1O3KA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3kA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3kA02
1MQ6A 4NWLA 3RC5A 1C9PA 2CF8H 4WH6A 1NZQH 5GCHG 2AMPA 2XYAA 1TNKA 2O8MA 2HWLB 3S9BA 1DY8A 5IYTA 4K69A 2WUCA 4AFQA 1G3DA 3KCGH 3HKIB 2XBVA 1NS3A 5C20A 4Z6AH 1BMAA 3F9HA 1G2MA 2VJ1A 4DY7B 2IPHA 4TWYA 2PLXA 4DT7B 1XUJA 1MAYA 1J14A 1EB1H 1GCTC 1EP5A 2VIQA 5DKMA 1DM4B 2A2QH 1KXFA 3ZVDA 5TCCA 3O8DA 5A8YA 3S7KB 4ZH8A 1F5LA 1UVTH 3ZVFA 4ISIH 1GHZA 1C9TA 1L1GA 4H4FA 1MZDA 4CBNA 4FUDA 2VIWA 5ESTE 3RU4D 2KAIB 2HPQH 1BJVA 2ZFPH 1LHCH 3URDA 1D3DB 1K22H 1O3OA 3U8OH 1TNIA 1RFNA 2VVVA 4WMFA 1SLUB 2GV6A 3K9XB 4H6SB 4K1EA 1EZSC 3RXFA 2THFB 3SUFA 1GJ4H 3QTVH 3H7OA 1S82A 3P17H 1G36A 4OS4A 3D65E 1MD7A 4JCNA 5C3NA 5JDUB 3E6PH 4FUCA 1FMGA 4AGKA 3NKKA 3RXHA 1PPFE 4ZKOU 3BG4C 1VCWA 1UVSH 3E0NB 4IN1A 3TH4H 1SFIA 4Y7BA 1HJAB 2NU3E 1P03A 3TK6A 1G3BA 3FP7E 5DK1A 2PTNA 2ZPSA 3CENA 3A80A 1SGQE 2ODQA 3NCLA 5FAHA 1GBEA 4MNWA 4BANB 1QA7A 2QC2A 1NU7B 3A7XA 1EJAA 2A5AA 3SORA 2NU4E 2EI7A 1GMHF 1MU8B 1SGNE 1UMAH 1Y3VA 3MU5A 3NPSA 2J92A 1GBMA 3PROA 4B75A 1TMTH 2QV1A 1LHFH 1INCA 2BDCA 5T3HA 3B9FH 3SOSA 1EUFA 4DG4A 3PLPA 1SLVB 2ZGXH 2VH0A 2ZQ1A 3STIA 3MU1A 1BMMH 1GJ8B 1O2MA 3U69H 3TH3H 2QCYA 3RC4A 3ZVEA 1OS8A 1EAXA 4A5TS 1GCDA 2LNCA 1PYTC 5C1YA 1DLEA 1VR1H 1C5XB 5F8ZA 1UTLM 1GMDF 5EW2H 3UQVA 4JZ1A 1FZZA 4VGCC 4AG2A 1CA8B 2W3IA 2BDHA 4WF8A 1BDAA 1EAUA 1ZPZA 4ZROA 4X8UH 3UPEA 3G01A 4KGAA 1GWAA 1QRZA 1LVYA 3QX5H 1O2HA 1GDQA 2H5CA 1T4VH 5GXPA 1P2OA 1W8BH 3TGJE 2F9UA 1QGFA 2VB0A 4GSOA 1KY9A 4GVUA 1N8OB 3RLWH 1P10A 1UVUH 2BB4A 3HKJB 4ABGA 2D2DA 5FPYA 1SQTA 1UTMA 1DE7H 1SOZA 4RSPA 3P6ZB 5LH8A 1AKSA 2XC5A 3RXGA 5EQQA 4JK5A 4B76A 4MQAA 3ATMA 4INLA 2ODYB 3U98H 1C5NH 2ANYA 1C4V2 1O34A 1TX8A 1O0DH 1BIOA 2ZU1A 1HAZB 3Q00A 1GI4A 4R8TB 3ATLA 3RMNH 4U01A 3Q76A 1GJBB 4Y7AA 1V2VT 1FY3A 2Z3CA 1ANEA 2H9EH 3M5MA 4NG9H 1P05A 4F49A 3E1XB 5FCKA 4DGJA 1SBWA 2PGQB 1O31A 1SSXA 3HK6B 1UTPA 3LGUA 2CV3A 4JZDH 1BUIA 1H8DH 1MKWK 1WQSA 1H4WA 2F9NA 2PUXB 4CHAC 1MAXA 1AO5A 2XC4A 2WPIS 1KXDA 2C8ZB 1VGCC 1MCTA 1P04A 1B0EA 1FV9A 1FY5A 2Y6TA 1UVPA 5EQRA 5K0HA 4R0IA 2VGCB 1UTNA 3ZZCA 1JRSA 3SI3H 4TWWA 1QBVH 2ZCHP 3TIUA 3A8CA 4ASHA 1TABE 2OQUA 1TPAE 1SLXB 2ZF0H 1SC8U 2ZDLA 2HALA 4Y8YA 2HNTC 3A88A 2BX4A 3SNBA 2FIRH 3LH1A 2G5NA 3R0FA 1SGTA 1T8LA 2FP7B 3UWIA 2PW8H 1QL7A 1QL9A 1Z8GA 4KTUA 1C1SA 3GY5A 1GG6B 3BIUH 2G51A 1D3TB 3GY3A 4JZEH 4CR5A 1O35A 2IJOB 1EAIA 1EAWA 1O5DH 1O2RA 1FQ3A 4DIIH 3I77A 3E90B 1DANH 4E06H 4YT6H 1NRPH 1MTVA 4CR9A 1ELCA 1GI1A 2QY0B 4DIHH 3BG8A 4CH2B 2AFQB 2OQ5A 3MYWA 2JETC 3M7QA 5EGMA 2OTVA 4X6OA 1O30A 1SGYE 2G4TA 4B71A 1EX3A 1KXCA 1AE5A 1O3GA 4D8NA 2AMQA 1DLKB 4IC5A 4FUHA 3ATKA 2SGEE 3MI4A 5A0BA 1VITG 4BOHA 1UTKA 2ZHWH 1GHBF 2FOHA 1DSUA 2QXGA 3SU1A 1WV7H 2ZPQA 4OS1A 1TA6A 2QAAA 1LQEA 2ALPA 1NPMA 4O3UA 2TGPZ 4AYYB 3F68H 8GCHF 1QHRB 1WTGH 2TGDA 5LPRA 1H9HE 1LMWB 3UNQA 3DUXH 1TNLA 4Q7YA 1S85A 1C2IA 1YGCH 1NC6A 2OD3B 4D9QA 3OTJE 4TY6A 4NA9H 1YF4A 3TU7H 3A7VA 1SVPA 5C1XA 1HYLA 1BBRH 2FESH 1E37B 1K1NA 2P59A 1W3CA 3KQEA 1F0UA 1Y8TA 1C1PA 2PV9B 4K3JA 3SV6A 4LK4A 2HRVA 1CSOE 1PQ7A 3IG6B 4OS6A 4IGDA 2TRMA 2VVUA 2H6MA 3T29A 4HZHA 3MOCA 2OBQA 1QTFA 1C5QA 3STJA 1DDJA 3RXLA 5CE1A 5JB8S 2BZ6H 3RC6A 1RS0A 1LCYA 3GY7A 2Z3DA 2D1JA 3SU3A 1BB0B 3UOPA 3ZV8A 1MD8A 2BDYA 1C2GA 3MMGA 1QURH 3QUMP 1K1MA 5HM2A 2A5IA 2CN0H 1EQ9A 2ZG0H 1W7GH 3GYMA 4X1PU 1NFXA 1HXFH 3UQOA 2VWLA 1G37A 2GKVE 1Q31A 3P92A 2RA0A 1CVWH 4Y0YE 3W95A 4BXSA 2JH6D 4IMZA 1VZQH 4ABJA 1TGCA 2SFAA 4CREA 1KIGH 1O3PB 3M7TA 4H42U 3RXQA 3RP2A 4WJG2 1AD8H 3PLBA 1SB1H 4TPYA 3A8BA 2FOFA 2BDBA 5JBTA 2SNWA 1IAUA 1TMUH 1FIWA 1O2PA 3UOUA 4LZ4B 1ABIH 2OCVB 1JMOH 3RM0H 1K1PA 3ZVGA 1K2I1 5LPFA 4KTSA 4MLFB 1AB9B 2AGGX 1NFUA 4GAWA 2F9BH 5DP4A 1WBGB 3KF2A 1BMLA 5FX5A 4XOJA 4M7GA 2BD5A 1IQMA 3TK9A 3R3GB 5A8ZA 3DFJA 3E16B 1P2NA 2VWMA 3E3TA 3L3TA 2BQWB 5L2YH 3A8DA 1ZTJA 1WAYB 3V13A 1WUNH 4YLUA 2ANMH 6CHAC 2EI6A 1UJ1A 1YPHE 2PKAA 1BTUA 5GIBA 4BAHB 3RMMH 4ABHA 2BVXH 1RIWC 3UR9A 3RXDA 3TNTA 4ABIA 2FS8A 4ZAEA 1P12E 4IMQA 5FXLA 4BAMB 1MTNC 2XWAA 4UDWH 3VPKA 1HIAB 5F8XA 5K7RA 1P0SH 1O3LA 3RXOA 3ZZ8A 3FFGA 1W0YH 1S6FA 1GBTA 1XVOA 1CA0B 1KSNA 2GMTC 2JKHA 1EB2A 1AUTC 1ETSH 4KELA 2P93A 2CJIA 2W7SA 1WU1A 4AOQA 5C67A 4ABEA 2VIDA 1C5WB 2FTLE 2R2MB 7ESTE 1A46H 5I46H 1M9UA 2BVRH 3SJIA 3BN9A 1PPBH 2XTTB 1K28D 1DUEA 2UWLA 1V2ST 3QGJA 6GCHF 4WVPE 3QN7A 1GI7B 3T28A 2CGAA 1O2SA 1GVKB 1Z1IA 2P8OB 3KQBA 2PKSB 1CBWC 1ELAA 1O5FH 1PPEE 1IQIA 1YPLH 1YM0A 1AE8H 1IOEA 2A0QB 1GGDB 1A3EH 1ACBE 3LIWA 2UWOA 3SJ8A 4X1QU 3AVZA 3ZZ5A 1O3JA 3GDVA 2XNIA 3HK3B 3PO1C 1C2MA 5E2OA 1V2WT 3SHAH 2QF3A 1D9IA 1J9CH 1GBCA 1IQKA 4HFPB 1GBKA 2A7CA 3SNAA 1O3BA 3H7TA 1Y5AT 4MNXA 4AFZA 2ZKSA 1EPTA 5JPMH 4CRBA 1XUKA 1LO6A 3M37A 1UCYE 1FN8A 2QXIA 1V2MT 4X8SH 1DXPA 1O2KA 5A2MH 1KXBA 1SGPE 1ELBA 2B5TB 5GJ4B 3TJOA 7KMEH 1JIRA 2BMGB 4O3TA 4BTTB 2WPMS 1N6XA 3TJUA 3LKWA 4ABBA 5EXMA 2W26A 2ZDAH 1N6YA 2FOCA 2ZC9H 4Y0ZE 5L6NH 2ZPRA 1O3CA 1GL1A 2O8WA 5GWZA 1D6WA 3FP8E 