1O3EA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3eA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3eA02
1P8VC 1Z71A 2ZF0H 2PV9B 1C1OA 1LKBA 2CN0H 1W7GH 3QUMP 3BSQA 1V2VT 5FAHA 2BY7X 1UVOA 4HI3A 1C5LH 3B9FH 3F68H 4WMEA 8GCHF 4B2CA 2JH6D 3NCLA 1DX5M 1P2KA 3E0PB 1H1BA 1S84A 1HAIH 3SV8A 1G3DA 1LHCH 1MAXA 4LXBH 1T32A 4NSYA 3GCOA 1EAWA 3RMOH 5B6OA 3HPTB 2Z9LA 1ESBA 5FHTA 1O5FH 1FONA 1O2NA 1HAHH 4YOGA 2VH0A 3T5FH 2BD3A 2QF0A 2C8YB 4X6NA 1TMBH 3S7KB 4B76A 2VIVA 2QXIA 1O2LA 2AFQB 3RC6A 1OWDA 4AFQA 1TX8A 1PQ8A 1CT2E 1K1MA 3UUZA 1EJMA 2BZ6H 3RM2H 4AGJA 1LPGB 3PM3A 3DA9B 1PQAA 1C1PA 4XOJA 5DP3A 4BNRA 5LPFA 1DVAH 5GDSH 5HM9A 1C2GA 2OC7A 1B5GH 5JYIA 1ELGA 4O97A 1RIWB 3A8CA 5DP4A 1BTWA 3A7TA 1UTJA 2WPIS 2ALPA 2FOAA 3LGTA 1V2OT 5EODA 2PHBA 1LPZB 1BZXE 1IQEA 1BMAA 2XWBI 3ZZ4A 4FU8A 5AF9H 2Z9IA 3RUOA 2ZC9H 4CRDA 1P09A 1W14U 1TMTH 1D3TB 1V2ST 3MH7A 5AVDA 2QF3A 1PPBH 1YYY1 4NA9H 1GJ4H 3L6PA 1EZXC 2FYQA 4CH2B 5F6MA 1GI1A 2VIDA 1OWJA 2SGAA 4GPGA 2AS9A 1RJXB 1HLTH 1GI7B 4ZKNU 1RIWC 1KDQB 3EYDA 1ZSKA 4X6PA 3K2UA 3K65B 3TH3H 2KAIB 2XWAA 1K1PA 1V2PT 1S6HA 3RXLA 4HZHA 4GVUA 4FUGA 1BHXB 1GCDA 4NGAH 1C5YB 2VIPA 3QK1A 1ETRH 3RDZA 2G4UA 3SN8A 4X6OA 1PQ5A 1VITG 2ZO3H 3L33A 4XBCA 1AKSA 4Q80A 1HDTH 1KXBA 1OP8A 5IDKA 1Z7KA 1V3XA 4YOIA 3LDXH 2TGDA 2ALVA 3CS7A 2ZDKA 3F9HA 1HAVB 2V6NA 1O3PB 1TAWA 2Z3CA 4AX9H 4BAQB 4MLFB 1PPCE 5JB9S 2GZ8A 1QR3E 1GHWH 3MO6A 3EAJA 1SGPE 9LPRA 4INHA 4UFEH 1T8LA 4YLUA 3ZYEA 2CGAA 5T3HA 1FAKH 4ABFA 2XYAA 4WF8A 3BG4B 2BB4A 1QTFA 4FUIA 3URCA 1ZYOA 1L4DA 3LC5A 3MOCA 4FUBA 1LQDB 2FESH 1O37A 1EOJA 1VCPA 2QY0B 3SJ9A 3M35A 3GY2A 1YKTA 3NKKA 1QL8A 2OUAA 2CF8H 3TU7H 3BTQE 1KIGH 3GICB 2F9BH 1LHDH 2OQ5A 4MNYA 1IQLA 4UEHH 4ZXXH 3BTFE 1JWTA 1XUKA 3PMAB 3SV2H 4X1RU 1H9HE 4FUFA 1J15A 2FI4E 4A1TA 4JK5A 3BG4C 1TPOA 3P6ZB 3ELAH 3O8DA 1GJ6A 3MNBA 1FPCH 3W94A 4NA7A 1A61H 1BMLA 2ZQ1A 3EDXB 4GHQA 1TA6A 1NPMA 2B7DH 1GL0E 4LK4A 4WMDA 1MAYA 3WY8A 3T25A 4X8UH 1D6RA 1SLWB 1GHYH 4F4OC 2HPQH 3CS0A 4FUDA 1EZSC 2B8OH 2FOMB 1AO5A 1MUEB 4UDWH 4XE4A 1GBLA 1D6WA 5L2ZH 2FYRA 4Y7AA 5EQRA 2FZZA 1BJUA 1SSXA 4K2YA 4FXGH 1BBRK 1KTTB 2XBVA 7GCHG 2CJIA 3Q77A 1C5PA 2G5NA 3TVJB 1ZR0A 2BVSH 4I33A 1HAOH 5JBTA 4NZQA 1O3DA 2O8WA 2FXRA 4NIWA 1BIOA 1BA8B 3ZZ3A 1OWEA 3ATMA 5FCRA 4LOYH 4U32A 2AIQA 3S7HB 1QRZA 3QX5H 1ELDE 1DWBH 4FUEA 2FX6A 1C5VA 5LH8A 1H4WA 1EATA 1TNIA 1GHVH 1EQ9A 1K1JA 3MH4A 4ZUHA 3QDZB 1Z1IA 1LHEH 2Y5GA 2EC9H 3U69H 3ITIA 1CE5A 2PTNA 4VGCB 3V3MA 4B71A 3BIUH 3ZVEA 1N6XA 4ABEA 4NCYA 5FBIA 1NN6A 1S6FA 1GJBB 1U6QA 4YOJA 4NIXA 1Y59T 2ZU2A 3SHCH 2STBE 1C2EA 2XC5A 1ETSH 1EOLA 3GDUA 2BLVA 4OS6A 1TA2A 2QC2A 3U9AH 2BD2A 1UVPA 1PPEE 3MI4A 3E90B 2FTMA 4X1SU 1TABE 3HGPA 1AFEH 1YPLH 3O8RA 2A4QA 1GJCB 1PFXC 1YCPM 3M5NA 2G8TA 5DP6A 3FFGA 3NPSA 4VGCC 2IOTA 1NZQH 1VGCB 4CRGA 2NU1E 2BOKA 1GMCG 1AKSB 1NS3A 2H9HA 3R3GB 3RXFA 1P2QA 3SU2A 1CT4E 1SBWA 3V0XA 2JKHA 4IC6A 1IAUA 1VJ9U 1JOUB 2XTTB 1TPAE 2H2ZA 1FUJA 2J9NA 2G51A 2ODYB 3S9AA 5EPNA 4ABHA 1IQNA 3A7VA 1O3OA 5FCKA 1BRCE 1QA7A 5L6NH 1AUJA 2ZFSA 2DE8A 1JRTA 2GT7A 3PV4A 2WUCA 1P03A 1UK2A 1O2GH 6GCHG 4UE7H 1FDPA 4A1XA 2FOGA 3SNDA 2VWMA 1TMUH 3QGNB 2O8TA 1GPZA 4IN2A 3EA9A 2ULLA 1BBRH 5T6FA 3EQ0H 4UD9H 1BRAA 4MG3A 1FQ3A 1SFQB 1O32A 3N7OA 2BLOA 2CXVA 5CMXH 1TNLA 2O8MA 1UCYK 2HGTH 5LPEA 4FUCA 4Q7YA 2B9LA 1LQEA 3PB1E 4E7NA 2TRMA 2SNWA 2Y7XA 1XXDA 1K21H 3SNAA 4K60A 2ZU1A 4BANB 4CRAA 1G32B 1ZRKA 4U2WA 3MTYA 1Y3VA 2W7UA 1G30B 3TGKE 1O2QA 4UONA 1GWAA 2EEKA 1YLDA 5DP9A 4J1YA 1ZSJA 1HCGA 2D2DA 1DICA 2ZPRA 2R9PA 2BDYA 2XCNA 3FVFB 1SGDE 2ZFRH 1EKBB 1PPFE 5EG4A 5JBBS 1G3EA 2PR3A 4H6TA 1G3CA 3QZQA 5TJXA 5A2MH 1PYTC 1UHBB 2BMGB 1BTUA 1P9SA 2THFB 5SGAE 5C67A 3GY8A 1MU8B 3SQHE 2FOHA 4XFQA 1SFIA 1AVWA 4JYTA 3T29A 4I8HA 3F6UH 4YLQH 1Y5AT 1G9IE 1ZTLA 3A8AA 3E6PH 4X8VH 4ZKOU 1Y3WA 2ZNKH 4WJG2 1MU6B 4ZKSU 1FY3A 2UUJB 2ODPA 2FOFA 2SGEE 3SNCA 4D7GA 1Q31A 1EP6A 1RGQA 1FIZA 2WPMS 1O3NA 4BTIB 1CSOE 2CMYA 1A46H 1IQKA 4IC5A 1QB1A 2BVXH 3MU8A 1Z8IB 2XNIA 3P8GA 1N6YA 3UREA 4INLA 2A5KA 1WYKA 2ZHQH 6CHAC 4JMYA 1P02A 4BTTB 4K8YA 2NU4E 1P2IA 3GDSA 4BTUB 2UUKB 4E05H 1SR5C 2BLWA 3RU4E 1O35A 5E2PA 1C5ZB 3M3VA 2ZPQA 3LGWA 1GBEA 1O2JA 1GBTA 1L1JA 3PYHA 1UMAH 2WINI 4NWKA 3OY6U 1UTOA 3ZV8A 3ZZBA 1F5KU 3T26A 1E34B 4ABGA 1TGBA 2Y82A 1KXAA 4JZ1A 5A8YA 3LJOA 1GGDB 1UCYH 3B8JA 1SGEE 5FPYA 1CGIE 1NO9H 1SGQE 5FPSA 1YLCA 2PSXA 1C5RA 2A32A 2EA3A 1FZZA 2VVUA 3ATIA 3U98H 3RLWH 4KELA 1UO6A 1KXDA 2PWXA 1TPPA 1BTHH 1J16A 1A5GH 1AI8H 3VFEA 3PO1B 1ESAA 1SLVB 3KIDU 3Q76A 2FP7B 1IQMA 3UFAA 5EQQA 2BLQA 1QBVH 1A3EH 1AY6H 4HGCA 4ZHAA 1ACBE 2ZHEH 4F49A 1D9IA 3H5CB 1F2SE 4X8SH 1OP2A 4XDEA 1GGDC 2ZA5A 4FU9A 4OGXA 1OYQA 1YBWA 4DURA 3ATLA 1BTXA 2ZG0H 1HJAB 1KXCA 1QB6A 3KNXA 1WU1A 3A83A 2J92A 1VITF 4DCDA 1WUNH 1A1RA 2A45B 1OOKB 3I77A 4ZAEA 1CO7E 1F0UA 4MDSA 1SOTA 1VR1H 4ZHMU 1ETTH 2XC0A 2AMQA 2QAAA 2GX4A 1FN8A 3KN2A 3A8BA 4AORA 2XBYA 3PO1C 3GYLB 3GY5A 3VB7A 1O2YA 1SOZA 3UPEA 4MNXA 5HMAA 1LMWB 1DWDH 3ZZAA 4GUXA 2G5VA 4ABBA 3MHWU 1E0FD 4MNVA 1C2LA 4K3JA 