AFZH 1QGFA 4H6TA 5TJXA 5I46H 1AVGH 3RXUA 1O34A 2VIOA 3RXHA 2KAIA 5E0HA 1G36A 4CRCA 1C5ZB 4DT7B 1UJ1A 2A7HA 3T29A 3MH4A 3ZZ9A 1GDNA 1O2MA 2TBSA 2ZG0H 1FMGA 1TMBH 1PJPA 2ANYA 4D8NA 1BBRE 2XRCA 3SNEA 8ESTE 1P2QA 1SPJA 3UQVA 1CT4E 1TQ7B 1NRRH 2FI5E 3JZ1B 4CHAB 2CJIA 3S69A 1X7AC 3STIA 1AWFH 4NIYA 3RC6A 4MTBA 3SORA 4UFEH 3UWIA 3FP8E 3LKWA 2HPQH 2ZHDA 1K1OA 1AKSA 1NO9H 3EYDA 2GCTC 3HATH 2QGRA 1ZHMA 1CBWC 2ALPA 1QB6A 2BHGA 2FPZA 2OC1A 3BTTE 4CREA 1RTFB 8KME2 1AUJA 5T3HA 4JZ1A 3PWCA 2H2ZA 1ZSKA 4X2VA 4YT7H 5A0BA 1NS3A 1GJ5H 2OD3B 2ZGXH 2OQ5A 2WV4A 1PQ5A 2V3OH 1Z71A 3O8CA 3B8JA 5C1UA 1UCYK 3EDXB 5FBEA 5FPSA 1O2OA 1B0FA 1D4PB 3GY2A 2SGEE 1F5LA 4GUXA 1ZRKA 1LTOA 2QXIA 1AE5A 1Z8RA 1T31A 2PTCE 3M3TA 4WXVA 1CHGA 2BQWB 3RMLH 3PB1E 3URDA 3RLYH 4XDEA 2VWNA 1HAVB 1OXGA 3RU4T 1GHVH 1G3BA 4CRDA 3MI4A 2XXLA 3PLBA 5JBCS 4AGJA 3HGPA 1GJBB 1V2OT 2OC7A 3L3TA 3MTYA 3BTEE 1UVSH 1BRCE 4ABFA 3TJUA 4YO9A 1YYY1 1YM0A 2BM2A 4MNWA 5GWZA 1GI7B 3MYWA 3ZZ8A 4INHA 2ANWA 2Z3DA 2A45B 1UK3A 2TGTA 3MH5A 2IJOB 3LDXH 3LONA 5HMAA 2EA3A 1E38B 2AH4X 1QB9A 1EOLA 1GBJA 1OWEA 1MTVA 1SGEE 1SGYE 2Z94A 1K2I1 2CHAC 3TJOA 3QWCH 2CHAB 4ABGA 1A2CH 3M7QA 3QK1A 1L2EA 2NU3E 3EE0B 1Z6EA 5F8ZA 3MMGA 1C5PA 3OY5U 3GY6A 1BRBE 4FUEA 1BTYA 1T4UH 1NTPA 1W7XH 2Y81A 1UK2A 1HAPH 5LGOA 1P09A 2ZDNA 5DP4A 2THFB 1N8OC 2XBVA 3RXBA 1C1NA 1GBAA 1TRYA 2UUKB 1GJ4H 5IYTA 6ESTA 1XUFA 1GVKB 4U2WA 1O3GA 4NGAH 3MU5A 1AU8A 5AHGH 4A6LA 4UONA 2VINA 1F92A 2VB0A 3A7YA 2G4TA 4A1XA 2XBXA 4X8SH 3ZZAA 2QCYA 1DWEH 3P8GA 4UFDH 1C1OA 3QGJA 1CGIE 5GCHG 4Y6DA 4SGAE 5EXMA 2SNWA 4K5ZA 1Z8JB 4FUCA 1A0HB 1SSXA 1GMDG 5E0GA 1TX8A 2G81E 2ZPSA 4JK6A 1OWHA 1QHRB 2BDYA 2GP9B 3MNBA 1OP0A 4NG9H 3C1KA 4AORA 1YPJH 4DCDA 3JZ2B 3Q3KA 1C1PA 1V2LT 1CSOE 1A61H 3TGIE 3RXSA 2GCHG 2FOMB 2BVXH 2Z9LA 1A0JA 1ESBA 4TYDA 2BD3A 4ABDA 1TPAE 1YP9A 3UY9A 1C1VH 1QRXA 1YCPK 2XTTB 3A81A 1QY6A 4OS6A 1OKXA 1RD3B 4INLA 1G2LA 1ID5H 1L1NA 1OP2A 1LVBA 2QF0A 3PMJA 1EB1H 1EAWA 4BAQB 4AG2A 1YPHC 1IQIA 1GBCA 1ARCA 1IQHA 3UWJH 4CHAC 3TK9A 2QN5T 2VIPA 2G51A 1C5MD 4X2WA 1XKBC 3EGKH 1UTMA 1GI1A 1MKWH 3V3MA 1DUAA 2BX4A 3SHAH 5DKMA 2PKAA 1HDTH 1KLIH 2F91A 3O8RA 1SGFG 5FPYA 1EZSC 3S9AA 1DICA 8GCHF 1XUIA 4NIXA 3DFLA 2QY0B 1YC0A 1VITG 1GI3A 1EJAA 5L2YH 2ZTYA 1YPGH 1XMNB 1TX6A 1ELDE 1GI2A 4JCNA 3KHVA 1LMWB 1FNIA 2O8TA 2SGAA 3KN2A 1H1BA 3QLPH 1TNHA 4IW4E 3TITA 1C2HA 3LGVA 3R3GB 1UO6A 1V3XA 4ZXYH 2GCTB 3WY8A 1NC6A 3SUGA 1B7XB 2AEIH 1EAXA 1OWJA 2FOGA 1A0LA 3MNXA 5BPEA 2IN2A 1O3DA 3MH7A 3K6YA 3LGUA 1P06A 1NFWA 2G52A 1DXPA 3ZYEA 1D6RA 3RC4A 3O8BA 4AFQA 3TK5A 4LZ1H 3SJKA 4IC6A 6GCHG 4K8BA 2FX6A 1K1PA 2IPHA 1TGBA 1PPBH 4NA7A 2CMYA 3U8TH 2YNAA 1ZHRA 4HI3A 1RXPA 1VCQA 2TGPZ 3BTFE 1V2NT 1MU6B 1C5WB 1SGDE 1BJUA 4JZIA 1BDAA 1DXWA 2ILNA 3ZVDA 4I32A 3GCTG 1ZMNA 1O2NA 4FVDA 2QA9E 4U30A 2OBQA 1OSSA 1KY9A 1TNLA 2R2MB 4Y76A 2TGDA 2ALVA 1O2YA 4TPYA 2ZFFH 2EEKA 1YBWA 3SUDA 3PV4A 1C1WH 1UVPA 1CBWB 2QIQA 2D1JA 1QJ7B 3ELAH 1EZUC 5E2OA 3VB5A 4VGCB 4WMFA 2ZCLP 1ZPCA 1TIOA 2HRVA 2V3HH 1YCPH 3D23A 1THSH 1Z1IA 3KQCA 2ZFTA 3MOCA 1VITH 4ISHH 3GYMA 1H9LB 2CN0H 2BY5X 3OTJE 2FS9A 1SQOA 2EC9H 2H9HA 4X1RU 2OBOA 4BXSA 1GJ6A 3I78A 3TPIZ 4ABEA 5HXFA 2J34A 2FI3E 2ZU5A 2A4OA 1GBEA 3BTKE 2LNCA 5FCKA 3UOUA 2QYIA 3UFAA 4I33A 3H7TA 1LVMA 1Y5BT 1CGHA 3GDSA 5C5NA 6LPRA 1FDPA 4GAWA 1ZTJA 1C9TA 2GZ9A 1CA0C 1ZMJA 2I6QA 3ZZ4A 3KF2A 1G37A 1O3BA 2Q1JA 1DM4B 3RXLA 1TA2A 5DGJA 2WPHS 4FUIA 1GMCG 4B2AA 2ESTE 3V12A 1P3CA 2BOKA 1XUKA 1ABJH 2BD8A 2FXRA 1LHCH 1ETSH 2VWLA 4CRBA 3VB7A 5EW1H 3OSYA 1JIMA 1C1TA 3SV2H 2W5EA 1GJ7B 3KQBA 1CGJE 1K22H 4DGJA 3UIRA 2ZGBH 1GHBG 4THNH 3RXCA 2WV5A 2R3UA 2GDDA 1UTKA 2H9EH 5AF9H 1GI5A 1K1JA 4NZQA 2JH6D 3BIVH 5ABWA 1WUNH 1GMCF 3FP6E 3RXIA 2W7UA 2ZDLA 1ZR0A 3LJJA 4GLYA 5DP5A 5ETXA 1HLTH 1FJSA 1VJAU 4X1NU 4FUFA 1JXPA 3U98H 1PQ8A 3B9FH 2P3UB 2CXVA 1BTWA 1BMAA 1XUGA 2AGGX 2OXSA 4AB8A 1FI8A 1IQNA 2Z7FE 1VJ9U 4UEHH 1TGTA 2XC0A 1CA0B 1EPTB 1GVZA 1Y3WA 1AQ7A 3N7OA 1O38A 3VEQB 3KGPA 5JYIA 2FOBA 3FZDA 1OYQA 1WAYB 2LPRA 2VGCC 3ZZBA 3E6PH 2VGCB 4MNXA 5T6GA 4IGDA 2VWOA 1C4U2 2G4UA 2A5AA 1SHHB 2VH0A 2ZFPH 1LO6A 2ZP0H 1UCYE 1WCZA 4K60A 3TH3H 1UVUH 1O3NA 4X2YA 2HGTH 3SHCH 2PGQB 1ANEA 3OYPA 3W94A 3MU4A 1BB0B 3I77A 3PROA 1D3PB 1PQAA 4GSOA 4MLFB 4AOQA 3TLOA 4ESTE 1TX7A 1CVWH 1V2ST 1GI6A 4GVUA 1SG8B 1C2LA 3VGCC 4GHTA 1MD8A 1ESTA 3ZVAA 2FZZA 1AUTC 1AVXA 1LHEH 4CR9A 2Y80A 1TE0A 1AFEH 3KEEA 2F9BH 1GVLA 4ISNA 4NWLA 3A8AA 3GY3A 3UQOA 3RM2H 1EZQA 5AFYH 1O32A 