4TPIZ 3V12A 5HYOA 1GI6A 1O3AA 2Y7XA 2B7DH 2Q1JA 3UTUH 2WPJS 4XE4A 1K1JA 3LONA 2ZHDA 1XVMA 2HNTF 3TGKE 2O9QA 2GDDA 3BTGE 2R0LA 4ZKNU 2GZ9A 1O2VA 2AGEX 1TNHA 1FY4A 4GLYA 1ESAA 1ELTA 3EE0B 2H5DA 1ZSLA 1OOKB 2FM2A 2R0KA 1OYTH 1GCTB 4ZHAA 5PTPA 1TRMA 1H9IE 6LPRA 1BRCE 2BDGA 1HJ8A 1K1LA 4YT7H 2V6NA 2ZGBH 2A1DB 4K2YA 2BTCE 1OWIA 4J2YB 2TPIZ 1YYY1 3ZVAA 1MKWH 2B0FA 2ZCKP 4DCDA 2ZGCA 1IQHA 1UVOA 1ZRBA 2FWWA 2PKAB 1P8VC 2G00A 4BAQB 2P3UB 1AQ7A 2ZGJA 4JYTA 3S9CA 1MUEB 2CXVA 1UK3A 3U9AH 2FS9A 3MU8A 3K6YA 2XW9A 2TGAA 1OP8A 1KLJH 1O3HA 1O5GH 1JRTA 3IWMA 2GDEH 1K21H 1OWJA 3VB3A 1TFXA 1A1RA 5T6DA 3BG4B 1WCZA 3LT3A 1XUIA 4Y8ZA 2J9NA 2LPRA 2PR3A 1J15A 1EP6A 1AVXA 1A0JA 1XUFA 1QB9A 3MNXA 1TPOA 4NWKA 3SGBE 1GJ6A 1YKTA 5FX6A 2YOLA 1LDTT 1ZSKA 4YOIA 1C2EA 2AEIH 3K6ZA 2EEKA 5ESBA 1THSH 5DPAA 1DS2E 1TBQH 5H4IB 3ZZBA 1LPGB 1UK2A 3RLYH 3S69A 2ANKH 3FZDA 1V6DA 2QXJA 1V2JT 3BTTE 4JZIA 5DP7A 4MPXA 2NU2E 1O3KA 1HAVA 2Y81A 3EA9A 3RMOH 4X2XA 4WXIA 1C1NA 4JZFH 3T5FH 2EC9H 4B1TA 1S84A 1QIXB 1AGJA 3BTDE 2HPPH 1MBQA 1AZZA 2VIVA 1Y5UT 1CHOF 1BTPA 4KKDA 5HGGA 1HCGA 3SUGA 3A81A 3A8AA 2BY9X 3HGPA 3PMHB 4NIVA 1YPMH 3D23A 1TNGA 2PHBA 4WH8A 5TJXA 4MPUA 3UIRA 3M3TA 3SI4H 3MTYA 4LOYH 4VGCB 3RU4E 1GJDB 1LPZB 2NU1E 7LPRA 4YOGA 1D6RA 2PFEA 1UHBB 2G52A 1SQAA 3U1IB 1C2FA 2OUAA 1GL0E 3UWJH 1KTSB 1HJAC 2TBSA 3MO9A 1ZMLA 1SL3A 1NN6A 5JBCS 1PYTD 4YESB 3BEIB 1SGFG 1DT2A 1YPKH 2BLWA 3E0PB 4CRDA 4F4OC 5E0JA 5DG6A 5JYIA 2WV4A 1HNEE 2EA3A 3SJOA 1C5LH 1OPHB 1EPTC 1TGBA 1UTQA 1O5CB 4MG3A 4X6MA 3LJJA 5TCAA 4ABFA 2BOKA 4NFFA 1QQUA 2AS9A 4AB9A 1ARBA 1KTTB 2ZFTA 3A85A 3QZRA 8GCHG 3AW1A 1V2QT 1KYNA 1ZHRA 4E7NA 5CHAB 5DP3A 1ANDA 1MBMA 4TY7A 1VCQA 3TH2H 2SGQE 3TVJB 3F9GA 1GMCG 5A09A 4K5ZA 3RXIA 1V2TT 4XBBA 2RA3A 4OGXA 1RRKA 2C90B 3GDSA 1GJCB 3DHKH 3OU0A 3M3SA 3ZVBA 2VU8E 4FU8A 1V2PT 2P94A 3RXJA 1Z8JB 4NGAH 4DW2U 1HUTH 4XFQA 2CMYA 1HAHH 5GCHF 1ZPBA 1BRAA 1HGTH 2SGDE 4CHAB 2BY6X 2G8TA 2ZFQH 1LHEH 1ELDE 4NIYA 1HLTH 1BOQA 2YNAA 1OKXA 4FU9A 3ZV9A 2VWNA 2PSYA 3BSQA 2C3SA 2FDAA 1IQEA 3ZZ7A 1SFQB 2VWOA 1O5AB 1NRQH 1N8OC 3P8NA 3RUOA 2VNTA 4BTIB 4AYVB 4Q2KA 1DSTA 3GCHB 3KL6A 1CU1A 2ZU2A 1GI3A 4NA7A 3AAUA 1XX9A 2FX4A 2F91A 4DURA 1O2LA 1HAPH 1A5IA 2P3TB 2WUBA 1P02A 1YC0A 4INHA 1ELVA 1V2UT 3VXEH 1C5TA 2A31A 3PTNA 3SN8A 1CGIE 5FPSA 3BV9B 1HBTH 1C5MD 3DA9B 1EZQA 3SNCA 1P57B 4UFFH 3SUDA 4FU7A 5HMAA 4X6NA 4FVDA 4I8KA 1GHVH 1C2JA 4A1VA 4Q7XA 4GHQA 1TAWA 1Z1JA 1V3XA 4SGBE 2JETB 1LPKB 3UR6A 3SNEA 2ASUB 3RXAA 2GZ8A 5EG4A 1AFQC 1KDQA 3P70B 1C2DA 1C5ZB 2A4OA 1XUGA 1DICA 2Y5HA 5C5OA 4MNVA 1SG8B 4GHTA 3MHWU 3TGIE 3LGIA 3V0XA 2CHAC 3QK1A 1QB1A 2BDAA 4I8LA 3LOXA 1SOTA 4NZQA 1S5SA 3PYHA 1QQ4A 3E91A 1W13U 1CE5A 2VGCC 1TMBH 3L33A 3NK8A 1QJ7B 3AAVA 1HAIH 2BLOA 2QN5T 1J17T 1O3IA 4CBOA 1FONA 1O2IA 1TGSZ 2QA9E 2XXLA 3U1JB 3S0NA 2XBWA 2J38A 1GBIA 3S7HB 1F0SA 3QDZB 4LZ1H 1NU9A 5A8XA 1TGNA 3EA8A 1TPPA 1XKAC 1IQLA 2VIOA 5EODA 2BLVA 2HOBA 1AI8H 3KIDU 4BTUB 1ZPCA 3GCTG 1UO6A 1BRBE 1NROH 3PV4A 2OXSA 3P8FA 3UY9A 2ESTE 1WSSH 4DVAU 2A45B 2Z9JA 3LGTA 2GCHF 5BRRE 3Q77A 1LVMA 2V35A 4XBCA 2JH0D 4K8YA 1AFEH 4CH8B 2G81E 2G4UA 1UCYK 1O2UA 4B2CA 3T27A 5DGJA 2ZQ2A 3OX7U 3IITA 2BD7A 3ODDA 1RTKA 1EZXC 3N7OA 1P11E 3FZZA 3KNXA 1PPZA 2FI3E 1AKSB 4AZ2B 3URCA 1E0FD 1ABJH 3GY2A 1G2LA 5AHGH 3BTWE 1FY8E 2ZO3H 3VB7A 2FTMA 1NO9H 5SGAE 3DT0H 4X2WA 4AG1A 3EGKH 1KXAA 1EOJA 1GI9B 1TE0A 1VJ9U 4FVBA 2J4IA 4IC6A 1DX5M 1LKAA 1O3NA 2ZHEH 1C2KA 4SGAE 3MH4A 2FYRA 4YLQH 1ZHPA 2RDLA 1C5RA 4XDEA 1AIXH 1ID5H 3LGYA 3SU4A 2R3UA 3LJOA 2XBXA 2SNVA 1B7XB 1LTOA 2IOTA 2WYJA 2Z9LA 3L6PA 3V7TA 1E38B 3RXPA 3VGCC 1TA2A 3RXBA 1JBUH 4MPWA 1YPHC 1T8MA 2F9OA 3F9EA 3E8LA 2ILNA 3SNDA 1S0RA 2XC0A 2ZTYA 1LHDH 3D49H 1ARCA 1IQFA 1PQ5A 3T62A 2V3HH 3UREA 3ELAH 1V2RT 2Y80A 2GCTB 3EAJA 5ETXA 3EDXB 3TJVA 3NXPA 1SR5C 4FUJA 4X8TH 1A5GH 1T31A 1GBJA 4NSVA 5GPIB 3RDZA 1JWTA 1JIMA 1O5EH 4UFGH 4WXVA 1IHTH 2FI5E 2PTCE 3WY8A 4UD9H 2Z6BD 1CHGA 4X6PA 3EYDA 1RIWB 2P3FH 5DP6A 2O8LA 2SGPE 1HRTH 2FPZA 2BOHB 1MTNB 1PQ8A 1PPGE 1L2EA 1DITH 5AF9H 1BT7A 1BMNH 1S81A 5G4BA 2P95A 3MH5A 5BPEA 1CT4E 1FPCH 1G3CA 4FUEA 3LC3A 1FAXA 1CT0E 1EXFA 4NIXA 1VJAU 1OP2A 1P09A 2J94A 1BITA 3ZZ9A 1ZGIA 2BY8X 1VCPA 3LU9B 4CRGA 2UUFB 4AFUA 9LPRA 1B5GH 2OBOA 1O33A 2Q6GA 1CT2E 1NRRH 1SPJA 1YLCA 1AWFH 3BIVH 2C4FH 1AY6H 1TPSA 2A4RA 1W7XH 2GZ7A 3K2UA 5C1UA 3ZYEA 4MNYA 1SGCA 1EJMA 1MTUA 4I8GA 1B0FA 3MNBA 1FIZA 1YPEH 4O9VA 3KQDA 3RXKA 1ELEE 1O2YA 1MMJN 4XBDA 1F0RA 8LPRA 2Q6DA 2SGAA 1K1IA 3RXVA 3OYPA 1A0HB 1V2OT 1AN1E 1NFWA 1TWXB 1ZJDA 5DJ7A 4CRAA 1ZLRA 3GISB 4H6TA 1WTHD 2BLQA 3D62A 2HLCA 2BHGA 2GX4A 2FOBA 4D7GA 1OWHA 4Z0KA 2H9HA 1P01A 4INKA 4X2YA 2OC7A 1UTOA 2KAIA 2ZCLP 1G30B 1QRWA 3SV8A 1QCPA 2FOAA 3ESTA 1GBDA 1NRNH 2BYAX 4ZHLU 2AMDA 3PO1B 1FN6A 4Y10E 1GI0A 1YCPK 2OINA 1G32B 2AH4X 5LPEA 2I6SA 1GBHA 3SJ9A 1HFDA 2PSXA 1NRSH 2ZFFH 1PJPA 1TRNA 2Z9KA 4JMYA 1O37A 4FUBA 1HDTH 2PGBB 2V3OH 1TRYA 3PMJA 1ZSJA 1C4U2 3SU0A 1HAXB 5FHTA 1BJUA 4IW4E 4B73A 1GMHG 2O8TA 3ATWA 5HM9A 2C8WB 1G3EA 2Y5FA 3PTBA 4TYDA 1CHOG 