1O3MA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3mA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3mA02
1L1JA 3P8NA 1C5VA 5EXMA 1V2NT 4ESTE 3RXMA 3M35A 1O2SA 3DFLA 2ANKH 2BVRH 3ZZ4A 3FZDA 3MH6A 2FO9A 1P0SH 3D65E 2Y5GA 2GCHF 5L2ZH 2AGGX 2H1UA 1UTNA 2PKSB 1GHYH 1AMHA 1DM4B 5EW1H 4O3UA 1QBVH 1CU1A 1L4DA 2P8OC 3SU1A 3BTHE 3Q3XA 1VCWA 3RU4D 5L30H 3UR9A 1BMNH 1X7AC 3GYLB 3LKWA 1T32A 1UCYE 3R3GB 2OXSA 3ZZDA 4I8HA 2AIQA 2GKVE 1XX9A 4GHQA 1WYKA 4FVDA 1T8LA 1ZMNA 2BY9X 4GLYA 3BG4B 1AFQC 4H4FA 3QGNB 1MZAA 4QT8C 1O36A 1GI3A 2C3SA 3PLKA 5AFZH 3TNTA 1K22H 1GPZA 1SOZA 4YLQH 1F5KU 2VIOA 5GDSH 1UHBA 2O8MA 3EAJA 3HK6B 1CO7E 2GZ7A 1DOJA 2WPHS 1GCTB 3VXEH 4BOHA 2GZ9A 2ZIQH 1C5ZB 3PTNA 3NWUA 2BDGA 2ZHWH 1SGCA 1P2NA 5JYIA 3T62A 1HAGE 4JCNA 3BTME 1SLVB 1L2EA 1GBFA 1F0RA 1EB1H 1FONA 1UVUH 1P2QA 2BY5X 3SOSA 3PWCA 2BD7A 1B0FA 2BY6X 1O0DH 1HNEE 4OS6A 1AUJA 4TWWA 3KCGH 4ZROA 3UNRA 3BEUA 1RTFB 1W10U 2Z9KA 1O2OA 1DVAH 3HPTB 1KXDA 1Y3UA 1TMTH 3BTDE 1GMHF 2ZDMA 2FM2A 1LTOA 3ENSB 1DS2E 4FUGA 2PKSC 2JH6D 3A8DA 1KXFA 1DWEH 4WF8A 4YO9A 4YOIA 2FI3E 1HCGA 3M3TA 2GCTB 2HGTH 1TQ7B 4Y7AA 4AORA 3MH4A 1AVWA 3RXRA 3SUEA 1LVMA 1SL3A 3A80A 1MCVA 5GJ4B 4DJZB 2NU4E 2ZU5A 1WSSH 2SGFE 2F83A 4IW4E 2P94A 2ZTXA 1EKBB 3P8GA 3PLBA 1C4V2 5ABWA 3GY8A 3Q77A 2ZHEH 5H4IB 4ZXYH 1RFNA 3KL6A 3RXVA 2ODYB 1BMMH 2QAAA 2V6NA 4LXBH 3RLWH 3UFAA 3ZVDA 1CT2E 3M7UA 5EODA 3F1SB 3MTYA 5FBIA 1P03A 1TFXA 2H2ZA 2TGDA 1DWDH 1XVOA 2VIQA 1C5QA 3GCNA 1SGYE 2NU2E 1ZSJA 1T4VH 1WQVH 2IJOB 2ANYA 3DHKH 2HALA 1P06A 1PJPA 2Q6FA 3T26A 1E36B 1TA2A 1BHXF 3C1KA 1PPZA 4J1YA 4TY6A 3ZV9A 1DFPA 2ZCHP 2BDCA 4IMQA 1EZSC 3BEIB 4O3TA 3SU5A 3GICB 1XXDA 2KAIA 2W26A 1V2MT 3UY9A 1TBRH 1GJ8B 1C5XB 4AFQA 1O2KA 1C4Y2 2C8YB 5K7RA 1CGJE 3ZYDA 1HAVB 1GJ7B 1C4U2 1UVTH 2A5KA 1OSSA 2OC7A 2FOFA 4RKOB 1ARCA 4JZDH 3SW2B 2FX4A 4Y8YA 1INCA 1SQAA 2ZDKA 3DUXH 3TK9A 5TJXA 1N1LA 1DLKB 1NRNH 1WOFA 3NXPA 2A4QA 3LT3A 3PO1C 3TGKE 2PFEA 2PUXB 1C9PA 4K5ZA 2GCTC 2W7SA 3RXLA 2Z3DA 1B0EA 3S9CA 2HWLB 3QWCH 3BTQE 2A2QH 1BTYA 1GJ6A 2ZU2A 2P59A 2Z9LA 1EAUA 2AERH 4BTUB 1C1QA 5FCRA 1N6XA 5HGGA 1NU9A 3E0PB 1P12E 3A8CA 1ELDE 2GTBA 5IYTA 4BANB 2AIPA 4X1PU 1QY6A 1C2MA 4INLA 1VJAU 2Y7XA 2V0BA 4CRBA 4JZIA 2XRCA 3U98H 3K65B 1BRAA 3OU0A 4K60A 1O2GH 1XUKA 2ODQA 1ZRBA 2AEIH 5SGAE 4IMZA 2Y6TA 2Y7ZA 3U8OH 1BTWA 3HGPA 5A09A 1WU1A 1GI0A 1SI5H 5CMXH 1MZDA 3SJ8A 4JZFH 4E7RG 1OOKB 3KF2A 1G9IE 4Q7ZA 1GVLA 1O3MA 5EXLA 2SNVA 4Y79A 3ZZAA 3QTOH 1XUJA 1YCPK 3UQVA 3I77A 1O5GH 4WVPE 5LPFA 3GISB 3QLPH 2V3OH 3SV6A 1AQ7A 1P09A 3SUDA 3FVFB 5DGJA 1NFUA 3SJIA 1DLEA 1SC8U 2IN2A 3SV7A 1GL0E 1NPMA 1FIZA 2ASUB 5JDUB 1FZZA 2WUCA 1OWHA 2W7UA 1MKWK 3EGKH 3P6ZB 4AYVB 3GY6A 3E0NB 1AIXH 1D3TB 1ZSLA 3A85A 4VGCB 4KELA 1A1RA 1P02A 3W95A 3SNDA 5LH8A 4YT6H 3VB4A 2Y5HA 3OY5U 1G3CA 1JWTA 3M7QA 1PQ5A 1TONA 1AKSA 4NSYA 3TITA 2UWLA 1ESAA 4ISOA 3GCHB 4Y0ZE 3SJ9A 1Z1JA 3A7WA 2XW9A 2UUFB 2HRVA 4X2WA 1LHEH 1VGCB 2QN5T 4Q80A 1FV9A 1ZTKA 4YZUA 1UCYK 3QZQA 2HVXA 4WJG2 1UVOA 2Q6GA 1O3IA 4WY3A 1ZMLA 1TNGA 4JYTA 1TPPA 1GI6A 3M3VA 1EJAA 3BTKE 3KQDA 4FU9A 2J38A 1D3DB 1C1OA 2BX3A 1P8VC 4X6PA 1FAKH 2QXIA 3CS7A 4AOQA 5ESTE 3TVJB 1MTSA 1ZR0A 3UWJH 1ZGVA 2OQUA 2RA3A 1TOCB 4Q7YA 5C67A 1GI2A 5FPYA 1LHDH 4X2XA 1V6DA 2VJ1A 3M5NA 1KXBA 2A7CA 3KGPA 3UPEA 4D8NA 4Z6AH 4GPGA 3VPKA 5CHAB 1W12U 1P01A 2ZDNA 1HJ8A 1NROH 2BLWA 2Y5FA 1LQDB 2FTLE 1YCPM 4VGCC 2OBOA 4X8TH 1IHSH 1GBHA 1ZHRA 1FUJA 1SGNE 4BXSA 4HI3A 2EI6A 1D3PB 1K1NA 7ESTE 1GBAA 1SQOA 2A45B 2PTNA 3SJOA 6CHAB 1PYTC 1VITF 2D2DA 2ALVA 3GCHC 3M61U 1SGQE 1JBUH 1UTMA 4MNYA 1FDPA 4TWYA 4KGAA 4BXWA 1Y59T 1W3CA 1QQ4A 1GBLA 1QA7A 2ODPA 2WV5A 3TGJE 4INKA 3SBKA 4ZAEA 1TNIA 2CN0H 2VU8E 2SGEE 3OSYA 1MBMA 4ISNA 5EXNA 1QJ6B 4GUXA 4UD9H 3SZNA 4B2AA 4R0IA 1P2OA 2HNTE 1G37A 1G32B 3RXUA 1O5CB 1V2PT 2R9PA 1P2JA 4MPWA 1J8AA 1IQMA 1TBQH 2PW8H 3NKKA 5A0BA 2BOKA 2QF0A 1UK2A 4GCHG 3F9FA 4I8LA 3UWIA 1Y3XA 2A4GA 1VCQA 1ZZZA 4GHTA 4IS5A 2IOTA 3RMLH 1TPOA 1GJDB 3RXOA 4F4OC 2BTCE 1HFDA 3MU8A 3ATLA 2ZP0H 1ANDA 5E0GA 5IDKA 2R2MB 1EXFA 1GHAG 3U8TH 4NWKA 4X6NA 1BITA 1O3FA 1PQAA 1XMNB 2FODA 7GCHF 2CV3A 1SMFE 2FOCA 1DWBH 5DO4H 1LHGH 5CHAC 1GBKA 1C2JA 1AGJA 1K1PA 1QCPA 2FLBH 5DP6A 4MNWA 1H9IE 1Y5AT 1QURH 2AGIX 4WWYA 1MUEB 1SBWA 1DXPA 3SGQE 3MU0A 4Y0YE 2BM2A 4X6OA 5B6OA 4ZKOU 1ZRKA 1DANH 3B23B 1GMCF 1QB9A 4ABGA 4CR5A 6CHAC 1ZHPA 2ZF0H 1Z8JB 3TH3H 5EW2H 3PTBA 4ZHLU 2QXHA 3KQEA 1AB9C 4OS1A 1P04A 3KNXA 4ZUHA 3KN2A 4YTAA 1IQJA 1TX7A 3TJUA 4UDWH 3HGNA 2B0FA 1Q31A 1IQNA 1HAPH 2G4UA 5FX5A 4Z0KA 1BBRH 1EPTA 4AN7A 1O3CA 5I25A 1TE0A 1TGSZ 4FU8A 3RU4E 1IHTH 3EA8A 3RUOA 1M9UA 1GBIA 5EOKA 3SU3A 1Q2WA 2PTCE 2AFQB 3KQCA 3MO9A 5DPAA 1OKXA 4TY7A 1VITG 4X6MA 1O5EH 5DP3A 1OP0A 4H6TA 1OWIA 2HPQH 1K28D 2OUAA 4Y71A 1FAXA 1F7ZA 1OS8A 3MI4A 1IQIA 1O2RA 2AMPA 2PKAA 1O2UA 3M5OA 1ZTJA 3C27B 3TH4H 2XXLA 1TMUH 4DCDA 2HNTC 1LVOA 1AHTH 4D76A 1O2HA 2I6QA 1IQFA 4GAWA 2WV4A 1S81A 2P3TB 3NCLA 1V2ST 2PWXA 3DA9B 4KKDA 4ABEA 1DUEA 1BHXB 3RC5A 4ISHH 4IBLH 1BJVA 1C2EA 3BV9B 4ZHAA 3PROA 1PPEE 1AE5A 