1NN6A 1RRKA 4A7IB 1ELFA 1OPHB 5FXLA 3Q3YA 1YKTA 7GCHF 4NWKA 4D7GA 3NWUA 1PPZA 4TY6A 5A09A 3IITA 1CHOF 2QAAA 2ZHWH 1ARBA 3ENSB 4WF8A 1SVPA 1UHBA 3MNSA 3SV6A 1HJ8A 1GG6B 3V13A 1ZTKA 2ZU2A 3F6UH 1HFDA 4YT6H 1FUJA 1O3JA 2GMTB 4LOYH 3RM0H 3LC3A 1EOJA 2BVSH 6GCHF 1FIWA 4Y0ZE 4ZKOU 4X8TH 2XCNA 1P2KA 4TPIZ 3Q3XA 4NIWA 1QB1A 1FLEE 3BG4B 2NU2E 1GBHA 1BZXE 4NCYA 2FX4A 1C4Y2 5JDUB 3GCNA 1S83A 1HJAC 5EW2H 3M3VA 5DK1A 1MCVA 4IS5A 1C4V2 1NFYA 2VIDA 4D7FA 1O2JA 4KTSA 2SGQE 3A85A 5DP6A 4CRFA 4WXIA 2J2UA 4FVBA 2VNTA 5DPAA 4Q7ZA 4K1TA 3KQEA 2O8LA 3RUOA 1QJ6B 1EPTA 1TAWA 1DPOA 1H9HE 5LPEA 1D6WA 1GBKA 2Q6FA 4AFUA 1C5TA 2PKSC 2D26C 1ANCA 1SLXB 4ASHA 2ZIQH 3BF6H 3NUMA 5EODA 1UK4A 1E34B 4X6OA 4F4OC 3KL6A 5FCRA 1EKBB 8GCHG 3U1JB 2D8WA 4ZMAH 2XC5A 1DOJA 2PLXA 1AMHA 2VWMA 2K1QA 4Z6AH 4D9RA 3QGNB 2AFQB 1MKXH 2C93B 2AIPA 4AG1A 2HALA 1MKWK 3AVZA 4X8UH 4BOHA 1DANH 1O2SA 5LPFA 2BDAA 2Y5HA 1MCTA 4M7GA 5C2ZA 1GCTB 3BTHE 1E0FD 2C90B 2B5TB 1DITH 1MQ6A 1PPGE 4ZXXH 1AB9B 2A31A 3SNCA 1O5AB 1UTQA 1W13U 4TWWA 1HJAB 1FXYA 1JRSA 2XWBI 2GZ8A 2D2DA 5E8EH 2ODQA 1P03A 2ZEBA 2VIWA 4R0IA 4Z0KA 1MBMA 2BLQA 3RXKA 4E05H 1JBUH 2W3KA 3UR6A 1EP6A 1FN6A 2RA3A 2ZDAH 1O3CA 1U6QA 1O5EH 4FUBA 4ABAA 1QA7A 2SFAA 3FZZA 3FAOA 3PYHA 1DFPA 3M37A 1C2JA 5TCAA 4Y0YE 1P57B 5EQQA 3TVJB 2BY6X 2C8XB 3UNSA 1W3CA 1O5GH 1C1UH 4K2YA 1YPMH 3NKKA 1LQEA 3ZZDA 5A8YA 8LPRA 1ZJKA 3TU7H 5G4BA 3P8FA 1GMDF 4YOJA 4X1SU 2BXUH 4LZ4B 3BEIB 1IHTH 3DT0H 1VCPA 3RXJA 3A7VA 1BHXF 5JBTA 2HOBA 1PFXC 1ZHPA 1DWDH 3LH1A 2M5TA 1SC8U 2F9PA 2STBE 5CHAC 5JPMH 1CU1A 1H8DH 1GJCB 2PHBA 4DURA 5L30H 2STAE 1G30B 1HAGE 1D3DB 1NU7B 4BAMB 1BTXA 1HAHH 3SU0A 3PMHB 1TMUH 2H1UA 3HKJB 1O2GH 1QJ1B 3EQ0H 1MAXA 2WUCA 2RCEA 4IBLH 2Y7XA 1D9IA 2NWNA 1P05A 1MTUA 5C1XA 1EZXC 2ZFSA 4ABJA 1SL3A 2A7CA 4KGAA 2I6SA 2BD9A 1CE5A 1HGTH 1QQ4A 3RU4E 4MNVA 1T8LA 1F0RA 1KXCA 3ZVBA 1LVOA 2PR3A 1T7CA 1IQKA 2AGIX 1THRH 4NSVA 1T4VH 1AWHB 3M3SA 1VCWA 1TALA 2WPMS 2J38A 5DP9A 3PLPA 1ZTLA 4WJG2 1GGDC 2UUYA 4AYYB 1TYNA 3T25A 4K1SA 1LHFH 4WH8A 1AFQB 3P6ZB 1BITA 1C5SA 1MUEB 1XUHA 2TPIZ 1Z1JA 4O9VA 1GG6C 1PPEE 3V0XA 4ABHA 1EX3A 3VB4A 1TABE 4MPVA 1RS0A 1CT0E 3MNCA 1RIWC 1Y3UA 2VIVA 4XFQA 4XBBA 1K1MA 5L6NH 1FY8E 1TBZH 3MWIU 3UOPA 3A7WA 3F9GA 3T26A 3NZIA 2F9UA 1K1LA 4J1YA 1OX1A 3MH6A 4DJZB 1HAIH 1A7SA 3ATIA 1HIAB 1AE8H 1AHTH 4OGYA 5FX5A 1P04A 1NM6A 4FU9A 2G5NA 3P17H 1FQ3A 2UWLA 2HPPH 1QQUA 4GCHF 4RN6A 1HUTH 1EP5A 1TNKA 4H6SB 3VB6A 2YNBA 3QN7A 3ZVFA 2HNTE 4BAOB 3PO1B 4O03A 1NRPH 1BMNH 3RXFA 1YF4A 1GCDA 1SGTA 1ELEE 1WBGB 3QDZB 1O5FH 4R8TB 3RXOA 1S84A 1O30A 4F49A 1K9OE 2ODYB 1O2IA 2WPJS 3ZVCA 1QR3E 2Y5FA 3ZZ5A 5C67A 4VGCC 4BXWA 1O5BB 3M61U 1E36B 1GHZA 1ELBA 5LH8A 2F9OA 2BD5A 4JYTA 4X6NA 2QXJA 4DOQA 3T62A 1DWBH 1SGQE 4Y79A 3LJOA 1BJVA 1SFIA 3RXQA 1SGFA 1XVOA 2FLBH 2H5CA 3LC5A 2FO9A 1GDUA 1DSTA 4JMYA 5HM9A 3B23B 4FXGH 1C5YB 3GCHC 1ETTH 1C1RA 2BVRH 1F7ZA 5EU8A 1IQMA 4X0WU 3MHWU 1LCYA 2TIOA 1FY1A 2ZHFH 2ZQ2A 3SNAA 1A5GH 1W11U 1NFUA 3A83A 3A82A 2H9TH 4UE7H 3SN8A 3TIUA 2CV3A 1HAZB 3AASA 1WU1A 1BT7A 4B71A 5FPTA 3LGIA 1LQDB 1S6HA 2ZGHA 1V2KT 2GX4A 4ISIH 4MPUA 1O2VA 1SLWB 1QTFA 2GGVB 1Z6JH 1F5KU 3A8BA 1E37B 1ELTA 5DP8A 1GBMA 3ESTA 4GCHG 2C3SA 5DG6A 1BA8B 2HNTC 1NRQH 1Y8TA 1EJMA 1TWXB 1KYNA 4ZUHA 1BRAA 3D65E 1BTHH 2A0QB 2PUXB 3AW0A 7ESTE 4Y8YA 4ZKSU 1SGIB 4OS7A 2P16A 3SV9A 3URCA 2FOAA 1HAVA 2WYJA 3ATKA 3HPTB 5GXPA 3EA9A 1NT1A 1ANBA 1ZSJA 1BMLA 3UUZA 5F8TA 4DW2U 1ZYOA 3S9BA 1GL1A 3A84A 3IWMA 2FYQA 2Z9GA 1C2KA 2BXTH 2WPLS 1XM1A 1V2WT 2RA0A 4A92A 1S0RA 1TQ0B 2Z3EA 5FHTA 2OC8A 3OY6U 3FVFB 1VR1H 2O8MA 1QRZA 3QTOH 1AB9C 1RGQA 1LPZB 3D62A 4YTAA 1O3KA 1SOZA 2CF8H 5J4QA 1G32B 3TNTA 1ZSLA 2BDHA 4B76A 1YCPM 1P8VC 1M9UA 4YZUA 3PWBA 1MTNC 4FU8A 1J14A 1C1QA 2GD4B 4NA8A 4WVPE 1RTKA 1VGCB 5JBBS 3K6ZA 4CH8B 3SUEA 2OQUA 4O3UA 1V2UT 1C5QA 1O2WA 1K28D 2C4FH 2JH5D 3VGCB 1O2UA 2TGAA 1HIAA 1GJAB 2BY8X 2CGAA 3RXRA 1SLVB 4OS4A 2ODPA 3SOSA 3ITIA 4BTIB 2ZA5A 3GYLB 2Q6GA 1P2MA 3SJOA 2PKSB 1O33A 3UNRA 1GHXH 1V2MT 5JB8S 2ZPRA 1SFQB 5H4IB 1ZGIA 4U32A 1IOEA 1C1MA 2HLCA 7GCHG 3DHKH 1JOUB 3GDUA 4BANB 1FIZA 1HNEE 1WQVH 2Q6DA 3M5NA 2AERH 5ESBA 4I8JA 1GBTA 2FDAA 1UVTH 1O3IA 2PWXA 1TNJA 2G8TA 2WPKS 5CE1A 2FOFA 4NFFA 5T6FA 2RDLA 2H6MA 1TNGA 3HK6B 1EASA 4X1QU 2V6NA 4MPXA 1TPPA 1OWIA 2VJ1A 4TWYA 3EA7A 2FM2A 1Y3YA 4JZDH 3ZZ7A 4OS5A 1TRMA 1AN1E 1O0DH 3QTVH 5A2MH 1JRTA 3M5LA 1O3PB 2VIQA 1J15A 1C2MA 1C2IA 4I7YH 4RSPA 4DG4A 1LPGB 4AN7A 3SV8A 1WV7H 4Q7YA 3P8NA 