4RN6A 1GDUA 1FPHH 1DVAH 1H8IH 3NZIA 1D3PB 1LQDB 1DY9A 3ZZAA 1F7ZA 2ZZUH 4OS7A 2ZFSA 1YPJH 1O32A 1SGRE 1HJ9A 2B9LA 2BD4A 3A7WA 3MH6A 2W5EA 2BD8A 2QIQA 3GY6A 1P2KA 3HPTB 1O36A 2A32A 3LDXH 1K1OA 1RTLA 1YLDA 3VFEA 2C8YB 2RCEA 1GHYH 1ZYOA 3A82A 4UE7H 3P95A 2OC1A 3SZNA 3SQEE 1GMDG 2C93B 1P3EA 3QTOH 3DFLA 3AW0A 3LC5A 3MFJA 4WY3A 5JBBS 3QZQA 1EKBB 2H9TH 1QBNA 1MH0A 1NFYA 1O2XA 3C27B 2SGFE 3MH7A 5T6GA 1THPB 1RXPA 1RJXB 3F6UH 2ZTXA 3OSYA 1TLDA 4ZKSU 4NA8A 2FZZA 1BTHH 3I78A 3UUZA 1F5KU 2XCNA 1OSSA 2F3CE 1GJ5H 4UFEH 5T6FA 3SJKA 3T25A 4UFDH 3M5LA 1P2JA 3K65B 3SQHE 5AFZH 3JZ2B 2J34A 4HI3A 4Y11E 1FLEE 3M3VA 1ESBA 1DWEH 1U6QA 2VH6A 1MCVA 2BD2A 3A89A 1NT1A 1W2KH 4HGCA 4MTBA 1PFXC 1KLIH 1XKBC 2Z3EA 3A83A 2G5VA 4GCHF 1AMHA 1O2QA 5ABWA 4B2BA 1BA8B 3EA7A 2ZU3A 1ETTH 1FUJA 2XCFA 5EOKA 1AU8A 2Y82A 1ELGA 1CO7E 4X2VA 3CS0A 5E8EH 1OP0A 1C2HA 1A3BH 4FUIA 2A4QA 1DWDH 3SU5A 1TOMH 1ZGVA 5J4QA 4Y6DA 4B2AA 1ANBA 4X8VH 1QNJA 7GCHF 4Y76A 2R3YA 3OY6U 1DWCH 3ZZ4A 1GHWH 4D76A 1GI5A 3TLOA 2F83A 3VEQB 1Z8IB 3RXCA 3ZZ6A 1TNJA 2C8XB 3A84A 4YZUA 4ZKRU 3GYLB 2PWXA 2H2ZA 1GHAF 4IS5A 4B74A 1IQGA 5DP5A 1KLTA 3M35A 5EU8A 1BTZA 3F1SB 2BQ6B 1MTSA 1LHGH 2BY5X 1FXYA 2ZHQH 2FLRH 2ZDVH 1BQYA 2GT7A 1BHXF 3KGPA 2ZHFH 3P8OA 2GGVB 4WWYA 5C5NA 1G9IE 1XXFA 3RXRA 2WPKS 5B6OA 4KTCA 2OC8A 1UK4A 2Z7FE 1P9UA 1C5OH 3GICB 3SW2B 3I29A 1PQAA 2FO9A 1PPCE 1W11U 4D7FA 4UEHH 2OLGA 3BEUA 2UUYA 5F6MA 3GY8A 1OWDA 2AIQA 2M5TA 1W10U 3HATH 1WYKA 2PUQH 4O97A 1SQOA 1EPTB 1E35B 2BXTH 1XUHA 3SU6A 1DPOA 1F5RA 3RMLH 1THRH 3RXTA 1GI2A 4FUFA 4YM9A 1Q3XA 1IHSH 5DO4H 1QR3E 1ORFA 2ZIQH 4ISLA 1QB6A 1OXGA 1UCYH 1NESE 5L2ZH 3CS7A 1C1UH 2F9VA 3M36A 3SGQE 1GHBG 2AYWA 3LGWA 1ELFA 2FMJA 1ZMJA 1TQ0B 2JH5D 4ZHMU 1DWBH 2ZA5A 4RKJB 1LKBA 2ZU5A 5DP9A 3VXFH 2P16A 3GCOA 4Y79A 3O8RA 4MVNA 4DOQA 4OS5A 2ZU4A 1ZZZA 1Y3WA 3A86A 1D3QB 2XRCA 3MU4A 2W3KA 4ZXXH 1MKXK 1O2WA 2GCHG 3TK5A 5HXFA 4NZLA 1BTWA 1CGHA 5GDSH 1Z6EA 1O2OA 2ZTZA 1P06A 1TONA 2D26C 1MZAA 2VVCA 3SV2H 2RG3A 5EQSA 3A87A 3RXEA 1O2JA 2ZGHA 2AIPA 1UTJA 5JBAS 1BBRE 4X1RU 1AWHB 2ZNKH 1Y3XA 4AB8A 3MNCA 4I8JA 1LVBA 1NY22 1TOCB 1LVOA 1VGCB 3VB6A 1BTXA 5A0AE 4ABAA 3ZYDA 1L1JA 1TIOA 1QBOA 1QA0A 2FI4E 3B23B 3SBKA 4OS2A 2GT8A 2BDIA 4ZUHA 1A0LA 1KXEA 4J1YA 2FOEA 1O2ZA 3BTME 5EPNA 1QJ1B 1Z6JH 2R9PA 5CHAC 1L4ZA 1GHXH 1HAYB 5FCRA 3TPIZ 1DOJA 1MU6B 2BX3A 3B8JA 1F92A 1GI8B 3VB5A 1O39A 1P9SA 3TITA 2HVXA 3MWIU 3PWBA 1QL8A 4I7YH 2BZAA 3GOVB 1ZTLA 1TX7A 3O8CA 1A61H 4A1TA 3GCNA 1AFQB 2B8OH 4HTCH 2EI8A 1H1BA 1AVWA 1C1OA 2ZECA 1SMFE 4E05H 1AZ8A 1RD3B 1S6HA 3SO3A 2WINI 2CHAB 1GDNA 5FPTA 3RXMA 1MTWA 2BXUH 1DXWA 3QGNB 4JYUH 5J4SA 2QYIA 3LPRA 4K60A 4A7IB 1HAVB 1OX1A 1T32A 1N1LA 3ATIA 5EXNA 3FANA 3MO6A 3JZ1B 8ESTE 1NM6A 3M7UA 1Q2WA 1Y59T 1RGQA 3PMBB 1DUAA 4I32A 1YP9A 4BNRA 1BRUP 2FLBH 3GCHC 1SGEE 3PWCA 3KHVA 1GBBA 3H5CB 2GVFA 1Z7KA 1HPGA 1C2LA 1QFKH 4ZXYH 5A0CA 4K8BA 5EXLA 2ZDKA 2BVSH 1O5BB 4LXBH 4Q7ZA 1YBWA 3Q3YA 5EPYA 4JYVH 1EATA 4K1TA 2CF9H 4I31A 2Z9IA 2ZDMA 1ZTKA 3PM3A 4CRFA 3SV9A 3SU2A 4MDSA 2GD4B 2FEQH 1FJSA 1TX6A 1O3DA 2TGTA 4FUGA 3ZVCA 4WMDA 3PLKA 3BTHE 1YCPH 2ODPA 1GG6C 1TYNA 4A92A 3DD2H 1HIAA 1BHXB 3SV7A 4DJZB 3KQCA 2IN2A 3RU4T 2HNTE 3PB1E 4X1SU 2AERH 5E2PA 3ZZDA 2NWNA 3TJNA 1OWEA 2H1UA 4IN2A 3M5NA 2A7HA 3HGNA 3BTKE 1BCUH 1ANCA 2DE8A 1E36B 1SI5H 1C1QA 1GVLA 6GCHG 1E34B 5I25A 2V0BA 4RKOB 2F9PA 1GMCF 2A2XH 1IQNA 1FNIA 1L0ZA 3FVFB 3VGCB 1XM1A 3C1KA 1QY6A 2UUKB 4I33A 1YCPM 1F2SE 4OGYA 1S0QA 1C1MA 1O2TA 2NU0E 1P2MA 2R2WU 1GJ7B 1AVGH 3Q3XA 5EW1H 1BTYA 1VITH 4Y8XA 1O3EA 3P8GA 4JK6A 3U8TH 1FY1A 1SGFA 3SHCH 3UNRA 1WOFA 3MNSA 1A7SA 5E0GA 2Z94A 3LH3A 1XXDA 4AN7A 2GTBA 2Y5GA 4XSKU 4ESTE 3BTFE 4ISOA 2J95A 2ALVA 2DE9A 1Y3UA 2FX6A 1W0ZU 5IDKA 4X1NU 4Q80A 2A5KA 3Q3KA 1EZUC 1HAGE 1JXPA 4AX9H 1A2CH 1OWKA 3NUMA 6CHAB 1EJNA 1GBLA 4ISHH 1GBAA 3ZZ3A 1SLWB 2ZP0H 1OYQA 1WQVH 1C1VH 1ZMNA 2OP9A 1W14U 2VINA 5AVDA 3T2NA 1GBFA 1C1WH 3KN2A 3A7TA 1O3MA 2QF0A 4BAOB 2STBE 1Y5BT 3V3MA 1HV7A 2WYGA 2XWBI 4GUXA 1SHHB 3RM2H 1KDQB 1QJ6B 2ZI2H 2WPHS 4WMEA 3S9AA 1P3CA 3TNSA 2QXHA 2A7JA 1QRXA 1V2NT 2TIOA 1C4Y2 4K1SA 2GP9B 5DP8A 3FAOA 1V2LT 3SUEA 2WV5A 3F9FA 1TGTA 1Z8RA 2GMTB 2GCTC 5FBEA 1T8NA 1PPHE 1CQQA 2FOMB 1H9LB 1XMNB 1RTFB 1TBZH 4ZMAH 4KP0A 1O2NA 3T26A 3O8BA 3AASA 1MQ5A 2UWPA 2BD9A 3ITIA 4GCHG 4Y71A 1X7AC 1C1RA 2BQ7B 3BTQE 5F03A 1AB9C 1C5UA 4THNH 3M5OA 4ABDA 2UUJB 3UFAA 4CRCA 1ZRKA 3A7ZA 3BTEE 1P2QA 1SGIB 3EQ0H 1C5VA 3KEEA 3MU0A 1C1TA 1T4UH 5L30H 3ODFA 4U32A 4A6LA 2QGRA 1CGJE 4FXGH 1VITF 1AHTH 4BAKB 4O03A 7GCHG 1FI8A 1IQJA 1CBWB 1HAOH 9ESTA 4AGJA 5LGOA 3GDUA 4D9RA 1T7CA 1O3FA 2ZDNA 3GCTF 1HB0B 2ZEBA 1SGDE 1Z71A 4NFEA 3UNSA 2WPLS 1GPZA 3NWUA 5JB9S 1ZHMA 4IBLH 1GHAG 2BY7X 4AORA 2J2UA 3FP6E 1SHYA 1P2IA 2I6QA 3RXUA 1D4PB 4NCYA 2O8UA 2Q6FA 1CA0C 2FXRA 4A1XA 1TB6H 4BXWA 1L4DA 1GJ9B 4PROA 3SGAE 2ANWA 4NIWA 5C2ZA 2G55A 4YOJA 1EASA 1JOUB 1V2KT 5FBIA 1W12U 1C5YB 1O38A 2Z9GA 2BM2A 1GVZA 2HGTH 2AGIX 4I8HA 2GV7A 2ZWLH 2VIPA 3QLPH 3VB4A 2BD3A 5CMXH 3RXSA 3PMAB 4MPVA 1DFPA 1TQ7B 2YNBA 4U30A 1J16A 2XBYA 1FAKH 4U2WA 3QWCH 1L1NA 1GJAB 4ISNA 3BEFB 1MKXH 1K9OE 2A4GA 2P8OC 2ULLA 2W7UA 1YPGH 2FODA 3ENSB 4UONA 2Y7ZA 1BBRK 1ZR0A 2PKSC 1TBRH 3LGVA 1C5SA 3A7YA 5AFYH 2K1QA 3OY5U 1AUJA 1GGDC 1UHBA 1J8AA 5E0HA 1T8OA 3BF6H 2FOGA 2STAE 1ESTA 6ESTA 1ZOMA 1EOLA 4YO9A 8KME2 4E7RG 3GY4A 4YTAA 1BZXE 4AFSA 1A4WH 2DUCA 2D8WA 3MO3A 2OC0A 1C5PA 1NTPA 4NSYA 4QT8C 5F8TA 3CP7A 3W94A 4X0WU 1F0TA 2ZFRH 3QO6A 3U8RH 1ETRH 1HXEH 1TALA 1FDPA 1O2GH 4GPGA 1Y3YA 2FYQA 1A5HA 3M61U 1ZJKA 1S83A
