1O3MA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3mA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3mA02
1O2HA 4K1EA 2QGRA 3Q3XA 1MTSA 3ZZ5A 3S9CA 1C5YB 3SV2H 1T4UH 3QDZB 3BG4C 3GICB 3OYPA 2Y6TA 3GYLB 2ZGHA 4TWYA 1O5DH 3OX7U 4NFEA 2G4UA 5C5NA 2CHAC 5AHGH 2Z9KA 4ABDA 5F8ZA 2B5TB 3EQ0H 2C8WB 2YOLA 1DY9A 3ZVCA 1KXEA 1HB0B 1ZHMA 4KTSA 2GD4B 1TLDA 1DE7H 1FY5A 1Y3UA 2P93A 1QB9A 2TGAA 1TPPA 1ZPBA 1Q3XA 4JK5A 3LH1A 4XE4A 4LZ4B 3D49H 3SU2A 3A8BA 4YZUA 1C5XB 1J14A 2YNAA 4CBNA 3P6ZB 3MH6A 4DOQA 4YESB 3RXGA 1NS3A 4J1YA 2ZG0H 5EQRA 1LTOA 3KEEA 1IQNA 3A8DA 2HLCA 4WMFA 3A84A 1L1NA 1WUNH 1F5RA 1QIXB 4Y10E 1DWBH 2OUAA 1K1PA 1AUJA 1DT2A 1SL3A 3UNQA 3R3GB 4BANB 1A7SA 2FOEA 2WPKS 1QFKH 1MU8B 3RM2H 1SGRE 4INHA 1LQEA 1TALA 1SGNE 3M5MA 3RXPA 3GCNA 3M3SA 1QBNA 1YPKH 1MBMA 2OC0A 3A7XA 3LDXH 4XFQA 1TONA 3V7TA 1WQVH 1P2NA 3M5OA 1FMGA 3F9HA 4YOGA 3AASA 5I46H 5EG4A 1YCPM 5J4SA 3QZRA 2VIPA 4BTTB 4A6LA 1DWDH 5E2PA 1HAOH 2DE9A 3AAUA 3LC3A 2EI7A 2C8XB 3EAJA 1C5LH 1GWAA 1KIGH 1UK4A 2C90B 4Y76A 5ESTE 1UK3A 1WQSA 1H4WA 4XOJA 2QA9E 5L2ZH 1AZZA 1O5EH 2Z94A 4QT8C 3ZZCA 4RN6A 1C5QA 1Z8GA 1NU9A 3F68H 1F0RA 4Y79A 4OS1A 3KCGH 2F9VA 2CJIA 1FQ3A 4ZHAA 1GHWH 1UJ1A 2NU1E 1G30B 3TNTA 1YKTA 3KGPA 5E0JA 2F3CE 1TOMH 4XBDA 3CP7A 3QTOH 5GDSH 1J8AA 4MPXA 1EPTB 8GCHF 5FX5A 4OGYA 1B0EA 1P06A 4J2YB 1ABJH 1P2MA 3TJVA 1FUJA 1NRSH 4X1QU 2NWNA 3SHAH 3UWJH 3K9XB 2FM2A 1EZQA 4ZHMU 1K1NA 1SQOA 3E90B 5J4QA 1ETSH 2HNTC 2ANWA 4XSKU 3K2UA 4WF8A 4A1VA 1OWKA 2PSYA 1DITH 1MCTA 2ZTYA 2F9NA 1J15A 1TNHA 2ZDVH 3Q76A 1O3GA 1XKBC 2C8ZB 4CRAA 2FOGA 4SGBE 2GV6A 4INLA 1LHEH 5AFZH 3LOXA 3RU4E 2GZ7A 1JWTA 5GPIB 3CS0A 4NIVA 4GCHF 5E0HA 1UTLM 4CRBA 1DXWA 3PYHA 1UMAH 1MAXA 1O2RA 1Z8RA 5I25A 6CHAB 4RSPA 2FX4A 2R0KA 1GBAA 3SNAA 2WYJA 1TRYA 2XC0A 1BMMH 5GCHG 3RMLH 1NROH 2ZC9H 3ZVDA 2UUJB 1IOEA 1E0FD 1GBBA 2Q6DA 3QO6A 4I33A 1Y3WA 1D3PB 3FAOA 3TK5A 2QXJA 1N1LA 1EZSC 2ZA5A 1O2VA 1TGTA 4KTCA 2WUBA 1UO6A 4JZDH 1AWHB 2SGPE 1XUHA 1NC6A 3I29A 4UFEH 1TPSA 2BM2A 2XBVA 1UTKA 2O9QA 4B2AA 3JZ1B 1BTWA 1DWCH 2LNCA 4YO9A 3SV7A 1EZXC 2FO9A 1S6FA 2H1UA 2FYQA 2XCFA 1BQYA 4B75A 1RIWB 4BNRA 3C1KA 4K8BA 3TGJE 4IW4E 2R9PA 1ZYOA 2SNVA 3PTNA 1ZPZA 2A5AA 1EATA 1AVGH 1GHBG 4OS5A 2Z9GA 3KIDU 4DIHH 4GLYA 4YOJA 5DG6A 2Y5GA 4B74A 2BY7X 3BTHE 3F9EA 3HKIB 1NRPH 3VB4A 1O39A 5JB9S 1HAPH 4AZ2B 2PTCE 5TCAA 3RXHA 3MU5A 2VVVA 1KLTA 3ATMA 5EW2H 1YYY1 2UUYA 1FN6A 3A7VA 2V0BA 3NPSA 3T62A 1BTUA 1EKBB 3PTBA 8LPRA 3KN2A 3UR9A 8ESTE 2ZIQH 2FOFA 4ZXXH 4NZLA 1LHGH 3SI3H 3PMAB 1PJPA 1IAUA 2B9LA 3SUFA 1GI8B 4AB9A 4BTIB 1H8DH 1MQ6A 2VGCC 3ENSB 3OTJE 1C1RA 1TQ0B 1W7GH 1T8OA 2BX3A 2GMTB 4CRDA 4AFSA 1K1OA 2HRVA 2PSXA 1A5HA 5A0CA 3ZVAA 4X2XA 1IQFA 2AEIH 4FUIA 2A7JA 1EAUA 1TMTH 1XUFA 4MPUA 1RS0A 3GY8A 1IQGA 1BMNH 4VGCC 2TGTA 1GBJA 1K21H 1K1LA 1AB9C 1P2IA 3T26A 5EGMA 5K7RA 1LVOA 2WV4A 5LGOA 1V2RT 4AN7A 1GI1A 7KMEH 1AQ7A 3GOVB 2P8OB 1QNJA 3MMGA 1YP9A 1CT0E 3GY5A 4X8VH 5T3HA 1DLKB 1VJAU 3HPTB 3SW2B 3SUEA 1ANEA 1O31A 2BD5A 1VZQH 2PR3A 1AIXH 3KQEA 1G36A 2FDAA 4INKA 1F5KU 1CA0B 1AKSB 1O3KA 1Z8JB 1V2OT 1KTSB 3LGVA 3SU1A 2YNBA 5FAHA 1TNLA 3BIVH 5F03A 2OTVA 5GXPA 1LVBA 1MZAA 4JMYA 4GUXA 4B76A 1GDUA 3U69H 1TBRH 2Y80A 3EGKH 3RXTA 2FOHA 2VH6A 2Y5HA 3M3VA 1V2JT 3SJOA 5EOKA 4DIIH 1FIZA 3S7HB 1GGDB 1O2QA 3ATLA 3P8GA 1IQEA 3SU0A 3LKWA 1WV7H 1A3EH 5GCHF 4AB8A 1VCQA 1G2LA 1S82A 4AG1A 1SGFA 1HIAA 2VINA 3T25A 1O2LA 2A7CA 1G3CA 2F9BH 3NCLA 