4YO9A 4X8TH 1V2UT 1NM6A 2BX3A 1TBRH 5A0CA 1SGCA 2A4GA 2ZDVH 3SW2B 1QBNA 1HJAC 3TGJE 1C2KA 2J94A 1AHTH 1AQ7A 4DGJA 2J34A 3EE0B 1HRTH 1GHXH 5K0HA 2PW8H 3M3TA 1AZZA 1ELVA 3MWIU 3PWCA 1BDAA 3OU0A 4AFUA 1D3QB 4DIIH 4MPWA 1YPHE 2FODA 3UY9A 1EAXA 1F5LA 1SI5H 2JETB 7KMEH 4X2XA 1MD8A 1K2I1 1IOEA 1GHAG 2VNTA 3P95A 1AIXH 1O5BB 1LHFH 1LVYA 2FS9A 4SGAE 4AGKA 2A7CA 3VXEH 1J17T 1ANDA 2AMPA 1WBGB 2VINA 4ABIA 4Y79A 3UOUA 1IQGA 3M5MA 2H5DA 4K1EA 1C5NH 1A2CH 1WAYB 1KY9A 4Y76A 2O9QA 4B2BA 3TPIZ 1DPOA 3UWIA 2BXTH 1FAXA 2ANMH 1QA0A 2JETC 3ZZDA 1TNHA 1XVMA 2H9EH 8ESTE 1PPHE 1LVOA 4JZIA 1ZJKA 3T2NA 3BTWE 4IMZA 3GCTG 4UFFH 3VGCB 1C5SA 4Y0YE 2F9PA 2WYGA 1W8BH 1ARBA 1QL7A 3RXIA 4A7IB 3VEQB 1HBTH 2ZDNA 1UTMA 2A5AA 1GBKA 3U8TH 1T31A 1C1NA 4THNH 3FP7E 2K1QA 1PJPA 2FLBH 2ZDAH 1FY1A 7GCHF 4D7FA 3RXAA 1GBHA 1XUFA 1BHXF 1GMDF 4CHAB 1UTKA 2J2UA 3IWMA 5F8TA 3ZV9A 1SC8U 2P3TB 1BBRE 4B75A 5AHGH 3LH1A 2V35A 3BEUA 4NIYA 3ZZ8A 4IBLH 3VGCC 1GJ7B 2GMTB 3PLPA 4Y8ZA 3TNTA 1KYNA 1O2HA 3A7ZA 1C1SA 2ZFFH 1GI0A 2ZGBH 2SGPE 2YNAA 1HNEE 1IQFA 1BMNH 3SV9A 1P2OA 1O3CA 3GY3A 3A82A 1MD7A 1EJNA 3KCGH 3KL6A 3RXBA 1L4ZA 4CHAC 1UTPA 4I8GA 1GBIA 4Z0KA 5F8ZA 6ESTA 1H8DH 2BD7A 2FIRH 4ISNA 4A5TS 1UVTH 1BRBE 1HIAA 4NFFA 1PQ7A 2GMTC 1F0RA 5TCAA 2UWOA 4GCHG 1BCUH 1XVOA 4NG9H 4UFGH 4WVPE 1ESTA 1HB0B 3QTVH 1YPGH 1HV7A 4K1SA 4RKOB 1K9OE 4ISIH 3C1KA 2LPRA 3A7XA 1C4Y2 1XUGA 3A80A 1GBFA 4FU7A 1LDTT 4KKDA 1GMCF 1CHOG 4X0WU 1PPZA 2PSYA 2AEIH 2HRVA 2ZHDA 1TLDA 2TGPZ 5EXLA 4K8BA 4B2AA 1E36B 1F0TA 4ABJA 3JZ1B 5HM2A 1UK3A 1THPB 5DKMA 4D9RA 1O30A 1AN1E 5C1YA 3SUGA 1O2KA 2ZFTA 1C2FA 2VIQA 4HTCH 5EQSA 2SGFE 3BEIB 2VWNA 1EZUC 3GYMA 4K5ZA 7LPRA 1XX9A 2PUQH 2BDBA 1QB9A 1NY22 2A4OA 1MTSA 2QXGA 5J4QA 3GY7A 1TOCB 3MYWA 3Q3YA 5T6GA 1O2MA 4JZFH 1B0FA 1SMFE 1TX6A 3S9CA 2AGIX 4OS1A 1FLEE 1XMNB 2ILNA 2TBSA 2RA3A 1EPTB 5HGGA 1ANEA 1NFUA 1MH0A 3HK3B 5AFZH 4RKJB 1QIXB 1VCQA 4LZ1H 4AB9A 1ZGIA 2A0QB 1LHGH 2ZGJA 4O03A 1GJ9B 1GDNA 1GJ5H 1M9UA 3A8DA 1QRXA 2H1UA 2AIPA 4I31A 1UCYE 1UTLM 1TQ0B 1QNJA 4IGDA 2ZFQH 1BTPA 3QN7A 4JYUH 1Z8JB 2ASUB 1O3MA 1HAYB 1WSSH 1ZTJA 2PLXA 3Q00A 1C9TA 3LGVA 1W7XH 3V13A 1O36A 1ZMLA 1DY8A 4WY3A 3RXGA 3IITA 3D62A 1BTZA 3PTBA 2G55A 1MTNB 3ZVFA 1OKXA 4X6MA 3QO6A 1EPTC 1WV7H 1ELTA 1OPHB 2D8WA 1SGFA 1GBAA 1V6DA 2ZCLP 3NXPA 1C5QA 1W0ZU 4CREA 5IYTA 1V2RT 2ZGXH 1B7XB 3FP8E 3EGKH 1LO6A 3P8OA 1QURH 1ZHMA 4MPXA 5DP7A 1S81A 1RXPA 1YP9A 1QY6A 2HNTE 1KSNA 3L3TA 2ZU3A 2ZU4A 1AE5A 5E0GA 3M7TA 1NROH 4Y11E 1P05A 1MZAA 3BG8A 1IHSH 1MTNC 1LKAA 1P06A 3AAVA 1C1TA 2ZECA 3SU6A 2R3UA 2SNVA 1XM1A 1P3EA 1GBDA 4TY7A 1TNKA 3GCNA 5TCCA 3D65E 1V2NT 5DO4H 4WH6A 5I25A 1TALA 1ZGVA 3G01A 2BDGA 1YCPK 4CH8B 2PKAA 3FZZA 1SGYE 1V2WT 3SHAH 1SHHB 1CGHA 3SOSA 1XUIA 3KQDA 3MO3A 1O5AB 2FOCA 2BM2A 1C2HA 1DY9A 1JRSA 1O3GA 2C8WB 1MCTA 2BDIA 1C5MD 1C1VH 5I46H 2F9UA 2NWNA 2VVCA 1KTSB 3GDVA 4FUJA 3SBKA 2A4RA 1GVLA 4OS2A 1P12E 2F9VA 1O0DH 2FPZA 1QJ6B 4GHTA 1THSH 1ELBA 3A88A 2BHGA 3TH4H 2WPHS 1CU1A 1DLKB 1HGTH 3RXTA 1WQSA 4Q2KA 5DGJA 2GCHG 3UNSA 5E0JA 2GZ7A 2ZU5A 1T4UH 2WPJS 1ARCA 3UNRA 1KXEA 2Z3EA 3TLOA 2BD9A 5GCHG 1CQQA 5EGMA 5GWZA 2FOEA 2UWLA 4ISLA 1SGRE 1GI3A 1SG8B 1HFDA 1O3JA 2FWWA 2EI8A 4IS5A 3EA8A 2BY6X 1AGJA 1VGCC 2HLCA 3RC5A 3UQVA 2BDHA 2Y6TA 1OS8A 1SB1H 5DK1A 4BAOB 1QCPA 1C1RA 2FS8A 4ZMAH 1W3CA 4DW2U 1T8NA 1L2EA 3F9GA 1ZTKA 4X2VA 4ABAA 3UOPA 1SQAA 5EW2H 2FEQH 2F83A 5FPTA 2ZHFH 3MNXA 3A85A 3P17H 1BMMH 1KLJH 1O2WA 2OXSA 4YT6H 4YM9A 1SGIB 2XBWA 1ABJH 2Y5FA 5DP8A 2WYJA 3PLBA 1AB9B 1CT0E 1TYNA 1GBBA 1DWCH 1S0QA 1E35B 3QTOH 1O2TA 3RXCA 3MH5A 1YPEH 4AFZA 2HOBA 3ZVDA 2BOHB 1SLUB 1KLIH 2VIOA 1YM0A 2P93A 1W12U 1O3LA 3LGUA 2A31A 3E91A 1TRMA 1GMHG 1O3BA 1O2OA 4I32A 3SQEE 2Q6GA 8KME2 1YCPH 3VB6A 3RMMH 1O2UA 2XBXA 2OQUA 3AASA 3Q3XA 5FBEA 1TGCA 2VB0A 2IJOB 2Z94A 3BF6H 4NWLA 2M5TA 2ZDLA 4WH8A 1YPHC 2RCEA 1ZLRA 1AB9C 7ESTE 1TQ7B 3SGQE 2VU8E 1FV9A 1NU9A 1O2XA 1RTLA 2PTCE 3LC3A 4OS5A 3ZZ9A 3BN9A 1UVUH 5H4IB 3RXOA 1DWEH 1L0ZA 3SU1A 2JH0D 1S85A 3ZVAA 3TJVA 1DT2A 4JYVH 1HJ8A 1AFQB 4ISHH 3ZYDA 2CV3A 3FANA 5GPIB 1C5UA 4CRBA 1ZHPA 2ZWLH 4AYVB 2BD4A 1O3EA 2A1DB 5F03A 1EXFA 2GV7A 4IMQA 1ZMJA 1P2MA 3A7YA 1TX7A 1TRNA 3GCTF 3SU3A 1CA0B 1CHGA 1PYTD 5CHAB 3KGPA 2OC0A 1MMJN 3LT3A 3SJIA 1ZZZA 3O8BA 3ZZCA 2ODQA 3PROA 3UWJH 3KEEA 3TJNA 2ZPSA 3ZZ7A 2IN2A 4DVAU 1ZOMA 1HXFH 1EB2A 2OC8A 2ZP0H 3A89A 1AFQC 5K7RA 4NZLA 2ZDMA 1BUIA 5GXPA 1WOFA 1AVGH 1UTQA 4AYYB 1OWHA 1BOQA 2OTVA 5EXMA 2ZGHA 4X2YA 3M7QA 5T6DA 2P94A 3LIWA 1YGCH 2FI5E 2QIQA 1QRWA 1YPMH 2VVVA 1ORFA 1CA0C 1C2IA 4TPIZ 3SJOA 3UIRA 5PTPA 1O2ZA 4Y8XA 1VITH 4MVNA 1TNJA 4K69A 5EW1H 4RN6A 1T4VH 5HYOA 4E7RG 1HXEH 1JXPA 2PKSB 2H5CA 3ATWA 2FMJA 1BJVA 3PWBA 3SUDA 4MPUA 3T27A 1CGJE 3UR6A 1Y5BT 1YPKH 1DS2E 4O3TA 5C5OA 1YF4A 2Y7ZA 1GVKB 1KDQA 5JBCS 1O31A 2QXHA 1SQOA 4DIHH 1AD8H 1DUEA 3TK6A 2CHAB 3K6ZA 3LH3A 1G36A 1K1IA 3BTHE 5ESTE 4X2WA 1DXPA 1A0HB 1DANH 4NA8A 3RLYH 3NK8A 5DP5A 1Q2WA 3LU9B 2ZI2H 1ZPCA 4MNWA 2V3HH 4Z6AH 1P11E 4LZ4B 3O8CA 2TPIZ 2H9TH 1C5WB 1K22H 2PKSC 1MKWK 3OYPA 1Z8GA 1E38B 