chains in the Genus database with same CATH superfamily
1MQ6A 4NWLA 3RC5A 1C9PA 2CF8H 4WH6A 5KEDA 1NZQH 5GCHG 2AMPA 2XYAA 1TNKA 2O8MA 3NRLA 2HWLB 3S9BA 1DY8A 5IYTA 4K69A 2WUCA 4AFQA 1G3DA 3KCGH 3HKIB 2XBVA 1NS3A 5C20A 4Z6AH 1BMAA 3F9HA 1G2MA 2VJ1A 4DY7B 2IPHA 4TWYA 2PLXA 4DT7B 3UAIC 1XUJA 1MAYA 1J14A 1EB1H 1GCTC 1EP5A 2VIQA 5DKMA 1DM4B 2A2QH 1KXFA 3ZVDA 5TCCA 3O8DA 5A8YA 3S7KB 4ZH8A 1F5LA 1UVTH 3ZVFA 4ISIH 1GHZA 1C9TA 1L1GA 4H4FA 1MZDA 4CBNA 4FUDA 2VIWA 5ESTE 2YMSC 3RU4D 2KAIB 2HPQH 1BJVA 2ZFPH 3OFND 1LHCH 3URDA 1D3DB 1K22H 1O3OA 1KMHB 3U8OH 1TNIA 1WDIA 1RFNA 2VVVA 4WMFA 1SLUB 2GV6A 3K9XB 4H6SB 4K1EA 1EZSC 3RXFA 2THFB 3SUFA 1GJ4H 5DSFA 2XOKD 3H7OA 3QTVH 1S82A 3P17H 1G36A 4OS4A 3D65E 1MD7A 4JCNA 5C3NA 2KCAA 5JDUB 3E6PH 4FUCA 1FMGA 4AGKA 3NKKA 3RXHA 1PPFE 4ZKOU 3BG4C 1VCWA 1UVSH 3E0NB 4IN1A 3VG8A 3TH4H 1SFIA 4Y7BA 1HJAB 2NU3E 1P03A 3TK6A 1G3BA 3FP7E 5DK1A 2PTNA 2ZPSA 3CENA 3A80A 1SGQE 2ODQA 3NCLA 5FAHA 1GBEA 4MNWA 5C0UA 4BANB 1QA7A 2QC2A 5B6LA 1NU7B 3A7XA 1EJAA 2A5AA 3SORA 2NU4E 2EI7A 1GMHF 1MU8B 1SGNE 1UMAH 1Y3VA 3MU5A 3NPSA 2J92A 1GBMA 3PROA 4B75A 1TMTH 2QV1A 1LHFH 1INCA 2BDCA 5T3HA 3B9FH 2V3MA 3SOSA 1EUFA 4DG4A 3PLPA 1SLVB 3SYJA 2ZGXH 2VH0A 2ZQ1A 3STIA 3MU1A 1BMMH 1GJ8B 1O2MA 3U69H 3TH3H 2QCYA 3RC4A 3ZVEA 1OS8A 1EAXA 4A5TS 1GCDA 2LNCA 1PYTC 5C1YA 1DLEA 1VR1H 1C5XB 2KX4A 5F8ZA 1UTLM 1GMDF 2F4LA 5EW2H 3UQVA 4JZ1A 1FZZA 4VGCC 4AG2A 1CA8B 2W3IA 2BDHA 4WF8A 1BDAA 1EAUA 1ZPZA 4ZROA 4X8UH 3UPEA 3G01A 4KGAA 1GWAA 1QRZA 1LVYA 3QX5H 1O2HA 1GDQA 2H5CA 1T4VH 5GXPA 1P2OA 1W8BH 4YXWD 3TGJE 2F9UA 1QGFA 2VB0A 4GSOA 1KY9A 4GVUA 1N8OB 3RLWH 1P10A 1UVUH 2BB4A 3HKJB 4ABGA 2D2DA 4Q63A 5FPYA 1SQTA 1UTMA 1DE7H 1SOZA 5KECA 4RSPA 3P6ZB 5LH8A 1AKSA 2XC5A 3RXGA 5EQQA 4JK5A 4B76A 4MQAA 2JIZD 3ATMA 4TSFD 4INLA 3WWFA 2ODYB 3PV5A 3UB0A 3U98H 1C5NH 2ANYA 1C4V2 1O34A 1TX8A 1O0DH 1BIOA 2ZU1A 4Q4LA 1HAZB 3Q00A 2XNDD 1GI4A 1YLNA 4R8TB 3ATLA 3RMNH 4U01A 3Q76A 2IJD1 1GJBB 4Y7AA 1V2VT 1FY3A 2Z3CA 1ANEA 2H9EH 3M5MA 4NG9H 1P05A 4F49A 3E1XB 5FCKA 4DGJA 1SBWA 2PGQB 1O31A 1SSXA 3HK6B 1UTPA 3LGUA 2CV3A 4JZDH 1BUIA 1H8DH 1MKWK 1WQSA 1H4WA 2F9NA 2PUXB 4CHAC 1MAXA 1AO5A 2XC4A 2WPIS 1KXDA 2C8ZB 1VGCC 1MCTA 1P04A 1B0EA 2L6OA 1FV9A 1FY5A 2Y6TA 1UVPA 5EQRA 5K0HA 4R0IA 2VGCB 1UTNA 3ZZCA 1JRSA 3SI3H 4TWWA 1QBVH 2ZCHP 3TIUA 3A8CA 4ASHA 1TABE 2OQUA 1TPAE 1SLXB 2ZF0H 1SC8U 2ZDLA 2HALA 4Y8YA 2HNTC 3A88A 2BX4A 3SNBA 2FIRH 3LH1A 2G5NA 3R0FA 1SGTA 2KFWA 1T8LA 2FP7B 3UWIA 2PW8H 1QL7A 1QL9A 1Z8GA 4KTUA 1C1SA 3GY5A 1GG6B 3BIUH 2G51A 1D3TB 3GY3A 4JZEH 4RI0A 1O35A 4CR5A 2IJOB 1E1QD 1EAIA 1EAWA 1O5DH 1O2RA 1FQ3A 4DIIH 3I77A 3E90B 1DANH 2W6ID 4E06H 4YT6H 1YY3A 5HKKD 1NRPH 1MTVA 4CR9A 1ELCA 1GI1A 2QY0B 4DIHH 3BG8A 4CH2B 2AFQB 2OQ5A 3MYWA 2JETC 3M7QA 5EGMA 2OTVA 4X6OA 1O30A 1SGYE 2G4TA 4B71A 1EX3A 1KXCA 1AE5A 1O3GA 4D8NA 2AMQA 1DLKB 4IC5A 4FUHA 4Z1MD 3ATKA 2SGEE 3MI4A 5A0BA 1VITG 4BOHA 1UTKA 2ZHWH 1GHBF 2FOHA 1DSUA 2QXGA 3SU1A 1WV7H 2ZPQA 4OS1A 1TA6A 2QAAA 1LQEA 2ALPA 1NPMA 4O3UA 2TGPZ 4AYYB 2QF4A 3F68H 8GCHF 1QHRB 1WTGH 2TGDA 5LPRA 1H9HE 5FL7D 1LMWB 3UNQA 3DUXH 1TNLA 4Q7YA 2KCOA 1S85A 1C2IA 1YGCH 1NC6A 2OD3B 2WPDD 4D9QA 3OTJE 4TY6A 4NA9H 1YF4A 3TU7H 3A7VA 1SVPA 5C1XA 1HYLA 1BBRH 2FESH 1E37B 1K1NA 2P59A 1W3CA 3KQEA 1F0UA 5F53A 1Y8TA 1C1PA 2PV9B 4K3JA 3SV6A 4LK4A 2HRVA 1CSOE 1PQ7A 3IG6B 4OS6A 4IGDA 2TRMA 2VVUA 2H6MA 3T29A 4F55A 4HZHA 3MOCA 1K0HA 2OBQA 1QTFA 1C5QA 3STJA 1DDJA 3RXLA 5CE1A 5JB8S 2BZ6H 2AHME 3RC6A 1RS0A 1LCYA 3GY7A 2Z3DA 2D1JA 3SU3A 1BB0B 3UOPA 2HLDD 3ZV8A 1MD8A 2BDYA 1C2GA 3MMGA 1QURH 3QUMP 1K1MA 5HM2A 3PRBA 2A5IA 2CN0H 1EQ9A 2ZG0H 1W7GH 3GYMA 4X1PU 1NFXA 1HXFH 2KCYA 3UQOA 2VWLA 1G37A 2J5UA 2GKVE 1Q31A 3P92A 2RA0A 1CVWH 4Y0YE 3W95A 4BXSA 2JH6D 4IMZA 1VZQH 4ABJA 1TGCA 2SFAA 4CREA 1KIGH 1O3PB 3M7TA 4H42U 3RXQA 3RP2A 4WJG2 1AD8H 3PLBA 1SB1H 4TPYA 3A8BA 2FOFA 2BDBA 5JBTA 2SNWA 1IAUA 1TMUH 3N7EA 1FIWA 1O2PA 3UOUA 4LZ4B 1ABIH 2OCVB 1JMOH 3RM0H 1K1PA 3ZVGA 1K2I1 5LPFA 4KTSA 4MLFB 1AB9B 2AGGX 1NFUA 4GAWA 2F9BH 5DP4A 1WBGB 3KF2A 1BMLA 5FX5A 4XOJA 4M7GA 2BD5A 1OHHD 1IQMA 2WSSD 3TK9A 3R3GB 5A8ZA 3DFJA 3E16B 1P2NA 2VWMA 3E3TA 3L3TA 2BQWB 5L2YH 3A8DA 1ZTJA 1WAYB 3V13A 1WUNH 4YLUA 2ANMH 6CHAC 2EI6A 1UJ1A 1YPHE 2PKAA 1BTUA 5GIBA 4BAHB 3RMMH 4ABHA 2BVXH 1RIWC 2PP6A 3UR9A 3RXDA 3TNTA 4ABIA 3F3BA 2FS8A 4ZAEA 1P12E 4IMQA 5FXLA 4BAMB 1MTNC 2XWAA 4UDWH 3VPKA 1HIAB 5F8XA 5K7RA 1P0SH 1O3LA 4P02A 3RXOA 3ZZ8A 3FFGA 1W0YH 1S6FA 1GBTA 1XVOA 1CA0B 1KSNA 2GMTC 2JKHA 1EB2A 1AUTC 1ETSH 4KELA 2P93A 2CJIA 2W7SA 