3A8CA 1NESE 3OSYA 1ANCA 2F9OA 4WWYA 3P92A 4ISIH 4E7NA 2VWNA 1GCTB 1LMWB 2FMJA 2AGGX 1SVPA 3QWCH 5EU8A 2QN5T 1QBVH 2ZGCA 2KAIB 1C5ZB 4MNYA 1C1PA 1ZSLA 1LKBA 4WY3A 1W8BH 2ANYA 1GL0E 2ASUB 1FJSA 1AO5A 4D76A 4NCYA 2V3OH 4YLUA 2G00A 5L30H 4FUBA 1MH0A 4D9RA 5DP9A 4O9VA 1JMOH 1FV9A 1L2EA 1O2KA 3F9FA 1GBKA 1LCYA 3E1XB 1SGIB 1HUTH 2C8YB 4OS6A 5HMAA 1T8LA 1GHBF 2FI4E 1GJ9B 3VGCB 4CREA 4I8GA 5GWZA 2AIPA 1MCVA 1TRMA 2ZU4A 1HJAC 4Q7YA 3Q00A 4Y0YE 1S84A 1D4PB 5F8XA 2GDEH 1MTNC 1MKWH 4H42U 4KELA 1ELAA 4YLQH 1NT1A 3EDXB 4RKJB 4X6MA 3UQOA 2SGAA 1SGDE 3QUMP 3RXVA 2W7UA 3A7YA 1TGCA 3P17H 4MLFB 1V2QT 3MO6A 1J9CH 1ZTJA 4U01A 3U8TH 1MU6B 1YCPK 2ZHQH 1KYNA 1C2EA 5EQQA 3KHVA 1Y3YA 1HIAB 3U9AH 1GHVH 1M9UA 2ZEBA 3FFGA 4ABAA 4K60A 1QQ4A 1SOZA 2A1DB 1Z71A 1TPOA 4AORA 1EOJA 2EI6A 2RA3A 2PWXA 1RTKA 4E05H 3BTTE 2FLBH 1G3DA 3VXEH 4BOHA 4JZFH 1OP2A 1L1GA 1C2DA 4FU8A 1V6DA 1TGBA 3UNSA 1GHXH 1ZJDA 4K5ZA 2ESTE 5JBAS 1DSUA 4HFPB 1C4Y2 1HDTH 1ZGVA 2Q6FA 4Q7XA 1O3NA 3ZZBA 1O0DH 9ESTA 2BY9X 4TY6A 2PTNA 1LPGB 3SU6A 1W7XH 2OLGA 2I6SA 5JBTA 1T32A 5HXFA 1V2WT 2ZHFH 4AYYB 5C3NA 5LPFA 1BRAA 2ZU3A 4NFFA 4D9QA 3SJIA 1JRSA 1NM6A 1ESTA 1TNKA 3QZQA 4CR9A 3SJ8A 1O3CA 2WYGA 3NK8A 2TRMA 1O3JA 4UFDH 3GY6A 5FBIA 4B73A 3U98H 4DY7B 4I8HA 3PWCA 4X6PA 4XBCA 3JZ2B 1ANBA 4U2WA 5A0AE 1EJMA 4LZ1H 1H1BA 3W95A 5C67A 2D8WA 1JIRA 2RDLA 1G32B 1C5TA 1F7ZA 1GJAB 1BT7A 1BTPA 4CR5A 3KQBA 1HAVA 4AG2A 1GHZA 2XYAA 4WXIA 2AMDA 1C1NA 4AGJA 1MMJN 4NIYA 1NY22 3ELAH 4K2YA 1LVYA 4UDWH 5LPEA 3DHKH 2WPHS 5FPTA 1JOUB 3RLYH 4ZUHA 1QL9A 2JETC 1XUIA 1ACBE 2CGAA 4A7IB 2GT7A 1HAIH 1KXFA 5EPYA 3ZZDA 1Z7KA 1O2WA 1O3MA 2OP9A 1KXDA 3BTKE 1QL7A 4I8LA 2ODYB 1P2OA 1EPTC 4XBBA 1AFQB 1TX6A 1C1MA 1VCPA 1QRWA 5FXLA 2BYAX 4UONA 1FDPA 2FZZA 4TPIZ 4KKDA 1SGPE 1MD7A 3STJA 1P12E 1O5BB 1W14U 1ZTLA 1ZRKA 1O33A 2QY0B 2VJ1A 2C93B 3Q3KA 3GDVA 2GCHG 1BBRH 1C2MA 3HK6B 1LHDH 3M7QA 5T6FA 4Y7BA 1JXPA 2BHGA 1P2QA 2BD7A 1P01A 3PMJA 3RUOA 4DVAU 1ELEE 5JBCS 1O2GH 2ZTXA 2BQWB 1MAYA 4DCDA 3GCTG 1OP0A 3AAVA 1IQIA 1C2LA 4HZHA 3URDA 2AH4X 1QA0A 2GX4A 1GMDG 1O2YA 2ZDAH 4Y11E 1N8OC 1PFXC 1GI9B 2NU2E 4IGDA 3LGIA 1G9IE 1IHSH 1PQ5A 1EX3A 1SMFE 1HXFH 3H7OA 7GCHG 1RD3B 3TH3H 1GI6A 1AVXA 2V3HH 4Q2KA 4NWLA 4ZKNU 3UOPA 1EXFA 3CS7A 4Q80A 4NIWA 1AZ8A 3ODFA 5F6MA 1KDQA 4GHQA 4MNXA 2BQ7B 1C2HA 4O03A 1FIWA 4RKOB 1VGCB 1TIOA 1AE5A 4ABEA 2JH0D 1Z1IA 4IMQA 2OC1A 1FZZA 1PYTC 3U1IB 1A1RA 5FPSA 1ZZZA 4NG9H 1SGQE 2M5TA 1S85A 1CBWB 1SQTA 3K6YA 3PROA 1D9IA 2ZP0H 1UHBA 5HGGA 1O30A 2PKSC 4HTCH 2G5NA 4Y6DA 4MNVA 4X2YA 2W3KA 1OKXA 3ITIA 2ZNKH 1GG6B 1W12U 2HOBA 3L33A 4MVNA 1X7AC 3ZZ9A 2EEKA 3QGJA 4NZQA 1T8MA 2ZCKP 3LPRA 2PUXB 2Z7FE 1GJ8B 3GISB 2GGVB 7ESTE 3V12A 2Z9IA 3E16B 1W11U 3A8AA 1XVOA 4BTUB 1P2JA 5H4IB 4IN1A 4TPYA 1UCYE 1KXBA 2BDIA 1OWEA 2WINI 1KXAA 3UOUA 2GDDA 3FZDA 3D23A 4NSVA 4FUEA 4DT7B 2D2DA 4NA8A 3B23B 3EE0B 1GJBB 1XMNB 2GMTC 4ISOA 1CGJE 4X8TH 4AGKA 3GCHB 1O5AB 1AGJA 1WYKA 3BTWE 2JH6D 5IYTA 1Z1JA 3ATKA 1ESAA 1AVWA 1MKXK 1UCYK 1P09A 2FOCA 2FESH 1YPHE 1QA7A 5EODA 4HGCA 1P03A 2HPPH 4ABJA 1YPMH 1CVWH 1CA8B 1XXFA 1AMHA 5A0BA 3IG6B 1PPHE 2P3FH 4X1SU 2FXRA 3VB7A 4BAKB 1SLWB 4MQAA 1MZDA 4OS2A 2P8OC 4X0WU 1DICA 4I32A 2CHAB 2ZQ2A 3VB5A 4GPGA 3UREA 1FNIA 5LH8A 1NRRH 2Z9LA 1DM4B 5HM2A 1HAZB 1OWJA 5DO4H 1W2KH 2OC7A 1O2UA 4JYUH 5T6GA 1UTJA 1BRCE 3FZZA 3T2NA 1XVMA 3UY9A 1CA0C 1GJDB 1NRQH 3F9GA 2A5KA 2GCHF 2QIQA 1LPKB 1S5SA 1ETRH 2QF0A 3E3TA 3W94A 