3HK3B 1O3OA 4H4FA 3PTNA 4D9QA 3O8DA 1SOTA 1A3EH 5EPNA 2R0KA 2OINA 1ELVA 2UUJB 4HGCA 2ZC9H 1FY4A 1GJ8B 2FI4E 2HWLB 1BMMH 3RXAA 3VPKA 2CF9H 4I8HA 4J2YB 5GCHF 4X6MA 1NROH 3E1XB 1EAIA 1GHAF 4A5TS 2C8YB 1F2SE 4Y7BA 1J16A 2OTVA 3NK8A 3GISB 4E7RG 2FS8A 1S0QA 3LGTA 3LOXA 3T5FH 1Y59T 1FN8A 3F9EA 1TGCA 1GBIA 1HBTH 4O97A 3ZV8A 4FU7A 4Y10E 1QBVH 3GDVA 1TBQH 1OWKA 1C5LH 1QL9A 2SNVA 3RC5A 1FPHH 2AMDA 1H4WA 3RDZA 4OGXA 3BSQA 1G9IE 3UTUH 2ZGCA 3E0NB 4Y8ZA 1O3MA 3UPEA 1MU8B 4B75A 1ELGA 1GBDA 3PTBA 1C5RA 1XXFA 4Y11E 2A1DB 1FZZA 3AAUA 1MTNB 2FMJA 2WPIS 1O35A 1GMHG 1Z8IB 1GBBA 2XC4A 1RJXB 3OX7U 5PTPA 4FUGA 1UTJA 1MD7A 1IQFA 2AYWA 3CS0A 1YLCA 4DIHH 4AGKA 3PMBB 1TFXA 4DY7B 1Y5UT 1HPGA 5DO4H 1P9SA 2SGFE 3UNQA 5C20A 3P8OA 4ABBA 4ZHAA 1TOMH 1O2XA 1EAUA 1ZPZA 2Y5GA 3UREA 1P12E 2HVXA 1ZLRA 2A32A 1P3EA 1P11E 1GMHF 2QV1A 1O2TA 3ODFA 1W14U 1PQ7A 3VXFH 1YLDA 1P2IA 4ZHMU 3DD2H 1QBNA 2P95A 4BNRA 2ZKSA 4B1TA 3RLWH 2C8WB 1ELAA 1MQ5A 3RMNH 2BZ6H 4BTTB 5EXLA 1HAYB 1UTLM 3BG4C 2J92A 2ZHQH 3F68H 1BBRK 1L4ZA 1ANDA 5HM2A 1AZZA 1P0SH 4O3TA 4INKA 1HCGA 2WYGA 3MU8A 2BLWA 4DVAU 1Q31A 5EPYA 1Y3XA 2BDGA 3NPSA 3HKIB 1HRTH 3ODDA 2B0FA 2JETB 3STJA 1FONA 1EPTC 4DIIH 4Y71A 4X8VH 4Q80A 1T8NA 3TH4H 3T27A 4JZEH 1QL8A 3ATMA 1DDJA 4Y8XA 1HYLA 1O5CB 2A2XH 3L33A 1GBFA 5EG4A 4X1PU 1SB1H 2R9PA 5I25A 1IQGA 3QUMP 1AY6H 1SGCA 3GY4A 6CHAB 1V2PT 1KDQA 2FP7B 6CHAC 1G3DA 1TLDA 2A5IA 2AIQA 1UHBB 2G00A 5GJ4B 5FX6A 4AZ2B 4K8YA 1PYTD 3GCTF 2VVCA 1S85A 7KMEH 1C5OH 2SGPE 3TGJE 2ZGJA 1O5DH 1L1JA 2SGDE 2PKAB 4KP0A 1TB6H 4SGBE 4TY7A 1FPCH 2P3FH 1INCA 1D3QB 2R3YA 4WMEA 2ZNKH 4KTUA 5A8ZA 1J9CH 2NU0E 5K0HA 2G55A 1TONA 3SNBA 1WSSH 1GDQA 1KTTB 1KXDA 1TMTH 3BV9B 3CS7A 1GHBF 1BOQA 5ESTE 1JIRA 1XX9A 5T6DA 5C5OA 2ZPQA 1ZMLA 3U8OH 1GPZA 4YESB 1GHWH 2FWWA 1ORFA 3RXMA 3BTQE 4CRGA 5L2ZH 1KXEA 1O2LA 3RU4D 2ZU3A 4U01A 1QIXB 1MBQA 1FY3A 3E91A 2DUCA 3BTGE 1THPB 1Q3XA 3A7ZA 3RXTA 5EXNA 1L0ZA 1TPSA 2BQ6B 3T28A 2P93A 1ZOMA 1KXBA 1O2PA 4LXBH 4B2CA 3F9FA 2ZDVH 2PW8H 3EAJA 1DE7H 2ZQ1A 3VB3A 1YPHE 4A1TA 4AX9H 1NZQH 4CBOA 1N6YA 4XOJA 1VGCC 4FUJA 3GICB 2J4IA 4K69A 4YOIA
chains in the Genus database with same CATH superfamily
1N6XA 2KAIB 1A4WH 3M5OA 1VITF 1Z8GA 1K21H 2ZWLH 2P8OB 3A8DA 1ZZZA 1BUIA 4MNYA 4OS1A 5CHAB 5EOKA 4FUHA 2B8OH 3BTWE 1GHAG 3SU5A 3CP7A 2PFEA 2O8WA 3GY8A 1D3TB 3W95A 1T32A 3M7UA 1DLKB 1WQSA 2VU8E 1IHSH 1S5SA 5HYOA 4Y7AA 4Q7XA 1O3AA 1LKBA 1T8MA 1VZQH 2ANMH 2XBWA 3RXDA 2FYRA 4BTUB 4I8KA 2ZU1A 3GY5A 3ATWA 2LELA 5AVDA 2Y6TA 4TT3D 4UFFH 3DCLA 1AGJA 2OLGA 2BLOA 2PUQH 3RXVA 2EI7A 5DP3A 1BTUA 3BTME 1AI8H 1C5XB 4YLQH 1AFQC 1MZAA 1DY9A 3OU0A 1BHXB 1B0EA 3A7TA 3AAVA 1PYTC 4FUDA 1J17T 1FY5A 2XCFA 2F9VA 5TCCA 1LKAA 2F3CE 3FANA 3VG8A 4AC9A 3SU1A 3T2NA 3SYJA 2BB4A 1UTOA 3A8CA 1SHYA 1SQTA 1XKAC 3LGYA 5F03A 5FAHA 3BEFB 4ISOA 1ACBE 2OCVB 3Q76A 4IMQA 4RKJB 3SGAE 1H9IE 2BYAX 3P70B 1V2JT 5EJZA 4ZKNU 1ZGVA 2TRMA 1K1IA 1ZPBA 4YLUA 2WSSD 2P3TB 2VBCA 3H5CB 2V3MA 3LH3A 5GDSH 2OUAA 4ZHLU 1N8OB 2QC2A 4X2XA 2B9LA 4NSYA 4ZROA 2ASUB 1OP8A 1QNJA 5C3NA 3ZV9A 1P02A 1W12U 2A4QA 3A88A 2BDBA 4AYVB 1UTPA 2BD2A 1TNIA 3A86A 3V7TA 5A0AE 1TA6A 4CR5A 3W1EA 1JMOH 1ESAA 3SU2A 4E7NA 1HAXB 1Z7KA 3FOAA 4AFZA 5HGGA 3H09A 4IN2A 2EI6A 2DE8A 1S6FA 2AGEX 1C5UA 2Z9IA 4RKOB 2VH6A 1LHDH 1BTPA 1KDQB 2UWOA 2FLRH 4B2BA 1NRNH 2BTCE 3SV7A 3S7HB 3TGKE 2ZFQH 4D76A 1UCYH 1S82A 2BY9X 2FOHA 1BQYA 1NRSH 3BTDE 9ESTA 3E8LA 3D49H 2WINI 1GWAA 3M7TA 4YOGA 1TOCB 2J9NA 1E1QD 1LHGH 1GL0E 2AMQA 1LPKB 2BDIA 2VVUA 1W8BH 5F8XA 1WYKA 2A2QH 5GPIB 2R2WU 2DE9A 4XBDA 4NZLA 4ASUD 1OWDA 2KFWA 1PPFE 2G5VA 1QRWA 1QURH 3FFGA 3A87A 1QL7A 2BX3A 7LPRA 2BMGB 2NU1E 1SMFE 2CK3D 4IC5A 2GKVE 2Z9JA 3E16B 2KR7A 1W7GH 5BRRE 1N1LA 3OFND 5GNDA 2EI8A 1T8OA 1F0SA 3PRBA 1C5NH 2FIRH 3PO1C 3F9HA 2PGBB 2O9QA 2ZU4A 2GCHF 3EA8A 5E0JA 3P92A 2XWAA 1QFKH 2WV9A 4ISLA 3IG6B 2BD7A 3R0FA 1A3BH 1CQQA 1SR5C 2AMPA 1TPOA 1EQ9A 1NY22 3QX5H 1KTSB 3F0PA 3KNXA 2K8IA 1SGRE 1AIXH 1BCUH 1O31A 1DWCH 1WTGH 1UTNA 1O2QA 2Z9KA 4E06H 1P01A 1SGNE 3RMOH 5E2PA 2V0BA 3NXPA 3CENA 3SJ8A 3UAIC 4DT4A 1C9PA 2BY7X 4B73A 1C5VA 2J95A 4I8GA 2J94A 3SJIA 1K1NA 3QO6A 4MVNA 4UD9H 3NCLA 2V35A 1Y5AT 1PPHE 1BBRH 2GDEH 5DP7A 4K3JA 3HGNA 4KELA 3SW2B 3P95A 2J5UA 2GV6A 2ZCHP 1TBRH 3ZVEA 3LPRA 1O39A 2H5DA 1PPCE 3BIUH 4UFGH 1A5HA 5JB9S 5A8XA 5HIYA 1F5RA 2P8OC 2HNTF 1NFXA 2XYAA 4BAKB 1GCTC 1YPKH 3BEUA 3ZVGA 2L74A 1RFNA 1IQJA 1C2EA 2GZ7A 4ZKRU 1BTZA 4MG3A 1HV7A 2A4RA 1HXFH 1G3CA 1H8ED 3PM3A 3FP7E 