2NU2E 2PFEA 1NT1A 1OX1A 2A7HA 4H42U 1GBCA 5JDUB 1FJSA 2BVRH 1EUFA 4D8NA 4UFDH 2RG3A 1ELCA 3VXFH 4B1TA 3M5OA 1TGTA 2C93B 1Z1JA 5J4SA 1A0LA 4BAHB 5A0BA 1QGFA 2CHAC 1ELEE 3D23A 2FX4A 4E06H 2TIOA 1GCTB 1WTHD 3MO9A 1RTKA 5FX5A 1TBZH 1O2RA 3BTDE 3A81A 2STAE 3U1JB 4BXSA 1NRPH 2BD8A 2QYIA 1XXFA 3ODDA 3MNSA 1J8AA 1YPJH 3SU0A 1IQHA 3KQEA 3LPRA 3HK6B 2OD3B 3SNBA 1BT7A 3AVZA 4BAMB 1QQUA 3HKIB 4A92A 4JZEH 1G37A 1T8OA 2C8XB 3T28A 1DITH 2FDAA 2IPHA 1GCTC 1GI9B 1VJAU 3RXSA 3LGYA 1G2LA 3STIA 2BXUH 2TGTA 2ZKSA 2P3UB 3M3SA 5C3NA 1XKBC 2D1JA 3URDA 3S0NA 1LPKB 2GZ9A 4GAWA 4CR5A 1Z6EA 2ZZUH 1X7AC 4A1VA 5ABWA 2BY5X 3NZIA 2GD4B 4KTCA 1QHRB 1K1LA 1H9LB 3SGAE 1GI6A 2P95A 3OSYA 1WQVH 1RRKA 2YOLA 3FAOA 1P04A 1GG6B 2Z6BD 1F5RA 5A8XA 2W3IA 1G3BA 3A87A 3AW1A 5AFYH 1ZMNA 2ZGCA 2ZTYA 4NFEA 2F3CE 4Y8YA 1A5HA 2CF9H 3BTEE 4JK6A 1D3PB 1JIMA 2Z7FE 2F91A 2RDLA 2Z9GA 1QL9A 1XKAC 3KHVA 3P8FA 1HAPH 2PGQB 2I6QA 2W5EA 2QXJA 1A3BH 2FTLE 3RC4A 5C1UA 1XUJA 2GGVB 1DSTA 1TWXB 2UUFB 1MKWH 4INKA 1O3KA 4KP0A 3CENA 1TGNA 1RFNA 1S5SA 1GG6C 1KXFA 3GOVB 3M61U 4AZ2B 2Z9JA 3SGBE 1DDJA 1HUTH 3V7TA 4GSOA 6LPRA 2HNTC 1SVPA 1MBMA 3SU4A 1NRQH 5JB8S 1GI5A 4TPYA 1XUHA 1NC6A 2PUXB 1O3HA 1THRH 4AG2A 1J9CH 1GL1A 4R0IA 2FLRH 2Q6FA 3BTKE 2HVXA 1PPGE 2ZHWH 2Y80A 1ANCA 1GI2A 2QCYA 1P10A 1SPJA 1N8OB 3RXMA 1IQJA 2J38A 1DXWA 4TY6A 1ZJDA 3U8RH 1NRNH 3OX7U 1C4V2 1QQ4A 2FI3E 3SNEA 2QGRA 3E3TA 2P59A 1MQ5A 2VJ1A 1GDUA 1P9UA 1O3FA 5BPEA 4WWYA 1P01A 4IN1A 5DPAA 2VWLA 5FX6A 5LGOA 2OLGA 2V0BA 1H8IH 1AWHB 1O34A 1NU7B 1YC0A 5ESBA 4YZUA 2NU0E 1GBJA 2ZCHP 4OS4A 1N8OC 1A7SA 1HAZB 1O2VA 4YTAA 2GCHF 3SV6A 2O8UA 2BQ6B 4ZXYH 1L1GA 1LVMA 2UUYA 5FXLA 3RMLH 3RMNH 5C2ZA 1D3DB 2H6MA 5GCHF 4CR9A 4TYDA 2W3KA 1ABIH 1O5EH 3MU1A 1V2QT 2EI6A 5C20A 3ZZ5A 2P8OB 1AUTC 4JCNA 2VGCB 1LCYA 3NUMA 4HFPB 1S82A 3AW0A 1ID5H 6GCHF 3SUFA 4I7YH 3DHKH 1TOMH 4JZDH 3HATH 2QN5T 2F9OA 4CRCA 1W0YH 1ELAA 1TB6H 2XRCA 3TJUA 1WTGH 2I6SA 1SQTA 4DT7B 1GHBG 2EI7A 3RXQA 1LVBA 3RP2A 5E2OA 3A86A 3A7WA 3LGIA 1EAIA 1L1NA 2A5IA 4IW4E 4U01A 2ZCKP 1GI4A 5EPYA 1ZPBA 3RXDA 2P8OC 1F92A 1TBQH 2VGCC 3BIVH 3DFJA 2G4TA 3KF2A 3GCHB 2JH5D 3M36A 1F7ZA 4Q7XA 2LNCA 2BY8X 3PMJA 3E16B 3U1IB 1C2JA 1EZQA 1O38A 3E8LA 4DJZB 2ESTE 3PMHB 8GCHG 4AOQA 1FY4A 1GBMA 3I29A 4B74A 2WV5A 4YT7H 3SI4H 1W10U 4KTUA 1CVWH 1Y3UA 1V2MT 3SJKA 3U8OH 4MTBA 1Q3XA 1GMHF 2ANWA 1T8MA 1RTFB 1OSSA 2SGDE 3OTJE 3UTUH 2AH4X 5E0HA 2R2WU 1V2LT 1SLXB 1UHBA 1P57B 2DUCA 1CA8B 3GCHC 1WCZA 5JPMH 5DG6A 4Y71A 3GY6A 1C1UH 2Y81A 3ESTA 4ESTE 1HAGE 1Y3YA 2ZTXA 4Y0ZE 3OY5U 3KQCA 4OS7A 2B5TB 4DOQA 1QJ1B 2GTBA 4WXIA 3SU5A 2Z3DA 2ZFPH 3LJJA 4ZH8A 1NFWA 4QT8C 1P3CA 2FO9A 1SHYA 1V2TT 3M37A 1GMDG 1FXYA 2C4FH 4ZKRU 3M7UA 5L2YH 3ZZ6A 1BB0B 3EA7A 3E1XB 4FVDA 4TWYA 2C90B 1MKXK 3PTNA 4ABDA 3SZNA 3P70B 1K1OA 3F1SB 1BQYA 1DSUA 2A2XH 3GY4A 4Y10E 5HXFA 4FVBA 2R3YA 2BX4A 2ZIQH 5EU8A 4CBNA 2ZTZA 3TJOA 1VZQH 1EAUA 1N1LA 4CRFA 2BTCE 1Z8RA 2OINA 3STJA 1TPSA 3RXJA 4SGBE 1P0SH 1C5TA 2DE9A 2GCTB 4OGYA 1HIAB 4ZROA 3P92A 1DUAA 1OWIA 4R8TB 3QGJA 1V2KT 5DJ7A 2BDCA 3SI3H 3TITA 2XCFA 1VCWA 3TK9A 3UQOA 2HPPH 3MMGA 1C2DA 3ZVCA 2P16A 1QJ7B 1BRUP 3ATKA 2C8ZB 4XSKU 1TFXA 1TRYA 2WPLS 4KTSA 1TGSZ 3LONA 1MQ6A 1OP0A 1MCVA 1RS0A 4X1PU 1O5GH 3SUEA 2GDEH 1BITA 4Y6DA 2FOBA 1A4WH 1O39A 4AG1A 2Q6DA 3E0NB 3BTME 3QZRA 2OBQA 1K28D 3R0FA 4XBDA 2GCTC 5GIBA 2J95A 3DD2H 3B23B 2VWOA 1GDQA 3SJ8A 1CBWB 1C2MA 3RM0H 2GP9B 1FN6A 1QFKH 1FMGA 3RU4D 1GVZA 1O5DH 2QV1A 1EP5A 2HWLB 3IG6B 3MU4A 2ZEBA 5G4BA 3VB5A 2SGQE 3ODFA 1A0JA 1NTPA 2Y5HA 1ZHRA 1KLTA 2OP9A 4RSPA 1W2KH 8LPRA 4BOHA 1Y5UT 1C1MA 2W26A 1AWFH 1JMOH 1TNGA 2GVFA 1S83A 5C5NA 1DE7H 2BQ7B 3AAUA 1O3AA 2AMDA 1MZDA 3KQBA 1CBWC 3HGNA 4WMFA 1C9PA 4NSVA 1AE8H 3VB3A 1S0RA 4O9VA 1MTVA 1D4PB 1K1NA 1IQIA 1C1WH 2XC4A 4KGAA 2BZAA 2V3OH 1O5CB 2D26C 1C4U2 1FY8E 3MFJA 5C1XA 1MKXH 1SGNE 3P8NA 1FNIA 2WV4A 1NFXA 3BV9B 5A0AE 2QA9E 4XBBA 5EOKA 3SV7A 1EB1H 2VH6A 4AN7A 2HALA 1O2SA 1ANBA 1GHAF 3TNSA 2WPKS 1E37B 3LKWA 2R2MB 1BTYA 3T62A 1MTUA 4U30A 4FUHA 4O3UA 4WXVA 1HJ9A 1GHZA 4NIVA 2SFAA 2Z9KA 1NFYA 2G52A 2GKVE 1OYTH 3QLPH 1AVXA 3ZVBA 1IHTH 3D49H 5GJ4B 1UJ1A 4Y7BA 4D9QA 1FI8A 1W11U 1FIWA 1QBOA 4X1QU 1P2JA 4B73A 6CHAB 2RA0A 5CE1A 3TIUA 1TIOA 5LPRA 2A7JA 1Y3XA 2A2QH 3RXVA 3BTTE 4DY7B 3FZDA 2GV6A 2XW9A 2GDDA 1LTOA 2PGBB 2J4IA 2G00A 2VIWA 4H6SB 1EX3A 1A5IA 2BQWB 1UTNA 1AMHA 2NU3E 2BDAA 3K9XB 1INCA 1GJAB 3C27B 4ISOA 4ASHA 2BY9X 3V12A 1GJDB 1DFPA 1ZPZA 3TH2H 2PKAB 4MPVA 3HKJB 1UVSH 3MU0A 3S69A 4M7GA 2OCVB 4I8LA 2AGEX 3PLKA 3I78A 5F8XA 1SL3A 3TGIE 3M5LA 1C5OH 1ELFA 2ZQ2A 4D76A 1TONA 4AB8A 1O3IA 5CHAC 3NWUA 1ZSLA 1TE0A 1RD3B 3S9BA 3DT0H 1Z6JH 2B0FA 1UK4A 3UNQA 5L30H 5A8ZA 3TK5A 1AU8A 3ENSB 1MTWA 1EJAA 3RXPA 3RXEA 1SGTA 2TGAA 2BYAX 4MQAA 1P2NA 1J14A 2YNBA 3BEFB 2G81E 3F9FA 1C5XB 2KAIA 3Q3KA 1O33A 1F0SA 1HPGA 3MH6A 1GI8B 2W7SA 1HYLA 3DUXH 5A09A 2C3SA 2ANKH 1NRSH 2AGGX 4GCHF 1AZ8A 4A6LA 1EASA 4TWWA 4Q7ZA 3PMBB 2AERH 1OXGA 2WUBA 1MBQA 1T7CA 3LOXA 2F9NA 3W95A 3MNCA 3VPKA 5E8EH 2OBOA 3VB4A 1HAVA 4BXWA 3JZ2B 1CHOF 3CP7A 1DLEA 5JBAS 4H4FA 1SGFG 3SORA 1FPHH 4BAKB 5ETXA 4J2YB 1W13U 2BD5A 3A84A 4PROA 2R0LA 1V2JT 3BTGE 3FP6E 2GT8A 3RXRA 2Q1JA 3H7OA 5BRRE 4I8JA 4ZHLU 1HAXB 2P3FH 1JIRA 2OC1A 1JBUH 1Y8TA 1B0EA 1OWKA 3K6YA 2XXLA 1DOJA 1DM4B 3MU5A 2FM2A 1C1QA 3DFLA 1O2PA 4X1NU 3SO3A 4DG4A 3QWCH 3UR9A 1NESE 3RXKA 4YESB 3F9EA 3RXHA 2AYWA 4CBOA 1NRRH 3ZVGA 1FY5A 2HNTF 4I8KA 1GHBF 2O8LA 5EXNA 3RU4T 3GISB 2UWPA 4K1TA 3RXUA 1GJ8B 1ZRBA 2ANYA 9ESTA 1O2IA 3H7TA 1G2MA 2R0KA 4AFSA 1EPTA 4GLYA 1H9IE