1ESBA 1ORFA 1DLEA 2J4IA 5AF9H 1QCPA 2J94A 3BEUA 1CT4E 2XRCA 3RC4A 1QY6A 3KL6A 2DE8A 2BOHB 1BUIA 1UK2A 3MWIU 1TE0A 1EAXA 4CHAB 3SGQE 2J95A 3GCTF 4H4FA 4MG3A 1C4U2 3LGYA 4Q7ZA 2A32A 4KP0A 1GMDF 1ZSJA 4TYDA 3LIWA 4Y8YA 5CMXH 1BTZA 1HCGA 2R3YA 4FUCA 3SV9A 5AFYH 1RXPA 2BTCE 1C1VH 4ABHA 3BTDE 2ODQA 1ZLRA 1GI2A 2BB4A 3ZVBA 2PHBA 1O2ZA 2A4RA 3BTEE 2H5CA 2Z3CA 2HVXA 5F8TA 2IJOB 4D7FA 5A8YA 3LU9B 4GVUA 1TYNA 3I77A 2FOMB 1AFEH 2FWWA 4I7YH 1GI0A 2GT8A 1A5GH 1NRNH 1EASA 2OCVB 5SGAE 3GYMA 4UD9H 2VB0A 2A5IA 3SHCH 1GCTC 3M7TA 3OU0A 4X6NA 3SOSA 3AW0A 2PFEA 1FPHH 4X8UH 1OWDA 1O2IA 1TBZH 1Y3VA 3O8BA 2J92A 4IMZA 3DFJA 3ATIA 3ZZ4A 2J38A 2PGBB 3SNCA 1TAWA 2AMPA 4X1RU 3T28A 1RJXB 2QC2A 3HGNA 2BLOA 4NWKA 5PTPA 1GDQA 4M7GA 1EUFA 2XXLA 2H6MA 1E36B 1J16A 2Q6GA 4MPWA 1BITA 3RXAA 2GTBA 1FLEE 2G51A 1GBDA 1V2MT 3VGCC 1F5LA 1GPZA 2Z9JA 3VEQB 3A88A 1PPBH 1C5OH 3GY3A 1QB1A 3GDUA 3QK1A 1TGSZ 5FX6A 1K22H 3ODDA 4UE7H 4ISNA 5JBBS 1TPAE 1OYQA 1P3EA 1O32A 1F0TA 1XUKA 2O8LA 3DUXH 3ZYEA 3RLWH 1KLJH 2ZI2H 1NFWA 4A5TS 2SGFE 1PPZA 1O2OA 1XUJA 1CT2E 4A1XA 3ZZ6A 1HBTH 3U8OH 3E91A 4YOIA 2AERH 3HKJB 1EJAA 1O5FH 1XX9A 2QAAA 1WTGH 3A80A 1N6YA 2H2ZA 1V2ST 2EC9H 3PLBA 2RCEA 2A4OA 2JH5D 2G5VA 2WPIS 4ISHH 1O2MA 1TGNA 3MH5A 3MU8A 2ZU2A 3M37A 1SSXA 1C5WB 2PGQB 3N7OA 2VIWA 3TH2H 4Y71A 2SFAA 1V2KT 3BF6H 1FAXA 3QTVH 4FVBA 1BMAA 5FBEA 1FXYA 4B2CA 5ETXA 1L0ZA 1O2XA 1L4ZA 4SGAE 1PYTD 1SPJA 2ZF0H 2BD2A 1H8IH 3LT3A 2HPQH 2G55A 2WV5A 4CH2B 2CF8H 2ZFTA 1NPMA 3LJOA 5B6OA 3P8FA 1YLDA 1YPGH 1AY6H 3MU1A 1GBCA 3TJNA 2A2QH 4LK4A 2BDAA 2P59A 1IQHA 4YT7H 1HAGE 3DD2H 1ZRBA 1GJ7B 2UUKB 2Y81A 2ZGBH 3LH3A 3ZV9A 2W5EA 1C2IA 1YPJH 4WXVA 2FYRA 1P05A 1CO7E 1P57B 4IC6A 3PLPA 2V6NA 1BHXB 2FS9A 5DP7A 4DURA 3MYWA 1LVMA 4B71A 2BOKA 1Y5BT 1Y5AT 4KGAA 2ZTZA 3SGAE 4ZMAH 1HGTH 5TJXA 4FUJA 2AS9A 4JZ1A 4X1NU 4FUFA 3S7KB 1THPB 3A82A 4K1TA 1E35B 1EQ9A 2BVRH 2OBOA 2QF3A 1OS8A 2FEQH 3RM0H 3TJUA 4MTBA 1D3QB 2THFB 2HNTE 3TH4H 1YPLH 2OXSA 3RMOH 4FU7A 1HYLA 2GZ9A 2ZCLP 4D7GA 2BD9A 1SOTA 5DJ7A 1QHRB 1ZMNA 3MHWU 1FY3A 1ELVA 1PPGE 1HPGA 2BD8A 3OY6U 1T8NA 5DKMA 2BD4A 2FLRH 2VGCB 4ZH8A 1TBQH 2XBWA 4D8NA 1NFUA 1PQAA 2GKVE 2G52A 1SGFG 1ABIH 1LQDB 1ZMJA 5CE1A 5L2YH 1QB6A 3FVFB 3QN7A 2VVUA 2BDHA 1BMLA 1DS2E 1A0HB 2B7DH 1K2I1 2QXGA 1GL1A 3RXEA 4IN2A 3SI4H 1WSSH 1F0UA 1GCDA 4VGCB 3LC5A 1YBWA 2BDCA 4Y0ZE 1AB9B 1LHCH 3TIUA 1OWHA 1GBMA 3UNRA 2ZHEH 1GI4A 4CRGA 1VITG 2D26C 1SFIA 2A2XH 2PUQH 1Y8TA 4I31A 3ZZ8A 4ZKSU 1ZR0A 4ABGA 1PPFE 2F83A 2STAE 5CHAB 5AVDA 1KXCA 3AVZA 3A89A 4BAHB 4K1SA 2AGEX 2HWLB 4X1PU 5HYOA 3A7WA 1C1SA 2Q1JA 3BEIB 5TCCA 3UWIA 2FP7B 3SO3A 1TNJA 1Z8IB 2BD3A 1QBOA 1L1JA 2OQUA 2VIDA 1SLVB 4DW2U 1HNEE 1C1WH 4UFFH 2BDGA 1HXEH 3BSQA 3RXOA 1ZTKA 2Y82A 5C20A 1S81A 1SLXB 2FODA 5JPMH 1D3DB 1DDJA 1A4WH 3EA7A 2ZPRA 3S69A 4ASHA 2FI3E 3FP7E 3P70B 2RA0A 5E0GA 3BTQE 1DVAH 1ELBA 3K6ZA 1ARCA 3M5LA 1YGCH 3PM3A 1EB1H 4ABBA 1VGCC 2Y7ZA 1ZSKA 1QURH 4JZEH 3A7ZA 1C5VA 3DA9B 3SNEA 1XUGA 2UWLA 3EA8A 1P0SH 2A31A 4ABIA 1SLUB 1BTXA 4YTAA 3PO1B 3KQCA 1NO9H 4BXWA 3S9AA 1FAKH 5GJ4B 1ZGIA 2QXHA 3A83A 4NSYA 1OOKB 1CBWC 1UTOA 2FX6A 8KME2 1O3EA 2AFQB 1C1OA 1QL8A 1A3BH 4BXSA 3DT0H 3WY8A 2H9HA 2LPRA 1UVUH 5ABWA 4AX9H 1OWIA 4AOQA 1HV7A 1UVOA 1BHXF 3SBKA 1LHFH 1DY8A 1Q31A 1UVPA 5DGJA 1PPEE 2ZU1A 1CU1A 2BLVA 2EA3A 5C1XA 4NA7A 1RRKA 5DP3A 1GI3A 1K28D 4UEHH 1Q2WA 4JYTA 1T31A 5LPRA 1JIMA 4X8SH 3LGTA 1ID5H 1JRTA 3FANA 3HATH 1DWEH 1SGEE 2F91A 