4JYVH 5J4SA 1W10U 1QA0A 1V2VT 2FOEA 3MO3A 4KTCA 2P94A 4WY3A 3S7KB 3SNDA 2OP9A 3SQEE 1FAXA 1QZ8A 1KIGH 2C8ZB 2O8UA 9LPRA 2PSXA 1KSNA 1W0YH 1L1GA 4UDWH 4K1EA 3SUFA 4MDSA 3MO6A 3MFJA 5FBIA 2UWPA 3TH2H 3KIDU 5SGAE 1NU9A 3SZNA 1SBWA 1GHYH 3KCGH 1C2GA 1GJDB 1RTLA 3A89A 2ZF0H 3E3TA 4XE4A 1L4DA 1A5IA 2J98A 1EJNA 1V2QT 2ANKH 4GPGA 3MO9A 1HB0B 1BRUP 1KXFA 4RI0A 1SLUB 2NU4E 2RG3A 2A7JA 3GOVB 3SJ9A 3M36A 4BAHB 1IQEA 1P9UA 3SU3A 1GBLA 2AS9A 4JK5A 1O2HA 2QF3A 3E90B 5DN6D 1AVWA 2Y82A 4WMDA 2GMTC 1F0UA 1KLJH 1DY8A 1WTHD 4XSKU 5GIBA 1O3HA 3MU1A 4GHQA 1ELCA 1MTWA 2FEQH 3LIWA 3L6PA 1UVOA 4FETA 4WH6A 1P2OA 1GI8B 1VKYA 1XVMA 3F0OA 2B7DH 5K7RA 3GY7A 5LPRA 1JWTA 1DUEA 2W3IA 2FTLE 4I31A 1B5GH 3C27B 4Q2KA 1MMJN 1HAOH 1E35B 1H8IH 3LT3A 1DVAH 1QCPA 4AB9A 1ZRBA 3SU4A 3Q00A 5EGMA 4OS2A 1ZJDA 3DUXH 4JYUH 2VVVA 3RXGA 1O37A 1S81A 3ATLA 2OC0A 3SGBE 5C0TA 4XD7D 4I8LA 2Z3CA 3VXEH 3K2UA 5EQSA 2XW9A 2FTMA 2WUBA 5JBAS 4JZFH 1A46H 2GV7A 4XBCA 5DJ7A 1ETRH 2KM0A 2ZECA 3PLKA 3PV2A 3PMAB 4X6PA 5C1YA 1A1RA 3A7XA 1XUJA 1GGDB 2KCOA 1MTSA 1OS8A 1KXAA 2GT8A 2GTBA 2GVFA 1NESE 1BIOA 3DA9B 3VFEA 4PROA 1DS2E 2ZZUH 1V2RT 1YGCH 2EY4C 3AW1A 3GCOA 1LVYA 1SGPE 1GI0A 1H8HD 1TRNA 1V6DA 2UUFB 5F6MA 2W26A 4CH2B 1GJ9B 1FAKH 1V2TT 3SU6A 1FV9A 2F83A 3U69H 1EB2A 1EUFA 1Y3VA 1YPEH 3SGQE 3SI3H 3M35A 2BOHB 2ZTZA 3RP2A 3S9CA 2ZDKA 2JH0D 5C17A 3LU9B 4B74A 3KQDA 5HKKD 2Z6BD 4IN1A 3LGWA 4HZHA 1O3FA 1YPLH 2BDCA 1Q2WA 2BQ7B 4MPWA 3RXPA 1AKSB 3TK6A 1TGNA 1OYTH 1DSUA 2IOTA 3M5MA 3UR9A 4NA9H 2YOLA 4YM9A 1W0ZU 1DLEA 2ZTXA 3F3BA 4NFEA 1ABIH 4QT8C 4LK4A 1CA8B 5A0CA 1NPMA 4CRAA 2ZDMA 3TNSA 3CNRA 4I86A 3G01A 4WWYA 3TJNA 1EATA 1CT2E 2PTNA 1AZ8A 3K9XB 1XXDA 3GS9A 3K65B 4Z1MD 4F48B 3ZYDA 4IMZA 5IDKA 5KGOA 2J97A 3TJVA 2XNIA 3ZZ3A 4ZAEA 1GI4A 2ZHEH 1SQRA 2GT7A 1CO7E 1RIWB 2FOCA 1C2FA 3SBKA 5B6OA 1NBMD 1AD8H 2P59A 1P2JA 1SI5H 4AFSA 3SO3A 4B6EA 1W0KD 4Q63A 2QXGA 1MZDA 1G3EA 1O3LA 1O2ZA 3FKSD 3H7OA 3U9AH 1LDTT 4HFPB 2FODA 1C2DA 1O36A 4ZH8A 3ZZCA 2ZI2H 3SQHE 1WOFA 2PSYA 2BD4A 2JDID 4H42U 2JETC 1C1SA 1W2KH 4MQAA 3E0PB 3GCHB 2BZAA 3F1SB 4A1VA 3QZRA 2AHME 1P10A 3SI4H 1IQLA 2A4GA 1HXEH 2F9NA 1OOKB 3MU0A 2Y7ZA 4KKDA 4CBNA 5CMXH 2HVYB 2ZO3H 1P2NA 3A80A 1AO5A 1QBOA 3DFJA 3ZZ6A 2QXHA 1SQAA 3BG8A 1MH0A 2XBYA 2ZFRH 2R0LA 1MKXK 2BLVA 4NIVA 1O3EA 2ZCKP 1IAUA 1DT2A 1UMAH 2ULLA 2W7SA 3Q77A 1J8AA 3U1IB 3I29A 3RXEA 3S0NA 3QZQA 2JKHA 5EQRA 4ABIA 1CHOG 1DX5M 1KLTA 1GI9B 2A5KA 2EQNA 1G2MA 3RMMH 2QF4A 1O2RA 3BN9A 1HJ9A 1MAYA 1TGSZ 1EXFA 2FESH 4HTCH 3U8RH 1F0TA 1O2KA 2PV9B 5AFZH 1QGFA 2WZQA 4H6TA 5TJXA 5I46H 1AVGH 3RXUA 1O34A 4FOUC 2VIOA 3U28C 3RXHA 2KAIA 5E0HA 1G36A 4CRCA 1C5ZB 4DT7B 1UJ1A 2A7HA 3T29A 3MH4A 3ZZ9A 1GDNA 1O2MA 2TBSA 2ZG0H 1FMGA 1TMBH 1PJPA 2ANYA 4D8NA 1BBRE 2XRCA 3SNEA 8ESTE 1P2QA 1SPJA 3UQVA 1CT4E 2OK5A 1TQ7B 1NRRH 2FI5E 3JZ1B 4CHAB 2CJIA 3S69A 1X7AC 3STIA 1AWFH 4NIYA 3RC6A 4MTBA 3SORA 4UFEH 1UW7A 3UWIA 3FP8E 3LKWA 2HPQH 2ZHDA 1K1OA 1AKSA 1NO9H 3EYDA 2GCTC 3HATH 2QGRA 1ZHMA 1CBWC 2ALPA 1QB6A 2BHGA 2FPZA 2OC1A 3BTTE 4CREA 1RTFB 8KME2 1AUJA 5T3HA 3PV5A 2KZ4A 4JZ1A 3PWCA 2H2ZA 1ZSKA 4X2VA 4YT7H 5A0BA 1NS3A 1NBME 1GJ5H 5DSFA 2OD3B 2ZGXH 2OQ5A 2WV4A 1PQ5A 2V3OH 1Z71A 3O8CA 3B8JA 5C1UA 1UCYK 3EDXB 5FBEA 5FPSA 1O2OA 1B0FA 1D4PB 3GY2A 2SGEE 1F5LA 4GUXA 1ZRKA 1LTOA 2QXIA 1AE5A 1Z8RA 1T31A 2PTCE 3M3TA 4WXVA 1CHGA 2BQWB 3RMLH 3PB1E 3URDA 3RLYH 4XDEA 1OXGA 1HAVB 2VWNA 3RU4T 1GHVH 1G3BA 4CRDA 3MI4A 2XXLA 3PLBA 5JBCS 4AGJA 3HGPA 1GJBB 1V2OT 2OC7A 3L3TA 3MTYA 3BTEE 1UVSH 1BRCE 4ABFA 3TJUA 4YO9A 1YYY1 1YM0A 2BM2A 4MNWA 5GWZA 1GI7B 3MYWA 3ZZ8A 4INHA 2ANWA 2Z3DA 2A45B 3OAAD 1UK3A 2TGTA 3MH5A 2IJOB 3LDXH 3LONA 5HMAA 2EA3A 1E38B 2AH4X 1QB9A 1EOLA 1GBJA 1OWEA 1MTVA 1SGEE 1SGYE 1COWD 2Z94A 1K2I1 2CHAC 3TJOA 3QWCH 2CHAB 4ABGA 1A2CH 3M7QA 3QK1A 1L2EA 2NU3E 3EE0B 1Z6EA 5F8ZA 3MMGA 1C5PA 3OY5U 3GY6A 1BRBE 4FUEA 1BTYA 1T4UH 1NTPA 1W7XH 2Y81A 1UK2A 1HAPH 5LGOA 1P09A 2ZDNA 5DP4A 2THFB 1N8OC 2XBVA 3RXBA 1C1NA 1GBAA 1TRYA 2KCPA 2UUKB 1GJ4H 5IYTA 6ESTA 1XUFA 4P02A 1GVKB 4U2WA 1O3GA 4NGAH 3MU5A 1AU8A 5AHGH 4A6LA 4UONA 2VINA 1F92A 2VB0A 3A7YA 3UB0A 2G4TA 3OTPA 4A1XA 2XBXA 4X8SH 3ZZAA 2QCYA 1DWEH 3KQ5A 3P8GA 2V7QD 4UFDH 1C1OA 3QGJA 1CGIE 5GCHG 4Y6DA 4SGAE 5EXMA 2SNWA 4K5ZA 1Z8JB 4FUCA 1A0HB 1SSXA 1GMDG 5E0GA 1TX8A 2G81E 2ZPSA 4JK6A 1OWHA 1QHRB 5FL7D 2BDYA 2GP9B 3MNBA 1OP0A 4NG9H 3C1KA 4AORA 1YPJH 4DCDA 3JZ2B 3Q3KA 1C1PA 1V2LT 1CSOE 1A61H 3TGIE 3RXSA 2GCHG 2FOMB 2BVXH 2Z9LA 1A0JA 