1SFIA 4M7GA 5FX6A 3T25A 1CT0E 3UR6A 1N8OC 1C5TA 1Y3WA 1C1WH 1UTJA 6GCHF 3OY6U 1YPKH 4J2YB 2XTTB 1O2WA 1P3CA 2ZU3A 1EB2A 3AW0A 3EA7A 2QY0B 1C2GA 1H1BA 4U01A 2WPLS 1HJ9A 7GCHG 2YOLA 1ETSH 2BD5A 3RU4T 4A6LA 1T31A 1TQ0B 3ZZ7A 1AU8A 1GJBB 3A7TA 1J17T 1THSH 2F9VA 3TJNA 1B7XB 4DT7B 1HAHH 1UTPA 1ZPZA 3O8BA 2GGVB 1ZTLA 5FHTA 4B76A 1A61H 1HAOH 2BVSH 1GVZA 1EX3A 1G3DA 3MMGA 2AGEX 1BTUA 1UTLM 2QIQA 3OX7U 1SQTA 4TPYA 4BAOB 3RXDA 4ABHA 4HTCH 5I46H 3TJVA 3LIWA 2YNAA 1EASA 1GJCB 4X1RU 1DWCH 1EZUC 4JYUH 3LJOA 3PWBA 4X2YA 4CRCA 3LJJA 3P70B 5EQQA 2FS8A 5C3NA 1DE7H 2H9HA 4XBDA 1S6FA 2BVXH 1GHVH 1H8DH 2W5EA 4K2YA 1EUFA 1N6YA 1C5OH 3A8BA 4XE4A 2GDDA 1BUIA 2HNTF 3ESTA 3BTEE 1AY6H 3DT0H 1IQLA 4I33A 4K8BA 4F49A 1O2ZA 1IOEA 3T2NA 5FAHA 2GX4A 1GBTA 3LGWA 2OLGA 3VB5A 1ZSKA 4MG3A 4JYVH 1G30B 1JRTA 3UOUA 1G36A 2BQWB 2F9BH 1NRPH 3RXJA 4FUEA 1GI1A 1GI4A 1KXEA 1QR3E 5T3HA 1HAVA 2P3UB 3SQHE 3RXFA 1P9UA 1QHRB 3SQEE 1FJSA 4LZ1H 1MAYA 1O38A 5BPEA 1C2IA 1A4WH 5PTPA 4CH8B 1CVWH 1PQ7A 4FXGH 2BZ6H 3MNXA 1F92A 3M36A 2NU1E 2WYGA 3AAUA 2BLQA 3D49H 3VXFH 3E6PH 1NRSH 3MNCA 1TGBA 2PGBB 2XBYA 2OCVB 4MVNA 3SN8A 3PO1B 4RN6A 1RTKA 3D62A 1A7SA 2SGQE 1UK4A 2BDBA 4CH2B 1AUTC 2QXGA 2TRMA 1CGIE 2O8LA 2Y80A 1A5IA 4PROA 5L2YH 8GCHG 1F0SA 4AB9A 5CE1A 2XC4A 3NK8A 1ESTA 1JIRA 1AWHB 3LC3A 4MDSA 1T7CA 3Q3YA 1DY8A 2AYWA 1QL8A 1CQQA 1P9SA 6GCHG 3MFJA 4LK4A 4LZ4B 2ZGBH 3RC4A 1O33A 2PGQB 2GMTB 2JKHA 1E35B 1P10A 3F9HA 1K21H 4WMFA 1RS0A 3U69H 2BB4A 2H5CA 1LPZB 3RXQA 1HB0B 2GCHG 1O31A 4FUIA 4WXVA 3MWIU 1O3OA 4Y7BA 5T6DA 2XWAA 3MU1A 5C1UA 5JPMH 3AW1A 1V2RT 1ETRH 2BLVA 2ZGJA 3A7YA 3LGVA 1YF4A 1C2KA 4ZKNU 1QIXB 1MKWH 1U6QA 4WXIA 1D6RA 1GVKB 2ANWA 3H5CB 1NFWA 3RMOH 4BAMB 1UHBB 2ZG0H 1O2MA 4X2VA 1TMBH 1NFYA 1SPJA 2ZWLH 1Z8RA 2VWLA 2ZFTA 2ZPSA 1CE5A 1V2LT 1SGFG 3E90B 4FUDA 4ABJA 1DSUA 1NESE 3A82A 5A2MH 1GBMA 1GBDA 2H9EH 3F9EA 2BD9A 5EPNA 2ZGHA 3E8LA 1MTWA 3L33A 2XBXA 8KME2 1XKBC 1ZJKA 3K2UA 5F8XA 1KLIH 3GY5A 3RC6A 2VWOA 4DGJA 2R0LA 1YPHE 4CRGA 3MNSA 3ZZBA 1C5UA 3UREA 4AFZA 2F3CE 4CBNA 1EP6A 3G01A 5DG6A 2VGCB 1TPSA 3NUMA 1W7XH 1P2IA 4XSKU 2STBE 1C2HA 2GV7A 3GCTF 1LPGB 2FZZA 1TABE 2BZAA 2WPJS 3F68H 1ZOMA 1C1NA 4X1QU 2ZHDA 4AB8A 2GMTC 2VVCA 1OP8A 5EQSA 1GMHG 1O5BB 1QB6A 1QNJA 2A5IA 2W3IA 1TOMH 4YM9A 2B8OH 5EG4A 1FY1A 5EPYA 1L1GA 4A5TS 2ZC9H 2BMGB 1O5FH 3BTGE 5A8ZA 1V3XA 1KTTB 2G51A 1BA8B 4WH6A 4HZHA 1CHGA 2B5TB 1A0LA 1KYNA 1W13U 5JB8S 1CSOE 1NFXA 5LPRA 5GCHF 5J4QA 4YOJA 2FTMA 2O8UA 3EE0B 4K1EA 1C9TA 2ANMH 1W7GH 1K2I1 3GY2A 3LOXA 4MNXA 3A7ZA 1PPFE 2ZPRA 2A32A 1QRZA 1C5RA 3EQ0H 1CHOF 3Q76A 4A1XA 2EI8A 4DY7B 2ULLA 1DPOA 1MQ6A 2QYIA 1C2FA 2Z9GA 1MTUA 1D9IA 4A7IB 1IQHA 3KQBA 1SGPE 3S69A 1S0RA 4CHAB 3MU4A 3GDUA 4CRDA 5EGMA 1AI8H 3U9AH 3RXBA 4UEHH 1TRYA 3ZVCA 3S9AA 4UONA 2P16A 2R0KA 3B8JA 2VIDA 2ZDAH 1YPMH 1GBEA 1KLTA 3RXPA 4ABAA 2BD4A 2VGCC 1DICA 4AYYB 1TYNA 1C5MD 2ZPQA 1TX8A 1O3EA 1O2NA 1SLWB 4WH8A 1LMWB 1C2DA 1KY9A 1GCDA 2TBSA 2HLCA 3ZV8A 3ZYEA 5JBBS 1EQ9A 3A84A 1HAIH 2F9NA 2CF8H 4KTCA 1CA8B 2PV9B 1G3EA 4DIHH 1TNHA 1GDNA 1MAXA 3RMNH 2ZFFH 1FMGA 2Z6BD 2A2XH 3V13A 1FN6A 3TU7H 2RDLA 4K1TA 1BTXA 1FN8A 1ELAA 1EAIA 1GJAB 1QJ7B 4UFFH 4X0WU 1O35A 2G00A 2ZU4A 4RSPA 4BAQB 1GI8B 2PLXA 3ZZ9A 1UVSH 2G5VA 2SGDE 1HAYB 1T8NA 1YPHC 1Z7KA 2VIWA 2EI7A 4E7NA 2VVUA 1V2QT 4K8YA 3JZ2B 3UOPA 2FXRA 4XBBA 1TALA 1V2UT 4Y8ZA 4B75A 5EQRA 3F6UH 3SV9A 5FBEA 1SSXA 2LNCA 1SGFA 2ZCLP 1C1VH 3GCTG 2OTVA 4NIWA 1GJ5H 4NIVA 1AFEH 4AFSA 1V2VT 2VINA 2R3UA 1HUTH 1YPJH 4THNH 1TIOA 2BDYA 2ZHFH 3SO3A 4HFPB 1H9HE 4OS2A 1XUIA 2CHAB 3MOCA 2FOAA 3ATIA 2UUJB 3URDA 1BBRE 1L4ZA 1TRMA 3U1IB 1LHCH 1OWKA 4R8TB 4D7GA 2NWNA 4CBOA 1SGIB 2YNBA 3FP6E 1O39A 1KIGH 2Q1JA 1S83A 1PPBH 2Z9IA 4NSVA 3UTUH 3RM2H 2A7JA 4CHAC 1HJAB 1GHBF 1RXPA 2FEQH 2FOEA 1KLJH 2ZGCA 2QC2A 2ZFQH 2TIOA 1C1SA 1J16A 1MQ5A 2VVVA 1FY4A 3SI3H 3S7KB 1BRCE 1MKXH 1AE8H 1DSTA 3SORA 3OTJE 3A83A 4K3JA 2Z94A 3E1XB 5GCHG 2FI4E 1SR5C 2O8WA 1ANBA 1OPHB 4AG2A 3E16B 1YM0A 1G2MA 2QA9E 1GMDF 4IN1A 3QK1A 3PM3A 3RMMH 3ZZ8A 1CHOG 1AB9B 1TNJA 1RRKA 2R3YA 3RXSA 5AF9H 1KXCA 3R0FA 1XUFA 4MNVA 1NT1A 3A7VA 3DD2H 2B9LA 1ESBA 1GHWH 3I29A 1SLUB 1EAWA 4O03A 4K69A 2C93B 2XCFA 1S82A 1QQUA 2XWBI 1SG8B 2THFB 4DIIH 3QO6A 1O2YA 5AVDA 2SNWA 3LC5A 4BTIB 5GXPA 1BB0B 1XKAC 2JETB 2FLRH 1FXYA 2A1DB 1CA0B 3RXGA 1GG6B 4BNRA 2J9NA 4E06H 1F0TA 1OP2A 2VNTA 5F8ZA 1O3BA 2CHAC 3ZZ3A 2FX6A 1IAUA 3PMJA 5DP9A 1UTKA 2ZU1A 2PSYA 1O37A 5C2ZA 1BMAA 1D3QB 3L3TA 3PV4A 1QBNA 1JRSA 1OYQA 3FP8E 1G2LA 1ABJH 1NZQH 2GT8A 3GY4A 4FUFA 1HJAC 2Q6DA 2F9OA 4CRFA 1YYY1 3F9GA 1LCYA 2GZ8A 3LGIA 4OS7A 1LKBA 4NA9H 3MHWU 2QCYA 5GWZA 3AAVA 3RXTA 1HGTH 4FU7A 3PMAB 2GV6A 3IWMA 1GDQA 1ELVA 1TX6A 2DE9A 1ABIH 3JZ1B 3ZVGA 1QRWA 1EJNA 1N8OB 1S5SA 1T8MA 4JK6A 5JBTA 2IPHA 1TGNA 1RIWB 1TPAE 2G52A 1O2XA 3RXAA 2C8XB 3OYPA 1ETTH 3GY3A 2C4FH 3S0NA 3CP7A 1LKAA 4MQAA 1GHXH 1JIMA 1VCPA 1GWAA 1V2JT 7KMEH 4A92A 1BQYA 2GD4B 1V2TT 4A1VA 2AMQA 2A31A 4SGAE 4XDEA 1SGDE 1TNLA 1TRNA 5JBAS 3D23A 5EU8A 1XM1A 3EYDA 4WMDA 2EC9H 2P93A 2BLOA 1ARBA 4FVBA 1FI8A 