2W26A 4THNH 1P11E 1EOLA 4JK6A 3RXIA 3V3MA 1SB1H 3P95A 1K9OE 1THRH 4WVPE 1FY1A 1UTMA 3VB3A 5JDUB 2B0FA 2R2MB 1O5GH 4BAOB 4F49A 4K69A 4AYVB 2BZ6H 1T4VH 5DP4A 4GCHG 5DPAA 2VVCA 3BG8A 3UFAA 1GBHA 3BV9B 3B9FH 2NU0E 4OGXA 1QJ1B 2ZFSA 1ANDA 3URCA 2STBE 2TPIZ 1EJNA 1G37A 1RTFB 2TGPZ 3A86A 3SUDA 1GHAG 5K0HA 5A8ZA 1CQQA 1D6RA 4ZKOU 3TPIZ 1W3CA 1V2LT 1WOFA 1Z6EA 2GCTB 1ZMLA 1RGQA 2F9UA 1P8VC 3E0PB 6CHAC 1HAVB 2P95A 1NU7B 1Z6JH 4U32A 1GDNA 1V3XA 5HM9A 1SBWA 2ZFQH 4Z0KA 1LDTT 3TK6A 1A46H 1YF4A 4Z6AH 1AN1E 2QCYA 2XC5A 4FU9A 2K1QA 1NN6A 3TGIE 3SJKA 1PPCE 4NGAH 4UFGH 4O97A 1VITF 1GBFA 1UTPA 2BY5X 4FUGA 4CHAC 5G4BA 1EPTA 2WPJS 2VU8E 3UIRA 3SU4A 1XM1A 2P16A 1O2TA 2CN0H 4WH6A 5C5OA 1O3IA 2ZPSA 2G81E 3TNSA 1GMCG 4O3UA 3VXFH 5DK1A 1O38A 1GBIA 3GCOA 3ZZ3A 2C4FH 5EXNA 2GV7A 1UTQA 2C3SA 2XNIA 4Y8ZA 1VJ9U 4B2BA 1WAYB 1RIWC 1IQMA 1MD8A 1N6XA 4AFQA 1YCPH 2XTTB 1S6HA 4YT6H 4FUDA 1ELCA 2O8MA 1P9UA 3E6PH 2ULLA 1XKAC 1L4DA 1OSSA 2Z6BD 3HK3B 6GCHG 4CRCA 2GP9B 3P8NA 1RFNA 2BQ6B 3MNSA 3U1JB 4R8TB 5C1UA 1IQKA 1O2JA 5ESBA 2A0QB 2GVFA 2BZAA 2BMGB 3RC5A 1OXGA 2XBXA 1P9SA 2EI8A 1XXDA 1SFQB 2HGTH 1BRBE 3UQVA 1CHGA 3GDSA 1CGIE 1GBEA 3LONA 2AMQA 1O3LA 2FOBA 3SV8A 2P3UB 1GVLA 2IN2A 2J9NA 2JETB 2H9EH 3E8LA 1EAIA 3PV4A 3FP8E 2ANKH 1ETTH 3L3TA 1TX8A 3CENA 2QXIA 3G01A 5JB8S 4KTUA 3TK9A 2R3UA 2ZZUH 1CGHA 1KDQB 1TNGA 2VIOA 1UTNA 1W13U 2GZ8A 3RXKA 3O8RA 2XCNA 1QGFA 1MBQA 2SNWA 1D6WA 4FVDA 4MNWA 2WUCA 1W10U 2BXTH 3SNDA 3MNCA 2BDBA 1SR5C 1C1TA 3BG4B 5EPNA 2Y5FA 1MTVA 3RU4T 1BJVA 1AU8A 1TRNA 2V35A 1K1IA 1QRXA 4E06H 1FY8E 1OPHB 2PLXA 1ELDE 1B7XB 2OC8A 4YM9A 1KY9A 1O2PA 1UHBB 7LPRA 1C2FA 1C5SA 4JCNA 3A87A 2ZCHP 3SV6A 4CBOA 2G8TA 3NZIA 2JKHA 3BTGE 4MDSA 4ZAEA 3DFLA 3M35A 1O36A 1TOCB 2UWPA 2O8TA 1P04A 1G3BA 4ZHLU 1N8OB 1C5UA 1ZJKA 3D62A 2FOAA 4IC5A 1BJUA 1WCZA 1A0JA 3RU4D 3SNBA 1GHAF 1F92A 1SHHB 4PROA 1QJ6B 3ZZAA 1S0QA 4F4OC 2VWLA 5DP8A 3T5FH 1O3DA 2VNTA 1SGCA 1O3PB 1BTYA 2VWMA 4IBLH 1CHOG 3A85A 3PMHB 3SU3A 1GJ4H 1GGDC 1FY4A 2XWBI 3EYDA 3UR6A 1QR3E 1TFXA 4WMDA 1AI8H 1AHTH 1NZQH 3MH7A 4LOYH 3MO3A 2A4GA 1B5GH 1EP6A 1E38B 1GI5A 3M3TA 1C1QA 1C2GA 7GCHF 1MKWK 1W0ZU 2F9PA 2XW9A 4AFUA 1P02A 4AFZA 1A61H 1OP8A 2R2WU 4DJZB 3OY5U 1V2TT 3SORA 4OS7A 3RXFA 2Z3DA 1VITH 1SHYA 4R0IA 5T6DA 3ZVFA 3TITA 3PMBB 2PKSB 4I8JA 3MU4A 5DP6A 1LPZB 3ESTA 5JYIA 1DUAA 3I78A 3F6UH 3VFEA 1FN8A 1FONA 1GMCF 4GHTA 3ZYDA 1AWFH 5FCRA 2BDYA 3SQHE 3P8OA 1P10A 1O3OA 1TABE 4X6OA 3RXRA 1QJ7B 4E7RG 1AKSA 3TU7H 1TB6H 5BRRE 2VIVA 1WTHD 1YM0A 4A1TA 1O2NA 2ZFFH 3SN8A 3RMNH 3B8JA 1QTFA 3MH4A 2ZECA 4FUHA 2J2UA 2ZKSA 3O8DA 1Y59T 3MTYA 3RXDA 1GJCB 6GCHF 4NIXA 1KLIH 3H7TA 1CE5A 1ARBA 6LPRA 3RDZA 2RG3A 3KF2A 1C9PA 5FPYA 1GMHG 1MUEB 1ZHPA 3MU0A 3RP2A 1MTWA 1EZUC 1GBTA 3VB6A 1AE8H 3BTFE 1HAYB 4JYVH 2ODPA 4B1TA 2A45B 1J17T 2B8OH 3IWMA 2PV9B 4GAWA 3TLOA 5IDKA 1UVSH 2XC4A 3QLPH 3LJJA 3UTUH 2OINA 3ZZ7A 2VWOA 1JBUH 1SG8B 2OQ5A 1H9HE 2SGQE 4K8YA 1NTPA 3RXUA 2TBSA 1TMBH 1TWXB 2KAIA 2BVSH 1ZPCA 2FIRH 3VPKA 2QV1A 1W0YH 4ABFA 5CHAC 3SUGA 4DG4A 1KTTB 1THSH 2Y7XA 3A7TA 2OD3B 3S9BA 1DX5M 3V13A 1A5IA 2G4TA 2UWOA 4WH8A 1ZHRA 4MPVA 1GJ6A 2VH0A 2ALVA 3LGWA 3MO9A 3KQDA 3R0FA 1VR1H 4NA9H 1HRTH 1TA6A 1O3AA 1BBRE 1U6QA 1BZXE 2IOTA 1Y5UT 1K1JA 1EB2A 3IITA 2CF9H 1O2SA 2H9TH 1B0FA 1UCYH 1MKXH 3RXJA 2J34A 1V2UT 3SJ9A 1BA8B 3GY7A 1QQUA 4H6TA 1C1UH 1FI8A 3T27A 1TA2A 1V2VT 3BN9A 4XDEA 1GVZA 2FS8A 1G2MA 1IHTH 2TGDA 4BAQB 1IQJA 1IQLA 