1ESBA 4TYDA 2BD3A 4ABDA 1TPAE 1YP9A 3UY9A 1C1VH 1QRXA 1YCPK 2XTTB 3A81A 1QY6A 4OS6A 1OKXA 1RD3B 4INLA 1G2LA 1ID5H 1L1NA 1OP2A 1LVBA 2QF0A 3PMJA 1EB1H 1EAWA 4BAQB 4AG2A 1YPHC 1IQIA 1GBCA 1ARCA 1IQHA 3UWJH 4CHAC 3TK9A 2QN5T 2VIPA 2G51A 1C5MD 4X2WA 1XKBC 3EGKH 3FN8A 1UTMA 1GI1A 1MKWH 3V3MA 1DUAA 2BX4A 3SHAH 5DKMA 2PKAA 1HDTH 1KLIH 4RT0A 2F91A 3O8RA 1SGFG 5FPYA 1EZSC 3S9AA 1SKYE 1DICA 8GCHF 1XUIA 3OEHD 2KCYA 4NIXA 3DFLA 2QY0B 1YC0A 1VITG 1GI3A 1EJAA 2W6ID 5L2YH 2ZTYA 1YPGH 1XMNB 1TX6A 1ELDE 1GI2A 4JCNA 3KHVA 1LMWB 1FNIA 2O8TA 2SGAA 3KN2A 1H1BA 3QLPH 1TNHA 4IW4E 3TITA 1C2HA 3LGVA 3R3GB 1UO6A 1V3XA 3OEED 4ZXYH 2GCTB 3WY8A 1NC6A 3SUGA 1KMHB 1B7XB 2AEIH 1EAXA 1OWJA 2FOGA 2JIZD 1A0LA 3MNXA 5BPEA 2IN2A 1O3DA 3MH7A 3K6YA 3LGUA 1P06A 1NFWA 2G52A 1DXPA 1MABB 3ZYEA 1D6RA 3RC4A 3O8BA 4AFQA 3TK5A 4LZ1H 3SJKA 4IC6A 6GCHG 4K8BA 2FX6A 1K1PA 2IPHA 1TGBA 1PPBH 4NA7A 2CMYA 3U8TH 2YNAA 1ZHRA 4HI3A 1RXPA 1VCQA 2TGPZ 3BTFE 1V2NT 1MU6B 1C5WB 1SGDE 1BJUA 4JZIA 1BDAA 1DXWA 2ILNA 5C94A 3ZVDA 4I32A 3GCTG 1ZMNA 1O2NA 3OE7D 4FVDA 2QA9E 4U30A 2OBQA 1OSSA 1KY9A 1TNLA 2R2MB 3KYGA 4Y76A 2TGDA 2ALVA 1O2YA 4RT1A 4TPYA 2ZFFH 2EEKA 1YBWA 3SUDA 3PV4A 1C1WH 1UVPA 1YY3A 1CBWB 2QIQA 2D1JA 1QJ7B 3ELAH 1EZUC 2F43B 5E2OA 3VB5A 4VGCB 4WMFA 2ZCLP 1ZPCA 1TIOA 2HRVA 2V3HH 1YCPH 3D23A 4ACBA 1THSH 1Z1IA 3KQCA 2ZFTA 3MOCA 1VITH 4ISHH 3GYMA 1H9LB 2CN0H 2BY5X 3OTJE 2FS9A 5C0UA 1SQOA 2EC9H 2H9HA 4X1RU 2OBOA 4BXSA 1GJ6A 3I78A 3TPIZ 4ABEA 5HXFA 2J34A 2FI3E 1FX0B 2A4OA 1GBEA 2ZU5A 3BTKE 2LNCA 5FCKA 3UOUA 2QYIA 3UFAA 4I33A 3H7TA 1LVMA 1Y5BT 1CGHA 3GDSA 5C5NA 6LPRA 1FDPA 4GAWA 1ZTJA 3NRLA 1C9TA 2GZ9A 1CA0C 5KEDA 1ZMJA 2I6QA 3ZZ4A 3KF2A 1G37A 1O3BA 2Q1JA 1DM4B 3RXLA 1WXRA 1TA2A 5DGJA 2WPHS 4FUIA 1GMCG 1YWUA 4B2AA 2ESTE 3V12A 1P3CA 2BOKA 1XUKA 2JJ2D 1ABJH 2BD8A 2FXRA 1LHCH 3F2HA 1ETSH 2VWLA 4CRBA 3VB7A 5EW1H 3OSYA 1JIMA 1C1TA 3SV2H 2W5EA 1GJ7B 3KQBA 1CGJE 1K22H 4DGJA 3UIRA 2ZGBH 1GHBG 4THNH 3RXCA 2WV5A 2R3UA 5KECA 2GDDA 1UTKA 2H9EH 5AF9H 1GI5A 1K1JA 4NZQA 2JH6D 3BIVH 5ABWA 1WUNH 1GMCF 3FP6E 3RXIA 2W7UA 2ZDLA 1ZR0A 1S6LA 3LJJA 4GLYA 5DP5A 5ETXA 1HLTH 1FJSA 1VJAU 4X1NU 4FUFA 1JXPA 3U98H 1PQ8A 3B9FH 2P3UB 2CXVA 1BTWA 1BMAA 1XUGA 2AGGX 2OXSA 4AB8A 1FI8A 1IQNA 2Z7FE 1VJ9U 4UEHH 1TGTA 2XC0A 1CA0B 1EPTB 1GVZA 1Y3WA 1AQ7A 3N7DA 3N7OA 1O38A 3VEQB 3KGPA 5JYIA 2FOBA 3FZDA 1OYQA 1WAYB 2LPRA 2VGCC 3ZZBA 3E6PH 2VGCB 4MNXA 5T6GA 4IGDA 2VWOA 1C4U2 2G4UA 2A5AA 1SHHB 2VH0A 2ZFPH 1LO6A 2ZP0H 1UCYE 1WCZA 4K60A 3TH3H 1UVUH 1O3NA 4X2YA 2HGTH 3SHCH 2PGQB 1ANEA 1K0HA 3OYPA 3W94A 2YMSB 3MU4A 1BB0B 3I77A 3PROA 1D3PB 1PQAA 4GSOA 4MLFB 4AOQA 3TLOA 4ESTE 1TX7A 1CVWH 1V2ST 1GI6A 3N99A 4GVUA 1SG8B 1C2LA 3VGCC 4GHTA 1MD8A 1ESTA 3ZVAA 2FZZA 1AUTC 1AVXA 1LHEH 4CR9A 2Y80A 1TE0A 1AFEH 3KEEA 4P00A 2F9BH 1GVLA 4ISNA 4NWLA 3A8AA 3GY3A 3UQOA 3RM2H 1EZQA 5AFYH 1O32A 1NN6A 1RRKA 4A7IB 1ELFA 1OPHB 5FXLA 3Q3YA 1YKTA 7GCHF 4NWKA 4D7GA 3NWUA 1PPZA 4TY6A 5A09A 3IITA 1CHOF 2QAAA 2ZHWH 1ARBA 3ENSB 4WF8A 1SVPA 1UHBA 3MNSA 3SV6A 1HJ8A 1GG6B 3V13A 1ZTKA 2ZU2A 3F6UH 2QF5A 1HFDA 4YT6H 1FUJA 1O3JA 2GMTB 4LOYH 3RM0H 3LC3A 1E79D 1EOJA 2BVSH 6GCHF 1FIWA 4Y0ZE 4ZKOU 4X8TH 2XCNA 1P2KA 4TPIZ 3Q3XA 4NIWA 1QB1A 1FLEE 3BG4B 2NU2E 1GBHA 1BZXE 4NCYA 2FX4A 1C4Y2 5JDUB 3GCNA 1S83A 1HJAC 5EW2H 3M3VA 2F4LA 5DK1A 1MCVA 4IS5A 1C4V2 1NFYA 2VIDA 4D7FA 1O2JA 4KTSA 2SGQE 3A85A 5DP6A 4CRFA 3WWBA 4WXIA 2J2UA 4Q4LA 4FVBA 2VNTA 5DPAA 4Q7ZA 4K1TA 3KQEA 2O8LA 3RUOA 5IK2D 1QJ6B 1EPTA 1TAWA 1DPOA 1H9HE 2W6JD 5LPEA 1D6WA 1GBKA 2Q6FA 4AFUA 1C5TA 1WDIA 2PKSC 2D26C 1ANCA 1SLXB 4ASHA 2ZIQH 3BF6H 3NUMA 5EODA 1UK4A 1E34B 4X6OA 4F4OC 3KL6A 5FCRA 1EKBB 8GCHG 3U1JB 2D8WA 4ZMAH 2PLXA 1DOJA 2XC5A 1AMHA 2VWMA 2K1QA 4ZCNA 4Z6AH 4D9RA 3QGNB 2AFQB 1MKXH 2C93B 2AIPA 4AG1A 2HALA 1MKWK 3AVZA 4X8UH 4BOHA 1DANH 1O2SA 5LPFA 2BDAA 2Y5HA 1MCTA 4M7GA 5C2ZA 1GCTB 3BTHE 1E0FD 2C90B 2B5TB 1DITH 1MQ6A 1PPGE 4ZXXH 1AB9B 2A31A 3SNCA 1O5AB 1UTQA 1W13U 4TWWA 2YMSC 1HJAB 1FXYA 1JRSA 3WWFA 2XWBI 2GZ8A 2D2DA 5E8EH 2ODQA 1P03A 2ZEBA 2VIWA 4R0IA 4Z0KA 1MBMA 2BLQA 3RXKA 4YXWD 4E05H 1JBUH 2W3KA 3UR6A 1EP6A 1FN6A 2RA3A 2ZDAH 1O3CA 1U6QA 1O5EH 4FUBA 4ABAA 1QA7A 2SFAA 3F2FA 3FAOA 3FZZA 3PYHA 4HG6A 1DFPA 3M37A 1C2JA 5TCAA 4Y0YE 5F53A 1P57B 5EQQA 3TVJB 2BY6X 2C8XB 3UNSA 1W3CA 1O5GH 1C1UH 4K2YA 1YPMH 3NKKA 1LQEA 4B6FA 3ZZDA 5A8YA 8LPRA 1ZJKA 3TU7H 5G4BA 3MQKC 3P8FA 1GMDF 4YOJA 4X1SU 2BXUH 4LZ4B 3BEIB 1IHTH 3DT0H 1VCPA 3RXJA 3A7VA 1BHXF 5JBTA 2HOBA 