1ZPCA 1HV7A 1W2KH 3ZVBA 1LO6A 1O2VA 1RD3B 3KEEA 2FOGA 3IG6B 1E38B 1PQ8A 2ZDLA 5LGOA 1NRQH 2QGRA 1QB1A 4NWLA 4Q7XA 2TPIZ 1XUHA 4IC5A 2WINI 2JETC 2VH6A 1ANEA 4OGYA 1CA0C 1C2LA 2A4RA 1TWXB 2VWNA 1GG6C 4ASHA 5FCKA 1DX5M 1HBTH 3UIRA 2OC8A 3SI4H 4UE7H 2ZA5A 2SFAA 3TH2H 3GYMA 2FDAA 3QZRA 1OWJA 2H6MA 4AG1A 1O2JA 4DOQA 1SHYA 1K1IA 4DG4A 1HAZB 1GI9B 1YKTA 2D26C 1O3JA 5HYOA 1SOTA 4ISLA 1K1MA 3CS0A 1S0QA 1ZHMA 1C5WB 3NZIA 4X8VH 4YLUA 5A0CA 1DT2A 1F0UA 2JH0D 1KDQB 4JK5A 2BDIA 3SV8A 2OP9A 1PPCE 2WPMS 4X8SH 3UNSA 1LQEA 2VB0A 2ILNA 3ZVEA 2VH0A 3DFJA 1O3GA 1V2OT 1MBQA 3ZZ5A 1A2CH 4B71A 2TGPZ 2FESH 1K1OA 4WMEA 2CJIA 5TCCA 4FUHA 5ESBA 1RIWC 3QUMP 3TK5A 1ELTA 2GDEH 1KTSB 1YLDA 1MU8B 3RM0H 2RCEA 1E34B 2BY8X 1ACBE 1EP5A 3MH7A 1O2QA 5LPEA 1HAXB 1Y5UT 1E0FD 1K1JA 3PMBB 1P11E 4ZKRU 4H6SB 4E05H 1SB1H 2B7DH 2LPRA 4JZEH 1Y3YA 4INHA 2P95A 1K9OE 4NIYA 2ZO3H 2G4TA 1HIAB 1RJXB 2QXJA 1TB6H 2ZTYA 1BTHH 4YT7H 1AZZA 3URCA 3FP7E 1MTNC 1UTOA 3SHCH 4ZHMU 1HDTH 1GMCG 2J2UA 3I78A 3PYHA 2ESTE 3M5LA 3SNBA 1EOLA 2Z3EA 4IGDA 3BTTE 1QBOA 3QN7A 4U2WA 1O30A 1W0YH 2FOBA 1TBZH 3PMHB 1EPTB 1GI7B 3N7OA 1FY5A 1P2KA 1TGCA 1NO9H 5A0AE 5A8YA 2BXTH 2BDAA 1AWFH 1WAYB 5DP4A 3SU6A 2BX4A 2FOMB 3A81A 5L6NH 1IQEA 3S7HB 1O2TA 2BD2A 3TJOA 3QTVH 1A46H 1BBRK 4KTSA 3HKJB 2VIVA 2XNIA 1UK3A 2PKAB 2BOHB 5DK1A 4YOGA 4X1NU 2A5AA 3V12A 3SU4A 2CGAA 1Z1IA 1O3DA 5DKMA 1H8IH 4UFDH 4BAKB 3UNQA 1W8BH 3Q00A 1Y8TA 4JZ1A 9ESTA 4B73A 1GJ4H 4MLFB 5C20A 1TLDA 1BRUP 2CXVA 3STJA 1ANCA 2NU3E 3P92A 4MPXA 3RLYH 1C1MA 4Y11E 3HATH 3M5MA 3TLOA 3MYWA 5K0HA 3FANA 2ZNKH 1L1NA 3ODDA 1J15A 1NRRH 2G81E 3SU0A 2CMYA 3LGYA 5HMAA 1GBJA 1C5LH 1C5NH 5TCAA 3QGJA 2CF9H 1A3EH 1ELCA 6ESTA 1CBWB 1MU6B 2Y82A 1ID5H 4I8GA 4X1SU 1SVPA 1WQSA 3EA9A 1BOQA 2PSXA 4I8KA 1P05A 4X8UH 5E0HA 4Y10E 3GDSA 2V3HH 5J4SA 1C1RA 2BDHA 4HGCA 1W0ZU 1YC0A 1YCPH 4NFFA 1EPTC 4MPUA 2OINA 2DE8A 3ATWA 1A0JA 5ETXA 1QJ1B 1OWDA 3K6ZA 1YBWA 6LPRA 1E37B 1F5RA 1C1UH 3BSQA 3U8RH 3BG4C 1BZXE 1TGTA 3SNCA 2Z3CA 1OWEA 2BHGA 1GI5A 3ZZ6A 1GCTC 1C5YB 1BDAA 1ZPBA 4U30A 3BG8A 4XOJA 3LH3A 1S84A 1O3HA 3QDZB 1O3PB 2PUQH 4B1TA 1O5AB 1Y5BT 2FS9A 2P3FH 2V35A 3E3TA 1WTGH 2WYJA 1MMJN 2J34A 2ZFPH 3STIA 1FPCH 1HLTH 1UMAH 3ZZCA 1EJMA 1A5HA 4CREA 1FQ3A 1T8OA 1FPHH 1QTFA 1SLXB 2UWPA 2XBWA 3FZZA 5JBCS 3A89A 3H7TA 2UWOA 2UUKB 1Y3VA 3FFGA 5A8XA 1GJ9B 4DVAU 3BN9A 4D9QA 1B5GH 4U32A 1Z71A 1BIOA 1NC6A 1IQGA 1OYTH 3VFEA 4CRAA 2RG3A 1UCYH 2FIRH 1FY3A 2VIPA 2DUCA 1FIWA 3GY7A 2GP9B 1CBWC 4MTBA 2ZHQH 8ESTE 1PPHE 2G8TA 3RXEA 3GDVA 3SGBE 2PHBA 1BTZA 3VB7A 4DW2U 4I31A 4Q2KA 1DY9A 2OD3B 1WUNH 2M5TA 1AZ8A 4AGJA 2XYAA 5C1XA 1A5GH 4FUJA 4NA8A 3PB1E 1SGRE 2EA3A 4D9RA 2F9UA 4ABDA 4H42U 1YPGH 5FPSA 2BQ7B 1ELBA 1YPEH 5DP5A 4A1TA 2UUYA 2ZECA 4GSOA 5E0JA 2A7HA 3NPSA 1FNIA 3LPRA 5F03A 1WCZA 4LOYH 3BTWE 3HK3B 3CENA 4O97A 3TPIZ 1YLCA 2TGAA 3SNEA 1ELGA 1HXEH 1O2PA 2OBQA 3RXIA 3AASA 4FUCA 5DJ7A 1BTPA 2HPPH 4NZLA 1XVMA 4ISIH 2BD8A 3M3SA 5HM2A 1TAWA 4AFUA 5G4BA 2G5NA 4NZQA 3ITIA 4YESB 3LH1A 4UFGH 3LDXH 3VB6A 1NY22 1T4UH 2JH5D 4AZ2B 3T28A 3H7OA 2KAIB 3QX5H 3UQOA 1A3BH 1ZYOA 2A0QB 4B2BA 1V2WT 1UTQA 1ZMJA 3T29A 2BXUH 1YGCH 1V2KT 1O3AA 2D1JA 2FP7B 3RXKA 3SGAE 3B9FH 3SU2A 2ZFSA 1WV7H 3P8FA 3SUGA 4Y76A 8LPRA 2WUBA 3SV2H 4TYDA 1C5SA 1HPGA 2AMDA 2A4OA 3KHVA 1DXWA 2H5DA 1LHFH 1J9CH 1PFXC 3IITA 3LU9B 4GCHF 1MD7A 2J92A 1P3EA 1Z6EA 2ZTZA 1KSNA 1HRTH 2O8TA 2ZI2H 2HOBA 2FYQA 3BIUH 3K9XB 3ZVAA 4RKJB 1LVBA 3GCOA 2J95A 1DDJA 4ABFA 1F5LA 1GHAF 5HXFA 1RGQA 3A8AA 1EAXA 1Z8GA 7LPRA 1O3NA 5GPIB 1O3LA 2J4IA 4AGKA 3TNSA 1O34A 1EATA 1ZLRA 3RP2A 3TGIE 4NG9H 2BY7X 4NFEA 3T27A 1LPKB 1Q3XA 3P17H 4D7FA 3VGCB 2FOHA 2J94A 2ZKSA 1VITH 4JMYA 4NIXA 5E2OA 5T6GA 2XC5A 1SGEE 1YPLH 1F2SE 1PPGE 4KP0A 1HXFH 3MO6A 1TA6A 1FLEE 1GBCA 1ZJDA 2D8WA 4XBCA 1AN1E 1CGHA 5C5NA 2O9QA 3O8RA 2NU0E 2QF3A 3O8CA 1YP9A 2BQ6B 1W11U 1DITH 2ZFRH 1C1PA 3L6PA 2SGPE 4NCYA 3K6YA 3MH5A 4NA7A 1PYTD 2OQ5A 2Z7FE 3ELAH 2ZQ1A 1NU7B 1A0HB 1JXPA 1Z6JH 1GGDB 2WPKS 3A87A 1ELEE 1BJUA 4OGXA 9LPRA 1H9LB 3V7TA 1UJ1A 4ZKSU 1NTPA 2FPZA 3SJKA 2STAE 2XC0A 1L0ZA 1FY8E 1AVXA 1WTHD 5E2PA 2AS9A 2QV1A 4OS5A 1QA0A 3VB3A 2C90B 1CT4E 1LDTT 1WBGB 3PLPA 4TPIZ 1QL7A 3TK6A 1C1TA 4AX9H 3E91A 1LVYA 4Y6DA 4ABIA 2R2WU 2Z9JA 1BCUH 1QL9A 2OC1A 1VR1H 1SHHB 1O2LA 1SFQB 3MNBA 1Z8IB 2C8WB 5AHGH 5AFYH 3GOVB 1UVPA 3A86A 4DURA 1IQKA 2FMJA 3P95A 3AVZA 2FWWA 3FAOA 4NGAH 1AKSB 1MTVA 1TNKA 4KTUA 3RXCA 2XBVA 1GHZA 4SGBE 5E8EH 5FPTA 1VGCC 2G55A 1D4PB 1THPB 4B2CA 1NN6A 1QFKH 2PR3A 3VGCC 3EDXB 4OS4A 4IN2A 2GVFA 1NS3A 2TGTA 2F9PA 2BD3A 1KXAA 2ALPA 3RXHA 3U1JB 1O3KA 1MH0A 2XCNA 1P57B 3RDZA 3T5FH 4BTTB 1KDQA 3SNAA 4Y8XA 2ZZUH 3SHAH 1D6WA 5T6FA 4ABBA 4ZH8A 1O5DH 1BT7A 2W3KA 2OC0A 2Y81A 2FI5E 1JMOH 3TIUA 1GGDC 1THRH 3BTFE 2ZDVH 1H4WA 1XXFA 2SGAA 2ZEBA 3HKIB 2EEKA 1UO6A 1C5PA 4BAHB 5BRRE 3LGTA 3LONA 1VZQH 1P2MA 2BYAX 1BMLA 1OX1A 2WPIS 4XFQA 1SGTA 3O8DA 1RTLA 4I8JA 3VEQB 3ODFA 1GHBG 3ZVFA 1O2IA 1K1LA 1HIAA 2ZCKP 3W94A 3V3MA 2AH4X 1JOUB 1QRXA 5C5OA 2RA0A 5DP7A 1MCTA 5F8TA 4B74A 5JB9S 4I7YH 1MTNB 5C1YA 1ELFA 1HYLA 1MKXK 3WY8A 1NM6A 2K1QA 5FXLA 1EOJA 1XUGA 3UUZA 2C8ZB 3P8OA 2P8OB 4MPVA 4GVUA 1GMDG 2F91A 1S6HA 5GIBA 1GL1A 4FUBA 4CR9A 2ZQ2A 2FYRA 1S85A 4K1SA 5HM9A 1GDUA 1VJ9U 3A88A 3S9BA 1O32A 1AFQB 3ATMA 1EZXC 3BF6H 1DUAA 1BRBE 2VWMA 2I6SA 4UFEH 1MD8A 4I32A 5DP8A 3LGUA 2ZGXH 1QGFA 3SUFA 1ORFA 1G3BA 3BIVH 3V0XA 5F6MA 1AO5A 3A7XA 1OXGA 1AD8H 4ZXXH 3MU5A 2GT7A 1GBBA 1EZQA 4ZMAH 3M37A 4O9VA 4IC6A 3Q3KA 1ZGIA 8GCHF 3BEFB 1AVGH 2H9TH 3KIDU 1J14A 3ATKA 3M7TA 3MO3A 1W14U