chains in the Genus database with same CATH superfamily
1P8VC 1Z71A 2ZF0H 2PV9B 1C1OA 1LKBA 2CN0H 1W7GH 3QUMP 3BSQA 1V2VT 5FAHA 2BY7X 1UVOA 4HI3A 1C5LH 3B9FH 3F68H 4WMEA 8GCHF 4B2CA 2JH6D 3NCLA 1DX5M 1P2KA 3E0PB 1H1BA 1S84A 1HAIH 3SV8A 1G3DA 1LHCH 1MAXA 1W0KD 4LXBH 1T32A 4NSYA 3GCOA 1EAWA 3UAIC 3RMOH 5B6OA 3HPTB 2Z9LA 1ESBA 5FHTA 1O5FH 1FONA 1O2NA 1HAHH 4YOGA 2VH0A 3T5FH 2BD3A 2QF0A 2C8YB 4X6NA 5C0TA 1TMBH 3S7KB 4B76A 5B6LA 2VIVA 2QXIA 3DSGA 1O2LA 2AFQB 3RC6A 1OWDA 4AFQA 2KZ4A 1TX8A 1PQ8A 1CT2E 1K1MA 3UUZA 1EJMA 2BZ6H 3RM2H 4AGJA 1LPGB 3PM3A 3DA9B 1PQAA 1C1PA 4XOJA 5DP3A 4BNRA 5LPFA 1DVAH 5GDSH 5HM9A 1C2GA 2OC7A 1B5GH 5JYIA 1ELGA 4O97A 1RIWB 3A8CA 5DP4A 1BTWA 3A7TA 1UTJA 2WPIS 2ALPA 2FOAA 3LGTA 1V2OT 5EODA 2PHBA 1LPZB 1BZXE 1IQEA 1BMAA 2XWBI 3ZZ4A 2WZQA 4FU8A 5AF9H 2Z9IA 3RUOA 2ZC9H 4CRDA 1P09A 1W14U 1TMTH 1D3TB 1V2ST 3MH7A 5AVDA 4RT0A 2QF3A 1PPBH 1YYY1 4NA9H 1BMFD 1GJ4H 3L6PA 1EZXC 2FYQA 4CH2B 5F6MA 1GI1A 2VIDA 1OWJA 2SGAA 4GPGA 2AS9A 1RJXB 1HLTH 1GI7B 4ZKNU 1RIWC 1KDQB 3EYDA 1ZSKA 4X6PA 2J98B 1NBMD 3K2UA 3K65B 3TH3H 2JIZD 2KAIB 2XWAA 1K1PA 4FETA 1V2PT 1S6HA 3FKSD 3RXLA 4HZHA 4GVUA 4FUGA 1BHXB 1GCDA 4NGAH 1C5YB 2VIPA 3QK1A 1ETRH 3RDZA 2G4UA 3SN8A 4X6OA 1PQ5A 1VITG 2ZO3H 3L33A 4XBCA 1AKSA 3WWBA 4Q80A 1HDTH 1KXBA 1OP8A 5IDKA 1Z7KA 1V3XA 4YOIA 3LDXH 2TGDA 2ALVA 3CS7A 2ZDKA 3F9HA 1HAVB 2V6NA 1O3PB 1TAWA 2Z3CA 4AX9H 4BAQB 4MLFB 1PPCE 5JB9S 2GZ8A 1QR3E 1GHWH 1EFRD 5CDFE 3MO6A 3EAJA 1SGPE 9LPRA 4INHA 4UFEH 1T8LA 5F53A 4YLUA 3ZYEA 2CGAA 5T3HA 2KCAA 1FAKH 4ABFA 2XYAA 4WF8A 3BG4B 2BB4A 1QTFA 4FUIA 3URCA 1ZYOA 1L4DA 3LC5A 3MOCA 4FUBA 1LQDB 2FESH 3SYJA 1O37A 1EOJA 1VCPA 2QY0B 3SJ9A 3M35A 3F0OA 3GY2A 4Q4LA 1YKTA 3NKKA 1QL8A 2OUAA 2CF8H 3TU7H 3BTQE 1KIGH 3GICB 2F9BH 1LHDH 2OQ5A 4MNYA 1IQLA 4UEHH 4ZXXH 3BTFE 1JWTA 1XUKA 3PMAB 5FL7D 4X1RU 3SV2H 4ZCNA 1H9HE 4FUFA 1J15A 2FI4E 4A1TA 4JK5A 3BG4C 1TPOA 3P6ZB 3ELAH 3O8DA 1GJ6A 3MNBA 1FPCH 3W94A 4NA7A 1A61H 1BMLA 2ZQ1A 3EDXB 4GHQA 3F3BA 1TA6A 1NPMA 2B7DH 1GL0E 4LK4A 4WMDA 1MAYA 3WY8A 3T25A 2JJ1D 4X8UH 4F55A 1D6RA 1SLWB 1GHYH 4F4OC 2HPQH 3CS0A 4FUDA 1EZSC 2B8OH 2FOMB 1AO5A 1MUEB 3CNRA 4UDWH 4XE4A 1GBLA 1D6WA 5L2ZH 2FYRA 4Y7AA 5EQRA 2FZZA 1BJUA 1SSXA 3N99A 4K2YA 4FXGH 1BBRK 1KTTB 2XBVA 7GCHG 2CJIA 3Q77A 1C5PA 2G5NA 3TVJB 1ZR0A 2BVSH 4I33A 1HAOH 5JBTA 4NZQA 1O3DA 2O8WA 2FXRA 4NIWA 1BIOA 1BA8B 3ZZ3A 1OWEA 3ATMA 3OAAD 5FCRA 4LOYH 4U32A 2AIQA 3S7HB 1QRZA 3QX5H 1ELDE 1DWBH 4FUEA 2FX6A 5HIZA 1C5VA 5LH8A 2HVYB 1H4WA 1EATA 1TNIA 1GHVH 1EQ9A 1K1JA 3MH4A 4ZUHA 3QDZB 1Z1IA 1LHEH 2Y5GA 2EC9H 3U69H 3ITIA 1CE5A 2PTNA 4VGCB 2J97A 3V3MA 4B71A 3BIUH 3ZVEA 1N6XA 4ABEA 4NCYA 5FBIA 1NN6A 1S6FA 1GJBB 1U6QA 4YOJA 4NIXA 1Y59T 2ZU2A 3SHCH 2STBE 1C2EA 2XC5A 1ETSH 1EOLA 3GDUA 2BLVA 4OS6A 1FX0B 1TA2A 2QC2A 3U9AH 2BD2A 1UVPA 1PPEE 3GS9A 3MI4A 3E90B 2FTMA 4X1SU 1TABE 3HGPA 1AFEH 1YPLH 3O8RA 2A4QA 1GJCB 1PFXC 1YCPM 3M5NA 2G8TA 5DP6A 3FFGA 3NPSA 3FN8A 4VGCC 2IOTA 1NZQH 1VGCB 4CRGA 2NU1E 2BOKA 1GMCG 1AKSB 1NS3A 2H9HA 3R3GB 3RXFA 2L6OA 1P2QA 3SU2A 1CT4E 1SBWA 3V0XA 2JKHA 4IC6A 1IAUA 1VJ9U 1JOUB 2XTTB 1TPAE 2H2ZA 1FUJA 2J9NA 2G51A 2ODYB 3S9AA 5EPNA 4ABHA 1IQNA 3A7VA 1O3OA 5FCKA 1BRCE 1QA7A 5L6NH 1AUJA 2ZFSA 2DE8A 1JRTA 2GT7A 3PV4A 2WUCA 1P03A 1UK2A 1O2GH 2YMSD 6GCHG 4UE7H 1FDPA 4A1XA 2FOGA 3SNDA 2VWMA 1TMUH 3QGNB 2O8TA 4ACBA 1GPZA 4IN2A 3EA9A 2ULLA 1BBRH 5T6FA 3EQ0H 4UD9H 1BRAA 4MG3A 1FQ3A 1SFQB 1O32A 3N7OA 2BLOA 3PV2A 2CXVA 5CMXH 1TNLA 2O8MA 1UCYK 2HGTH 5LPEA 4FUCA 4Q7YA 2B9LA 1LQEA 3PB1E 4E7NA 2TRMA 2SNWA 2Y7XA 3FOAA 1XXDA 1K21H 3SNAA 5T1VA 4K60A 2ZU1A 4BANB 4CRAA 1G32B 1ZRKA 4U2WA 3MTYA 1Y3VA 2W7UA 1G30B 3TGKE 1O2QA 4UONA 1GWAA 2EEKA 1YLDA 5DP9A 4J1YA 1ZSJA 1HCGA 2D2DA 1DICA 2ZPRA 2R9PA 1WDIA 2BDYA 2XCNA 3FVFB 1SGDE 2ZFRH 1EKBB 1PPFE 5EG4A 5JBBS 1G3EA 2PR3A 4H6TA 1G3CA 3QZQA 5TJXA 5A2MH 1PYTC 1UHBB 2BMGB 1BTUA 1P9SA 2THFB 5SGAE 5C67A 3GY8A 1MU8B 3SQHE 2FOHA 4XFQA 1SFIA 1AVWA 4JYTA 3T29A 4I8HA 3F6UH 4YLQH 1Y5AT 1G9IE 1ZTLA 3A8AA 3E6PH 4X8VH 4ZKOU 1Y3WA 2ZNKH 4WJG2 1MU6B 4ZKSU 1FY3A 2UUJB 2ODPA 2FOFA 2SGEE 3SNCA 4D7GA 1Q31A 1EP6A 1RGQA 1FIZA 3H09A 2WPMS 1O3NA 4BTIB 1CSOE 2CMYA 1A46H 1IQKA 4IC5A 1QB1A 1H8HD 2BVXH 3MU8A 1Z8IB 3F2FA 2XNIA 3P8GA 1N6YA 3UREA 4INLA 2A5KA 2K8IA 1WYKA 2ZHQH 6CHAC 4JMYA 1P02A 4BTTB 4K8YA 2NU4E 1P2IA 3GDSA 4BTUB 2UUKB 3FO8D 4E05H 1SR5C 2BLWA 3RU4E 5EJ1A 1O35A 5E2PA 1C5ZB 3M3VA 2WPDD 2ZPQA 3LGWA 1GBEA 1O2JA 1GBTA 1L1JA 3F2GA 1UMAH 3PYHA 2WINI 4NWKA 3OY6U 1UTOA 3ZV8A 3ZZBA 1F5KU 2M2AA 1E34B 4I86A 3T26A 4ABGA 