1DFPA 1V2PT 2ALPA 3PO1C 1C5PA 1WBGB 1BBRK 1EP5A 3NXPA 4U30A 4O3TA 3M61U 3K65B 3SGBE 4CRFA 2AGIX 2O8UA 2FTLE 1CHOF 1CSOE 1ZOMA 1TX7A 2UUFB 4ISLA 3Q3YA 4TWWA 1S83A 1E37B 3H5CB 2ZGJA 1PQ8A 1LO6A 1K1MA 2R0LA 1SC8U 1C5RA 5L6NH 4X2VA 3BEFB 4ESTE 1F2SE 1O5CB 1SI5H 1C9TA 1TQ7B 3ZVEA 1O34A 1MTUA 1UVTH 3SU5A 1GJ5H 1H9LB 3MFJA 2D1JA 1SQAA 1LKAA 4OS4A 1INCA 1YC0A 5EW1H 1DANH 2ZDMA 3SZNA 5E8EH 1ELFA 1RTLA 1SGTA 4BAMB 1E34B 2XBYA 4FXGH 3PB1E 1EAWA 2W3IA 3LGUA 5E2OA 2FPZA 3NWUA 1AFQC 1BIOA 1AUTC 1PQ7A 4DGJA 1ELTA 2NU3E 2P3TB 5DP5A 4ZKRU 1Y3XA 3NUMA 1F0SA 2AYWA 1QRZA 1DUEA 1NFYA 3O8CA 2FTMA 4Y7AA 4IS5A 2WPMS 2BY8X 2ILNA 3PWBA 1ELGA 3QGNB 1BOQA 1C5NH 4LXBH 2PKAA 5GIBA 3RXMA 3U8RH 3ZV8A 5C2ZA 4I8KA 1VCWA 1SGYE 2XWAA 2CXVA 2ANMH 5A09A 1A2CH 1BDAA 1H9IE 1C5MD 1OX1A 3C27B 5C1YA 1YPEH 3L6PA 4X2WA 2HNTF 4A92A 2VIQA 1TNIA 5A2MH 1GMHF 2FI5E 3GY4A 1GI7B 2GCTC 1DOJA 3MOCA 3SQEE 1P2KA 3HGPA 1HAHH 4TY7A 3RMMH 2SGEE 2A7HA 3AW1A 2PW8H 1O3FA 1O3HA 4H6SB 2IPHA 1TMUH 2BY6X 2TIOA 3A81A 1YPHC 2QYIA 4WJG2 1T7CA 3RXLA 3E0NB 2BVXH 5FHTA 3KNXA 4ZXYH 3NKKA 2ZHWH 3TVJB 1P3CA 3ZVGA 1S0RA 4Y8XA 3MNBA 6ESTA 2BLWA 1O35A 1G3EA 1FPCH 1NFXA 3QX5H 5EXLA 1O3BA 2H5DA 3RXBA 2NU4E 3PLKA 2ZDNA 2P94A 2O8WA 1BCUH 2ZFRH 1BTHH 1A0LA 2A4QA 2WPLS 1GBLA 1HLTH 1HAXB 2BXUH 1GVKB 1KSNA 2Z3EA 5FCKA 1GHYH 3UUZA 9LPRA 3D65E 2ZDLA 2OBQA 1O37A 2ZQ1A 2AIQA 3F1SB 1C4V2 4WMEA 2PKAB 1D3TB 1HJ8A 2W7SA 4GSOA 2ZFPH 1GG6C 2BX4A 1BB0B 3M5NA 8GCHG 4K3JA 3RXSA 5A8XA 4JZIA 3S0NA 3ATWA 4ZROA 2ZDKA 1BRUP 3M36A 2CMYA 3EA9A 3UPEA 3V0XA 1DPOA 5BPEA 1AD8H 1HJ9A 2ZGXH 2ZU5A 2ZPQA 4HI3A 1OYTH 2HALA 3BTME 1YLCA 2ZHDA 2CV3A 5EXMA 1C2JA 3TJOA 3GY2A 5EQSA 3Q77A 1V2NT 2DUCA 3MNXA 2ZO3H 3TGKE 1C2KA 3M7UA 3RXQA 1HJAB 2ZWLH 3GCHC 1WU1A 3MI4A 3RXCA 1HFDA 2SGDE 2I6QA 3STIA 1MQ5A 3RC6A 3T29A 1MTNB 3FP6E 1DSTA 4CH8B 1DXPA 2BLQA 3BIUH
chains in the Genus database with same CATH superfamily
1O2HA 4K1EA 2QGRA 1E1RD 3Q3XA 1MTSA 3ZZ5A 3S9CA 1C5YB 3SV2H 1T4UH 2L6OA 3QDZB 2KFWA 3BG4C 3GICB 3OYPA 2Y6TA 3GYLB 2ZGHA 4TWYA 1O5DH 3OX7U 4NFEA 2G4UA 2KZ4A 5C5NA 2CHAC 5AHGH 2Z9KA 4ABDA 5F8ZA 2B5TB 3EQ0H 3PV2A 2C8WB 2YOLA 1DY9A 3ZVCA 1KXEA 1HB0B 1ZHMA 4P02A 4KTSA 2GD4B 1TLDA 1DE7H 1FY5A 1Y3UA 2P93A 1QB9A 2TGAA 4ASUD 1TPPA 1ZPBA 1Q3XA 4JK5A 3LH1A 4XE4A 4LZ4B 3D49H 3SU2A 3A8BA 4YZUA 5DN6D 1C5XB 1J14A 2YNAA 4CBNA 2IPQX 3P6ZB 3MH6A 2KCAA 4DOQA 3WWBA 4YESB 3RXGA 1NS3A 4J1YA 2ZG0H 5EQRA 1LTOA 3KEEA 1IQNA 3A8DA 2HLCA 1SKYE 3A84A 1L1NA 1WUNH 4WMFA 1F5RA 1QIXB 4Y10E 1DWBH 2OUAA 1K1PA 1AUJA 1DT2A 1SL3A 3UNQA 3R3GB 4BANB 1A7SA 2FOEA 2WPKS 1QFKH 1MU8B 3RM2H 1SGRE 4INHA 1LQEA 1TALA 1SGNE 3M5MA 3RXPA 3GCNA 3M3SA 1QBNA 1YPKH 1MBMA 2OC0A 3A7XA 3LDXH 4XFQA 1TONA 2WZQA 3V7TA 1WQVH 2XNDD 1P2NA 3M5OA 1FMGA 3F9HA 4YOGA 3AASA 5I46H 5EG4A 1YCPM 5J4SA 3QZRA 2VIPA 4BTTB 4A6LA 1DWDH 5E2PA 1HAOH 2DE9A 3AAUA 3LC3A 2EI7A 2C8XB 3EAJA 1C5LH 1GWAA 1KIGH 1UK4A 2C90B 4Y76A 5ESTE 1UK3A 1WQSA 1H4WA 4XOJA 2QA9E 5L2ZH 2HLDD 1AZZA 1O5EH 2Z94A 4QT8C 3ZZCA 4RN6A 1C5QA 1Z8GA 1NU9A 3F68H 1F0RA 4Y79A 4OS1A 3KCGH 2F9VA 2CJIA 1FQ3A 4ZHAA 1GHWH 1UJ1A 2NU1E 1G30B 3TNTA 1YKTA 3KGPA 5E0JA 2F3CE 1TOMH 4XBDA 3CP7A 3QTOH 5GDSH 1J8AA 4MPXA 1EPTB 8GCHF 5FX5A 4OGYA 1B0EA 1P06A 4J2YB 1ABJH 1P2MA 3TJVA 1FUJA 5T1VA 1NRSH 1BMFD 4X1QU 2NWNA 3SHAH 3UWJH 3K9XB 2FM2A 1EZQA 4ZHMU 1K1NA 1SQOA 3E90B 5J4QA 1ETSH 2HNTC 2ANWA 4XSKU 3K2UA 4WF8A 4A1VA 1OWKA 2PSYA 1DITH 1MCTA 2ZTYA 