chains in the Genus database with same CATH superfamily
1L1JA 3P8NA 1C5VA 5EXMA 1V2NT 4ESTE 3RXMA 3M35A 1O2SA 3DFLA 2ANKH 3PV5A 3OEHD 2BVRH 3ZZ4A 3FZDA 3MH6A 2FO9A 1P0SH 2XNDD 3D65E 2Y5GA 2GCHF 5L2ZH 2AGGX 2H1UA 1UTNA 2PKSB 1GHYH 1AMHA 2QF5A 1DM4B 5EW1H 4O3UA 1QBVH 1CU1A 1L4DA 2P8OC 3SU1A 3BTHE 3Q3XA 1VCWA 3RU4D 5L30H 3UR9A 1BMNH 1X7AC 3GYLB 3LKWA 1T32A 1UCYE 3R3GB 2OXSA 3ZZDA 4I8HA 2AIQA 2GKVE 1XX9A 4GHQA 1WYKA 4FVDA 1T8LA 1ZMNA 2BY9X 4GLYA 3BG4B 1AFQC 4H4FA 3QGNB 1MZAA 4QT8C 1O36A 1GI3A 2C3SA 3PLKA 5AFZH 5CDFE 3TNTA 1K22H 1GPZA 1SOZA 4YLQH 1F5KU 2VIOA 5GDSH 1UHBA 2O8MA 2J97A 3EAJA 1CO7E 3HK6B 2GZ7A 2LP6A 1DOJA 2WPHS 1GCTB 3VXEH 4BOHA 3CNRA 2GZ9A 2ZIQH 1C5ZB 3PTNA 3NWUA 2BDGA 2ZHWH 1SGCA 1P2NA 5JYIA 3T62A 1HAGE 4JCNA 3BTME 1SLVB 1L2EA 1GBFA 1F0RA 1EB1H 2QF4A 1FONA 1UVUH 1P2QA 2BY5X 3SOSA 3PWCA 2IPQX 2BD7A 1B0FA 2BY6X 1O0DH 1HNEE 4OS6A 2KR7A 1AUJA 4TWWA 3KCGH 4ZROA 3UNRA 3BEUA 1RTFB 1W10U 2Z9KA 1O2OA 1DVAH 3HPTB 1KXDA 1Y3UA 4M9FA 2RFKC 1TMTH 3BTDE 1GMHF 2ZDMA 2FM2A 1LTOA 3ENSB 1DS2E 4FUGA 2PKSC 2JH6D 3A8DA 1KXFA 1DWEH 4WF8A 4YO9A 4YOIA 2FI3E 1HCGA 3M3TA 2GCTB 2HGTH 1TQ7B 4Y7AA 4AORA 3MH4A 1AVWA 3RXRA 3SUEA 1LVMA 1SL3A 3A80A 1MCVA 5GJ4B 4DJZB 2NU4E 2ZU5A 1WSSH 2SGFE 2F83A 4IW4E 2P94A 2ZTXA 1EKBB 3P8GA 3PLBA 1C4V2 5ABWA 3GY8A 3Q77A 2ZHEH 2W6ID 5H4IB 4ZXYH 1RFNA 3KL6A 3RXVA 2ODYB 1BMMH 2IJD1 2KCYA 2QAAA 2V6NA 4LXBH 3RLWH 3UFAA 1E1QD 3ZVDA 1CT2E 3M7UA 5EODA 3F1SB 3MTYA 5FBIA 1P03A 1TFXA 2H2ZA 5GNDA 2TGDA 1DWDH 1VKYA 1XVOA 2VIQA 1C5QA 3GCNA 1SGYE 2NU2E 1ZSJA 1T4VH 1WQVH 2IJOB 2ANYA 3DHKH 2HALA 1P06A 1PJPA 2Q6FA 3T26A 1E36B 1TA2A 1BHXF 3C1KA 1PPZA 4J1YA 4TY6A 3ZV9A 1DFPA 2ZCHP 2BDCA 4IMQA 1EZSC 3BEIB 3SYJA 4O3TA 3SU5A 3GICB 1XXDA 2KAIA 2W26A 1V2MT 3UY9A 1TBRH 1GJ8B 1C5XB 4AFQA 1O2KA 1C4Y2 2C8YB 5K7RA 1CGJE 3ZYDA 1HAVB 1GJ7B 1C4U2 1UVTH 2A5KA 1OSSA 2OC7A 3FO8D 2FOFA 4RKOB 1ARCA 4JZDH 4TSFD 2FX4A 3SW2B 4Y8YA 1INCA 1SQAA 2ZDKA 3DUXH 3TK9A 5TJXA 1N1LA 1DLKB 1NRNH 1WOFA 3NXPA 2A4QA 3LT3A 3PO1C 3TGKE 2PFEA 2PUXB 1C9PA 4K5ZA 2GCTC 2W7SA 3RXLA 2Z3DA 1B0EA 3S9CA 2HWLB 3QWCH 3BTQE 2A2QH 1BTYA 1GJ6A 2ZU2A 2P59A 2Z9LA 1EAUA 2AERH 4BTUB 1C1QA 5FCRA 1N6XA 5HGGA 1NU9A 3E0PB 2V3MA 1P12E 3A8CA 1ELDE 2GTBA 5IYTA 4BANB 2AIPA 5B6LA 4X1PU 1QY6A 1C2MA 4INLA 1VJAU 2Y7XA 2V0BA 4CRBA 4JZIA 2XRCA 3U98H 3K65B 1BRAA 3OU0A 4K60A 1O2GH 1XUKA 2ODQA 1ZRBA 2AEIH 5SGAE 4IMZA 4OM9A 2CK3D 2Y6TA 2Y7ZA 3U8OH 1BTWA 1YY3A 3HGPA 5A09A 1WU1A 1GI0A 1SI5H 5CMXH 1MZDA 3SJ8A 4JZFH 4E7RG 1OOKB 3KF2A 1G9IE 4Q7ZA 1SQRA 1GVLA 1O3MA 5EXLA 2SNVA 4Y79A 3ZZAA 3QTOH 1XUJA 1YCPK 3UQVA 3I77A 3DCLA 1O5GH 4WVPE 5LPFA 3GISB 3QLPH 2V3OH 3SV6A 1AQ7A 1P09A 3SUDA 3FVFB 5DGJA 1NFUA 3SJIA 1DLEA 1SC8U 2IN2A 3SV7A 1GL0E 1NPMA 1FIZA 2ASUB 4ASUD 5JDUB 1FZZA 2WUCA 1OWHA 2W7UA 1MKWK 3EGKH 3P6ZB 4AYVB 3GY6A 3E0NB 1AIXH 1D3TB 1ZSLA 3A85A 4VGCB 4KELA 1A1RA 1P02A 3W95A 1YWUA 3PV2A 3SNDA 5LH8A 4YT6H 3VB4A 2Y5HA 3OY5U 1G3CA 1JWTA 3M7QA 1PQ5A 1TONA 1AKSA 4NSYA 3TITA 2UWLA 1ESAA 4ISOA 3DSGA 3GCHB 4Y0ZE 3SJ9A 1Z1JA 3A7WA 2XW9A 2UUFB 2HRVA 4X2WA 1LHEH 1VGCB 2QN5T 4Q80A 1FV9A 5EIYA 1ZTKA 4YZUA 1UCYK 3QZQA 2HVXA 4WJG2 1UVOA 2Q6GA 1O3IA 4WY3A 1ZMLA 1TNGA 4JYTA 1TPPA 1GI6A 3M3VA 1EJAA 3BTKE 3KQDA 4FU9A 2J38A 1D3DB 1C1OA 2BX3A 1P8VC 4X6PA 1FAKH 2QXIA 3CS7A 4AOQA 5ESTE 3TVJB 1MTSA 1ZR0A 3UWJH 1ZGVA 2OQUA 2RA3A 1TOCB 4Q7YA 5C67A 1GI2A 5FPYA 1LHDH 4X2XA 1V6DA 2VJ1A 3M5NA 3ZIAD 1KXBA 2A7CA 3KGPA 3UPEA 4D8NA 4Z6AH 4GPGA 3VPKA 5CHAB 1W12U 1P01A 2ZDNA 1HJ8A 1NROH 2BLWA 2Y5FA 1LQDB 2FTLE 1YCPM 4VGCC 2OBOA 4X8TH 1IHSH 1GBHA 1ZHRA 1FUJA 1SGNE 4BXSA 1NBMD 4HI3A 2EI6A 1D3PB 1K1NA 7ESTE 1GBAA 1SQOA 2A45B 2PTNA 3SJOA 6CHAB 1PYTC 1VITF 2D2DA 2ALVA 3GCHC 3M61U 1SGQE 1JBUH 1UTMA 4MNYA 1FDPA 4TWYA 4KGAA 4BXWA 1Y59T 1W3CA 1QQ4A 1GBLA 1QA7A 2ODPA 2WV5A 3TGJE 4INKA 3SBKA 4ZAEA 1TNIA 2CN0H 2VU8E 2SGEE 3OSYA 1MBMA 4ISNA 5EXNA 5T1VA 1QJ6B 4GUXA 4UD9H 3SZNA 5KGOA 4B2AA 4R0IA 1P2OA 2HNTE 1G37A 1G32B 3RXUA 1O5CB 1V2PT 2R9PA 1P2JA 4MPWA 1J8AA 1IQMA 1TBQH 2PW8H 3NKKA 5A0BA 2BOKA 2QF0A 1UK2A 4GCHG 3F9FA 4I8LA 3UWIA 1Y3XA 2A4GA 1VCQA 1ZZZA 4GHTA 4IS5A 5C0UA 2JIZD 2IOTA 4Q4LA 1TPOA 3RMLH 1GJDB 3RXOA 4F4OC 2BTCE 1HFDA 3MU8A 3ATLA 2ZP0H 1ANDA 5E0GA 5IDKA 2R2MB 1EXFA 1GHAG 3U8TH 4NWKA 4X6NA 1BITA 1O3FA 1PQAA 1XMNB 2FODA 7GCHF 2CV3A 1SMFE 2FOCA 4ACAA 1DWBH 2PP6A 5DO4H 1LHGH 5CHAC 1GBKA 1C2JA 1AGJA 1K1PA 1QCPA 2FLBH 2WSSD 5DP6A 4MNWA 1H9IE 2KCPA 4RT1A 1Y5AT 1QURH 2AGIX 2VBCA 4WWYA 1MUEB 1SBWA 1DXPA 3SGQE 3MU0A 4Y0YE 2BM2A 4X6OA 5B6OA 4ZKOU 1ZRKA 1DANH 