1TGBA 2Y82A 1KXAA 4JZ1A 5A8YA 3LJOA 1GGDB 1UCYH 3B8JA 2LP6A 1SGEE 5FPYA 1CGIE 3W1EA 1NO9H 1SGQE 5FPSA 1YLCA 2PSXA 1C5RA 2RDEA 2A32A 2EA3A 1FZZA 2VVUA 3ATIA 3U98H 3RLWH 4KELA 1UO6A 1KXDA 2PWXA 1TPPA 2XOKD 1BTHH 1J16A 1A5GH 1AI8H 3VFEA 3PO1B 3U28C 1MABB 1ESAA 1SLVB 3KIDU 3Q76A 2FP7B 1IQMA 3UFAA 4XRNA 5EQQA 2BLQA 1QBVH 1A3EH 1AY6H 4HGCA 4ZHAA 1ACBE 2ZHEH 3KYFA 4F49A 1D9IA 3H5CB 1F2SE 1YLNA 4X8SH 1OP2A 2KX4A 4XDEA 1GGDC 2ZA5A 4FU9A 4OGXA 1KMHB 2L74A 1OYQA 1YBWA 4DURA 3ATLA 2JDID 1BTXA 2ZG0H 1HJAB 1KXCA 1QB6A 3KNXA 1WU1A 3A83A 2J92A 1VITF 4DCDA 1WUNH 1A1RA 2A45B 1OOKB 3I77A 3OEED 4ZAEA 1CO7E 1F0UA 4MDSA 1SOTA 1VR1H 4ZHMU 1ETTH 2XC0A 2AMQA 2QAAA 2GX4A 1FN8A 3KN2A 3A8BA 4AORA 1OHHD 2XBYA 3PO1C 3GYLB 3GY5A 3VB7A 1O2YA 1SOZA 3UPEA 4MNXA 5HMAA 1LMWB 1DWDH 3ZZAA 4GUXA 2G5VA 4ABBA 3MHWU 1E0FD 4MNVA 1C2LA 4K3JA 4YO9A 4HG6A 1V2UT 4X8TH 1NM6A 2BX3A 1TBRH 5A0CA 1SGCA 2A4GA 2ZDVH 3SW2B 1QBNA 1HJAC 3OTPA 3TGJE 1C2KA 2J94A 1AHTH 1AQ7A 4DGJA 2J34A 3EE0B 1HRTH 1GHXH 5K0HA 2PW8H 3M3TA 4YXWD 1AZZA 1ELVA 3MWIU 3PWCA 1BDAA 3OU0A 4TT3D 1D3QB 4AFUA 4DIIH 4MPWA 1YPHE 2FODA 3UY9A 1EAXA 1F5LA 1SI5H 2JETB 7KMEH 4X2XA 1MD8A 1K2I1 1IOEA 1GHAG 2VNTA 3P95A 1AIXH 1O5BB 1LHFH 1LVYA 2FS9A 4SGAE 4AGKA 2A7CA 3VXEH 1J17T 1ANDA 2AMPA 3F0PA 1WBGB 2VINA 4ABIA 4Y79A 2V3MA 3UOUA 1IQGA 3M5MA 1YWUA 2H5DA 4K1EA 1C5NH 1A2CH 1WAYB 1KY9A 4Y76A 2O9QA 4B2BA 3TPIZ 1DPOA 3UWIA 2BXTH 1FAXA 2ANMH 1QA0A 2JETC 3ZZDA 1TNHA 1XVMA 2H9EH 8ESTE 1PPHE 1LVOA 4JZIA 1ZJKA 3T2NA 3BTWE 4IMZA 3GCTG 4UFFH 3VGCB 1C5SA 4Y0YE 2F9PA 2WYGA 1W8BH 1ARBA 1QL7A 3RXIA 4A7IB 3VEQB 1HBTH 2ZDNA 1UTMA 2A5AA 1GBKA 3U8TH 1T31A 1C1NA 4THNH 3FP7E 2K1QA 1PJPA 2FLBH 2ZDAH 1FY1A 7GCHF 4D7FA 3RXAA 1E79D 1GBHA 1XUFA 5EIYA 1BHXF 1GMDF 4CHAB 1UTKA 2J2UA 3IWMA 5F8TA 3ZV9A 1SC8U 2P3TB 1BBRE 4B75A 5AHGH 3LH1A 2V35A 3BEUA 4NIYA 3ZZ8A 4IBLH 3VGCC 1GJ7B 2GMTB 3PLPA 4Y8ZA 3TNTA 1KYNA 1O2HA 3A7ZA 1C1SA 2ZFFH 1GI0A 2ZGBH 2SGPE 2YNAA 1HNEE 1IQFA 1BMNH 3SV9A 1P2OA 1O3CA 3KQ5A 3GY3A 3A82A 1MD7A 1EJNA 2LELA 3KCGH 3KL6A 3RXBA 1L4ZA 4CHAC 1UTPA 4I8GA 1GBIA 4Z0KA 5F8ZA 6ESTA 5C0UA 1H8DH 2XNDD 2BD7A 5KECA 2FIRH 4ISNA 4A5TS 1UVTH 1BRBE 1HIAA 4NFFA 1PQ7A 2GMTC 1F0RA 5TCAA 2UWOA 4GCHG 1BCUH 1XVOA 4NG9H 4P00A 4UFGH 3N7DA 4WVPE 1ESTA 1HB0B 3QTVH 1YPGH 1HV7A 4K1SA 4RKOB 1K9OE 4ISIH 3C1KA 2LPRA 3A7XA 1C4Y2 1XUGA 3A80A 1GBFA 4FU7A 1LDTT 4KKDA 1GMCF 1CHOG 4X0WU 1PPZA 2PSYA 2AEIH 2HRVA 2ZHDA 1TLDA 2TGPZ 5EXLA 4K8BA 4B2AA 1E36B 1F0TA 4ABJA 3JZ1B 5HM2A 1UK3A 1THPB 5DKMA 4D9RA 1O30A 1AN1E 5C1YA 3SUGA 1O2KA 3PV5A 2ZFTA 1C2FA 2VIQA 4HTCH 2IPQX 5EQSA 2SGFE 3BEIB 2VWNA 1EZUC 3GYMA 4K5ZA 7LPRA 1XX9A 2PUQH 2EQNA 2BDBA 1QB9A 1NY22 2A4OA 3ZIAD 1MTSA 2QXGA 5J4QA 3GY7A 1TOCB 3MYWA 3Q3YA 5T6GA 1O2MA 4JZFH 1B0FA 1SMFE 1TX6A 3S9CA 2AGIX 4OS1A 1FLEE 1XMNB 2ILNA 2TBSA 2RA3A 1EPTB 5HGGA 1ANEA 1NFUA 1MH0A 3HK3B 5AFZH 4RKJB 1QIXB 1VCQA 4LZ1H 4AB9A 1ZGIA 2A0QB 1LHGH 2ZGJA 4O03A 1GJ9B 1GDNA 1GJ5H 1M9UA 3A8DA 1QRXA 2H1UA 2AIPA 4I31A 1UCYE 1UTLM 1TQ0B 1QNJA 4IGDA 2ZFQH 1BTPA 3QN7A 4JYUH 1Z8JB 2ASUB 1O3MA 1HAYB 1WSSH 1ZTJA 2PLXA 3Q00A 1C9TA 3LGVA 1W7XH 3V13A 4FOUC 1O36A 1ZMLA 1DY8A 4WY3A 3RXGA 3IITA 3D62A 1BTZA 3PTBA 2G55A 1MTNB 3ZVFA 1OKXA 4X6MA 3QO6A 1EPTC 1WV7H 1ELTA 4ACAA 1OPHB 2D8WA 1SGFA 1GBAA 1V6DA 2ZCLP 3NXPA 2W6JD 1C5QA 1W0ZU 1NBME 4CREA 5IYTA 1V2RT 2ZGXH 1B7XB 3FP8E 3EGKH 1LO6A 3P8OA 1QURH 1ZHMA 4MPXA 5DP7A 1S81A 1RXPA 1YP9A 1QY6A 2HNTE 1KSNA 3L3TA 2ZU3A 4RI0A 2ZU4A 1AE5A 5E0GA 3M7TA 1NROH 4Y11E 1P05A 1MZAA 3BG8A 1IHSH 1MTNC 1LKAA 1P06A 3AAVA 1C1TA 2ZECA 3SU6A 2R3UA 3WW7A 2SNVA 1XM1A 3DSOA 1P3EA 1GBDA 4TY7A 1TNKA 3GCNA 5TCCA 3D65E 1V2NT 5DO4H 4WH6A 5I25A 1TALA 1ZGVA 3G01A 2BDGA 1YCPK 4CH8B 2PKAA 3FZZA 3DSPA 1SGYE 1V2WT 2W6ID 2YMSB 1SHHB 3SHAH 1CGHA 3SOSA 1XUIA 3WWFA 3KQDA 3MO3A 1O5AB 2FOCA 2BM2A 1C2HA 1DY9A 1JRSA 1O3GA 2C8WB 1MCTA 2BDIA 2KM0A 1C5MD 1C1VH 5I46H 2F9UA 2NWNA 2VVCA 1KTSB 3GDVA 4FUJA 3SBKA 2A4RA 1GVLA 4OS2A 1P12E 2F9VA 1O0DH 2QF4A 2FPZA 1QJ6B 4GHTA 1THSH 1ELBA 3A88A 2BHGA 3TH4H 2WPHS 1VKYA 1CU1A 1DLKB 1HGTH 3RXTA 1WQSA 4Q2KA 5DGJA 2GCHG 3UNSA 5E0JA 2V7QD 2GZ7A 2ZU5A 3KYGA 1T4UH 2WPJS 1ARCA 5CHBA 2KCOA 3UNRA 1KXEA 2Z3EA 3TLOA 4Z1MD 2BD9A 5GCHG 1CQQA 5EGMA 5GWZA 4B6FA 2FOEA 2UWLA 4ISLA 1SGRE 1GI3A 1SG8B 1HFDA 1O3JA 2FWWA 2EI8A 4IS5A 3OE7D 3PRBA 3EA8A 2BY6X 1AGJA 1VGCC 2HLCA 3RC5A 3UQVA 2BDHA 2Y6TA 1OS8A 1SB1H 5DK1A 4BAOB 1QCPA 2J5UA 1C1RA 2FS8A 4ZMAH 1W3CA 4DW2U 1T8NA 1L2EA 3F9GA 1ZTKA 4X2VA 4ABAA 4TSFD 1K0HA 3UOPA 1SQAA 5EW2H 2FEQH 2F83A 5FPTA 2ZHFH 3MNXA 3A85A 3P17H 1BMMH 1KLJH 1O2WA 2OXSA 4YT6H 4YM9A 1SGIB 2XBWA 1ABJH 2Y5FA 5DP8A 2WYJA 3PLBA 1AB9B 1CT0E 1TYNA 1GBBA 1DWCH 1S0QA 1E35B 3QTOH 1O2TA 3RXCA 3MH5A 1YPEH 4AFZA 2HOBA 3ZVDA 2BOHB 1SLUB 1KLIH 2VIOA 1YM0A 2P93A 1W12U 1O3LA 3LGUA 2A31A 3E91A 1TRMA 1COWD 1GMHG 1O3BA 1O2OA 4I32A 3SQEE 2Q6GA 8KME2 1YCPH 3VB6A 3RMMH 1O2UA 2XBXA 2OQUA 3AASA 3Q3XA 5FBEA 1TGCA 2VB0A 2IJOB 2Z94A 3BF6H 4NWLA 2M5TA 2ZDLA 4WH8A 1YPHC 2RCEA 1ZLRA 1AB9C 7ESTE 1TQ7B 3SGQE 2F4LA 2VU8E 