1WU1A 4AOQA 5C67A 4ABEA 2VIDA 1C5WB 2FTLE 2R2MB 7ESTE 1A46H 5I46H 1M9UA 2BVRH 3SJIA 3BN9A 1PPBH 2XTTB 5HIYA 1K28D 1DUEA 2UWLA 1V2ST 3QGJA 6GCHF 2W6JD 4WVPE 3QN7A 1GI7B 3T28A 2CGAA 1O2SA 1GVKB 1Z1IA 2P8OB 3KQBA 2PKSB 1CBWC 1ELAA 1O5FH 1PPEE 1IQIA 1YPLH 1YM0A 1AE8H 1IOEA 2A0QB 2J98A 1GGDB 1A3EH 1ACBE 2EQNA 3LIWA 2UWOA 3SJ8A 4X1QU 3AVZA 3ZZ5A 1O3JA 3GDVA 2XNIA 3HK3B 3PO1C 1C2MA 5E2OA 1V2WT 3SHAH 2QF3A 1D9IA 1J9CH 1GBCA 1IQKA 4HFPB 1GBKA 2A7CA 3SNAA 1O3BA 1H8ED 3H7TA 1Y5AT 4MNXA 4AFZA 2ZKSA 1EPTA 5JPMH 4CRBA 1XUKA 2GJGA 1LO6A 3M37A 1UCYE 1FN8A 2QXIA 1V2MT 4X8SH 1DXPA 1O2KA 5A2MH 1NBMD 1KXBA 1SGPE 1ELBA 2B5TB 5GJ4B 3TJOA 7KMEH 1JIRA 2BMGB 4O3TA 4BTTB 2WPMS 1N6XA 3CNRA 3TJUA 3LKWA 4ABBA 5EXMA 2W26A 2ZDAH 1N6YA 2FOCA 2ZC9H 4Y0ZE 3DCLA 5L6NH 2ZPRA 1O3CA 1GL1A 2O8WA 5GWZA 1D6WA 3FP8E 4TPIZ 3V12A 4B6FA 5HYOA 1GI6A 1O3AA 2Y7XA 2B7DH 2Q1JA 3UTUH 2WPJS 4XE4A 1K1JA 3LONA 2ZHDA 1XVMA 2HNTF 3TGKE 2O9QA 4DT4A 2GDDA 3BTGE 2R0LA 4ZKNU 2GZ9A 1O2VA 2AGEX 1TNHA 1FY4A 4GLYA 1ESAA 1ELTA 3EE0B 2H5DA 1ZSLA 1OOKB 2FM2A 2R0KA 1OYTH 1GCTB 4ZHAA 5PTPA 1TRMA 1H9IE 6LPRA 1BRCE 2BDGA 1HJ8A 1K1LA 4I86A 4YT7H 2V6NA 2ZGBH 2A1DB 4K2YA 2BTCE 1OWIA 4J2YB 2TPIZ 1YYY1 3ZVAA 1MKWH 2B0FA 2ZCKP 4DCDA 2ZGCA 1IQHA 1UVOA 1ZRBA 2FWWA 2PKAB 1P8VC 2G00A 4BAQB 2P3UB 1AQ7A 2ZGJA 4RT0A 4JYTA 3S9CA 1MUEB 2CXVA 1UK3A 3U9AH 2FS9A 3MU8A 3K6YA 3N99A 2XW9A 2TGAA 1OP8A 1KLJH 1O3HA 1O5GH 1JRTA 3IWMA 4XRNA 2GDEH 1K21H 5C0TA 1OWJA 3VB3A 1TFXA 1A1RA 5T6DA 3BG4B 3U28C 1WCZA 3LT3A 1XUIA 4Y8ZA 2J9NA 2LPRA 2PR3A 1J15A 1EP6A 1AVXA 1A0JA 1XUFA 3GS9A 1QB9A 3MNXA 1TPOA 4NWKA 3SGBE 1GJ6A 1BMFD 1YKTA 5FX6A 3FOAA 2YOLA 1LDTT 1ZSKA 4YOIA 1C2EA 2AEIH 3K6ZA 2EEKA 5ESBA 1THSH 3F2FA 5DPAA 1DS2E 1TBQH 5H4IB 3PRDA 3ZZBA 1LPGB 1UK2A 3RLYH 3S69A 2ANKH 3FZDA 1V6DA 2QXJA 1V2JT 3BTTE 4JZIA 5DP7A 4MPXA 2NU2E 1O3KA 1HAVA 2Y81A 3EA9A 3RMOH 4X2XA 1W0KD 4WXIA 3KQ5A 1C1NA 4JZFH 3T5FH 2EC9H 4B1TA 1S84A 1QIXB 1AGJA 3BTDE 2HPPH 1MBQA 1AZZA 2VIVA 1Y5UT 1CHOF 1BTPA 4OM9A 4KKDA 5HGGA 1HCGA 3SUGA 3A81A 3A8AA 2BY9X 3HGPA 3PMHB 4NIVA 1YPMH 3D23A 1TNGA 2PHBA 4WH8A 5TJXA 4MPUA 3UIRA 3M3TA 3SI4H 3MTYA 4LOYH 4VGCB 3RU4E 1GJDB 3H09A 1LPZB 2NU1E 3OE7D 7LPRA 4YOGA 1D6RA 2PFEA 1UHBB 2G52A 1SQAA 2F43B 3U1IB 1C2FA 2OUAA 1GL0E 3UWJH 2KCPA 1KTSB 1HJAC 2TBSA 3MO9A 1ZMLA 1SL3A 1NN6A 5JBCS 1PYTD 4YESB 3BEIB 1SGFG 1DT2A 1YPKH 2BLWA 3E0PB 4CRDA 4F4OC 5E0JA 5DG6A 5JYIA 2WV4A 1HNEE 2EA3A 2EY4C 3SJOA 1C5LH 1OPHB 1EPTC 1S6LA 1TGBA 1O5CB 1UTQA 4MG3A 4X6MA 3LJJA 5TCAA 4ABFA 2BOKA 4NFFA 1QQUA 2AS9A 4AB9A 1ARBA 1KTTB 2ZFTA 3A85A 3QZRA 8GCHG 3AW1A 5T1VA 1V2QT 1KYNA 1ZHRA 4E7NA 5CHAB 5DP3A 1ANDA 1MBMA 4TY7A 1VCQA 3TH2H 2SGQE 3TVJB 3F9GA 1GMCG 5A09A 4K5ZA 3RXIA 1V2TT 4XBBA 2RA3A 4OGXA 1RRKA 2C90B 3GDSA 1GJCB 3DHKH 3OU0A 3M3SA 2OK5A 2VU8E 3ZVBA 4FU8A 1V2PT 2P94A 3RXJA 1Z8JB 4NGAH 4DW2U 1HUTH 4XFQA 2CMYA 1HAHH 5GCHF 1ZPBA 1BRAA 1HGTH 2SGDE 4CHAB 2CK3D 2BY6X 2G8TA 2ZFQH 1LHEH 1ELDE 4NIYA 1E1RD 1HLTH 1BOQA 2YNAA 1OKXA 4FU9A 3ZV9A 2VWNA 2PSYA 3BSQA 2C3SA 2FDAA 1IQEA 3ZZ7A 1SFQB 2VWOA 1O5AB 1NRQH 1N8OC 3P8NA 3RUOA 2VNTA 4BTIB 4AYVB 4Q2KA 1DSTA 2L74A 3GCHB 3KL6A 1CU1A 2ZU2A 1GI3A 3EE7A 4NA7A 3AAUA 1XX9A 2FX4A 2F91A 4DURA 1O2LA 1HAPH 1A5IA 2P3TB 2WUBA 1P02A 1YC0A 4INHA 1ELVA 4ZCNA 1V2UT 3VXEH 1C5TA 2A31A 3PTNA 3SN8A 1CGIE 5FPSA 3BV9B 1HBTH 1C5MD 3DA9B 1EZQA 3SNCA 1P57B 4UFFH 3SUDA 4FU7A 5HMAA 3WW7A 4X6NA 4FVDA 4I8KA 1GHVH 1C2JA 4A1VA 4Q7XA 4GHQA 1TAWA 1Z1JA 1V3XA 4SGBE 2JETB 1LPKB 3UR6A 3SNEA 2ASUB 3RXAA 2GZ8A 3FO8D 5EG4A 1AFQC 1KDQA 3P70B 1C2DA 1C5ZB 2A4OA 1XUGA 1DICA 2Y5HA 5C5OA 4MNVA 1SG8B 4GHTA 3MHWU 3TGIE 3LGIA 3V0XA 2CHAC 3QK1A 1QB1A 2BDAA 4I8LA 3LOXA 3OAAD 3FKSD 1SOTA 4NZQA 1S5SA 3PYHA 1QQ4A 3E91A 1W13U 1CE5A 2VGCC 1TMBH 3L33A 3NK8A 1QJ7B 3AAVA 1HAIH 2BLOA 1W0JD 2QN5T 1J17T 1O3IA 4CBOA 1FONA 1O2IA 1TGSZ 2QA9E 2RDEA 2XXLA 3U1JB 3S0NA 2XBWA 2J38A 1GBIA 5CDFE 4RT1A 3S7HB 2M2AA 1F0SA 3QDZB 4LZ1H 1NU9A 5A8XA 1TGNA 3EA8A 1TPPA 1XKAC 1IQLA 2VIOA 5EODA 2BLVA 2HOBA 3KYGA 1AI8H 3KIDU 4BTUB 1ZPCA 3GCTG 1UO6A 1BRBE 1NROH 3PV4A 2OXSA 3P8FA 3UY9A 2ESTE 1WSSH 4DVAU 2A45B 3AK5A 2Z9JA 3LGTA 2GCHF 5BRRE 3Q77A 1LVMA 2V35A 4XBCA 2JH0D 4K8YA 1AFEH 2WHXA 4CH8B 1QZ8A 2G81E 2G4UA 1UCYK 5HIZA 1O2UA 4B2CA 3T27A 5DGJA 2ZQ2A 3OX7U 3IITA 2BD7A 3ODDA 1RTKA 1EZXC 3N7OA 4M9FA 1P11E 3FZZA 3KNXA 1PPZA 2FI3E 1AKSB 4AZ2B 3URCA 1E0FD 1ABJH 3GY2A 1G2LA 3F2GA 2KR7A 5AHGH 3BTWE 2J97A 1FY8E 2ZO3H 3VB7A 2FTMA 1NO9H 5SGAE 3DT0H 4X2WA 4AG1A 3EGKH 1KXAA 1EOJA 1GI9B 1TE0A 1VJ9U 4FVBA 2J4IA 4IC6A 1DX5M 1LKAA 1O3NA 2ZHEH 1C2KA 4SGAE 3MH4A 2FYRA 4YLQH 1ZHPA 2RDLA 1C5RA 4XDEA 1COWD 1AIXH 1ID5H 3LGYA 1SQRA 3SU4A 2R3UA 3LJOA 3N7DA 2XBXA 2SNVA 1B7XB 1LTOA 2IOTA 1SKYE 5C94A 2WYJA 2Z9LA 3L6PA 3V7TA 1E38B 3RXPA 3VGCC 1TA2A 3RXBA 2LP6A 1JBUH 4MPWA 1YPHC 1T8MA 2F9OA 3F9EA 3E8LA 2ILNA 3SNDA 1S0RA 2XC0A 2ZTYA 1LHDH 3D49H 1ARCA 1IQFA 1PQ5A 3T62A 2V3HH 3UREA 3ELAH 5IK2D 1V2RT 2Y80A 2GCTB 3EAJA 5ETXA 3EDXB 3TJVA 3NXPA 1SR5C 4FUJA 4X8TH 1A5GH 1T31A 1GBJA 4NSVA 5GPIB 5EJZA 