3AK5A 4ZCNA 3B23B 1GMCF 1QB9A 4ABGA 4CR5A 6CHAC 1ZHPA 2ZF0H 1Z8JB 3TH3H 5EW2H 3PTBA 3F0PA 1H8HD 4ZHLU 3PRDA 2QXHA 3KQEA 1AB9C 4OS1A 1P04A 3KNXA 4ZUHA 3KN2A 2EY4C 4YTAA 1IQJA 1TX7A 3TJUA 4UDWH 3HGNA 2B0FA 1Q31A 1IQNA 1HAPH 2G4UA 5FX5A 4Z0KA 1BBRH 1EPTA 4AN7A 1O3CA 5I25A 2WZQA 1TE0A 1TGSZ 4FU8A 3RU4E 1IHTH 3EA8A 3RUOA 1M9UA 1GBIA 5EOKA 3SU3A 1Q2WA 2PTCE 2AFQB 3KQCA 3MO9A 5DPAA 1OKXA 4TY7A 1VITG 4X6MA 1O5EH 5DP3A 1OP0A 4H6TA 1OWIA 2HPQH 5CHBA 1K28D 2OUAA 4Y71A 1FAXA 2KX4A 1F7ZA 1OS8A 3MI4A 1IQIA 1O2RA 2AMPA 2PKAA 1O2UA 2KFWA 3M5OA 1ZTJA 3C27B 3TH4H 2XXLA 1TMUH 4DCDA 2HNTC 1LVOA 1AHTH 2AHME 4D76A 1O2HA 2I6QA 1IQFA 4GAWA 5DSFA 2WV4A 1S81A 2P3TB 3NCLA 1V2ST 2PWXA 3DA9B 3N7DA 4KKDA 4ABEA 5HKKD 1DUEA 1BHXB 3RC5A 4ISHH 4IBLH 1BJVA 1C2EA 3BV9B 3F2HA 4ZHAA 3PROA 1PPEE 1WXRA 1AE5A 1SFIA 4M7GA 5FX6A 3T25A 1CT0E 3UR6A 1N8OC 1C5TA 1Y3WA 1C1WH 1UTJA 3OEED 6GCHF 3OY6U 1YPKH 4J2YB 2XTTB 1O2WA 1P3CA 2ZU3A 1EB2A 3AW0A 3EA7A 2QY0B 1C2GA 1H1BA 4U01A 2WPLS 1HJ9A 7GCHG 2YOLA 1ETSH 2BD5A 3RU4T 4A6LA 1T31A 1TQ0B 3ZZ7A 1AU8A 1GJBB 3A7TA 1J17T 3KYFA 1THSH 2F9VA 3TJNA 2HLDD 1B7XB 4DT7B 1HAHH 1UTPA 1ZPZA 3O8BA 2GGVB 1ZTLA 5FHTA 4B76A 1A61H 1HAOH 2BVSH 2LELA 1GVZA 1EX3A 1G3DA 3MMGA 2AGEX 1BTUA 1UTLM 2QIQA 3OX7U 1SQTA 4TPYA 4BAOB 3RXDA 4ABHA 4HTCH 5I46H 3TJVA 3LIWA 2YNAA 4FETA 1EASA 1GJCB 4X1RU 1DWCH 1EZUC 4JYUH 3LJOA 3PWBA 4X2YA 4CRCA 3LJJA 3P70B 5EQQA 2FS8A 3SZEA 5C3NA 1DE7H 2H9HA 4XBDA 1S6FA 2BVXH 5EJLA 1GHVH 1H8DH 2W5EA 4K2YA 1EUFA 1N6YA 1C5OH 3A8BA 4XE4A 2GDDA 1BUIA 2HNTF 3ESTA 3BTEE 1AY6H 3DT0H 1IQLA 4I33A 4K8BA 4F49A 1O2ZA 1IOEA 3T2NA 5FAHA 2GX4A 1GBTA 3LGWA 2OLGA 3VG8A 3VB5A 1ZSKA 4MG3A 4JYVH 1G30B 1JRTA 3UOUA 1G36A 2BQWB 2F9BH 1NRPH 3RXJA 4FUEA 1GI1A 1GI4A 1KXEA 1MABB 1QR3E 5T3HA 4B6EA 1HAVA 2P3UB 3SQHE 3RXFA 1S6LA 1P9UA 1QHRB 3SQEE 1FJSA 4LZ1H 1MAYA 1O38A 5BPEA 1C2IA 1A4WH 5PTPA 4CH8B 1CVWH 1PQ7A 4FXGH 2BZ6H 2L74A 3MNXA 1F92A 3M36A 2NU1E 2WYGA 3AAUA 2BLQA 3D49H 3VXFH 3E6PH 1NRSH 3MNCA 1TGBA 2PGBB 2XBYA 2OCVB 4MVNA 3SN8A 3PO1B 4RN6A 4P00A 1RTKA 3D62A 1A7SA 2SGQE 1UK4A 2BDBA 4CH2B 1AUTC 2QXGA 2TRMA 1CGIE 2O8LA 2Y80A 1A5IA 4PROA 5L2YH 8GCHG 1F0SA 4AB9A 5CE1A 2XC4A 3NK8A 1ESTA 1JIRA 1AWHB 3LC3A 4MDSA 1T7CA 3Q3YA 1DY8A 2AYWA 1QL8A 1CQQA 1P9SA 4HG6A 6GCHG 3MFJA 4LK4A 4LZ4B 2ZGBH 3RC4A 1O33A 2PGQB 2GMTB 2JKHA 1E35B 1P10A 3F9HA 1K21H 4WMFA 1RS0A 3U69H 2BB4A 2H5CA 1LPZB 3RXQA 1HB0B 2GCHG 1O31A 4FUIA 4WXVA 3MWIU 1O3OA 4Y7BA 5T6DA 2XWAA 3MU1A 5C1UA 5JPMH 3AW1A 1SKYE 1V2RT 1ETRH 2BLVA 2ZGJA 3A7YA 3LGVA 2YMSD 1YF4A 1C2KA 4ZKNU 5FL7D 1QIXB 1MKWH 1U6QA 4WXIA 1D6RA 1GVKB 2ANWA 3H5CB 1NFWA 3RMOH 4BAMB 1UHBB 2ZG0H 1O2MA 4X2VA 3UB0A 1TMBH 1NFYA 1SPJA 2ZWLH 1Z8RA 2VWLA 2ZFTA 2ZPSA 1CE5A 1V2LT 1SGFG 3E90B 4FUDA 4ABJA 1DSUA 1NESE 3A82A 5C17A 5A2MH 1GBMA 1GBDA 2H9EH 3F9EA 2BD9A 5EPNA 2ZGHA 3E8LA 1MTWA 3L33A 2XBXA 8KME2 1XKBC 1ZJKA 3K2UA 5F8XA 1KLIH 3GY5A 3RC6A 2VWOA 4DGJA 2R0LA 1YPHE 4CRGA 3MNSA 3ZZBA 1C5UA 3UREA 4AFZA 2F3CE 4CBNA 1EP6A 3G01A 5DG6A 2VGCB 1TPSA 3NUMA 1W7XH 1P2IA 4XSKU 2STBE 1C2HA 2GV7A 3GCTF 1LPGB 2FZZA 1TABE 2BZAA 2WPJS 3F68H 1ZOMA 1C1NA 4X1QU 2ZHDA 4AB8A 2GMTC 2VVCA 4YXWD 1OP8A 5EQSA 1GMHG 1O5BB 1QB6A 1QNJA 2A5IA 2W3IA 1TOMH 4YM9A 2B8OH 5EG4A 4RT0A 1FY1A 5EPYA 1KMHB 1L1GA 4A5TS 2ZC9H 2BMGB 1O5FH 3BTGE 5A8ZA 1V3XA 1KTTB 2G51A 1BA8B 4WH6A 4HZHA 1CHGA 2B5TB 1A0LA 1KYNA 1W13U 5JB8S 2OK5A 1CSOE 1NFXA 5LPRA 5GCHF 5J4QA 4YOJA 2FTMA 2O8UA 3EE0B 4K1EA 1C9TA 2ANMH 1W7GH 1K2I1 4Z1MD 3GY2A 3LOXA 4MNXA 3A7ZA 1PPFE 2ZPRA 4F55A 2A32A 1QRZA 1C5RA 3EQ0H 1CHOF 3Q76A 4A1XA 2EI8A 4DY7B 2ULLA 1DPOA 1MQ6A 2GJGA 1C2FA 2QYIA 2Z9GA 1MTUA 1D9IA 4A7IB 1IQHA 3KQBA 1SGPE 3S69A 1S0RA 4CHAB 3MU4A 3GDUA 4CRDA 5EGMA 1AI8H 3U9AH 3RXBA 4UEHH 1TRYA 3ZVCA 4XRNA 3S9AA 4UONA 2P16A 2R0KA 3B8JA 2VIDA 2ZDAH 1YPMH 1GBEA 1KLTA 3RXPA 4ABAA 2BD4A 2WV9A 2VGCC 1DICA 4AYYB 1TYNA 1C5MD 2ZPQA 1TX8A 1O3EA 1O2NA 1SLWB 3F2GA 4WH8A 1LMWB 1C2DA 1KY9A 1GCDA 2TBSA 2HLCA 3ZV8A 3ZYEA 5JBBS 1EQ9A 3A84A 1HAIH 3EE7A 2F9NA 2CF8H 4KTCA 1CA8B 2PV9B 1G3EA 4DIHH 1TNHA 1GDNA 1MAXA 3RMNH 2ZFFH 1FMGA 2Z6BD 2A2XH 3V13A 1FN6A 3TU7H 2RDLA 5KECA 4K1TA 1BTXA 1FN8A 1ELAA 1EAIA 1GJAB 1QJ7B 4UFFH 4X0WU 1O35A 2G00A 2ZU4A 4RSPA 4BAQB 1GI8B 2PLXA 3ZZ9A 1UVSH 2G5VA 2SGDE 1HAYB 1T8NA 1YPHC 1Z7KA 2VIWA 2EI7A 4E7NA 2VVUA 1V2QT 3WW7A 4K8YA 3JZ2B 3UOPA 2FXRA 4XBBA 1TALA 1V2UT 4Y8ZA 4B75A 5EQRA 3F6UH 3SV9A 5FBEA 1SSXA 2LNCA 1SGFA 2ZCLP 1C1VH 3GCTG 2OTVA 4NIWA 1GJ5H 4NIVA 5HIYA 1AFEH 4AFSA 1V2VT 2VINA 2R3UA 1HUTH 1YPJH 4THNH 1TIOA 2BDYA 2ZHFH 3SO3A 4HFPB 1H9HE 4OS2A 1XUIA 2CHAB 3MOCA 2FOAA 3ATIA 2UUJB 3URDA 1BBRE 1L4ZA 1TRMA 3U1IB 1LHCH 1OWKA 4R8TB 4D7GA 2NWNA 4CBOA 1SGIB 2J98B 2YNBA 3FP6E 1O39A 1KIGH 2Q1JA 1S83A 1PPBH 2Z9IA 4NSVA 3UTUH 3RM2H 2A7JA 4CHAC 1HJAB 1GHBF 1RXPA 2FEQH 2FOEA 1KLJH 2ZGCA 2QC2A 2ZFQH 2TIOA 1C1SA 1J16A 1MQ5A 2VVVA 1FY4A 2WHXA 3SI3H 3S7KB 1BRCE 1MKXH 1AE8H 1DSTA 3SORA 3OTJE 3A83A 4K3JA 2Z94A 3E1XB 5GCHG 2FI4E 1SR5C 2O8WA 1ANBA 1OPHB 4AG2A 3E16B 1YM0A 1G2MA 2QA9E 1GMDF 4IN1A 