1FV9A 1NU9A 1O2XA 1RTLA 2PTCE 3LC3A 4OS5A 3ZZ9A 3BN9A 1UVUH 4RT1A 5H4IB 3RXOA 1DWEH 1L0ZA 3SU1A 2JH0D 1S85A 3ZVAA 3TJVA 1DT2A 4JYVH 1HJ8A 1AFQB 4ISHH 3ZYDA 2CV3A 3FANA 5GPIB 1C5UA 4CRBA 1ZHPA 2ZWLH 4AYVB 2BD4A 1O3EA 2A1DB 5F03A 1EXFA 2GV7A 4IMQA 1ZMJA 1P2MA 3A7YA 1TX7A 1H8ED 1TRNA 3GCTF 3SU3A 1CA0B 1CHGA 1PYTD 5CHAB 3KGPA 2OC0A 1MMJN 1E1RD 3LT3A 3SJIA 1ZZZA 3O8BA 3ZZCA 2ODQA 3PROA 3UWJH 3KEEA 3TJNA 2ZPSA 3ZZ7A 2IN2A 4DVAU 1ZOMA 1HXFH 1EB2A 2OC8A 2ZP0H 3A89A 1AFQC 5K7RA 4NZLA 2ZDMA 1BUIA 2KCPA 4Q63A 5GXPA 1WOFA 1AVGH 1UTQA 4AYYB 1OWHA 1BOQA 2OTVA 3OEHD 5EXMA 2ZGHA 4X2YA 3M7QA 5T6DA 2P94A 3LIWA 1YGCH 2FI5E 2QIQA 1QRWA 1YPMH 2VVVA 1ORFA 1CA0C 1C2IA 4TPIZ 3SJOA 3UIRA 5PTPA 1O2ZA 4Y8XA 1VITH 4MVNA 1TNJA 4K69A 5EW1H 4RN6A 1T4VH 5HYOA 4E7RG 1HXEH 1JXPA 2PKSB 2H5CA 3ATWA 2FMJA 1BJVA 3PWBA 3SUDA 4MPUA 3T27A 1CGJE 3UR6A 1Y5BT 1YPKH 1DS2E 4O3TA 5C5OA 1YF4A 2Y7ZA 1GVKB 1KDQA 5JBCS 2J98A 1O31A 2QXHA 1SQOA 4DIHH 1WXRA 1AD8H 1DUEA 3TK6A 2CHAB 3K6ZA 3LH3A 1G36A 1K1IA 3BTHE 5ESTE 4X2WA 1DXPA 1A0HB 1DANH 4NA8A 3RLYH 3NK8A 5DP5A 1Q2WA 3LU9B 2ZI2H 1ZPCA 4MNWA 2V3HH 4Z6AH 1P11E 4LZ4B 3O8CA 2TPIZ 2H9TH 1C5WB 1K22H 2F43B 2PKSC 1MKWK 5EJZA 3OYPA 1Z8GA 1E38B 2NU2E 2PFEA 1NT1A 1OX1A 2A7HA 2QE7D 4H42U 1GBCA 5JDUB 1FJSA 2BVRH 1EUFA 4D8NA 4UFDH 2RG3A 1ELCA 3VXFH 4B1TA 3M5OA 1TGTA 2C93B 1Z1JA 5J4SA 1A0LA 4BAHB 5A0BA 1QGFA 2CHAC 1ELEE 3D23A 2FX4A 4E06H 2TIOA 1GCTB 1WTHD 3MO9A 1RTKA 5FX5A 1TBZH 1O2RA 3BTDE 3A81A 2STAE 3U1JB 4BXSA 1NRPH 2BD8A 2QYIA 1XXFA 3ODDA 3MNSA 1J8AA 1YPJH 3SU0A 1IQHA 3KQEA 3LPRA 3HK6B 2OD3B 3SNBA 1BT7A 3AVZA 4BAMB 1QQUA 3HKIB 4A92A 4JZEH 1G37A 1T8OA 2C8XB 3T28A 2EY4C 1DITH 2FDAA 2IPHA 1GCTC 1GI9B 1QZ8A 1VJAU 3RXSA 3LGYA 1G2LA 3STIA 2BXUH 2TGTA 2ZKSA 2P3UB 3M3SA 5C3NA 1XKBC 2D1JA 3URDA 3S0NA 1LPKB 2GZ9A 4GAWA 4CR5A 1Z6EA 2ZZUH 1X7AC 4P02A 4A1VA 5ABWA 2BY5X 3NZIA 2GD4B 4KTCA 1QHRB 1K1LA 1H9LB 3SGAE 1GI6A 2P95A 3OSYA 1WQVH 1RRKA 2YOLA 3FAOA 1P04A 1GG6B 2Z6BD 1F5RA 5A8XA 2W3IA 1G3BA 3A87A 5HIYA 3AW1A 5AFYH 5DN6D 1ZMNA 2ZGCA 2ZTYA 4NFEA 2F3CE 4Y8YA 1A5HA 2CF9H 3BTEE 4JK6A 1D3PB 1SKYE 1JIMA 2Z7FE 3VG8A 2F91A 2RDLA 2Z9GA 1QL9A 1XKAC 3KHVA 3P8FA 1HAPH 2PGQB 2I6QA 2W5EA 2WSSD 2QXJA 1A3BH 2FTLE 3RC4A 5C1UA 1XUJA 2GGVB 1DSTA 1TWXB 2UUFB 1MKWH 4INKA 1O3KA 4KP0A 3CENA 1TGNA 1RFNA 1S5SA 1GG6C 1KXFA 3GOVB 3M61U 4AZ2B 2Z9JA 3SGBE 5C17A 1DDJA 1HUTH 3V7TA 4GSOA 6LPRA 2HNTC 1SVPA 2K0QA 1MBMA 3SU4A 1NRQH 5JB8S 1GI5A 4TPYA 1XUHA 1NC6A 2PUXB 1O3HA 1THRH 4AG2A 1J9CH 1GL1A 4R0IA 2FLRH 2Q6FA 3BTKE 2HVXA 1PPGE 2ZHWH 2Y80A 1ANCA 1GI2A 2QCYA 1P10A 1SPJA 1N8OB 3RXMA 1IQJA 2J38A 1DXWA 4TY6A 1ZJDA 3U8RH 1NRNH 3OX7U 1C4V2 4OM9A 1QQ4A 2FI3E 3SNEA 2QGRA 3E3TA 2P59A 1MQ5A 2VJ1A 1GDUA 1P9UA 1O3FA 5BPEA 4WWYA 1P01A 4IN1A 5DPAA 2VWLA 5FX6A 5LGOA 2AHME 2OLGA 2V0BA 1H8IH 1AWHB 1O34A 1NU7B 1YC0A 5ESBA 4YZUA 2NU0E 1GBJA 2ZCHP 4OS4A 1N8OC 1A7SA 4XD7D 1HAZB 1O2VA 4YTAA 2GCHF 3SV6A 2O8UA 2BQ6B 4ZXYH 1L1GA 1LVMA 2UUYA 5FXLA 3RMLH 3RMNH 3UB0A 5C2ZA 1D3DB 2H6MA 5GCHF 4CR9A 4TYDA 2W3KA 1ABIH 1O5EH 3MU1A 1V2QT 2EI6A 5C20A 2KFWA 3ZZ5A 2P8OB 1AUTC 4JCNA 2VGCB 1LCYA 3NUMA 4HFPB 1S82A 3AW0A 1ID5H 6GCHF 3SUFA 4I7YH 3DHKH 1TOMH 4JZDH 3HATH 2QN5T 2F9OA 4CRCA 1W0YH 1ELAA 1TB6H 2XRCA 3TJUA 1WTGH 2I6SA 1SQTA 4DT7B 1GHBG 2EI7A 3RXQA 1LVBA 3RP2A 5E2OA 3A86A 3A7WA 3LGIA 1EAIA 1L1NA 2CK3D 2A5IA 4IW4E 4U01A 2ZCKP 1GI4A 5EPYA 1ZPBA 3RXDA 2P8OC 1F92A 1TBQH 2VGCC 3BIVH 3DFJA 2G4TA 3KF2A 3GCHB 2JH5D 3M36A 1F7ZA 4Q7XA 2LNCA 2BY8X 3PMJA 3E16B 3U1IB 1C2JA 1EZQA 1O38A 3E8LA 4DJZB 2ESTE 3PMHB 5DSFA 8GCHG 4AOQA 1FY4A 1GBMA 3I29A 4B74A 2WV5A 4YT7H 3SI4H 1W10U 4KTUA 1CVWH 1Y3UA 1V2MT 3SJKA 1YY3A 3U8OH 4MTBA 4ASUD 1Q3XA 1GMHF 2ANWA 2KR7A 1T8MA 1RTFB 1OSSA 2SGDE 3OTJE 3UTUH 2AH4X 5E0HA 2R2WU 1V2LT 1SLXB 1SQRA 1UHBA 1P57B 2DUCA 1CA8B 3GCHC 1WCZA 5JPMH 5DG6A 4Y71A 3GY6A 1C1UH 2Y81A 3ESTA 4B6EA 4ESTE 1HAGE 1Y3YA 2ZTXA 4Y0ZE 3OY5U 3KQCA 4OS7A 2B5TB 4DOQA 1QJ1B 2GTBA 4WXIA 3SU5A 2Z3DA 2ZFPH 3LJJA 4ZH8A 1NFWA 4QT8C 1P3CA 2FO9A 1SHYA 1V2TT 2KCYA 3AK5A 3M37A 1GMDG 1FXYA 2C4FH 4ZKRU 3M7UA 5L2YH 3EE7A 3ZZ6A 1BB0B 3EA7A 3E1XB 4FVDA 4TWYA 5IK2D 2C90B 1MKXK 2OK5A 2HLDD 3PTNA 4ABDA 3SZNA 3P70B 1K1OA 3F1SB 1BQYA 1DSUA 2A2XH 3GY4A 4Y10E 5HXFA 4FVBA 2R3YA 2BX4A 2ZIQH 5EU8A 4CBNA 2ZTZA 3TJOA 1VZQH 1EAUA 1N1LA 4CRFA 2BTCE 1Z8RA 2OINA 3STJA 1TPSA 3RXJA 3DCLA 4SGBE 1P0SH 1C5TA 2DE9A 2GCTB 4OGYA 1HIAB 4ZROA 3P92A 1DUAA 1OWIA 4R8TB 3QGJA 1V2KT 5DJ7A 2BDCA 3SI3H 3TITA 2XCFA 1VCWA 3TK9A 3UQOA 2HPPH 3MMGA 1C2DA 3ZVCA 2P16A 1QJ7B 1BRUP 2VBCA 3ATKA 2C8ZB 4XSKU 1TFXA 1TRYA 2WPLS 2YMSC 4KTSA 1TGSZ 3LONA 1MQ6A 1OP0A 1MCVA 1RS0A 4X1PU 1O5GH 3SUEA 2GDEH 1BITA 4Y6DA 2FOBA 1A4WH 1O39A 4AG1A 2Q6DA 3E0NB 3BTME 3QZRA 2OBQA 1K28D 3R0FA 4XBDA 2GCTC 5GIBA 2J95A 2PP6A 3DD2H 3B23B 2VWOA 1GDQA 3SJ8A 1CBWB 1C2MA 3RM0H 2GP9B 1FN6A 1QFKH 1FMGA 3RU4D 1GVZA 1O5DH 2QV1A 1EP5A 2HWLB 3IG6B 3MU4A 2ZEBA 5G4BA 3VB5A 2SGQE 5C94A 3ODFA 1A0JA 5KGOA 1NTPA 2Y5HA 1ZHRA 1KLTA 2OP9A 4RSPA 1W2KH 8LPRA 4BOHA 1Y5UT 1C1MA 2W26A 1AWFH 