3RDZA 1JWTA 1JIMA 1O5EH 4UFGH 4WXVA 1IHTH 2FI5E 2PTCE 3WY8A 5C17A 4UD9H 2Z6BD 1CHGA 4X6PA 3EYDA 1RIWB 2P3FH 5DP6A 2O8LA 2SGPE 3ZIAD 1HRTH 1UW7A 2FPZA 2BOHB 1MTNB 1PQ8A 1PPGE 1L2EA 1DITH 5AF9H 1BT7A 1BMNH 1S81A 5G4BA 2P95A 3MH5A 5BPEA 1CT4E 1FPCH 1G3CA 1WXRA 4FUEA 3LC3A 1FAXA 1CT0E 1EXFA 4NIXA 1VJAU 1OP2A 1P09A 2J94A 1BITA 3ZZ9A 1ZGIA 2BY8X 1VCPA 3LU9B 4CRGA 2UUFB 4AFUA 9LPRA 1B5GH 2OBOA 1O33A 2Q6GA 1CT2E 1NRRH 1SPJA 1YLCA 1AWFH 3BIVH 2C4FH 1AY6H 1YWUA 1TPSA 2A4RA 1W7XH 2GZ7A 3K2UA 5C1UA 3ZYEA 4MNYA 1SGCA 1EJMA 1MTUA 4I8GA 1B0FA 3MNBA 1FIZA 1YPEH 4O9VA 3KQDA 3RXKA 1ELEE 1O2YA 1MMJN 4XBDA 1F0RA 8LPRA 2Q6DA 2SGAA 1K1IA 3RXVA 3OYPA 1A0HB 1V2OT 1AN1E 1NFWA 1TWXB 1ZJDA 5DJ7A 4CRAA 1ZLRA 3GISB 4H6TA 1WTHD 2BLQA 3D62A 2HLCA 2BHGA 2JJ2D 2GX4A 2FOBA 4D7GA 1OWHA 4Z0KA 2H9HA 1P01A 4INKA 4X2YA 2OC7A 1UTOA 2KAIA 2ZCLP 1G30B 1QRWA 3SV8A 1QCPA 2FOAA 3ESTA 1GBDA 1NRNH 2BYAX 4ZHLU 2AMDA 3PO1B 4AC9A 1FN6A 4Y10E 1GI0A 1YCPK 2OINA 1G32B 2AH4X 5LPEA 2I6SA 1GBHA 3SJ9A 1HFDA 2PSXA 3F0PA 1NRSH 2ZFFH 1PJPA 1TRNA 2Z9KA 4JMYA 1O37A 4FUBA 1HDTH 2PGBB 2V3OH 1TRYA 3PMJA 1ZSJA 1C4U2 3SU0A 1HAXB 5FHTA 1BJUA 4IW4E 5EJLA 4B73A 1GMHG 2O8TA 3ATWA 5HM9A 2C8WB 1G3EA 2Y5FA 3PTBA 4TYDA 1CHOG 4RN6A 1GDUA 1FPHH 1DVAH 1H8IH 3NZIA 1D3PB 1LQDB 1DY9A 3ZZAA 1F7ZA 2ZZUH 4OS7A 2ZFSA 1YPJH 1O32A 1SGRE 1HJ9A 2B9LA 2BD4A 3A7WA 3MH6A 2W5EA 2BD8A 2QIQA 3GY6A 4F48B 1P2KA 3HPTB 1O36A 2A32A 3LDXH 1K1OA 1RTLA 1YLDA 3VFEA 2C8YB 2RCEA 1GHYH 1ZYOA 3A82A 4UE7H 3P95A 2OC1A 3SZNA 3SQEE 1GMDG 2C93B 1P3EA 3QTOH 3DFLA 3AW0A 3LC5A 3MFJA 4WY3A 5JBBS 3QZQA 1EKBB 2H9TH 1QBNA 1MH0A 1NFYA 1O2XA 3C27B 2SGFE 3MH7A 5T6GA 1THPB 1RXPA 1RJXB 3F6UH 2ZTXA 3OSYA 1TLDA 4ZKSU 4NA8A 2FZZA 1BTHH 3I78A 3UUZA 1F5KU 2XCNA 1OSSA 2F3CE 1GJ5H 4UFEH 5T6FA 3SJKA 3T25A 4UFDH 3M5LA 1P2JA 3K65B 3SQHE 5AFZH 3JZ2B 2J34A 4HI3A 4Y11E 1FLEE 3M3VA 1ESBA 1DWEH 1U6QA 2YMSB 2VH6A 1MCVA 2BD2A 3A89A 1NT1A 1W2KH 4HGCA 4MTBA 1PFXC 1KLIH 1XKBC 2Z3EA 3A83A 2G5VA 4GCHF 1AMHA 1O2QA 5ABWA 1NBME 4B2BA 5EIYA 1BA8B 3EA7A 3MQKC 2ZU3A 1ETTH 1FUJA 2XCFA 5EOKA 1AU8A 2Y82A 1ELGA 1CO7E 4X2VA 3CS0A 5E8EH 1OP0A 1C2HA 1A3BH 2KZ4A 4FUIA 5GNDA 2A4QA 1DWDH 3SU5A 1TOMH 1ZGVA 5J4QA 4Y6DA 2YMSD 4B2AA 1ANBA 4X8VH 1QNJA 7GCHF 4Y76A 2R3YA 3OY6U 2K8IA 1DWCH 3ZZ4A 1GHWH 4D76A 3F0OA 3DSGA 1GI5A 3TLOA 2F83A 3VEQB 1Z8IB 2JJ1D 3RXCA 3ZZ6A 1TNJA 2C8XB 3A84A 4YZUA 1H8HD 2V7QD 4ZKRU 3GYLB 2PWXA 2H2ZA 1GHAF 4IS5A 4B74A 1IQGA 5DP5A 1KLTA 3M35A 5EU8A 1BTZA 3F1SB 2BQ6B 1MTSA 1LHGH 2BY5X 1FXYA 2ZHQH 2FLRH 2ZDVH 1BQYA 2GT7A 1BHXF 3KGPA 4TT3D 2ZHFH 3P8OA 4FETA 2GGVB 4WWYA 5C5NA 1G9IE 2J98B 3PV2A 1XXFA 3RXRA 2WPKS 5B6OA 4KTCA 2OC8A 1MABB 1UK4A 2Z7FE 1P9UA 1C5OH 3GICB 3SW2B 3I29A 1PQAA 2FO9A 1PPCE 1W11U 4D7FA 4UEHH 2OLGA 3BEUA 2UUYA 5F6MA 3GY8A 1OWDA 2AIQA 2M5TA 1W10U 3HATH 1WYKA 2PUQH 4O97A 1SQOA 5EJ1A 1EPTB 1E35B 2BXTH 1XUHA 3SU6A 1DPOA 1F5RA 3RMLH 1THRH 3RXTA 1GI2A 4FUFA 4YM9A 1Q3XA 1IHSH 5DO4H 1QR3E 1ORFA 3DSOA 2ZIQH 4ISLA 1QB6A 5CHBA 1OXGA 1UCYH 1NESE 5L2ZH 3CS7A 1C1UH 2F9VA 3M36A 3SGQE 2LELA 1GHBG 2AYWA 3LGWA 1ELFA 2FMJA 1ZMJA 1TQ0B 2JH5D 4ZHMU 1DWBH 2ZA5A 4RKJB 1LKBA 2ZU5A 5DP9A 3VXFH 2P16A 3GCOA 4Y79A 3O8RA 4MVNA 4DOQA 4OS5A 2ZU4A 1ZZZA 1Y3WA 3A86A 1D3QB 2XRCA 3MU4A 2W3KA 4ZXXH 1MKXK 1O2WA 2GCHG 3TK5A 5HXFA 4NZLA 3KYFA 1BTWA 1CGHA 5GDSH 1Z6EA 1O2OA 2ZTZA 1P06A 1TONA 2D26C 1MZAA 2VVCA 3SV2H 2RG3A 5EQSA 3A87A 3RXEA 1O2JA 2ZGHA 2AIPA 1UTJA 5JBAS 1BBRE 4X1RU 1AWHB 2ZNKH 1Y3XA 4AB8A 3MNCA 4I8JA 1LVBA 3W1EA 1NY22 1TOCB 4FOUC 1LVOA 1VGCB 3VB6A 1BTXA 5A0AE 4ABAA 3ZYDA 1L1JA 1TIOA 1QBOA 1QA0A 2FI4E 3B23B 3SBKA 4OS2A 2GT8A 2BDIA 4HG6A 1A0LA 1KXEA 4J1YA 2FOEA 4ZUHA 1O2ZA 3BTME 5EPNA 1QJ1B 1Z6JH 2R9PA 5CHAC 1L4ZA 1GHXH 1HAYB 5FCRA 3OEHD 2QF5A 3TPIZ 1DOJA 1MU6B 2BX3A 3B8JA 1F92A 1GI8B 3VB5A 1O39A 1P9SA 3TITA 2HVXA 3MWIU 3PWBA 1QL8A 2RFKC 4I7YH 2BZAA 3GOVB 1ZTLA 1TX7A 3O8CA 3F2HA 1A61H 4A1TA 3GCNA 3OTPA 1AFQB 2IPQX 2B8OH 4HTCH 1FX0B 2EI8A 1H1BA 1AVWA 1EFRD 1C1OA 2ZECA 1SMFE 4E05H 1AZ8A 1RD3B 1S6HA 2KM0A 2WINI 3SO3A 2CHAB 1GDNA 5FPTA 3RXMA 1MTWA 2BXUH 1DXWA 3QGNB 4JYUH 5J4SA 2QYIA 3LPRA 4K60A 4A7IB 1HAVB 1OX1A 1T32A 1N1LA 3ATIA 5EXNA 3FANA 3MO6A 3JZ1B 8ESTE 1NM6A 3M7UA 1Q2WA 1Y59T 1RGQA 3PMBB 1DUAA 4I32A 1YP9A 4XD7D 4BNRA 1BRUP 2FLBH 3GCHC 1SGEE 3PWCA 3KHVA 1GBBA 3H5CB 2GVFA 1Z7KA 1HPGA 1C2LA 1QFKH 4ZXYH 5A0CA 4K8BA 5EXLA 2ZDKA 2BVSH 1O5BB 4LXBH 4Q7ZA 1YBWA 3Q3YA 5EPYA 4JYVH 1EATA 4K1TA 2CF9H 4I31A 2Z9IA 2ZDMA 1ZTKA 3PM3A 4CRFA 3SV9A 3SU2A 4MDSA 2GD4B 2FEQH 1FJSA 1TX6A 1O3DA 4B6EA 2TGTA 4FUGA 3ZVCA 4WMDA 3PLKA 3BTHE 1YCPH 2ODPA 1GG6C 1TYNA 4A92A 3DD2H 1HIAA 1BHXB 3SV7A 4DJZB 3KQCA 5DN6D 2IN2A 3RU4T 2HNTE 3PB1E 4X1SU 2AERH 1E79D 5E2PA 3ZZDA 2NWNA 3TJNA 1OWEA 2QE7D 2H1UA 4IN2A 2JDID 3M5NA 2A7HA 3HGNA 3BTKE 1BCUH 1ANCA 2DE8A 1E36B 1SI5H 1C1QA 1GVLA 6GCHG 2VBCA 1E34B 2WV9A 5I25A 2V0BA 4RKOB 2F9PA 1GMCF 2A2XH 1IQNA 1FNIA 1L0ZA 3FVFB 3VGCB 1XM1A 3C1KA 1QY6A 2UUKB 4I33A 1YCPM 1F2SE 4OGYA 1S0QA 1C1MA 1O2TA 2NU0E 1P2MA 2R2WU 1GJ7B 1AVGH 3Q3XA 5EW1H 