2F9NA 2WV9A 1J15A 1TNHA 2ZDVH 3Q76A 1O3GA 1XKBC 2C8ZB 4CRAA 2FOGA 4SGBE 2GV6A 4INLA 1LHEH 5AFZH 3LOXA 3RU4E 2GZ7A 1JWTA 5GPIB 3CS0A 4NIVA 4GCHF 5E0HA 1UTLM 1W0JD 4CRBA 1DXWA 3PYHA 1UMAH 1MAXA 1O2RA 1Z8RA 5I25A 6CHAB 4RSPA 2FX4A 2R0KA 1GBAA 3SNAA 2WYJA 5CHBA 5C17A 1TRYA 2XC0A 1BMMH 5GCHG 3RMLH 1NROH 2ZC9H 3ZVDA 2UUJB 1IOEA 1E0FD 1GBBA 2Q6DA 3QO6A 4I33A 1Y3WA 1D3PB 3FAOA 2KM0A 3TK5A 1NBME 2QXJA 1N1LA 1EZSC 2ZA5A 1O2VA 1TGTA 4KTCA 2WUBA 1UO6A 4JZDH 1AWHB 2SGPE 1XUHA 1NC6A 3I29A 4UFEH 1TPSA 2BM2A 2XBVA 1UTKA 2O9QA 4B2AA 3JZ1B 1BTWA 1DWCH 2LNCA 4YO9A 3SV7A 1EZXC 1FX0B 2FO9A 1S6FA 2H1UA 2FYQA 2XCFA 1BQYA 4B75A 1RIWB 4BNRA 3C1KA 4K8BA 3TGJE 4IW4E 2R9PA 1ZYOA 2SNVA 3PTNA 1ZPZA 2A5AA 1H8HD 1EATA 1AVGH 1GHBG 4OS5A 2Z9GA 3KIDU 4DIHH 4GLYA 4YOJA 5DG6A 2Y5GA 4B74A 2BY7X 3BTHE 3F9EA 3HKIB 1NRPH 3VB4A 1O39A 5JB9S 3KQ5A 4AZ2B 1HAPH 2PTCE 5TCAA 3RXHA 3MU5A 2VVVA 1KLTA 3ATMA 5EW2H 1YYY1 2UUYA 1FN6A 3A7VA 2V0BA 3NPSA 3T62A 1BTUA 1EKBB 3PTBA 8LPRA 3KN2A 3UR9A 8ESTE 2ZIQH 2FOFA 4ZXXH 4NZLA 1LHGH 3SI3H 3PMAB 1PJPA 1IAUA 2B9LA 3SUFA 1GI8B 4AB9A 4BTIB 1H8DH 1MQ6A 2VGCC 3ENSB 3OTJE 1C1RA 1TQ0B 1W7GH 1T8OA 2BX3A 2GMTB 4CRDA 4AFSA 1K1OA 2HRVA 2PSXA 1A5HA 5A0CA 3ZVAA 4X2XA 2J5UA 1IQFA 2AEIH 4FUIA 2A7JA 1EAUA 1TMTH 1COWD 1XUFA 4MPUA 1RS0A 3GY8A 1IQGA 4M9FA 1BMNH 4VGCC 2TGTA 1GBJA 1K21H 1K1LA 1AB9C 1P2IA 3T26A 5EGMA 5K7RA 1LVOA 2WV4A 5LGOA 1V2RT 4AN7A 1GI1A 7KMEH 3F2FA 1AQ7A 3GOVB 2P8OB 2KX4A 1QNJA 1WDIA 1YP9A 3MMGA 1CT0E 3GY5A 4X8VH 5T3HA 1DLKB 1VJAU 3HPTB 3SW2B 3SUEA 1ANEA 1O31A 2BD5A 1VZQH 2PR3A 1AIXH 3KQEA 1G36A 2FDAA 4INKA 1F5KU 2WPDD 1CA0B 1AKSB 1O3KA 1Z8JB 1V2OT 1KTSB 3LGVA 3SU1A 2YNBA 5FAHA 1TNLA 3BIVH 5F03A 2YMSB 2OTVA 5GXPA 1LVBA 1MZAA 4JMYA 4GUXA 4B76A 1GDUA 3U69H 1TBRH 2Y80A 3EGKH 3RXTA 2FOHA 2VH6A 2Y5HA 3M3VA 3AK5A 1V2JT 3SJOA 5EOKA 4DIIH 1FIZA 3S7HB 1GGDB 1O2QA 3ATLA 3P8GA 1H8ED 1IQEA 3SU0A 3LKWA 1WV7H 1A3EH 5GCHF 2JJ2D 4AB8A 1VCQA 1G2LA 1S82A 4AG1A 1SGFA 1HIAA 2VINA 3T25A 1O2LA 2A7CA 1G3CA 2F9BH 3NCLA 3A8CA 1NESE 3OSYA 2M2AA 1ANCA 2F9OA 4WWYA 3P92A 4ISIH 4E7NA 2VWNA 1GCTB 1LMWB 2FMJA 2AGGX 1SVPA 2F43B 3CNRA 3QWCH 5EU8A 2QN5T 1QBVH 2ZGCA 2KAIB 1C5ZB 4MNYA 1C1PA 1ZSLA 1LKBA 4WY3A 1W8BH 2ANYA 1GL0E 2K0QA 2ASUB 3UB0A 1FJSA 2QF4A 1AO5A 4D76A 4NCYA 2V3OH 4YLUA 2G00A 5L30H 4FUBA 1MH0A 2J98A 4D9RA 4O9VA 5DP9A 1JMOH 1FV9A 1L2EA 1O2KA 3F9FA 1GBKA 1LCYA 3E1XB 1SGIB 1HUTH 2C8YB 4OS6A 5HMAA 1T8LA 1GHBF 2FI4E 1GJ9B 4FOUC 3VGCB 4CREA 4I8GA 5GWZA 2AIPA 1MCVA 1TRMA 2ZU4A 1HJAC 4Q7YA 3Q00A 4Y0YE 1S84A 2JDID 1D4PB 5F8XA 2GDEH 1MTNC 1MKWH 4H42U 4KELA 1ELAA 4YLQH 1NT1A 3FN8A 3EDXB 4RKJB 4X6MA 3UQOA 2SGAA 1SGDE 3QUMP 3RXVA 2W7UA 2EQNA 3A7YA 1TGCA 2EY4C 3P17H 4MLFB 1V2QT 3MO6A 1J9CH 1ZTJA 4U01A 3U8TH 1MU6B 1YCPK 2ZHQH 1KYNA 1C2EA 5EQQA 3KHVA 5EJ1A 1Y3YA 1HIAB 3U9AH 1GHVH 1M9UA 2ZEBA 3FFGA 4ABAA 4K60A 1QQ4A 1SOZA 2A1DB 1Z71A 1TPOA 4AORA 1EOJA 2EI6A 2RA3A 2PWXA 1RTKA 4E05H 3BTTE 4ACAA 2FLBH 1G3DA 3VXEH 4BOHA 4JZFH 1OP2A 1L1GA 1C2DA 4FU8A 1V6DA 1TGBA 3UNSA 1GHXH 1ZJDA 4K5ZA 2ESTE 5JBAS 1DSUA 4HFPB 1C4Y2 3N99A 1HDTH 1ZGVA 2Q6FA 4Q7XA 1O3NA 3ZZBA 1O0DH 9ESTA 2BY9X 3OEED 4TY6A 2PTNA 1LPGB 3SU6A 1W7XH 2OLGA 2I6SA 5JBTA 1T32A 5HXFA 1V2WT 2ZHFH 4AYYB 5C3NA 5LPFA 1BRAA 2ZU3A 4NFFA 4D9QA 3SJIA 1JRSA 1NM6A 1ESTA 1TNKA 3GS9A 3QZQA 4CR9A 3SJ8A 1O3CA 2WYGA 3NK8A 2TRMA 1O3JA 4UFDH 3GY6A 5FBIA 4B73A 3U98H 4DY7B 4I8HA 3PWCA 4X6PA 4XBCA 3JZ2B 1ANBA 