1JMOH 1TNGA 2GVFA 1S83A 5C5NA 1DE7H 2BQ7B 2QF5A 3AAUA 3OFND 1O3AA 2AMDA 1MZDA 2RFKC 1UW7A 5HKKD 4AC9A 3KQBA 1CBWC 3SZEA 3HGNA 4WMFA 1C9PA 4NSVA 1AE8H 3VB3A 1S0RA 4O9VA 1MTVA 1D4PB 1K1NA 1IQIA 1C1WH 2XC4A 4KGAA 2BZAA 2V3OH 1O5CB 2D26C 1C4U2 1FY8E 3MFJA 5C1XA 1MKXH 1SGNE 3P8NA 1FNIA 2WV4A 1NFXA 3BV9B 3F2HA 5A0AE 2QA9E 4XBBA 5EOKA 3SV7A 1W0JD 1EB1H 2VH6A 4AN7A 2HALA 1O2SA 1ANBA 1GHAF 3TNSA 2WPKS 1E37B 3LKWA 2R2MB 1BTYA 3T62A 1MTUA 4U30A 4FUHA 2GJGA 4O3UA 4WXVA 1HJ9A 1GHZA 4NIVA 2SFAA 2Z9KA 1NFYA 2G52A 2GKVE 1OYTH 2IJD1 3QLPH 1AVXA 2WHXA 3ZVBA 1IHTH 3D49H 5GJ4B 1UJ1A 4Y7BA 4D9QA 1FI8A 1W11U 1FIWA 4F48B 1QBOA 4X1QU 1P2JA 3NRLA 4B73A 6CHAB 2RA0A 5CE1A 3TIUA 1TIOA 5LPRA 2A7JA 1Y3XA 2A2QH 3RXVA 3BTTE 4DY7B 3FZDA 2GV6A 2XW9A 2GDDA 1LTOA 2PGBB 2J4IA 2G00A 2VIWA 4H6SB 1EX3A 1A5IA 2JJ2D 2BQWB 1UTNA 1AMHA 2NU3E 2BDAA 3K9XB 1INCA 1GJAB 3C27B 4ISOA 4ASHA 2BY9X 3V12A 1GJDB 1DFPA 1ZPZA 3TH2H 2PKAB 4MPVA 3HKJB 1UVSH 3MU0A 3S69A 4M7GA 2OCVB 4I8LA 2AGEX 3PLKA 3I78A 5F8XA 1SL3A 3TGIE 3M5LA 3MQKC 1C5OH 1ELFA 4M9FA 5GNDA 2ZQ2A 4D76A 1TONA 4AB8A 1O3IA 5CHAC 3NWUA 1ZSLA 1TE0A 1RD3B 3S9BA 3DT0H 1Z6JH 2B0FA 1UK4A 3UNQA 5L30H 5A8ZA 3TK5A 1AU8A 3ENSB 1MTWA 1EJAA 3RXPA 3RXEA 1SGTA 2TGAA 2BYAX 4MQAA 1P2NA 1J14A 2YNBA 3BEFB 2G81E 3F9FA 1C5XB 2KAIA 3Q3KA 1O33A 5KEDA 1E1QD 1F0SA 1HPGA 3MH6A 1GI8B 2W7SA 1HYLA 3DUXH 5A09A 2C3SA 2ANKH 1NRSH 2AGGX 4GCHF 1AZ8A 4A6LA 3PRDA 1EASA 4TWWA 4Q7ZA 2WV9A 3PMBB 2AERH 1OXGA 2WUBA 1MBQA 1T7CA 3LOXA 2F9NA 3W95A 3MNCA 4DT4A 3VPKA 5E8EH 2OBOA 3VB4A 1HAVA 4BXWA 3JZ2B 1CHOF 3CP7A 1DLEA 5JBAS 4H4FA 1SGFG 3SORA 1FPHH 4BAKB 5ETXA 4J2YB 1W13U 2BD5A 3A84A 4PROA 2R0LA 1V2JT 3BTGE 3FP6E 2GT8A 3RXRA 2Q1JA 3H7OA 5BRRE 4I8JA 4ZHLU 1HAXB 2P3FH 1JIRA 2OC1A 1JBUH 1Y8TA 1B0EA 1OWKA 3K6YA 2XXLA 1DOJA 1DM4B 3MU5A 2FM2A 1C1QA 3DFLA 3N7EA 1O2PA 4X1NU 1S6LA 3SO3A 4DG4A 3QWCH 3UR9A 1NESE 3RXKA 4YESB 3F9EA 3RXHA 2AYWA 4CBOA 1NRRH 3ZVGA 1FY5A 2HNTF 4I8KA 1GHBF 2O8LA 5EXNA 3RU4T 3GISB 2UWPA 4K1TA 3RXUA 1GJ8B 1ZRBA 2ANYA 9ESTA 1O2IA 3H7TA 5EJLA 1G2MA 2R0KA 4AFSA 1EPTA 4GLYA 1H9IE
chains in the Genus database with same CATH topology
1P8VC 1Z71A 2ZF0H 2PV9B 1C1OA 1LKBA 2CN0H 1W7GH 3QUMP 3BSQA 1V2VT 5FAHA 2BY7X 1UVOA 4HI3A 1C5LH 3B9FH 3F68H 4WMEA 8GCHF 4B2CA 2JH6D 3NCLA 1DX5M 1P2KA 3E0PB 1H1BA 1S84A 1HAIH 3SV8A 1G3DA 1LHCH 1MAXA 4LXBH 1T32A 4NSYA 3GCOA 1EAWA 3RMOH 5B6OA 3HPTB 2Z9LA 1ESBA 5FHTA 1O5FH 1FONA 1O2NA 1HAHH 4YOGA 2VH0A 3T5FH 2BD3A 2QF0A 2C8YB 4X6NA 1TMBH 3S7KB 4B76A 2VIVA 2QXIA 1O2LA 2AFQB 3RC6A 1OWDA 4AFQA 1TX8A 1PQ8A 1CT2E 1K1MA 3UUZA 1EJMA 2BZ6H 3RM2H 4AGJA 1LPGB 3PM3A 3DA9B 1PQAA 1C1PA 4XOJA 5DP3A 4BNRA 5LPFA 1DVAH 5GDSH 5HM9A 1C2GA 2OC7A 1B5GH 5JYIA 1ELGA 4O97A 1RIWB 3A8CA 5DP4A 1BTWA 3A7TA 1UTJA 2WPIS 2ALPA 2FOAA 3LGTA 1V2OT 5EODA 2PHBA 1LPZB 1BZXE 1IQEA 1BMAA 2XWBI 3ZZ4A 4FU8A 5AF9H 2Z9IA 3RUOA 2ZC9H 4CRDA 1P09A 1W14U 1TMTH 1D3TB 1V2ST 3MH7A 5AVDA 2QF3A 1PPBH 1YYY1 4NA9H 1GJ4H 3L6PA 1EZXC 2FYQA 4CH2B 5F6MA 1GI1A 2VIDA 1OWJA 2SGAA 4GPGA 2AS9A 1RJXB 1HLTH 1GI7B 4ZKNU 1RIWC 1KDQB 3EYDA 1ZSKA 4X6PA 3K2UA 3K65B 3TH3H 2KAIB 2XWAA 1K1PA 1V2PT 1S6HA 3RXLA 4HZHA 4GVUA 4FUGA 1BHXB 1GCDA 4NGAH 1C5YB 2VIPA 3QK1A 1ETRH 3RDZA 2G4UA 3SN8A 4X6OA 1PQ5A 1VITG 2ZO3H 3L33A 4XBCA 1AKSA 4Q80A 1HDTH 1KXBA 1OP8A 5IDKA 1Z7KA 1V3XA 4YOIA 3LDXH 2TGDA 2ALVA 3CS7A 2ZDKA 3F9HA 1HAVB 2V6NA 1O3PB 1TAWA 2Z3CA 4AX9H 4BAQB 4MLFB 1PPCE 5JB9S 2GZ8A 1QR3E 1GHWH 3MO6A 3EAJA 1SGPE 9LPRA 4INHA 4UFEH 1T8LA 4YLUA 3ZYEA 2CGAA 5T3HA 1FAKH 4ABFA 2XYAA 4WF8A 3BG4B 2BB4A 1QTFA 4FUIA 3URCA 1ZYOA 1L4DA 3LC5A 3MOCA 4FUBA 1LQDB 2FESH 1O37A 1EOJA 1VCPA 2QY0B 3SJ9A 3M35A 3GY2A 1YKTA 3NKKA 1QL8A 2OUAA 2CF8H 3TU7H 3BTQE 1KIGH 3GICB 2F9BH 1LHDH 2OQ5A 4MNYA 1IQLA 4UEHH 4ZXXH 3BTFE 1JWTA 1XUKA 3PMAB 3SV2H 4X1RU 1H9HE 4FUFA 1J15A 2FI4E 4A1TA 4JK5A 3BG4C 1TPOA 3P6ZB 3ELAH 3O8DA 1GJ6A 3MNBA 1FPCH 3W94A 4NA7A 1A61H 1BMLA 2ZQ1A 3EDXB 4GHQA 1TA6A 1NPMA 2B7DH 1GL0E 4LK4A 4WMDA 1MAYA 3WY8A 3T25A 4X8UH 1D6RA 1SLWB 1GHYH 4F4OC 2HPQH 3CS0A 4FUDA 1EZSC 2B8OH 2FOMB 1AO5A 1MUEB 4UDWH 4XE4A 1GBLA 1D6WA 5L2ZH 2FYRA 4Y7AA 5EQRA 2FZZA 1BJUA 1SSXA 4K2YA 4FXGH 1BBRK 1KTTB 2XBVA 7GCHG 2CJIA 3Q77A 1C5PA 2G5NA 3TVJB 1ZR0A 2BVSH 4I33A 1HAOH 5JBTA 4NZQA 1O3DA 2O8WA 2FXRA 4NIWA 1BIOA 1BA8B 3ZZ3A 1OWEA 3ATMA 5FCRA 4LOYH 4U32A 2AIQA 3S7HB 1QRZA 3QX5H 1ELDE 1DWBH 4FUEA 2FX6A 1C5VA 5LH8A 1H4WA 1EATA 1TNIA 1GHVH 1EQ9A 1K1JA 3MH4A 4ZUHA 3QDZB 1Z1IA 1LHEH 2Y5GA 2EC9H 3U69H 3ITIA 1CE5A 2PTNA 4VGCB 3V3MA 4B71A 3BIUH 3ZVEA 1N6XA 4ABEA 4NCYA 5FBIA 1NN6A 1S6FA 1GJBB 1U6QA 4YOJA 4NIXA 1Y59T 2ZU2A 3SHCH 2STBE 1C2EA 2XC5A 1ETSH 1EOLA 3GDUA 2BLVA 4OS6A 1TA2A 2QC2A 3U9AH 2BD2A 1UVPA 1PPEE 3MI4A 3E90B 2FTMA 4X1SU 1TABE 3HGPA 1AFEH 1YPLH 3O8RA 2A4QA 1GJCB 1PFXC 1YCPM 3M5NA 2G8TA 5DP6A 3FFGA 3NPSA 4VGCC 2IOTA 1NZQH 1VGCB 4CRGA 2NU1E 2BOKA 1GMCG 1AKSB 1NS3A 2H9HA 3R3GB 3RXFA 1P2QA 3SU2A 1CT4E 1SBWA 3V0XA 2JKHA 4IC6A 1IAUA 1VJ9U 1JOUB 2XTTB 1TPAE 2H2ZA 1FUJA 2J9NA 2G51A 2ODYB 3S9AA 5EPNA 4ABHA 1IQNA 3A7VA 