3QK1A 3PM3A 3RMMH 3ZZ8A 1CHOG 1AB9B 1TNJA 1RRKA 2R3YA 3RXSA 5AF9H 1KXCA 5EJ1A 3R0FA 1XUFA 4MNVA 1NT1A 3A7VA 3DD2H 2B9LA 1ESBA 1GHWH 3I29A 1SLUB 1EAWA 4O03A 4K69A 2C93B 2XCFA 1S82A 1QQUA 3W1EA 2XWBI 1SG8B 2THFB 3WWFA 4DIIH 3QO6A 1O2YA 5AVDA 2SNWA 3LC5A 4BTIB 5GXPA 1BB0B 1XKAC 2JETB 2FLRH 1FXYA 2A1DB 1CA0B 3RXGA 1GG6B 4BNRA 2J9NA 4E06H 1F0TA 1OP2A 2VNTA 5F8ZA 1O3BA 5IK2D 2CHAC 3ZZ3A 2FX6A 1IAUA 3PMJA 5DP9A 1UTKA 2ZU1A 2PSYA 1O37A 5HIZA 5C2ZA 1BMAA 1D3QB 3L3TA 3PV4A 1QBNA 1JRSA 1OYQA 3FP8E 1G2LA 3KYGA 1ABJH 1NZQH 2GT8A 3GY4A 4FUFA 1HJAC 2Q6DA 2F9OA 4CRFA 1YYY1 3F9GA 1LCYA 2GZ8A 3LGIA 4OS7A 1LKBA 4NA9H 3MHWU 2QCYA 5GWZA 3AAVA 3RXTA 1HGTH 4FU7A 3PMAB 2GV6A 3IWMA 1GDQA 1ELVA 1TX6A 2DE9A 1ABIH 3JZ1B 3ZVGA 1QRWA 1EJNA 1N8OB 1S5SA 1T8MA 3GS9A 4JK6A 1H8ED 5JBTA 2IPHA 1TGNA 1RIWB 1TPAE 2G52A 1O2XA 3RXAA 2C8XB 3OYPA 1ETTH 3DSPA 3GY3A 2C4FH 3S0NA 3CP7A 1LKAA 4MQAA 1GHXH 1JIMA 1VCPA 1GWAA 1V2JT 7KMEH 4A92A 1BQYA 2GD4B 1V2TT 4A1VA 2AMQA 2A31A 4SGAE 4XDEA 1SGDE 3OTPA 1TNLA 1TRNA 5JBAS 3D23A 5EU8A 1XM1A 3EYDA 3F2FA 4WMDA 2JDID 2EC9H 3F3BA 2P93A 2BLOA 1ARBA 3H09A 4FVBA 1FI8A 1ZPCA 1HV7A 1W2KH 3ZVBA 1LO6A 1O2VA 1RD3B 3KEEA 2FOGA 3IG6B 1E38B 1PQ8A 2ZDLA 5LGOA 1NRQH 2QGRA 1QB1A 4NWLA 4Q7XA 2TPIZ 1XUHA 4IC5A 2WINI 2JETC 2VH6A 1ANEA 4OGYA 5KEDA 1CA0C 1C2LA 2A4RA 1TWXB 2VWNA 1GG6C 4ASHA 5FCKA 3UAIC 1DX5M 1HBTH 3UIRA 2OC8A 3SI4H 4UE7H 2ZA5A 2SFAA 3TH2H 3GYMA 2FDAA 3QZRA 1OWJA 2H6MA 4AG1A 1O2JA 4DOQA 1SHYA 2KM0A 1K1IA 4DG4A 1HAZB 1GI9B 1YKTA 2D26C 1O3JA 5HYOA 1SOTA 4ISLA 1K1MA 3CS0A 1S0QA 1ZHMA 3FKSD 1C5WB 3NZIA 4X8VH 4YLUA 5A0CA 1DT2A 1F0UA 2JH0D 4Q63A 1KDQB 4JK5A 2BDIA 3SV8A 2OP9A 1PPCE 2WPMS 4X8SH 3UNSA 1LQEA 2VB0A 2ILNA 3ZVEA 2VH0A 3DFJA 1O3GA 1V2OT 1MBQA 3ZZ5A 1A2CH 4B71A 2TGPZ 2FESH 1K1OA 4WMEA 4B6FA 2CJIA 5TCCA 4FUHA 5ESBA 1RIWC 3QUMP 4AC9A 3TK5A 1ELTA 2GDEH 1KTSB 1YLDA 1MU8B 3RM0H 2RCEA 1E34B 2BY8X 1ACBE 1EP5A 3MH7A 1O2QA 5LPEA 1HAXB 1Y5UT 1E0FD 1K1JA 3PMBB 1P11E 4ZKRU 4H6SB 4DT4A 4E05H 1SB1H 2B7DH 2XOKD 4FOUC 2LPRA 4JZEH 1Y3YA 4INHA 3MQKC 2P95A 1K9OE 4NIYA 2L6OA 2ZO3H 2G4TA 1HIAB 1RJXB 2QXJA 1TB6H 2ZTYA 1BTHH 4YT7H 1AZZA 3URCA 3FP7E 1MTNC 1UTOA 3SHCH 4ZHMU 1HDTH 1GMCG 2J2UA 3I78A 3PYHA 2ESTE 3M5LA 3SNBA 1EOLA 1QZ8A 1E79D 2Z3EA 4IGDA 3BTTE 1QBOA 3QN7A 4U2WA 1O30A 1W0YH 2FOBA 1TBZH 3PMHB 1EPTB 1GI7B 1WDIA 3N7OA 1FY5A 1P2KA 1TGCA 1NO9H 5A0AE 5A8YA 2BXTH 2BDAA 1AWFH 1WAYB 5DP4A 2HVYB 3SU6A 2BX4A 2FOMB 3A81A 5L6NH 1IQEA 3S7HB 1O2TA 2BD2A 3TJOA 3QTVH 1A46H 1BBRK 4KTSA 3HKJB 2VIVA 2XNIA 1UK3A 2PKAB 2BOHB 5DK1A 4YOGA 4X1NU 2A5AA 3V12A 3SU4A 2CGAA 2W6JD 1Z1IA 1O3DA 5DKMA 1H8IH 4UFDH 4BAKB 3UNQA 1W8BH 3Q00A 3OFND 1Y8TA 4JZ1A 9ESTA 4B73A 1GJ4H 4MLFB 5C20A 1TLDA 1BRUP 2CXVA 3STJA 1ANCA 2NU3E 3P92A 4MPXA 3RLYH 1C1MA 4Y11E 3HATH 3M5MA 3TLOA 3MYWA 5K0HA 3FANA 2ZNKH 1L1NA 3ODDA 1J15A 1NRRH 1W0KD 2G81E 3SU0A 2CMYA 3LGYA 3DSOA 5HMAA 2YMSB 1GBJA 1C5LH 1C5NH 5TCAA 3U28C 3QGJA 2CF9H 1A3EH 1ELCA 6ESTA 1CBWB 1MU6B 2Y82A 1ID5H 4I8GA 4X1SU 1SVPA 1WQSA 3EA9A 1BOQA 2PSXA 4I8KA 1P05A 4X8UH 5E0HA 4Y10E 3GDSA 2V3HH 5J4SA 1C1RA 2BDHA 4HGCA 1W0ZU 1YC0A 1YCPH 4NFFA 1EPTC 4MPUA 2OINA 2DE8A 3ATWA 1A0JA 5ETXA 1QJ1B 1OWDA 3K6ZA 1YBWA 6LPRA 1E37B 1F5RA 1C1UH 3BSQA 3U8RH 3BG4C 4P02A 2KZ4A 1BZXE 1TGTA 3SNCA 2RDEA 2KCAA 1OWEA 2Z3CA 2BHGA 1GI5A 3ZZ6A 2K8IA 1GCTC 1C5YB 1BDAA 1ZPBA 4U30A 3BG8A 4XOJA 3LH3A 1S84A 1O3HA 3QDZB 1O3PB 2PUQH 4B1TA 1O5AB 1Y5BT 2FS9A 2P3FH 2V35A 3E3TA 1WTGH 2WYJA 1MMJN 2J34A 2ZFPH 3STIA 1FPCH 1HLTH 1UMAH 3ZZCA 2F4LA 1OHHD 1EJMA 1A5HA 4CREA 1FQ3A 1T8OA 1FPHH 1QTFA 1SLXB 2UWPA 2XBWA 3FZZA 5JBCS 3A89A 3H7TA 2UWOA 2UUKB 1Y3VA 3FFGA 4RI0A 5A8XA 1GJ9B 4DVAU 3BN9A 4D9QA 1B5GH 4U32A 1Z71A 1BIOA 3OAAD 1NC6A 1IQGA 1OYTH 3VFEA 4CRAA 2RG3A 2YMSC 1UCYH 2FIRH 1FY3A 2VIPA 2DUCA 1FIWA 3GY7A 2GP9B 1CBWC 4MTBA 2ZHQH 8ESTE 1PPHE 2G8TA 3RXEA 3GDVA 3SGBE 2PHBA 1BTZA 3VB7A 4DW2U 3KQ5A 4I31A 4Q2KA 1DY9A 2OD3B 1WUNH 2M5TA 1AZ8A 4AGJA 2XYAA 5C1XA 1A5GH 4FUJA 4NA8A 3PB1E 1SGRE 3FOAA 2EA3A 4D9RA 1BMFD 2F9UA 4ABDA 4H42U 1YPGH 5FPSA 2BQ7B 1ELBA 1FX0B 1YPEH 5F53A 5DP5A 4A1TA 2UUYA 2ZECA 1EFRD 4GSOA 5E0JA 2A7HA 3NPSA 1FNIA 3LPRA 4I86A 5C94A 5F03A 2EQNA 1WCZA 1E1RD 4LOYH 3BTWE 3HK3B 3CENA 4O97A 3TPIZ 1YLCA 2TGAA 3SNEA 1ELGA 1HXEH 1O2PA 2J98A 2OBQA 3RXIA 3AASA 4FUCA 5DJ7A 1BTPA 2HPPH 4NZLA 1XVMA 4ISIH 2BD8A 3M3SA 1W0JD 5HM2A 1TAWA 4AFUA 5G4BA 2G5NA 4NZQA 3FN8A 3ITIA 4YESB 3LH1A 4UFGH 3LDXH 3VB6A 1NY22 1COWD 1T4UH 2JH5D 4AZ2B 3T28A 3H7OA 2KAIB 3QX5H 3UQOA 1A3BH 1ZYOA 2A0QB 4B2BA 1V2WT 2J5UA 1UTQA 1ZMJA 3T29A 2BXUH 1YGCH 1V2KT 1O3AA 2D1JA 2FP7B 3RXKA 3SGAE 3B9FH 3SU2A 1UW7A 2ZFSA 1WV7H 1NBME 3PRBA 3P8FA 3SUGA 4Y76A 8LPRA 2WUBA 3SV2H 3NRLA 4TYDA 1C5SA 1HPGA 2AMDA 2A4OA 3KHVA 1DXWA 2H5DA 1LHFH 1J9CH 1PFXC 3IITA 3LU9B 4GCHF 1MD7A 2J92A 1P3EA 1Z6EA 2JJ1D 2ZTZA 5DN6D 1KSNA 1HRTH 2O8TA 2ZI2H 2HOBA 2FYQA 3BIUH 3K9XB 3ZVAA 4RKJB 1LVBA 3GCOA 2J95A 1DDJA 4ABFA 1F5LA 1GHAF 5HXFA 1RGQA 3A8AA 1EAXA 1Z8GA 7LPRA 1O3NA 3N7EA 1O3LA 2J4IA 5GPIB 3TNSA 4AGKA 1O34A 1EATA 