2XOKD 1PFXC 1ZHPA 1DWDH 3LH1A 2M5TA 1SC8U 2F9PA 2STBE 5CHAC 5JPMH 1CU1A 1H8DH 1GJCB 2PHBA 4DURA 5L30H 2STAE 1G30B 1HAGE 1D3DB 1NU7B 4BAMB 1BTXA 1HAHH 3SU0A 3PMHB 1TMUH 2H1UA 3HKJB 1O2GH 2YMSD 1QJ1B 3EQ0H 1MAXA 2WUCA 2RCEA 4IBLH 2Y7XA 1D9IA 2NWNA 1P05A 1MTUA 5T1VA 5C1XA 1EZXC 2ZFSA 4ABJA 1SL3A 2A7CA 4KGAA 2I6SA 2BD9A 1CE5A 1HGTH 1QQ4A 3RU4E 4MNVA 2LP6A 1T8LA 1F0RA 1KXCA 3ZVBA 1LVOA 2PR3A 1T7CA 1IQKA 2AGIX 1THRH 4NSVA 1T4VH 1AWHB 3M3SA 1VCWA 1TALA 2WPMS 2J38A 5DP9A 3PLPA 1ZTLA 4WJG2 1GGDC 2UUYA 4AYYB 1TYNA 3T25A 4K1SA 1LHFH 4WH8A 1AFQB 3P6ZB 1BITA 1C5SA 1MUEB 1XUHA 2TPIZ 1Z1JA 4O9VA 1GG6C 1PPEE 3V0XA 5CHBA 4ABHA 1EX3A 3VB4A 1TABE 4MPVA 1RS0A 1CT0E 3MNCA 1RIWC 1Y3UA 2VIVA 4XFQA 4XBBA 1K1MA 5L6NH 1FY8E 1TBZH 3MWIU 3UOPA 3A7WA 3F9GA 3T26A 3NZIA 2F9UA 1K1LA 4J1YA 1OX1A 3MH6A 4DJZB 1HAIH 1A7SA 3ATIA 1HIAB 1AE8H 1AHTH 4OGYA 5FX5A 1P04A 3EE7A 1NM6A 4FU9A 2G5NA 3P17H 1FQ3A 2UWLA 5EJ1A 2HPPH 1QQUA 4GCHF 4RN6A 1HUTH 1EP5A 1TNKA 4H6SB 1EFRD 3VB6A 2YNBA 3QN7A 3ZVFA 2HNTE 4BAOB 5EIYA 3PO1B 4O03A 1NRPH 1BMNH 3RXFA 1YF4A 1GCDA 1SGTA 1ELEE 3N7EA 1WBGB 3QDZB 1O5FH 4R8TB 3RXOA 1S84A 1O30A 4F49A 1K9OE 2ODYB 3DSOA 1O2IA 2WPJS 3ZVCA 1QR3E 2Y5FA 3ZZ5A 5C67A 4VGCC 4BXWA 1O5BB 3M61U 1E36B 1GHZA 1ELBA 5LH8A 2F9OA 2BD5A 3AK5A 4JYTA 4X6NA 2QXJA 4DOQA 3T62A 1DWBH 1SGQE 2M2AA 4Y79A 3LJOA 1BJVA 1SFIA 3RXQA 1SGFA 1XVOA 2FLBH 2H5CA 3LC5A 2FO9A 1GDUA 1DSTA 4JMYA 2J98B 5HM9A 3B23B 4FXGH 1C5YB 3GCHC 1ETTH 1C1RA 2BVRH 2IJD1 1F7ZA 5EU8A 2L6OA 1IQMA 4X0WU 3MHWU 1LCYA 2TIOA 1FY1A 2ZHFH 2ZQ2A 3SNAA 1A5GH 1W11U 1NFUA 3A83A 3A82A 2H9TH 4UE7H 3SN8A 3TIUA 2CV3A 1HAZB 3AASA 1WU1A 1BT7A 4B71A 5FPTA 3LGIA 1LQDB 1S6HA 2ZGHA 1V2KT 2GX4A 4ISIH 4MPUA 1O2VA 1SLWB 1QTFA 2GGVB 1Z6JH 1F5KU 3A8BA 1E37B 1ELTA 1OHHD 5DP8A 1GBMA 3ESTA 4GCHG 2C3SA 5DG6A 1BA8B 2HNTC 2RDEA 3DSGA 1NRQH 1Y8TA 1EJMA 1TWXB 1KYNA 4ZUHA 4M9FA 1BRAA 3D65E 1BTHH 2A0QB 2PUXB 3AW0A 7ESTE 4Y8YA 4ZKSU 1SGIB 2IPQX 4OS7A 2P16A 3SV9A 3URCA 2FOAA 1HAVA 4ACAA 2WYJA 3ATKA 3HPTB 5GXPA 3EA9A 1NT1A 1ANBA 1ZSJA 1BMLA 3UUZA 5F8TA 4DW2U 1ZYOA 3S9BA 1GL1A 3A84A 3IWMA 2FYQA 2Z9GA 1C2KA 2BXTH 2WPLS 1XM1A 1V2WT 2RA0A 4A92A 1S0RA 1TQ0B 2Z3EA 5FHTA 2OC8A 3OY6U 3FVFB 1VR1H 2O8MA 2WHXA 1QRZA 3QTOH 1AB9C 1RGQA 1LPZB 3D62A 4YTAA 1O3KA 1SOZA 2CF8H 5J4QA 1G32B 3TNTA 1ZSLA 2BDHA 4B76A 1YCPM 1P8VC 1M9UA 4YZUA 3PWBA 1MTNC 4FU8A 1J14A 1C1QA 2GD4B 4NA8A 4WVPE 1RTKA 1VGCB 5JBBS 3K6ZA 4CH8B 3SUEA 2OQUA 4O3UA 1V2UT 1C5QA 1O2WA 1K28D 2C4FH 3PRDA 2JH5D 3VGCB 1O2UA 2TGAA 1HIAA 1GJAB 3F2GA 2BY8X 2CGAA 2RFKC 3RXRA 1SLVB 4OS4A 2ODPA 3SOSA 3ITIA 4BTIB 2ZA5A 3GYLB 2Q6GA 1P2MA 3SJOA 2PKSB 1O33A 3UNRA 1GHXH 1V2MT 5JB8S 2ZPRA 1SFQB 5H4IB 1ZGIA 4U32A 1IOEA 1C1MA 2HLCA 7GCHG 3DHKH 1JOUB 3GDUA 4BANB 4XRNA 1FIZA 1HNEE 1WQVH 2Q6DA 3M5NA 2AERH 5ESBA 4I8JA 1GBTA 2FDAA 1UVTH 1O3IA 2PWXA 1TNJA 2G8TA 2WPKS 5CE1A 2FOFA 4NFFA 5T6FA 2RDLA 2H6MA 1TNGA 3HK6B 1EASA 4X1QU 2V6NA 4MPXA 1TPPA 1OWIA 2VJ1A 4TWYA 3EA7A 2FM2A 1Y3YA 4JZDH 3ZZ7A 4OS5A 1TRMA 1AN1E 1O0DH 3QTVH 5A2MH 1JRTA 3M5LA 1O3PB 2VIQA 1J15A 2HLDD 1C2MA 1C2IA 4I7YH 4RSPA 4DG4A 1LPGB 4AN7A 3SV8A 1WV7H 4Q7YA 3P8NA 3HK3B 1O3OA 4H4FA 3PTNA 3ZIAD 4D9QA 3O8DA 1SOTA 1A3EH 1W0JD 5EPNA 2R0KA 2OINA 1ELVA 2UUJB 4HGCA 2ZC9H 1FY4A 1GJ8B 2FI4E 2HWLB 1BMMH 3RXAA 3VPKA 2CF9H 4I8HA 4J2YB 5GCHF 3FO8D 4X6MA 1NROH 3E1XB 1EAIA 1GHAF 4A5TS 2C8YB 1F2SE 4Y7BA 1J16A 2OTVA 1E1RD 3NK8A 3GISB 4E7RG 2FS8A 1S0QA 3LGTA 3LOXA 3T5FH 2GJGA 1Y59T 1FN8A 3F9EA 1TGCA 1GBIA 1HBTH 3DSPA 4O97A 4FU7A 3ZV8A 4Y10E 1QBVH 3GDVA 1TBQH 4OM9A 1OWKA 1C5LH 1QL9A 2SNVA 3RC5A 1FPHH 2AMDA 1H4WA 3RDZA 4OGXA 3BSQA 1G9IE 3UTUH 2ZGCA 4TSFD 4F55A 3E0NB 4Y8ZA 1O3MA 3UPEA 1MU8B 4B75A 1ELGA 1GBDA 3PTBA 1C5RA 3WW7A 1XXFA 4Y11E 2A1DB 1FZZA 3AAUA 1MTNB 2FMJA 2WPIS 1O35A 1GMHG 1Z8IB 1GBBA 2XC4A 1RJXB 3OX7U 5PTPA 4FUGA 1UTJA 1MD7A 1IQFA 2AYWA 3CS0A 1YLCA 4DIHH 4AGKA 3KYFA 3PMBB 1TFXA 4DY7B 1Y5UT 2WPDD 1HPGA 5DO4H 1P9SA 2SGFE 3UNQA 5C20A 3P8OA 4ABBA 4ZHAA 1TOMH 1O2XA 1EAUA 1ZPZA 2Y5GA 3UREA 1P12E 2HVXA 5HIZA 1ZLRA 2A32A 1P3EA 1P11E 1GMHF 2QV1A 1O2TA 3ODFA 1W14U 1PQ7A 3VXFH 1YLDA 1P2IA 4ZHMU 3DD2H 1QBNA 2P95A 4BNRA 2ZKSA 4B1TA 3RLWH 2C8WB 1ELAA 1MQ5A 3RMNH 2BZ6H 4BTTB 5EXLA 1HAYB 1UTLM 3BG4C 2J92A 2ZHQH 3F68H 1BBRK 1L4ZA 1ANDA 5HM2A 1AZZA 2K0QA 1P0SH 4O3TA 4INKA 1HCGA 2WYGA 3MU8A 2BLWA 4DVAU 1Q31A 5EJLA 5EPYA 1Y3XA 5B6LA 2BDGA 3NPSA 3HKIB 1HRTH 3ODDA 2B0FA 2JETB 3STJA 1FONA 1EPTC 4DIIH 4Y71A 4X8VH 4Q80A 1T8NA 