1O3OA 5FCKA 1BRCE 1QA7A 5L6NH 1AUJA 2ZFSA 2DE8A 1JRTA 2GT7A 3PV4A 2WUCA 1P03A 1UK2A 1O2GH 6GCHG 4UE7H 1FDPA 4A1XA 2FOGA 3SNDA 2VWMA 1TMUH 3QGNB 2O8TA 1GPZA 4IN2A 3EA9A 2ULLA 1BBRH 5T6FA 3EQ0H 4UD9H 1BRAA 4MG3A 1FQ3A 1SFQB 1O32A 3N7OA 2BLOA 2CXVA 5CMXH 1TNLA 2O8MA 1UCYK 2HGTH 5LPEA 4FUCA 4Q7YA 2B9LA 1LQEA 3PB1E 4E7NA 2TRMA 2SNWA 2Y7XA 1XXDA 1K21H 3SNAA 4K60A 2ZU1A 4BANB 4CRAA 1G32B 1ZRKA 4U2WA 3MTYA 1Y3VA 2W7UA 1G30B 3TGKE 1O2QA 4UONA 1GWAA 2EEKA 1YLDA 5DP9A 4J1YA 1ZSJA 1HCGA 2D2DA 1DICA 2ZPRA 2R9PA 2BDYA 2XCNA 3FVFB 1SGDE 2ZFRH 1EKBB 1PPFE 5EG4A 5JBBS 1G3EA 2PR3A 4H6TA 1G3CA 3QZQA 5TJXA 5A2MH 1PYTC 1UHBB 2BMGB 1BTUA 1P9SA 2THFB 5SGAE 5C67A 3GY8A 1MU8B 3SQHE 2FOHA 4XFQA 1SFIA 1AVWA 4JYTA 3T29A 4I8HA 3F6UH 4YLQH 1Y5AT 1G9IE 1ZTLA 3A8AA 3E6PH 4X8VH 4ZKOU 1Y3WA 2ZNKH 4WJG2 1MU6B 4ZKSU 1FY3A 2UUJB 2ODPA 2FOFA 2SGEE 3SNCA 4D7GA 1Q31A 1EP6A 1RGQA 1FIZA 2WPMS 1O3NA 4BTIB 1CSOE 2CMYA 1A46H 1IQKA 4IC5A 1QB1A 2BVXH 3MU8A 1Z8IB 2XNIA 3P8GA 1N6YA 3UREA 4INLA 2A5KA 1WYKA 2ZHQH 6CHAC 4JMYA 1P02A 4BTTB 4K8YA 2NU4E 1P2IA 3GDSA 4BTUB 2UUKB 4E05H 1SR5C 2BLWA 3RU4E 1O35A 5E2PA 1C5ZB 3M3VA 2ZPQA 3LGWA 1GBEA 1O2JA 1GBTA 1L1JA 3PYHA 1UMAH 2WINI 4NWKA 3OY6U 1UTOA 3ZV8A 3ZZBA 1F5KU 3T26A 1E34B 4ABGA 1TGBA 2Y82A 1KXAA 4JZ1A 5A8YA 3LJOA 1GGDB 1UCYH 3B8JA 1SGEE 5FPYA 1CGIE 1NO9H 1SGQE 5FPSA 1YLCA 2PSXA 1C5RA 2A32A 2EA3A 1FZZA 2VVUA 3ATIA 3U98H 3RLWH 4KELA 1UO6A 1KXDA 2PWXA 1TPPA 1BTHH 1J16A 1A5GH 1AI8H 3VFEA 3PO1B 1ESAA 1SLVB 3KIDU 3Q76A 2FP7B 1IQMA 3UFAA 5EQQA 2BLQA 1QBVH 1A3EH 1AY6H 4HGCA 4ZHAA 1ACBE 2ZHEH 4F49A 1D9IA 3H5CB 1F2SE 4X8SH 1OP2A 4XDEA 1GGDC 2ZA5A 4FU9A 4OGXA 1OYQA 1YBWA 4DURA 3ATLA 1BTXA 2ZG0H 1HJAB 1KXCA 1QB6A 3KNXA 1WU1A 3A83A 2J92A 1VITF 4DCDA 1WUNH 1A1RA 2A45B 1OOKB 3I77A 4ZAEA 1CO7E 1F0UA 4MDSA 1SOTA 1VR1H 4ZHMU 1ETTH 2XC0A 2AMQA 2QAAA 2GX4A 1FN8A 3KN2A 3A8BA 4AORA 2XBYA 3PO1C 3GYLB 3GY5A 3VB7A 1O2YA 1SOZA 3UPEA 4MNXA 5HMAA 1LMWB 1DWDH 3ZZAA 4GUXA 2G5VA 4ABBA 3MHWU 1E0FD 4MNVA 1C2LA 4K3JA 4YO9A 4X8TH 1V2UT 1NM6A 2BX3A 1TBRH 5A0CA 1SGCA 2A4GA 2ZDVH 3SW2B 1QBNA 1HJAC 3TGJE 1C2KA 2J94A 1AHTH 1AQ7A 4DGJA 2J34A 3EE0B 1HRTH 1GHXH 5K0HA 2PW8H 3M3TA 1AZZA 1ELVA 3MWIU 3PWCA 1BDAA 3OU0A 4AFUA 1D3QB 4DIIH 4MPWA 1YPHE 2FODA 3UY9A 1EAXA 1F5LA 1SI5H 2JETB 7KMEH 4X2XA 1MD8A 1K2I1 1IOEA 1GHAG 2VNTA 3P95A 1AIXH 1O5BB 1LHFH 1LVYA 2FS9A 4SGAE 4AGKA 2A7CA 3VXEH 1J17T 1ANDA 2AMPA 1WBGB 2VINA 4ABIA 4Y79A 3UOUA 1IQGA 3M5MA 2H5DA 4K1EA 1C5NH 1A2CH 1WAYB 1KY9A 4Y76A 2O9QA 4B2BA 3TPIZ 1DPOA 3UWIA 2BXTH 1FAXA 2ANMH 1QA0A 2JETC 3ZZDA 1TNHA 1XVMA 2H9EH 8ESTE 1PPHE 1LVOA 4JZIA 1ZJKA 3T2NA 3BTWE 4IMZA 3GCTG 4UFFH 3VGCB 1C5SA 4Y0YE 2F9PA 2WYGA 1W8BH 1ARBA 1QL7A 3RXIA 4A7IB 3VEQB 1HBTH 2ZDNA 1UTMA 2A5AA 1GBKA 3U8TH 1T31A 1C1NA 4THNH 3FP7E 2K1QA 1PJPA 2FLBH 2ZDAH 1FY1A 7GCHF 4D7FA 3RXAA 1GBHA 1XUFA 1BHXF 1GMDF 4CHAB 1UTKA 2J2UA 3IWMA 5F8TA 3ZV9A 1SC8U 2P3TB 1BBRE 4B75A 5AHGH 3LH1A 2V35A 3BEUA 4NIYA 3ZZ8A 4IBLH 3VGCC 1GJ7B 2GMTB 3PLPA 4Y8ZA 3TNTA 1KYNA 1O2HA 3A7ZA 1C1SA 2ZFFH 1GI0A 2ZGBH 2SGPE 2YNAA 1HNEE 1IQFA 1BMNH 3SV9A 1P2OA 1O3CA 3GY3A 3A82A 1MD7A 1EJNA 3KCGH 3KL6A 3RXBA 1L4ZA 4CHAC 1UTPA 4I8GA 1GBIA 4Z0KA 5F8ZA 6ESTA 1H8DH 2BD7A 2FIRH 4ISNA 4A5TS 1UVTH 1BRBE 1HIAA 4NFFA 1PQ7A 2GMTC 1F0RA 5TCAA 2UWOA 4GCHG 1BCUH 1XVOA 4NG9H 4UFGH 4WVPE 1ESTA 1HB0B 3QTVH 1YPGH 1HV7A 4K1SA 4RKOB 1K9OE 4ISIH 3C1KA 2LPRA 3A7XA 1C4Y2 1XUGA 3A80A 1GBFA 4FU7A 1LDTT 4KKDA 1GMCF 1CHOG 4X0WU 1PPZA 2PSYA 2AEIH 2HRVA 2ZHDA 1TLDA 2TGPZ 5EXLA 4K8BA 4B2AA 1E36B 1F0TA 4ABJA 3JZ1B 5HM2A 1UK3A 1THPB 5DKMA 4D9RA 1O30A 1AN1E 5C1YA 3SUGA 1O2KA 2ZFTA 1C2FA 2VIQA 4HTCH 5EQSA 2SGFE 3BEIB 2VWNA 1EZUC 3GYMA 4K5ZA 7LPRA 1XX9A 2PUQH 2BDBA 1QB9A 1NY22 2A4OA 1MTSA 2QXGA 5J4QA 3GY7A 1TOCB 3MYWA 3Q3YA 5T6GA 1O2MA 4JZFH 1B0FA 1SMFE 1TX6A 3S9CA 2AGIX 4OS1A 1FLEE 1XMNB 2ILNA 2TBSA 2RA3A 1EPTB 5HGGA 1ANEA 1NFUA 1MH0A 3HK3B 5AFZH 4RKJB 1QIXB 1VCQA 4LZ1H 4AB9A 1ZGIA 2A0QB 1LHGH 2ZGJA 4O03A 1GJ9B 1GDNA 1GJ5H 1M9UA 3A8DA 1QRXA 2H1UA 2AIPA 4I31A 1UCYE 1UTLM 1TQ0B 1QNJA 4IGDA 2ZFQH 1BTPA 3QN7A 4JYUH 1Z8JB 2ASUB 1O3MA 1HAYB 1WSSH 1ZTJA 2PLXA 3Q00A 1C9TA 3LGVA 1W7XH 3V13A 1O36A 1ZMLA 1DY8A 4WY3A 3RXGA 3IITA 3D62A 1BTZA 3PTBA 2G55A 1MTNB 3ZVFA 1OKXA 4X6MA 3QO6A 1EPTC 1WV7H 1ELTA 1OPHB 2D8WA 1SGFA 1GBAA 1V6DA 2ZCLP 3NXPA 1C5QA 1W0ZU 4CREA 5IYTA 1V2RT 2ZGXH 1B7XB 3FP8E 3EGKH 1LO6A 3P8OA 1QURH 1ZHMA 4MPXA 5DP7A 1S81A 1RXPA 1YP9A 1QY6A 2HNTE 1KSNA 3L3TA 2ZU3A 2ZU4A 1AE5A 5E0GA 3M7TA 1NROH 4Y11E 1P05A 1MZAA 3BG8A 1IHSH 1MTNC 1LKAA 1P06A 3AAVA 1C1TA 2ZECA 3SU6A 2R3UA 2SNVA 1XM1A 1P3EA 1GBDA 4TY7A 1TNKA 3GCNA 5TCCA 3D65E 1V2NT 5DO4H 4WH6A 5I25A 1TALA 1ZGVA 3G01A 2BDGA 1YCPK 4CH8B 2PKAA 3FZZA 1SGYE 1V2WT 3SHAH 1SHHB 1CGHA 3SOSA 1XUIA 3KQDA 3MO3A 1O5AB 2FOCA 2BM2A 1C2HA 1DY9A 1JRSA 1O3GA 2C8WB 1MCTA 2BDIA 1C5MD 1C1VH 5I46H 2F9UA 2NWNA 2VVCA 1KTSB 3GDVA 4FUJA 3SBKA 2A4RA 1GVLA 4OS2A 1P12E 2F9VA 1O0DH 2FPZA 1QJ6B 4GHTA 1THSH 1ELBA 3A88A 2BHGA 3TH4H 2WPHS 1CU1A 1DLKB 1HGTH 3RXTA 1WQSA 4Q2KA