4U2WA 5A0AE 1EJMA 4LZ1H 1H1BA 3W95A 5C67A 2D8WA 1JIRA 2RDLA 1G32B 1C5TA 1F7ZA 1GJAB 1BT7A 1BTPA 4CR5A 3KQBA 3F0PA 1HAVA 4AG2A 1GHZA 2XYAA 4WXIA 2AMDA 1C1NA 4AGJA 1MMJN 4NIYA 1NY22 3ELAH 4K2YA 1LVYA 4UDWH 5LPEA 3DHKH 2WPHS 5FPTA 1JOUB 4RT1A 3RLYH 4ZUHA 1QL9A 2JETC 1XUIA 1ACBE 2CGAA 4A7IB 2GT7A 1HAIH 1KXFA 5EPYA 3ZZDA 1Z7KA 3DCLA 1O2WA 5EJZA 1O3MA 2OP9A 1KXDA 5CDFE 3BTKE 1QL7A 4I8LA 2ODYB 1P2OA 1EPTC 4TSFD 4XBBA 1AFQB 1TX6A 1C1MA 1VCPA 1QRWA 5FXLA 2BYAX 4UONA 1FDPA 2FZZA 4TPIZ 4KKDA 1SGPE 1MD7A 1YY3A 1P12E 3STJA 2W6ID 1O5BB 1W14U 1ZTLA 1ZRKA 1O33A 2QY0B 2VJ1A 2C93B 3Q3KA 3GDVA 2GCHG 1BBRH 1C2MA 3HK6B 1LHDH 3M7QA 5T6FA 4Y7BA 1JXPA 2BHGA 1P2QA 2BD7A 1P01A 3PMJA 3RUOA 4DVAU 1ELEE 5JBCS 1O2GH 2ZTXA 2BQWB 1MAYA 4DCDA 3GCTG 1OP0A 3AAVA 1IQIA 1C2LA 5C0UA 4HZHA 3URDA 2AH4X 1QA0A 2GX4A 1GMDG 1O2YA 2ZDAH 4Y11E 1N8OC 1PFXC 1GI9B 2NU2E 4IGDA 3LGIA 1G9IE 1IHSH 1PQ5A 1EX3A 1SMFE 1HXFH 3H7OA 7GCHG 1RD3B 3TH3H 1GI6A 1AVXA 2V3HH 4Q2KA 4NWLA 4ZKNU 3UOPA 1EXFA 3CS7A 4Q80A 4NIWA 1AZ8A 3ODFA 5F6MA 1KDQA 4GHQA 4MNXA 2BQ7B 3EE7A 1C2HA 4O03A 1FIWA 4RKOB 1VGCB 1TIOA 1AE5A 4ABEA 2JH0D 1Z1IA 4IMQA 2OC1A 1FZZA 1PYTC 1YLNA 1A1RA 3U1IB 2AHME 5FPSA 1ZZZA 4NG9H 1SGQE 2M5TA 1S85A 1CBWB 1SQTA 3K6YA 3PROA 3UAIC 1D9IA 2ZP0H 1UHBA 5HGGA 1O30A 2PKSC 4HTCH 2G5NA 4Y6DA 4MNVA 4X2YA 2W3KA 1OKXA 3ITIA 2ZNKH 1GG6B 1W12U 2HOBA 3L33A 4MVNA 1X7AC 3ZZ9A 2EEKA 3QGJA 4NZQA 1T8MA 2ZCKP 3LPRA 2PUXB 2Z7FE 1GJ8B 3GISB 2GGVB 7ESTE 3V12A 2Z9IA 3E16B 1W11U 3A8AA 1XVOA 4BTUB 1P2JA 5H4IB 4IN1A 4TPYA 5IK2D 1UCYE 1KXBA 2BDIA 1OWEA 2WINI 3PV5A 1KXAA 3UOUA 2GDDA 3FZDA 3D23A 4NSVA 4FUEA 4DT7B 2D2DA 4NA8A 3B23B 3EE0B 2XOKD 1GJBB 1XMNB 2GMTC 4ISOA 1CGJE 4X8TH 2KR7A 3GCHB 4AGKA 1O5AB 1AGJA 5HIYA 1WYKA 4XD7D 3BTWE 2JH6D 5IYTA 1Z1JA 3ATKA 1ESAA 1AVWA 1MKXK 1UCYK 1P09A 2FOCA 5HKKD 2FESH 1YPHE 4HG6A 1QA7A 5EODA 4HGCA 1P03A 2HPPH 4ABJA 1YPMH 1CVWH 1CA8B 1XXFA 1AMHA 5A0BA 3IG6B 1PPHE 2P3FH 4X1SU 2FXRA 3VB7A 4BAKB 1SLWB 4MQAA 1MZDA 4OS2A 2P8OC 4X0WU 1DICA 4I32A 2CHAB 2ZQ2A 3VB5A 4GPGA 1E1QD 3UREA 1FNIA 5LH8A 1NRRH 2Z9LA 1DM4B 5HM2A 1HAZB 1OWJA 5DO4H 1W2KH 2OC7A 1O2UA 4JYUH 5T6GA 1UTJA 1BRCE 3FZZA 3T2NA 1XVMA 3UY9A 1CA0C 1GJDB 1NRQH 3F9GA 2A5KA 2GCHF 2QIQA 1LPKB 4I86A 1S5SA 1ETRH 2QF0A 3E3TA 3W94A 1ESBA 1ORFA 1DLEA 2J4IA 5AF9H 1QCPA 2J94A 3BEUA 1CT4E 2YMSC 2XRCA 3RC4A 3U28C 1QY6A 3KL6A 2DE8A 2BOHB 1BUIA 1UK2A 3MWIU 1TE0A 1EAXA 4CHAB 3SGQE 2J95A 3GCTF 4H4FA 4MG3A 1C4U2 3LGYA 4Q7ZA 2A32A 4KP0A 1GMDF 1ZSJA 4TYDA 3LIWA 4Y8YA 5CMXH 1BTZA 1HCGA 5KECA 2R3YA 4FUCA 3SV9A 5AFYH 1RXPA 2BTCE 1C1VH 4ABHA 5KEDA 3BTDE 2ODQA 1ZLRA 1GI2A 2BB4A 3ZVBA 2PHBA 1O2ZA 2A4RA 3BTEE 5KGOA 2H5CA 2Z3CA 2HVXA 5F8TA 2IJOB 4D7FA 5A8YA 3LU9B 4GVUA 1TYNA 3I77A 2FOMB 1AFEH 2FWWA 4I7YH 1GI0A 2GT8A 1A5GH 1NRNH 1EASA 2OCVB 5SGAE 3GYMA 4UD9H 2VB0A 2A5IA 3SHCH 1GCTC 3M7TA 3OU0A 4X6NA 3SOSA 2V3MA 3AW0A 2PFEA 1FPHH 4X8UH 1OWDA 1O2IA 1TBZH 1Y3VA 3O8BA 2K8IA 2J92A 4IMZA 3DFJA 3ATIA 3ZZ4A 2J38A 2PGBB 3PRDA 1TAWA 3SNCA 2AMPA 4X1RU 3T28A 1RJXB 2QC2A 3HGNA 2BLOA 4NWKA 5PTPA 1GDQA 3OEHD 4M7GA 1EUFA 2XXLA 2H6MA 1E36B 1J16A 2Q6GA 3SYJA 4MPWA 1BITA 3RXAA 2GTBA 1FLEE 2G51A 1GBDA 1V2MT 3VGCC 1F5LA 1GPZA 2Z9JA 3VEQB 3WW7A 3A88A 1PPBH 1C5OH 3GY3A 1QB1A 3GDUA 3QK1A 1TGSZ 5FX6A 1K22H 3ODDA 4UE7H 4ISNA 5JBBS 3KYFA 1TPAE 2QF5A 1OYQA 1P3EA 1O32A 1F0TA 1XUKA 2O8LA 3DUXH 2OK5A 3ZYEA 3RLWH 1KLJH 2ZI2H 1NFWA 2IJD1 4A5TS 2SGFE 1PPZA 