1BTYA 1VITH 4Y8XA 1O3EA 3P8GA 4JK6A 3U8TH 1FY1A 1SGFA 3SHCH 3UNRA 1WOFA 3MNSA 1A7SA 5E0GA 2Z94A 3LH3A 1XXDA 4AN7A 2GTBA 2Y5GA 4XSKU 3SZEA 4ESTE 3BTFE 4ISOA 2J95A 2ALVA 2DE9A 1Y3UA 2FX6A 1W0ZU 5IDKA 4X1NU 4Q80A 2A5KA 3Q3KA 1EZUC 1HAGE 1JXPA 4AX9H 1A2CH 1OWKA 3NUMA 6CHAB 1EJNA 1GBLA 3DSPA 4ISHH 1GBAA 3ZZ3A 1SLWB 2ZP0H 1OYQA 1WQVH 1C1VH 1ZMNA 2OP9A 1W14U 2VINA 5AVDA 3T2NA 1GBFA 1C1WH 3KN2A 1VKYA 3A7TA 1O3MA 2QF0A 4BAOB 2STBE 1Y5BT 3V3MA 1HV7A 2WYGA 2XWBI 4GUXA 1SHHB 3RM2H 1KDQB 1QJ6B 2ZI2H 2WPHS 4WMEA 3S9AA 1P3CA 3TNSA 2QXHA 2A7JA 1QRXA 1V2NT 2TIOA 1C4Y2 4K1SA 2GP9B 5DP8A 3FAOA 1V2LT 3SUEA 2WV5A 3F9FA 1TGTA 1Z8RA 2GMTB 2GCTC 5FBEA 1T8NA 1PPHE 1CQQA 2FOMB 1H9LB 1XMNB 1RTFB 1TBZH 4ZMAH 3FN8A 3OEED 4KP0A 1O2NA 3T26A 3O8BA 3AASA 1MQ5A 2UWPA 2BD9A 3ITIA 4GCHG 4Y71A 1X7AC 1C1RA 3WWBA 2BQ7B 3BTQE 5F03A 1AB9C 1C5UA 4THNH 3M5OA 4ABDA 2UUJB 3UFAA 4CRCA 1ZRKA 3A7ZA 3BTEE 1P2QA 1SGIB 3EQ0H 1C5VA 3KEEA 3MU0A 1C1TA 1T4UH 5L30H 3ODFA 4U32A 4A6LA 2QGRA 1CGJE 4FXGH 1VITF 1AHTH 4BAKB 4O03A 7GCHG 1FI8A 1IQJA 1CBWB 1HAOH 9ESTA 4AGJA 5LGOA 3GDUA 4D9RA 1T7CA 1O3FA 2ZDNA 3GCTF 1HB0B 4P00A 2ZEBA 1SGDE 1Z71A 2K0QA 4NFEA 3UNSA 2WPLS 1GPZA 3NWUA 5JB9S 1ZHMA 4IBLH 1GHAG 2BY7X 4AORA 2J2UA 3FP6E 1SHYA 1P2IA 2I6QA 3RXUA 1D4PB 4NCYA 2O8UA 2Q6FA 1CA0C 2FXRA 4A1XA 1TB6H 4BXWA 1L4DA 1GJ9B 4PROA 3SGAE 2ANWA 4NIWA 5C2ZA 2G55A 4YOJA 1EASA 1JOUB 1V2KT 5FBIA 1W12U 1C5YB 1O38A 2Z9GA 2BM2A 1GVZA 2HGTH 2AGIX 4I8HA 2GV7A 2ZWLH 2VIPA 3QLPH 4ASUD 4ACAA 3VB4A 2BD3A 5CMXH 3RXSA 3PMAB 4MPVA 1DFPA 1TQ7B 2YNBA 4U30A 1J16A 2XBYA 1FAKH 4U2WA 3QWCH 1L1NA 1GJAB 4ISNA 3BEFB 1MKXH 1K9OE 2A4GA 2P8OC 2ULLA 2W7UA 1YPGH 2FODA 3ENSB 4UONA 2Y7ZA 1BBRK 1ZR0A 2PKSC 1TBRH 3LGVA 1C5SA 3A7YA 5AFYH 2K1QA 3OY5U 1AUJA 1GGDC 1UHBA 1J8AA 5E0HA 1T8OA 3BF6H 2FOGA 2STAE 1ESTA 2HVYB 6ESTA 1ZOMA 1EOLA 4YO9A 8KME2 2WZQA 4E7RG 3GY4A 4YTAA 4ACBA 1BZXE 4AFSA 1A4WH 2DUCA 2D8WA 3MO3A 2OC0A 1C5PA 1NTPA 4NSYA 4QT8C 5F8TA 3CP7A 3W94A 4X0WU 1F0TA 5KGOA 2ZFRH 3QO6A 3U8RH 1ETRH 1HXEH 1TALA 1FDPA 1O2GH 4GPGA 1Y3YA 2FYQA 1A5HA 3M61U 1ZJKA 1S83A
chains in the Genus database with same CATH topology
1MQ6A 4NWLA 3RC5A 1C9PA 2CF8H 4WH6A 1NZQH 5GCHG 2AMPA 2XYAA 1TNKA 2O8MA 2HWLB 3S9BA 1DY8A 5IYTA 4K69A 2WUCA 4AFQA 1G3DA 3KCGH 3HKIB 2XBVA 1NS3A 5C20A 4Z6AH 1BMAA 3F9HA 1G2MA 2VJ1A 4DY7B 2IPHA 4TWYA 2PLXA 4DT7B 1XUJA 1MAYA 1J14A 1EB1H 1GCTC 1EP5A 2VIQA 5DKMA 1DM4B 2A2QH 1KXFA 3ZVDA 5TCCA 3O8DA 5A8YA 3S7KB 4ZH8A 1F5LA 1UVTH 3ZVFA 4ISIH 1GHZA 1C9TA 1L1GA 4H4FA 1MZDA 4CBNA 4FUDA 2VIWA 5ESTE 3RU4D 2KAIB 2HPQH 1BJVA 2ZFPH 1LHCH 3URDA 1D3DB 1K22H 1O3OA 3U8OH 1TNIA 1RFNA 2VVVA 4WMFA 1SLUB 2GV6A 3K9XB 4H6SB 4K1EA 1EZSC 3RXFA 2THFB 3SUFA 1GJ4H 3QTVH 3H7OA 1S82A 3P17H 1G36A 4OS4A 3D65E 1MD7A 4JCNA 5C3NA 5JDUB 3E6PH 4FUCA 1FMGA 4AGKA 3NKKA 3RXHA 1PPFE 4ZKOU 3BG4C 1VCWA 1UVSH 3E0NB 4IN1A 3TH4H 1SFIA 4Y7BA 1HJAB 2NU3E 1P03A 3TK6A 1G3BA 3FP7E 5DK1A 2PTNA 2ZPSA 3CENA 3A80A 1SGQE 2ODQA 3NCLA 5FAHA 1GBEA 4MNWA 4BANB 1QA7A 2QC2A 1NU7B 3A7XA 1EJAA 2A5AA 3SORA 2NU4E 2EI7A 1GMHF 1MU8B 1SGNE 1UMAH 1Y3VA 3MU5A 3NPSA 2J92A 1GBMA 3PROA 4B75A 1TMTH 2QV1A 1LHFH 1INCA 2BDCA 5T3HA 3B9FH 3SOSA 1EUFA 4DG4A 3PLPA 1SLVB 2ZGXH 2VH0A 2ZQ1A 3STIA 3MU1A 1BMMH 1GJ8B 1O2MA 3U69H 3TH3H 2QCYA 3RC4A 3ZVEA 1OS8A 1EAXA 4A5TS 1GCDA 2LNCA 1PYTC 5C1YA 1DLEA 1VR1H 1C5XB 5F8ZA 1UTLM 1GMDF 5EW2H 3UQVA 4JZ1A 1FZZA 4VGCC 4AG2A 1CA8B 2W3IA 2BDHA 4WF8A 1BDAA 1EAUA 1ZPZA 4ZROA 4X8UH 3UPEA 3G01A 4KGAA 1GWAA 1QRZA 1LVYA 3QX5H 1O2HA 1GDQA 2H5CA 1T4VH 5GXPA 1P2OA 1W8BH 3TGJE 2F9UA 1QGFA 2VB0A 4GSOA 1KY9A 4GVUA 1N8OB 3RLWH 1P10A 1UVUH 2BB4A 3HKJB 4ABGA 2D2DA 5FPYA 1SQTA 1UTMA 1DE7H 1SOZA 4RSPA 3P6ZB 5LH8A 1AKSA 2XC5A 3RXGA 5EQQA 4JK5A 4B76A 4MQAA 3ATMA 4INLA 2ODYB 3U98H 1C5NH 2ANYA 1C4V2 1O34A 1TX8A 1O0DH 1BIOA 2ZU1A 1HAZB 3Q00A 1GI4A 4R8TB 3ATLA 3RMNH 4U01A 3Q76A 1GJBB 4Y7AA 1V2VT 1FY3A 2Z3CA 1ANEA 2H9EH 3M5MA 4NG9H 1P05A 4F49A 3E1XB 5FCKA 4DGJA 1SBWA 2PGQB 1O31A 1SSXA 3HK6B 1UTPA 3LGUA 2CV3A 4JZDH 1BUIA 1H8DH 1MKWK 1WQSA 1H4WA 2F9NA 2PUXB 4CHAC 1MAXA 1AO5A 2XC4A 2WPIS 1KXDA 2C8ZB 1VGCC 1MCTA 1P04A 1B0EA 1FV9A 1FY5A 2Y6TA 1UVPA 5EQRA 5K0HA 4R0IA 2VGCB 1UTNA 3ZZCA 1JRSA 3SI3H 4TWWA 1QBVH 2ZCHP 3TIUA 3A8CA 4ASHA 1TABE 2OQUA 1TPAE 1SLXB 2ZF0H 1SC8U 2ZDLA 2HALA 4Y8YA 2HNTC 3A88A 2BX4A 3SNBA 2FIRH 3LH1A 2G5NA 3R0FA 1SGTA 1T8LA 2FP7B 3UWIA 2PW8H 1QL7A 1QL9A 1Z8GA 4KTUA 1C1SA 3GY5A 1GG6B 3BIUH 2G51A 1D3TB 3GY3A 4JZEH 4CR5A 1O35A 2IJOB 1EAIA 1EAWA 1O5DH 1O2RA 1FQ3A 4DIIH 3I77A 3E90B 1DANH 4E06H 4YT6H 1NRPH 1MTVA 4CR9A 1ELCA 1GI1A 2QY0B 4DIHH 3BG8A 4CH2B 2AFQB 2OQ5A 3MYWA 2JETC 3M7QA 5EGMA 2OTVA 4X6OA 1O30A 1SGYE 2G4TA 4B71A 1EX3A 1KXCA 1AE5A 1O3GA 4D8NA 2AMQA 1DLKB 4IC5A 4FUHA 3ATKA 2SGEE 3MI4A 5A0BA 1VITG 4BOHA 1UTKA 2ZHWH 1GHBF 2FOHA 1DSUA 2QXGA 3SU1A 1WV7H 2ZPQA 4OS1A 1TA6A 2QAAA 1LQEA 2ALPA 1NPMA 4O3UA 2TGPZ 4AYYB 3F68H 8GCHF 1QHRB 1WTGH 2TGDA 5LPRA 1H9HE 1LMWB 3UNQA 3DUXH 1TNLA 4Q7YA 1S85A 1C2IA 1YGCH 1NC6A 2OD3B 4D9QA 3OTJE 4TY6A 4NA9H 1YF4A 3TU7H 