3TH4H 3T27A 4JZEH 1QL8A 2KCAA 3ATMA 1DDJA 4Y8XA 1HYLA 1O5CB 2A2XH 3L33A 1GBFA 2PP6A 5EG4A 4X1PU 1SB1H 2R9PA 5I25A 1IQGA 3QUMP 1AY6H 1SGCA 3GY4A 6CHAB 1V2PT 1KDQA 2FP7B 6CHAC 1G3DA 1TLDA 2A5IA 2AIQA 1UHBB 2G00A 3SZEA 5GJ4B 5FX6A 4AZ2B 4K8YA 5CDFE 1PYTD 3GCTF 2VVCA 1S85A 7KMEH 1C5OH 2SGPE 1YLNA 3TGJE 2ZGJA 1O5DH 1L1JA 2SGDE 2PKAB 4KP0A 1TB6H 4SGBE 4TY7A 1FPCH 2P3FH 1INCA 1D3QB 2R3YA 2QE7D 2ZNKH 4KTUA 4WMEA 5A8ZA 1J9CH 2NU0E 2KX4A 5K0HA 2G55A 1TONA 3SNBA 1WSSH 1GDQA 1KTTB 1KXDA 1TMTH 3BV9B 3CS7A 1GHBF 1BOQA 5ESTE 1JIRA 1XX9A 5T6DA 5C5OA 2ZPQA 1ZMLA 3U8OH 1GPZA 4YESB 1GHWH 2FWWA 1ORFA 3RXMA 3BTQE 4CRGA 2JJ1D 5L2ZH 1KXEA 1O2LA 3RU4D 2ZU3A 4U01A 1QIXB 1MBQA 1FY3A 1BMFD 3E91A 2DUCA 3BTGE 1THPB 1Q3XA 3A7ZA 3RXTA 5EXNA 1L0ZA 1TPSA 2BQ6B 3T28A 2P93A 1ZOMA 1KXBA 1O2PA 4LXBH 4B2CA 3F9FA 2ZDVH 2PW8H 3EAJA 1DE7H 2ZQ1A 3VB3A 1YPHE 4A1TA 2XNDD 4AX9H 1NZQH 4CBOA 1N6YA 4XOJA 1VGCC 4FUJA 3GICB 2J4IA 4K69A 4YOIA
chains in the Genus database with same CATH topology
1N6XA 2KAIB 1A4WH 3M5OA 1VITF 1Z8GA 1K21H 2ZWLH 2P8OB 3A8DA 1ZZZA 1BUIA 4MNYA 4OS1A 5CHAB 5EOKA 4FUHA 2B8OH 3BTWE 1GHAG 3SU5A 3CP7A 2PFEA 2O8WA 3GY8A 1D3TB 3W95A 1T32A 3M7UA 1DLKB 1WQSA 2VU8E 1IHSH 1S5SA 5HYOA 4Y7AA 4Q7XA 1O3AA 1LKBA 1T8MA 1VZQH 2ANMH 2XBWA 3RXDA 2FYRA 4BTUB 4I8KA 2ZU1A 3GY5A 3ATWA 5AVDA 2Y6TA 4UFFH 1AGJA 2OLGA 2BLOA 2PUQH 3RXVA 2EI7A 5DP3A 1BTUA 3BTME 1AI8H 1C5XB 4YLQH 1AFQC 1MZAA 1DY9A 3OU0A 1BHXB 1B0EA 3A7TA 3AAVA 1PYTC 4FUDA 1J17T 1FY5A 2XCFA 2F9VA 5TCCA 1LKAA 2F3CE 3FANA 3SU1A 3T2NA 2BB4A 1UTOA 3A8CA 1SHYA 1SQTA 1XKAC 3LGYA 5F03A 5FAHA 3BEFB 4ISOA 1ACBE 2OCVB 3Q76A 4IMQA 4RKJB 3SGAE 1H9IE 2BYAX 3P70B 1V2JT 4ZKNU 1ZGVA 2TRMA 1K1IA 1ZPBA 4YLUA 3H5CB 2P3TB 5GDSH 3LH3A 2OUAA 4ZHLU 1N8OB 2QC2A 4X2XA 2B9LA 4NSYA 4ZROA 2ASUB 1OP8A 1QNJA 5C3NA 3ZV9A 1P02A 1W12U 2A4QA 3A88A 2BDBA 4AYVB 1UTPA 2BD2A 1TNIA 3A86A 3V7TA 5A0AE 1TA6A 4CR5A 1JMOH 1ESAA 3SU2A 4E7NA 1HAXB 1Z7KA 4AFZA 5HGGA 4IN2A 2EI6A 2DE8A 1S6FA 2AGEX 1C5UA 2Z9IA 4RKOB 2VH6A 1LHDH 1BTPA 1KDQB 2UWOA 2FLRH 4B2BA 1NRNH 2BTCE 3SV7A 3S7HB 3TGKE 2ZFQH 4D76A 1UCYH 1S82A 2BY9X 2FOHA 1BQYA 1NRSH 3BTDE 9ESTA 3E8LA 3D49H 2WINI 1GWAA 3M7TA 4YOGA 1TOCB 2J9NA 1LHGH 1GL0E 2AMQA 1LPKB 2BDIA 2VVUA 1W8BH 5F8XA 1WYKA 2A2QH 5GPIB 2R2WU 2DE9A 4XBDA 4NZLA 1OWDA 1PPFE 2G5VA 1QRWA 1QURH 3FFGA 3A87A 1QL7A 2BX3A 7LPRA 2BMGB 2NU1E 1SMFE 4IC5A 2GKVE 2Z9JA 3E16B 1W7GH 5BRRE 1N1LA 2EI8A 1T8OA 1F0SA 1C5NH 2FIRH 3PO1C 3F9HA 2PGBB 2O9QA 2ZU4A 2GCHF 3EA8A 5E0JA 3P92A 2XWAA 1QFKH 4ISLA 3IG6B 2BD7A 3R0FA 1A3BH 1CQQA 1SR5C 2AMPA 1TPOA 1EQ9A 1NY22 3QX5H 1KTSB 3KNXA 1SGRE 1AIXH 1BCUH 1O31A 1DWCH 1WTGH 1UTNA 1O2QA 2Z9KA 4E06H 1P01A 1SGNE 3RMOH 5E2PA 2V0BA 3NXPA 3CENA 3SJ8A 1C9PA 2BY7X 4B73A 1C5VA 2J95A 4I8GA 2J94A 3SJIA 1K1NA 3QO6A 4MVNA 4UD9H 3NCLA 2V35A 1Y5AT 1PPHE 1BBRH 2GDEH 5DP7A 4K3JA 3HGNA 4KELA 3SW2B 3P95A 2GV6A 2ZCHP 1TBRH 3ZVEA 3LPRA 1O39A 2H5DA 1PPCE 3BIUH 4UFGH 1A5HA 5JB9S 5A8XA 1F5RA 2P8OC 2HNTF 1NFXA 2XYAA 4BAKB 1GCTC 1YPKH 3BEUA 3ZVGA 1RFNA 1IQJA 1C2EA 2GZ7A 4ZKRU 1BTZA 4MG3A 1HV7A 2A4RA 1HXFH 1G3CA 3PM3A 4JYVH 3FP7E 5J4SA 1W10U 1QA0A 1V2VT 2FOEA 3MO3A 4KTCA 2P94A 4WY3A 3S7KB 3SNDA 2OP9A 3SQEE 1FAXA 1KIGH 2C8ZB 2O8UA 9LPRA 2PSXA 1KSNA 1W0YH 1L1GA 4UDWH 4K1EA 3SUFA 4MDSA 3MO6A 3MFJA 5FBIA 2UWPA 3TH2H 3KIDU 5SGAE 1NU9A 3SZNA 1SBWA 1GHYH 3KCGH 1C2GA 1GJDB 1RTLA 3A89A 2ZF0H 3E3TA 4XE4A 1L4DA 1A5IA 1EJNA 1V2QT 2ANKH 4GPGA 3MO9A 1HB0B 1BRUP 1KXFA 1SLUB 2NU4E 2RG3A 2A7JA 3GOVB 3SJ9A 3M36A 4BAHB 1IQEA 1P9UA 3SU3A 1GBLA 2AS9A 4JK5A 1O2HA 2QF3A 3E90B 1AVWA 2Y82A 4WMDA 2GMTC 1F0UA 1KLJH 1DY8A 1WTHD 4XSKU 5GIBA 1O3HA 3MU1A 4GHQA 1ELCA 1MTWA 2FEQH 3LIWA 3L6PA 1UVOA 4WH6A 1P2OA 1GI8B 1XVMA 2B7DH 5K7RA 3GY7A 5LPRA 1JWTA 1DUEA 2W3IA 2FTLE 4I31A 1B5GH 3C27B 4Q2KA 1MMJN 1HAOH 1E35B 1H8IH 3LT3A 1DVAH 1QCPA 4AB9A 1ZRBA 3SU4A 3Q00A 5EGMA 4OS2A 1ZJDA 3DUXH 4JYUH 2VVVA 3RXGA 1O37A 1S81A 3ATLA 2OC0A 3SGBE 4I8LA 2Z3CA 3VXEH 3K2UA 5EQSA 2XW9A 2FTMA 2WUBA 5JBAS 4JZFH 1A46H 2GV7A 4XBCA 5DJ7A 1ETRH 2ZECA 3PLKA 3PMAB 4X6PA 5C1YA 1A1RA 3A7XA 1XUJA 1GGDB 1MTSA 1OS8A 1KXAA 2GT8A 2GTBA 2GVFA 1NESE 1BIOA 3DA9B 3VFEA 4PROA 1DS2E 2ZZUH 1V2RT 1YGCH 3AW1A 3GCOA 1LVYA 1SGPE 1GI0A 1TRNA 1V6DA 2UUFB 5F6MA 2W26A 4CH2B 1GJ9B 1FAKH 1V2TT 3SU6A 1FV9A 2F83A 3U69H 1EB2A 1EUFA 1Y3VA 1YPEH 3SGQE 3SI3H 3M35A 2BOHB 2ZTZA 3RP2A 3S9CA 2ZDKA 2JH0D 3LU9B 4B74A 3KQDA 2Z6BD 4IN1A 3LGWA 4HZHA 1O3FA 1YPLH 2BDCA 1Q2WA 2BQ7B 