1ZLRA 3RP2A 3TGIE 4NG9H 2BY7X 4NFEA 3T27A 1LPKB 1Q3XA 3P17H 4D7FA 3WWBA 3VGCB 2FOHA 2J94A 2ZKSA 1K0HA 1VITH 4JMYA 4NIXA 5E2OA 5T6GA 2XC5A 1SGEE 1YPLH 1F2SE 1PPGE 4KP0A 1HXFH 3MO6A 1TA6A 1FLEE 1GBCA 1ZJDA 2D8WA 4XBCA 1AN1E 3N99A 1CGHA 5C5NA 2O9QA 3O8RA 2NU0E 2QF3A 3O8CA 1YP9A 2BQ6B 1W11U 1DITH 2ZFRH 1C1PA 3L6PA 2SGPE 4NCYA 3K6YA 3MH5A 4NA7A 1PYTD 2OQ5A 2Z7FE 3ELAH 5EJZA 2ZQ1A 1NU7B 1A0HB 1JXPA 1Z6JH 1GGDB 2WPKS 3A87A 1ELEE 1BJUA 4OGXA 9LPRA 1H9LB 3V7TA 1UJ1A 2QE7D 4ZKSU 1NTPA 2FPZA 3SJKA 2STAE 2XC0A 1L0ZA 1FY8E 1AVXA 1WTHD 5E2PA 2AS9A 2QV1A 4OS5A 1QA0A 3VB3A 2C90B 1CT4E 1LDTT 1WBGB 3PLPA 4TPIZ 1QL7A 3TK6A 1C1TA 4AX9H 3E91A 1LVYA 4Y6DA 4ABIA 2R2WU 2Z9JA 1BCUH 1QL9A 2OC1A 1VR1H 1SHHB 1O2LA 1SFQB 3MNBA 1Z8IB 2C8WB 5AHGH 5AFYH 3GOVB 1UVPA 3A86A 4DURA 1IQKA 2FMJA 3P95A 2V7QD 3AVZA 2FWWA 3FAOA 3F0OA 4NGAH 1AKSB 1MTVA 1TNKA 4KTUA 3RXCA 2XBVA 1GHZA 4SGBE 5E8EH 5FPTA 1VGCC 2G55A 1D4PB 1THPB 4B2CA 1NN6A 1QFKH 2PR3A 3VGCC 3EDXB 4OS4A 4IN2A 2GVFA 1NS3A 2TGTA 2F9PA 2BD3A 1KXAA 2ALPA 2M2AA 5C0TA 3RXHA 3U1JB 1O3KA 1MH0A 2XCNA 1P57B 3RDZA 3T5FH 4BTTB 1KDQA 3SNAA 4Y8XA 2ZZUH 3SHAH 4ACBA 1D6WA 5T6FA 4ABBA 4ZH8A 1O5DH 1BT7A 2W3KA 2OC0A 2Y81A 2FI5E 1JMOH 1YLNA 3TIUA 1GGDC 1THRH 3BTFE 2ZDVH 1H4WA 1XXFA 2F43B 2SGAA 2ZEBA 3HKIB 2EEKA 1UO6A 1C5PA 4BAHB 5BRRE 3LGTA 3LONA 1VZQH 1P2MA 2BYAX 1BMLA 1OX1A 3OE7D 4TT3D 2WPIS 4XFQA 1SGTA 3O8DA 1RTLA 4I8JA 3VEQB 3ODFA 1GHBG 3ZVFA 1O2IA 1K1LA 1HIAA 2ZCKP 3W94A 3V3MA 2AH4X 4F48B 1JOUB 1QRXA 5C5OA 2RA0A 5DP7A 1MCTA 5F8TA 4B74A 5JB9S 4I7YH 1MTNB 5C1YA 1ELFA 1HYLA 1MKXK 3WY8A 2WPDD 1NM6A 2K1QA 5FXLA 1EOJA 1XUGA 3UUZA 2C8ZB 3P8OA 2P8OB 4MPVA 4GVUA 1GMDG 2F91A 1S6HA 5GIBA 1GL1A 4FUBA 4CR9A 2ZQ2A 2KCOA 2FYRA 1S85A 4K1SA 5HM9A 1GDUA 1VJ9U 2K0QA 3A88A 3S9BA 1O32A 1AFQB 3ATMA 1EZXC 3BF6H 1DUAA 1BRBE 2VWMA 2I6SA 4UFEH 1MD8A 4I32A 5DP8A 3LGUA 2ZGXH 1QGFA 3SUFA 1ORFA 1G3BA 3BIVH 3V0XA 5F6MA 1AO5A 2JJ2D 3A7XA 1OXGA 1AD8H 4ZXXH 3MU5A 2GT7A 1GBBA 1EZQA 4ZMAH 3M37A 4O9VA 4IC6A 3Q3KA 1ZGIA 8GCHF 3BEFB 1AVGH 2H9TH 3KIDU 1J14A 3ATKA 4XD7D 3M7TA 3MO3A 1W14U
chains in the Genus database with same CATH topology
1L1JA 3P8NA 1C5VA 5EXMA 1V2NT 4ESTE 3RXMA 3M35A 1O2SA 3DFLA 2ANKH 2BVRH 3ZZ4A 3FZDA 3MH6A 2FO9A 1P0SH 3D65E 2Y5GA 2GCHF 5L2ZH 2AGGX 2H1UA 1UTNA 2PKSB 1GHYH 1AMHA 1DM4B 5EW1H 4O3UA 1QBVH 1CU1A 1L4DA 2P8OC 3SU1A 3BTHE 3Q3XA 1VCWA 3RU4D 5L30H 3UR9A 1BMNH 1X7AC 3GYLB 3LKWA 1T32A 1UCYE 3R3GB 2OXSA 3ZZDA 4I8HA 2AIQA 2GKVE 1XX9A 4GHQA 1WYKA 4FVDA 1T8LA 1ZMNA 2BY9X 4GLYA 3BG4B 1AFQC 4H4FA 3QGNB 1MZAA 4QT8C 1O36A 1GI3A 2C3SA 3PLKA 5AFZH 3TNTA 1K22H 1GPZA 1SOZA 4YLQH 1F5KU 2VIOA 5GDSH 1UHBA 2O8MA 3EAJA 3HK6B 1CO7E 2GZ7A 1DOJA 2WPHS 1GCTB 3VXEH 4BOHA 2GZ9A 2ZIQH 1C5ZB 3PTNA 3NWUA 2BDGA 2ZHWH 1SGCA 1P2NA 5JYIA 3T62A 1HAGE 4JCNA 3BTME 1SLVB 1L2EA 1GBFA 1F0RA 1EB1H 1FONA 1UVUH 1P2QA 2BY5X 3SOSA 3PWCA 2BD7A 1B0FA 2BY6X 1O0DH 1HNEE 4OS6A 1AUJA 4TWWA 3KCGH 4ZROA 3UNRA 3BEUA 1RTFB 1W10U 2Z9KA 1O2OA 1DVAH 3HPTB 1KXDA 1Y3UA 1TMTH 3BTDE 1GMHF 2ZDMA 2FM2A 1LTOA 3ENSB 1DS2E 4FUGA 2PKSC 2JH6D 3A8DA 1KXFA 1DWEH 4WF8A 4YO9A 4YOIA 2FI3E 1HCGA 3M3TA 2GCTB 2HGTH 1TQ7B 4Y7AA 4AORA 3MH4A 1AVWA 3RXRA 3SUEA 1LVMA 1SL3A 3A80A 1MCVA 5GJ4B 4DJZB 2NU4E 2ZU5A 1WSSH 2SGFE 2F83A 4IW4E 2P94A 2ZTXA 1EKBB 3P8GA 3PLBA 1C4V2 5ABWA 3GY8A 3Q77A 2ZHEH 5H4IB 4ZXYH 1RFNA 3KL6A 3RXVA 2ODYB 1BMMH 2QAAA 2V6NA 4LXBH 3RLWH 3UFAA 3ZVDA 1CT2E 3M7UA 5EODA 3F1SB 3MTYA 5FBIA 1P03A 1TFXA 2H2ZA 2TGDA 1DWDH 1XVOA 2VIQA 1C5QA 3GCNA 1SGYE 2NU2E 1ZSJA 1T4VH 1WQVH 2IJOB 2ANYA 3DHKH 2HALA 1P06A 1PJPA 2Q6FA 3T26A 1E36B 1TA2A 1BHXF 3C1KA 1PPZA 4J1YA 4TY6A 3ZV9A 1DFPA 2ZCHP 2BDCA 4IMQA 1EZSC 3BEIB 4O3TA 3SU5A 3GICB 1XXDA 2KAIA 2W26A 1V2MT 3UY9A 1TBRH 1GJ8B 1C5XB 4AFQA 1O2KA 1C4Y2 2C8YB 5K7RA 1CGJE 3ZYDA 1HAVB 1GJ7B 1C4U2 1UVTH 2A5KA 1OSSA 2OC7A 2FOFA 4RKOB 1ARCA 4JZDH 3SW2B 2FX4A 4Y8YA 1INCA 1SQAA 2ZDKA 3DUXH 3TK9A 5TJXA 1N1LA 1DLKB 1NRNH 1WOFA 3NXPA 2A4QA 3LT3A 3PO1C 3TGKE 2PFEA 2PUXB 1C9PA 4K5ZA 2GCTC 2W7SA 3RXLA 2Z3DA 1B0EA 3S9CA 2HWLB 3QWCH 3BTQE 2A2QH 1BTYA 1GJ6A 2ZU2A 2P59A 2Z9LA 1EAUA 2AERH 4BTUB 1C1QA 5FCRA 1N6XA 5HGGA 1NU9A 3E0PB 1P12E 3A8CA 1ELDE 2GTBA 5IYTA 4BANB 2AIPA 4X1PU 1QY6A 1C2MA 4INLA 1VJAU 2Y7XA 2V0BA 4CRBA 4JZIA 2XRCA 3U98H 3K65B 1BRAA 3OU0A 4K60A 1O2GH 1XUKA 2ODQA 1ZRBA 2AEIH 5SGAE 4IMZA 2Y6TA 2Y7ZA 3U8OH 1BTWA 3HGPA 5A09A 1WU1A 1GI0A 1SI5H 5CMXH 1MZDA 3SJ8A 4JZFH 4E7RG 1OOKB 3KF2A 1G9IE 4Q7ZA 1GVLA 1O3MA 5EXLA 2SNVA 4Y79A 3ZZAA 3QTOH 1XUJA 1YCPK 3UQVA 3I77A 1O5GH 4WVPE 5LPFA 3GISB 3QLPH 2V3OH 3SV6A 1AQ7A 1P09A 3SUDA 3FVFB 5DGJA 1NFUA 3SJIA 1DLEA 1SC8U 2IN2A 3SV7A 1GL0E 1NPMA 1FIZA 2ASUB 5JDUB 1FZZA 2WUCA 1OWHA 2W7UA 1MKWK 3EGKH 3P6ZB 4AYVB 3GY6A 3E0NB 1AIXH 1D3TB 1ZSLA 3A85A 4VGCB 4KELA 1A1RA 1P02A 3W95A 3SNDA 5LH8A 4YT6H 3VB4A 2Y5HA 3OY5U 1G3CA 1JWTA 3M7QA 1PQ5A 1TONA 1AKSA 4NSYA 3TITA 2UWLA 1ESAA 4ISOA 3GCHB 4Y0ZE 3SJ9A 1Z1JA 3A7WA 2XW9A 2UUFB 2HRVA 4X2WA 1LHEH 1VGCB 2QN5T 4Q80A 1FV9A 1ZTKA 4YZUA 1UCYK 3QZQA 2HVXA 4WJG2 1UVOA 2Q6GA 