3A7VA 1SVPA 5C1XA 1HYLA 1BBRH 2FESH 1E37B 1K1NA 2P59A 1W3CA 3KQEA 1F0UA 1Y8TA 1C1PA 2PV9B 4K3JA 3SV6A 4LK4A 2HRVA 1CSOE 1PQ7A 3IG6B 4OS6A 4IGDA 2TRMA 2VVUA 2H6MA 3T29A 4HZHA 3MOCA 2OBQA 1QTFA 1C5QA 3STJA 1DDJA 3RXLA 5CE1A 5JB8S 2BZ6H 3RC6A 1RS0A 1LCYA 3GY7A 2Z3DA 2D1JA 3SU3A 1BB0B 3UOPA 3ZV8A 1MD8A 2BDYA 1C2GA 3MMGA 1QURH 3QUMP 1K1MA 5HM2A 2A5IA 2CN0H 1EQ9A 2ZG0H 1W7GH 3GYMA 4X1PU 1NFXA 1HXFH 3UQOA 2VWLA 1G37A 2GKVE 1Q31A 3P92A 2RA0A 1CVWH 4Y0YE 3W95A 4BXSA 2JH6D 4IMZA 1VZQH 4ABJA 1TGCA 2SFAA 4CREA 1KIGH 1O3PB 3M7TA 4H42U 3RXQA 3RP2A 4WJG2 1AD8H 3PLBA 1SB1H 4TPYA 3A8BA 2FOFA 2BDBA 5JBTA 2SNWA 1IAUA 1TMUH 1FIWA 1O2PA 3UOUA 4LZ4B 1ABIH 2OCVB 1JMOH 3RM0H 1K1PA 3ZVGA 1K2I1 5LPFA 4KTSA 4MLFB 1AB9B 2AGGX 1NFUA 4GAWA 2F9BH 5DP4A 1WBGB 3KF2A 1BMLA 5FX5A 4XOJA 4M7GA 2BD5A 1IQMA 3TK9A 3R3GB 5A8ZA 3DFJA 3E16B 1P2NA 2VWMA 3E3TA 3L3TA 2BQWB 5L2YH 3A8DA 1ZTJA 1WAYB 3V13A 1WUNH 4YLUA 2ANMH 6CHAC 2EI6A 1UJ1A 1YPHE 2PKAA 1BTUA 5GIBA 4BAHB 3RMMH 4ABHA 2BVXH 1RIWC 3UR9A 3RXDA 3TNTA 4ABIA 2FS8A 4ZAEA 1P12E 4IMQA 5FXLA 4BAMB 1MTNC 2XWAA 4UDWH 3VPKA 1HIAB 5F8XA 5K7RA 1P0SH 1O3LA 3RXOA 3ZZ8A 3FFGA 1W0YH 1S6FA 1GBTA 1XVOA 1CA0B 1KSNA 2GMTC 2JKHA 1EB2A 1AUTC 1ETSH 4KELA 2P93A 2CJIA 2W7SA 1WU1A 4AOQA 5C67A 4ABEA 2VIDA 1C5WB 2FTLE 2R2MB 7ESTE 1A46H 5I46H 1M9UA 2BVRH 3SJIA 3BN9A 1PPBH 2XTTB 1K28D 1DUEA 2UWLA 1V2ST 3QGJA 6GCHF 4WVPE 3QN7A 1GI7B 3T28A 2CGAA 1O2SA 1GVKB 1Z1IA 2P8OB 3KQBA 2PKSB 1CBWC 1ELAA 1O5FH 1PPEE 1IQIA 1YPLH 1YM0A 1AE8H 1IOEA 2A0QB 1GGDB 1A3EH 1ACBE 3LIWA 2UWOA 3SJ8A 4X1QU 3AVZA 3ZZ5A 1O3JA 3GDVA 2XNIA 3HK3B 3PO1C 1C2MA 5E2OA 1V2WT 3SHAH 2QF3A 1D9IA 1J9CH 1GBCA 1IQKA 4HFPB 1GBKA 2A7CA 3SNAA 1O3BA 3H7TA 1Y5AT 4MNXA 4AFZA 2ZKSA 1EPTA 5JPMH 4CRBA 1XUKA 1LO6A 3M37A 1UCYE 1FN8A 2QXIA 1V2MT 4X8SH 1DXPA 1O2KA 5A2MH 1KXBA 1SGPE 1ELBA 2B5TB 5GJ4B 3TJOA 7KMEH 1JIRA 2BMGB 4O3TA 4BTTB 2WPMS 1N6XA 3TJUA 3LKWA 4ABBA 5EXMA 2W26A 2ZDAH 1N6YA 2FOCA 2ZC9H 4Y0ZE 5L6NH 2ZPRA 1O3CA 1GL1A 2O8WA 5GWZA 1D6WA 3FP8E 4TPIZ 3V12A 5HYOA 1GI6A 1O3AA 2Y7XA 2B7DH 2Q1JA 3UTUH 2WPJS 4XE4A 1K1JA 3LONA 2ZHDA 1XVMA 2HNTF 3TGKE 2O9QA 2GDDA 3BTGE 2R0LA 4ZKNU 2GZ9A 1O2VA 2AGEX 1TNHA 1FY4A 4GLYA 1ESAA 1ELTA 3EE0B 2H5DA 1ZSLA 1OOKB 2FM2A 2R0KA 1OYTH 1GCTB 4ZHAA 5PTPA 1TRMA 1H9IE 6LPRA 1BRCE 2BDGA 1HJ8A 1K1LA 4YT7H 2V6NA 2ZGBH 2A1DB 4K2YA 2BTCE 1OWIA 4J2YB 2TPIZ 1YYY1 3ZVAA 1MKWH 2B0FA 2ZCKP 4DCDA 2ZGCA 1IQHA 1UVOA 1ZRBA 2FWWA 2PKAB 1P8VC 2G00A 4BAQB 2P3UB 1AQ7A 2ZGJA 4JYTA 3S9CA 1MUEB 2CXVA 1UK3A 3U9AH 2FS9A 3MU8A 3K6YA 2XW9A 2TGAA 1OP8A 1KLJH 1O3HA 1O5GH 1JRTA 3IWMA 2GDEH 1K21H 1OWJA 3VB3A 1TFXA 1A1RA 5T6DA 3BG4B 1WCZA 3LT3A 1XUIA 4Y8ZA 2J9NA 2LPRA 2PR3A 1J15A 1EP6A 1AVXA 1A0JA 1XUFA 1QB9A 3MNXA 1TPOA 4NWKA 3SGBE 1GJ6A 1YKTA 5FX6A 2YOLA 1LDTT 1ZSKA 4YOIA 1C2EA 2AEIH 3K6ZA 2EEKA 5ESBA 1THSH 5DPAA 1DS2E 1TBQH 5H4IB 3ZZBA 1LPGB 1UK2A 3RLYH 3S69A 2ANKH 3FZDA 1V6DA 2QXJA 1V2JT 3BTTE 4JZIA 5DP7A 4MPXA 2NU2E 1O3KA 1HAVA 2Y81A 3EA9A 3RMOH 4X2XA 4WXIA 1C1NA 4JZFH 3T5FH 2EC9H 4B1TA 1S84A 1QIXB 1AGJA 3BTDE 2HPPH 1MBQA 1AZZA 2VIVA 1Y5UT 1CHOF 1BTPA 4KKDA 5HGGA 1HCGA 3SUGA 3A81A 3A8AA 2BY9X 3HGPA 3PMHB 4NIVA 1YPMH 3D23A 1TNGA 2PHBA 4WH8A 5TJXA 4MPUA 3UIRA 3M3TA 3SI4H 3MTYA 4LOYH 4VGCB 3RU4E 1GJDB 1LPZB 2NU1E 7LPRA 4YOGA 1D6RA 2PFEA 1UHBB 2G52A 1SQAA 3U1IB 1C2FA 2OUAA 1GL0E 3UWJH 1KTSB 1HJAC 2TBSA 3MO9A 1ZMLA 1SL3A 1NN6A 5JBCS 1PYTD 4YESB 3BEIB 1SGFG 1DT2A 1YPKH 2BLWA 3E0PB 4CRDA 4F4OC 5E0JA 5DG6A 5JYIA 2WV4A 1HNEE 2EA3A 3SJOA 1C5LH 1OPHB 1EPTC 1TGBA 1UTQA 1O5CB 4MG3A 4X6MA 3LJJA 5TCAA 4ABFA 2BOKA 4NFFA 1QQUA 2AS9A 4AB9A 1ARBA 1KTTB 2ZFTA 3A85A 3QZRA 8GCHG 3AW1A 1V2QT 1KYNA 1ZHRA 4E7NA 5CHAB 5DP3A 1ANDA 1MBMA 4TY7A 1VCQA 3TH2H 2SGQE 3TVJB 3F9GA 1GMCG 5A09A 4K5ZA 3RXIA 1V2TT 4XBBA 2RA3A 4OGXA 1RRKA 2C90B 3GDSA 1GJCB 3DHKH 3OU0A 3M3SA 3ZVBA 2VU8E 4FU8A 1V2PT 2P94A 3RXJA 1Z8JB 4NGAH 4DW2U 1HUTH 4XFQA 2CMYA 1HAHH 5GCHF 1ZPBA 1BRAA 1HGTH 2SGDE 4CHAB 2BY6X 2G8TA 2ZFQH 1LHEH 1ELDE 4NIYA 1HLTH 1BOQA 2YNAA 1OKXA 4FU9A 3ZV9A 2VWNA 2PSYA 3BSQA 2C3SA 2FDAA 1IQEA 3ZZ7A 1SFQB 2VWOA 1O5AB 1NRQH 1N8OC 3P8NA 3RUOA 2VNTA 4BTIB 4AYVB 4Q2KA 1DSTA 3GCHB 3KL6A 1CU1A 2ZU2A 1GI3A 4NA7A 3AAUA 1XX9A 2FX4A 2F91A 4DURA 1O2LA 1HAPH 1A5IA 2P3TB 2WUBA 1P02A 1YC0A 4INHA 1ELVA 1V2UT 3VXEH 1C5TA 2A31A 3PTNA 3SN8A 1CGIE 5FPSA 3BV9B 1HBTH 1C5MD 3DA9B 1EZQA 3SNCA 1P57B 4UFFH 3SUDA 4FU7A 5HMAA 4X6NA 4FVDA 4I8KA 1GHVH 1C2JA 4A1VA 4Q7XA 4GHQA 1TAWA 1Z1JA 1V3XA 4SGBE 2JETB 1LPKB 3UR6A 3SNEA 2ASUB 3RXAA 2GZ8A 5EG4A 1AFQC 1KDQA 3P70B 1C2DA 1C5ZB 2A4OA 1XUGA 1DICA 2Y5HA 5C5OA 4MNVA 1SG8B 4GHTA 3MHWU 3TGIE 3LGIA 3V0XA 2CHAC 3QK1A 1QB1A 2BDAA 4I8LA 3LOXA 1SOTA 4NZQA 1S5SA 3PYHA 1QQ4A 3E91A 1W13U 1CE5A 2VGCC 1TMBH 3L33A 3NK8A 1QJ7B 3AAVA 1HAIH 2BLOA 2QN5T 1J17T 1O3IA 4CBOA 1FONA 1O2IA 1TGSZ 2QA9E 2XXLA 3U1JB 3S0NA 2XBWA 2J38A 1GBIA 3S7HB 1F0SA 3QDZB 4LZ1H 1NU9A 5A8XA 1TGNA 3EA8A 1TPPA 1XKAC 1IQLA 2VIOA 5EODA 2BLVA 2HOBA 1AI8H 3KIDU 4BTUB 1ZPCA 3GCTG 1UO6A 1BRBE 1NROH 3PV4A 2OXSA 3P8FA 3UY9A