4MPWA 3RXPA 1AKSB 3TK6A 1TGNA 1OYTH 1DSUA 2IOTA 3M5MA 3UR9A 4NA9H 2YOLA 4YM9A 1W0ZU 1DLEA 2ZTXA 4NFEA 1ABIH 4QT8C 4LK4A 1CA8B 5A0CA 1NPMA 4CRAA 2ZDMA 3TNSA 3G01A 4WWYA 3TJNA 1EATA 1CT2E 2PTNA 1AZ8A 3K9XB 1XXDA 3K65B 3ZYDA 4IMZA 5IDKA 3TJVA 2XNIA 3ZZ3A 4ZAEA 1GI4A 2ZHEH 2GT7A 1CO7E 1RIWB 2FOCA 1C2FA 3SBKA 5B6OA 1AD8H 2P59A 1P2JA 1SI5H 4AFSA 3SO3A 2QXGA 1MZDA 1G3EA 1O3LA 1O2ZA 3H7OA 3U9AH 1LDTT 4HFPB 2FODA 1C2DA 1O36A 4ZH8A 3ZZCA 2ZI2H 3SQHE 1WOFA 2PSYA 2BD4A 4H42U 2JETC 1C1SA 1W2KH 4MQAA 3E0PB 3GCHB 2BZAA 3F1SB 4A1VA 3QZRA 1P10A 3SI4H 1IQLA 2A4GA 1HXEH 2F9NA 1OOKB 3MU0A 2Y7ZA 4KKDA 4CBNA 5CMXH 2ZO3H 1P2NA 3A80A 1AO5A 1QBOA 3DFJA 3ZZ6A 2QXHA 1SQAA 3BG8A 1MH0A 2XBYA 2ZFRH 2R0LA 1MKXK 2BLVA 4NIVA 1O3EA 2ZCKP 1IAUA 1DT2A 1UMAH 2ULLA 2W7SA 3Q77A 1J8AA 3U1IB 3I29A 3RXEA 3S0NA 3QZQA 2JKHA 5EQRA 4ABIA 1CHOG 1DX5M 1KLTA 1GI9B 2A5KA 1G2MA 3RMMH 1O2RA 3BN9A 1HJ9A 1MAYA 1TGSZ 1EXFA 2FESH 4HTCH 3U8RH 1F0TA 1O2KA 2PV9B 5AFZH 1QGFA 4H6TA 5TJXA 5I46H 1AVGH 3RXUA 1O34A 2VIOA 3RXHA 2KAIA 5E0HA 1G36A 4CRCA 1C5ZB 4DT7B 1UJ1A 2A7HA 3T29A 3MH4A 3ZZ9A 1GDNA 1O2MA 2TBSA 2ZG0H 1FMGA 1TMBH 1PJPA 2ANYA 4D8NA 1BBRE 2XRCA 3SNEA 8ESTE 1P2QA 1SPJA 3UQVA 1CT4E 1TQ7B 1NRRH 2FI5E 3JZ1B 4CHAB 2CJIA 3S69A 1X7AC 3STIA 1AWFH 4NIYA 3RC6A 4MTBA 3SORA 4UFEH 3UWIA 3FP8E 3LKWA 2HPQH 2ZHDA 1K1OA 1AKSA 1NO9H 3EYDA 2GCTC 3HATH 2QGRA 1ZHMA 1CBWC 2ALPA 1QB6A 2BHGA 2FPZA 2OC1A 3BTTE 4CREA 1RTFB 8KME2 1AUJA 5T3HA 4JZ1A 3PWCA 2H2ZA 1ZSKA 4X2VA 4YT7H 5A0BA 1NS3A 1GJ5H 2OD3B 2ZGXH 2OQ5A 2WV4A 1PQ5A 2V3OH 1Z71A 3O8CA 3B8JA 5C1UA 1UCYK 3EDXB 5FBEA 5FPSA 1O2OA 1B0FA 1D4PB 3GY2A 2SGEE 1F5LA 4GUXA 1ZRKA 1LTOA 2QXIA 1AE5A 1Z8RA 1T31A 2PTCE 3M3TA 4WXVA 1CHGA 2BQWB 3RMLH 3PB1E 3URDA 3RLYH 4XDEA 2VWNA 1HAVB 1OXGA 3RU4T 1GHVH 1G3BA 4CRDA 3MI4A 2XXLA 3PLBA 5JBCS 4AGJA 3HGPA 1GJBB 1V2OT 2OC7A 3L3TA 3MTYA 3BTEE 1UVSH 1BRCE 4ABFA 3TJUA 4YO9A 1YYY1 1YM0A 2BM2A 4MNWA 5GWZA 1GI7B 3MYWA 3ZZ8A 4INHA 2ANWA 2Z3DA 2A45B 1UK3A 2TGTA 3MH5A 2IJOB 3LDXH 3LONA 5HMAA 2EA3A 1E38B 2AH4X 1QB9A 1EOLA 1GBJA 1OWEA 1MTVA 1SGEE 1SGYE 2Z94A 1K2I1 2CHAC 3TJOA 3QWCH 2CHAB 4ABGA 1A2CH 3M7QA 3QK1A 1L2EA 2NU3E 3EE0B 1Z6EA 5F8ZA 3MMGA 1C5PA 3OY5U 3GY6A 1BRBE 4FUEA 1BTYA 1T4UH 1NTPA 1W7XH 2Y81A 1UK2A 1HAPH 5LGOA 1P09A 2ZDNA 5DP4A 2THFB 1N8OC 2XBVA 3RXBA 1C1NA 1GBAA 1TRYA 2UUKB 1GJ4H 5IYTA 6ESTA 1XUFA 1GVKB 4U2WA 1O3GA 4NGAH 3MU5A 1AU8A 5AHGH 4A6LA 4UONA 2VINA 1F92A 2VB0A 3A7YA 2G4TA 4A1XA 2XBXA 4X8SH 3ZZAA 2QCYA 1DWEH 3P8GA 4UFDH 1C1OA 3QGJA 1CGIE 5GCHG 4Y6DA 4SGAE 5EXMA 2SNWA 4K5ZA 1Z8JB 4FUCA 1A0HB 1SSXA 1GMDG 5E0GA 1TX8A 2G81E 2ZPSA 4JK6A 1OWHA 1QHRB 2BDYA 2GP9B 3MNBA 1OP0A 4NG9H 3C1KA 4AORA 1YPJH 4DCDA 3JZ2B 3Q3KA 1C1PA 1V2LT 1CSOE 1A61H 3TGIE 3RXSA 2GCHG 2FOMB 2BVXH 2Z9LA 1A0JA 1ESBA 4TYDA 2BD3A 4ABDA 1TPAE 1YP9A 3UY9A 1C1VH 1QRXA 1YCPK 2XTTB 3A81A 1QY6A 4OS6A 1OKXA 1RD3B 4INLA 1G2LA 1ID5H 1L1NA 1OP2A 1LVBA 2QF0A 3PMJA 1EB1H 1EAWA 4BAQB 4AG2A 1YPHC 1IQIA 1GBCA 1ARCA 1IQHA 3UWJH 4CHAC 3TK9A 2QN5T 2VIPA 2G51A 1C5MD 4X2WA 1XKBC 3EGKH 1UTMA 1GI1A 1MKWH 3V3MA 1DUAA 2BX4A 3SHAH 5DKMA 2PKAA 1HDTH 1KLIH 2F91A 3O8RA 1SGFG 5FPYA 1EZSC 3S9AA 1DICA 8GCHF 1XUIA 4NIXA 3DFLA 2QY0B 1YC0A 1VITG 1GI3A 1EJAA 5L2YH 2ZTYA 1YPGH 1XMNB 1TX6A 1ELDE 1GI2A 4JCNA 3KHVA 1LMWB 1FNIA 2O8TA 2SGAA 3KN2A 1H1BA 3QLPH 1TNHA 4IW4E 3TITA 1C2HA 3LGVA 3R3GB 1UO6A 1V3XA 4ZXYH 2GCTB 3WY8A 1NC6A 3SUGA 1B7XB 2AEIH 1EAXA 1OWJA 2FOGA 1A0LA 3MNXA 5BPEA 2IN2A 1O3DA 3MH7A 3K6YA 3LGUA 1P06A 1NFWA 2G52A 1DXPA 3ZYEA 1D6RA 3RC4A 3O8BA 4AFQA 3TK5A 4LZ1H 3SJKA 4IC6A 6GCHG 4K8BA 2FX6A 1K1PA 2IPHA 1TGBA 1PPBH 4NA7A 2CMYA 3U8TH 2YNAA 1ZHRA 4HI3A 1RXPA 1VCQA 2TGPZ 3BTFE 1V2NT 1MU6B 1C5WB 1SGDE 1BJUA 4JZIA 1BDAA 1DXWA 2ILNA 3ZVDA 4I32A 3GCTG 1ZMNA 1O2NA 4FVDA 2QA9E 4U30A 2OBQA 1OSSA 1KY9A 1TNLA 2R2MB 4Y76A 2TGDA 2ALVA 1O2YA 4TPYA 2ZFFH 2EEKA 1YBWA 3SUDA 3PV4A 1C1WH 1UVPA 1CBWB 2QIQA 2D1JA 1QJ7B 3ELAH 1EZUC 5E2OA 3VB5A 4VGCB 4WMFA 2ZCLP 1ZPCA 1TIOA 2HRVA 2V3HH 1YCPH 3D23A 1THSH 1Z1IA 3KQCA 2ZFTA 3MOCA 1VITH 4ISHH 3GYMA 1H9LB 2CN0H 2BY5X 3OTJE 2FS9A 1SQOA 2EC9H 2H9HA 4X1RU 2OBOA 4BXSA 1GJ6A 3I78A 3TPIZ 4ABEA 5HXFA 2J34A 2FI3E 2ZU5A 2A4OA 1GBEA 3BTKE 2LNCA 5FCKA 3UOUA 2QYIA 3UFAA 4I33A 3H7TA 1LVMA 1Y5BT 1CGHA 3GDSA 5C5NA 6LPRA 1FDPA 4GAWA 1ZTJA 1C9TA 2GZ9A 1CA0C 1ZMJA 2I6QA 3ZZ4A 3KF2A 1G37A 1O3BA 2Q1JA 1DM4B 3RXLA 1TA2A 5DGJA 2WPHS 4FUIA 1GMCG 4B2AA 2ESTE 3V12A 1P3CA 2BOKA 1XUKA 1ABJH 2BD8A 2FXRA 1LHCH 1ETSH