1O3IA 4WY3A 1ZMLA 1TNGA 4JYTA 1TPPA 1GI6A 3M3VA 1EJAA 3BTKE 3KQDA 4FU9A 2J38A 1D3DB 1C1OA 2BX3A 1P8VC 4X6PA 1FAKH 2QXIA 3CS7A 4AOQA 5ESTE 3TVJB 1MTSA 1ZR0A 3UWJH 1ZGVA 2OQUA 2RA3A 1TOCB 4Q7YA 5C67A 1GI2A 5FPYA 1LHDH 4X2XA 1V6DA 2VJ1A 3M5NA 1KXBA 2A7CA 3KGPA 3UPEA 4D8NA 4Z6AH 4GPGA 3VPKA 5CHAB 1W12U 1P01A 2ZDNA 1HJ8A 1NROH 2BLWA 2Y5FA 1LQDB 2FTLE 1YCPM 4VGCC 2OBOA 4X8TH 1IHSH 1GBHA 1ZHRA 1FUJA 1SGNE 4BXSA 4HI3A 2EI6A 1D3PB 1K1NA 7ESTE 1GBAA 1SQOA 2A45B 2PTNA 3SJOA 6CHAB 1PYTC 1VITF 2D2DA 2ALVA 3GCHC 3M61U 1SGQE 1JBUH 1UTMA 4MNYA 1FDPA 4TWYA 4KGAA 4BXWA 1Y59T 1W3CA 1QQ4A 1GBLA 1QA7A 2ODPA 2WV5A 3TGJE 4INKA 3SBKA 4ZAEA 1TNIA 2CN0H 2VU8E 2SGEE 3OSYA 1MBMA 4ISNA 5EXNA 1QJ6B 4GUXA 4UD9H 3SZNA 4B2AA 4R0IA 1P2OA 2HNTE 1G37A 1G32B 3RXUA 1O5CB 1V2PT 2R9PA 1P2JA 4MPWA 1J8AA 1IQMA 1TBQH 2PW8H 3NKKA 5A0BA 2BOKA 2QF0A 1UK2A 4GCHG 3F9FA 4I8LA 3UWIA 1Y3XA 2A4GA 1VCQA 1ZZZA 4GHTA 4IS5A 2IOTA 3RMLH 1TPOA 1GJDB 3RXOA 4F4OC 2BTCE 1HFDA 3MU8A 3ATLA 2ZP0H 1ANDA 5E0GA 5IDKA 2R2MB 1EXFA 1GHAG 3U8TH 4NWKA 4X6NA 1BITA 1O3FA 1PQAA 1XMNB 2FODA 7GCHF 2CV3A 1SMFE 2FOCA 1DWBH 5DO4H 1LHGH 5CHAC 1GBKA 1C2JA 1AGJA 1K1PA 1QCPA 2FLBH 5DP6A 4MNWA 1H9IE 1Y5AT 1QURH 2AGIX 4WWYA 1MUEB 1SBWA 1DXPA 3SGQE 3MU0A 4Y0YE 2BM2A 4X6OA 5B6OA 4ZKOU 1ZRKA 1DANH 3B23B 1GMCF 1QB9A 4ABGA 4CR5A 6CHAC 1ZHPA 2ZF0H 1Z8JB 3TH3H 5EW2H 3PTBA 4ZHLU 2QXHA 3KQEA 1AB9C 4OS1A 1P04A 3KNXA 4ZUHA 3KN2A 4YTAA 1IQJA 1TX7A 3TJUA 4UDWH 3HGNA 2B0FA 1Q31A 1IQNA 1HAPH 2G4UA 5FX5A 4Z0KA 1BBRH 1EPTA 4AN7A 1O3CA 5I25A 1TE0A 1TGSZ 4FU8A 3RU4E 1IHTH 3EA8A 3RUOA 1M9UA 1GBIA 5EOKA 3SU3A 1Q2WA 2PTCE 2AFQB 3KQCA 3MO9A 5DPAA 1OKXA 4TY7A 1VITG 4X6MA 1O5EH 5DP3A 1OP0A 4H6TA 1OWIA 2HPQH 1K28D 2OUAA 4Y71A 1FAXA 1F7ZA 1OS8A 3MI4A 1IQIA 1O2RA 2AMPA 2PKAA 1O2UA 3M5OA 1ZTJA 3C27B 3TH4H 2XXLA 1TMUH 4DCDA 2HNTC 1LVOA 1AHTH 4D76A 1O2HA 2I6QA 1IQFA 4GAWA 2WV4A 1S81A 2P3TB 3NCLA 1V2ST 2PWXA 3DA9B 4KKDA 4ABEA 1DUEA 1BHXB 3RC5A 4ISHH 4IBLH 1BJVA 1C2EA 3BV9B 4ZHAA 3PROA 1PPEE 1AE5A 1SFIA 4M7GA 5FX6A 3T25A 1CT0E 3UR6A 1N8OC 1C5TA 1Y3WA 1C1WH 1UTJA 6GCHF 3OY6U 1YPKH 4J2YB 2XTTB 1O2WA 1P3CA 2ZU3A 1EB2A 3AW0A 3EA7A 2QY0B 1C2GA 1H1BA 4U01A 2WPLS 1HJ9A 7GCHG 2YOLA 1ETSH 2BD5A 3RU4T 4A6LA 1T31A 1TQ0B 3ZZ7A 1AU8A 1GJBB 3A7TA 1J17T 1THSH 2F9VA 3TJNA 1B7XB 4DT7B 1HAHH 1UTPA 1ZPZA 3O8BA 2GGVB 1ZTLA 5FHTA 4B76A 1A61H 1HAOH 2BVSH 1GVZA 1EX3A 1G3DA 3MMGA 2AGEX 1BTUA 1UTLM 2QIQA 3OX7U 1SQTA 4TPYA 4BAOB 3RXDA 4ABHA 4HTCH 5I46H 3TJVA 3LIWA 2YNAA 1EASA 1GJCB 4X1RU 1DWCH 1EZUC 4JYUH 3LJOA 3PWBA 4X2YA 4CRCA 3LJJA 3P70B 5EQQA 2FS8A 5C3NA 1DE7H 2H9HA 4XBDA 1S6FA 2BVXH 1GHVH 1H8DH 2W5EA 4K2YA 1EUFA 1N6YA 1C5OH 3A8BA 4XE4A 2GDDA 1BUIA 2HNTF 3ESTA 3BTEE 1AY6H 3DT0H 1IQLA 4I33A 4K8BA 4F49A 1O2ZA 1IOEA 3T2NA 5FAHA 2GX4A 1GBTA 3LGWA 2OLGA 3VB5A 1ZSKA 4MG3A 4JYVH 1G30B 1JRTA 3UOUA 1G36A 2BQWB 2F9BH 1NRPH 3RXJA 4FUEA 1GI1A 1GI4A 1KXEA 1QR3E 5T3HA 1HAVA 2P3UB 3SQHE 3RXFA 1P9UA 1QHRB 3SQEE 1FJSA 4LZ1H 1MAYA 1O38A 5BPEA 1C2IA 1A4WH 5PTPA 4CH8B 1CVWH 1PQ7A 4FXGH 2BZ6H 3MNXA 1F92A 3M36A 2NU1E 2WYGA 3AAUA 2BLQA 3D49H 3VXFH 3E6PH 1NRSH 3MNCA 1TGBA 2PGBB 2XBYA 2OCVB 4MVNA 3SN8A 3PO1B 4RN6A 1RTKA 3D62A 1A7SA 2SGQE 1UK4A 2BDBA 4CH2B 1AUTC 2QXGA 2TRMA 1CGIE 2O8LA 2Y80A 1A5IA 4PROA 5L2YH 8GCHG 1F0SA 4AB9A 5CE1A 2XC4A 3NK8A 1ESTA 1JIRA 1AWHB 3LC3A 4MDSA 1T7CA 3Q3YA 1DY8A 2AYWA 1QL8A 1CQQA 1P9SA 6GCHG 3MFJA 4LK4A 4LZ4B 2ZGBH 3RC4A 1O33A 2PGQB 2GMTB 2JKHA 1E35B 1P10A 3F9HA 1K21H 4WMFA 1RS0A 3U69H 2BB4A 2H5CA 1LPZB 3RXQA 1HB0B 2GCHG 1O31A 4FUIA 4WXVA 3MWIU 1O3OA 4Y7BA 5T6DA 2XWAA 3MU1A 5C1UA 5JPMH 3AW1A 1V2RT 1ETRH 2BLVA 2ZGJA 3A7YA 3LGVA 1YF4A 1C2KA 4ZKNU 1QIXB 1MKWH 1U6QA 4WXIA 1D6RA 1GVKB 2ANWA 3H5CB 1NFWA 3RMOH 4BAMB 1UHBB 2ZG0H 1O2MA 4X2VA 1TMBH 1NFYA 1SPJA 2ZWLH 1Z8RA 2VWLA 2ZFTA 2ZPSA 1CE5A 1V2LT 1SGFG 3E90B 4FUDA 4ABJA 1DSUA 1NESE 3A82A 5A2MH 1GBMA 1GBDA 2H9EH 3F9EA 2BD9A 5EPNA 2ZGHA 3E8LA 1MTWA 3L33A 2XBXA 8KME2 1XKBC 1ZJKA 3K2UA 5F8XA 1KLIH 3GY5A 3RC6A 2VWOA 4DGJA 2R0LA 1YPHE 4CRGA 3MNSA 3ZZBA 1C5UA 3UREA 4AFZA 2F3CE 4CBNA 1EP6A 3G01A 5DG6A 2VGCB 1TPSA 3NUMA 1W7XH 1P2IA 4XSKU 2STBE 1C2HA 2GV7A 3GCTF 1LPGB 2FZZA 1TABE 2BZAA 2WPJS 3F68H 1ZOMA 1C1NA 4X1QU 2ZHDA 4AB8A 2GMTC 2VVCA 1OP8A 5EQSA 1GMHG 1O5BB 1QB6A 1QNJA 2A5IA 2W3IA 1TOMH 4YM9A 2B8OH 5EG4A 1FY1A 5EPYA 1L1GA 4A5TS 2ZC9H 2BMGB 1O5FH 3BTGE 5A8ZA 1V3XA 1KTTB 2G51A 1BA8B 4WH6A 4HZHA 1CHGA 2B5TB 1A0LA 1KYNA 1W13U 5JB8S 1CSOE 1NFXA 5LPRA 5GCHF 5J4QA 4YOJA 2FTMA 2O8UA 3EE0B 4K1EA 1C9TA 2ANMH 1W7GH 1K2I1 3GY2A 3LOXA 4MNXA 3A7ZA 1PPFE 2ZPRA 2A32A 1QRZA 1C5RA 3EQ0H 1CHOF 3Q76A 4A1XA 2EI8A 4DY7B 2ULLA 1DPOA 1MQ6A 2QYIA 1C2FA 2Z9GA 1MTUA 1D9IA 4A7IB 1IQHA 3KQBA 1SGPE 3S69A 1S0RA 4CHAB 3MU4A 3GDUA 4CRDA 5EGMA 1AI8H 3U9AH 3RXBA 4UEHH 1TRYA 3ZVCA 3S9AA 4UONA 2P16A 2R0KA 3B8JA 2VIDA 2ZDAH 1YPMH 1GBEA 1KLTA 3RXPA 4ABAA 2BD4A 2VGCC 1DICA 4AYYB 1TYNA 1C5MD 2ZPQA 1TX8A 1O3EA 1O2NA 1SLWB 4WH8A 1LMWB 1C2DA 1KY9A 1GCDA 2TBSA 2HLCA 3ZV8A 3ZYEA 5JBBS 1EQ9A 3A84A 1HAIH 2F9NA 2CF8H 4KTCA