1O2OA 1XUJA 1CT2E 4A1XA 2F4LA 3ZZ6A 1HBTH 3U8OH 3E91A 4YOIA 2AERH 3HKJB 1EJAA 1O5FH 1XX9A 2QAAA 1WTGH 3A80A 1N6YA 2H2ZA 1V2ST 2EC9H 3PLBA 2RCEA 2A4OA 2JH5D 2G5VA 2WPIS 4ISHH 1O2MA 2JJ1D 1TGNA 3MH5A 3MU8A 2ZU2A 3M37A 1SSXA 1C5WB 2PGQB 1E79D 2VIWA 3DSPA 3N7OA 3TH2H 4Y71A 2SFAA 1V2KT 3BF6H 1FAXA 3QTVH 4FVBA 1BMAA 5FBEA 1FXYA 4B2CA 5ETXA 1L0ZA 1O2XA 1L4ZA 4SGAE 1PYTD 5B6LA 1SPJA 2ZF0H 2V7QD 2BD2A 1H8IH 3LT3A 2HPQH 2G55A 2WV5A 4CH2B 2CF8H 2ZFTA 1QZ8A 1NPMA 3LJOA 5B6OA 5C94A 3P8FA 1YLDA 1YPGH 1AY6H 3MU1A 3MQKC 1GBCA 3TJNA 2A2QH 4LK4A 2BDAA 2P59A 1IQHA 4YT7H 1HAGE 2VBCA 3DD2H 1ZRBA 1GJ7B 2UUKB 2Y81A 2ZGBH 2LELA 3LH3A 3ZV9A 2W5EA 1C2IA 1YPJH 4WXVA 2FYRA 1P05A 1CO7E 1P57B 4IC6A 3PLPA 2V6NA 1BHXB 2FS9A 5DP7A 3NRLA 4DURA 3MYWA 1LVMA 4B71A 2BOKA 1Y5BT 1Y5AT 4KGAA 2ZTZA 3SGAE 4ZMAH 1HGTH 5TJXA 4FUJA 2AS9A 4JZ1A 4X1NU 2JIZD 4FUFA 3S7KB 1THPB 3A82A 4K1TA 1E35B 1EQ9A 3OE7D 2BVRH 2OBOA 2KCOA 2QF3A 1OS8A 2FEQH 3RM0H 3TJUA 4MTBA 1D3QB 2THFB 2HNTE 3TH4H 1YPLH 2OXSA 3RMOH 4FU7A 1HYLA 2GZ9A 2ZCLP 4D7GA 2BD9A 1SOTA 5DJ7A 1QHRB 1ZMNA 3MHWU 1FY3A 1ELVA 1PPGE 1HPGA 2BD8A 3OY6U 1T8NA 5DKMA 2BD4A 2FLRH 2VGCB 4ZH8A 2CK3D 1TBQH 2XBWA 4D8NA 1NFUA 1PQAA 2GKVE 2G52A 1SGFG 1ABIH 1LQDB 1ZMJA 2W6JD 5CE1A 5L2YH 1QB6A 3FVFB 3QN7A 2VVUA 2BDHA 1BMLA 1DS2E 1A0HB 2B7DH 1K2I1 2QXGA 1GL1A 3RXEA 4IN2A 3SI4H 1WSSH 1F0UA 1GCDA 4VGCB 3SZEA 3LC5A 1YBWA 2BDCA 4Y0ZE 1AB9B 1LHCH 4P00A 3TIUA 1OWHA 1GBMA 3UNRA 2ZHEH 1GI4A 4CRGA 1VITG 2D26C 1SFIA 2A2XH 2PUQH 1Y8TA 4I31A 3ZZ8A 4ZKSU 1ZR0A 4ABGA 1PPFE 2F83A 2STAE 5CHAB 2YMSD 5AVDA 1KXCA 3AVZA 3A89A 4BAHB 4K1SA 2AGEX 2HWLB 4X1PU 5HYOA 3A7WA 1C1SA 2Q1JA 3BEIB 5TCCA 3UWIA 2FP7B 3SO3A 1TNJA 1EFRD 1Z8IB 2BD3A 3KYGA 1QBOA 2J98B 3H09A 1L1JA 2OQUA 2LP6A 2VIDA 1SLVB 4DW2U 1HNEE 1C1WH 4UFFH 2BDGA 1HXEH 3BSQA 3RXOA 1ZTKA 2Y82A 5C20A 1S81A 1SLXB 2FODA 5JPMH 1D3DB 1DDJA 1A4WH 3EA7A 2ZPRA 3S69A 4ASHA 2FI3E 3FP7E 3P70B 2RA0A 3F2GA 5E0GA 3BTQE 1DVAH 1ELBA 3K6ZA 1ARCA 3M5LA 1YGCH 3PM3A 1EB1H 4ABBA 1VGCC 2Y7ZA 1ZSKA 1QURH 4JZEH 3A7ZA 1C5VA 3DA9B 3SNEA 1XUGA 2UWLA 3EA8A 1P0SH 2A31A 4ABIA 1SLUB 1BTXA 4YTAA 2WHXA 3PO1B 3KQCA 1NO9H 4BXWA 4B6EA 3S9AA 1FAKH 5GJ4B 1ZGIA 2QXHA 3A83A 4NSYA 1OOKB 1CBWC 1UTOA 2FX6A 8KME2 1O3EA 2AFQB 1C1OA 1QL8A 1A3BH 4BXSA 3DT0H 3WY8A 3OFND 2H9HA 2LPRA 1UVUH 5ABWA 4AX9H 1OWIA 4AOQA 1HV7A 2RFKC 1UVOA 1BHXF 3SBKA 1LHFH 1DY8A 1Q31A 1UVPA 5DGJA 1PPEE 2ZU1A 1CU1A 2BLVA 2EA3A 5C1XA 1UW7A 4NA7A 1RRKA 5DP3A 1GI3A 1K28D 4UEHH 1Q2WA 4JYTA 1T31A 5LPRA 1JIMA 4X8SH 3LGTA 1ID5H 1JRTA 3FANA 3HATH 1DWEH 1SGEE 2F91A 2W26A 4THNH 1P11E 1EOLA 4JK6A 3RXIA 3V3MA 1SB1H 3P95A 1K9OE 1THRH 2PP6A 4WVPE 1FY1A 1UTMA 3VB3A 5JDUB 2B0FA 2R2MB 1O5GH 4BAOB 4F49A 4K69A 4AYVB 2BZ6H 1T4VH 5DP4A 4GCHG 5DPAA 2VVCA 3BG8A 3UFAA 1GBHA 3BV9B 3B9FH 2NU0E 4OGXA 4F55A 1QJ1B 2ZFSA 1ANDA 3URCA 2STBE 2TPIZ 1EJNA 1G37A 1RTFB 2TGPZ 3A86A 3SUDA 1GHAG 5K0HA 5A8ZA 1CQQA 1D6RA 4ZKOU 3TPIZ 1W3CA 1V2LT 1WOFA 1Z6EA 2GCTB 1ZMLA 1RGQA 2F9UA 1P8VC 3E0PB 6CHAC 1HAVB 2P95A 1NU7B 1Z6JH 4U32A 1GDNA 1V3XA 5HM9A 1SBWA 2ZFQH 4Z0KA 1LDTT 3TK6A 1A46H 1YF4A 4Z6AH 1AN1E 3PRBA 2QCYA 2XC5A 4FU9A 2K1QA 1NN6A 3TGIE 3SJKA 1PPCE 4NGAH 5C0TA 4UFGH 4O97A 1VITF 1GBFA 1UTPA 2BY5X 4FUGA 4CHAC 5G4BA 1EPTA 2WPJS 2VU8E 3UIRA 3SU4A 1XM1A 2P16A 1O2TA 2CN0H 4WH6A 5C5OA 1O3IA 2ZPSA 2G81E 3TNSA 3W1EA 1GMCG 4O3UA 3VXFH 5DK1A 1O38A 1GBIA 3GCOA 3ZZ3A 2C4FH 5EXNA 2GV7A 1UTQA 2C3SA 2XNIA 4Y8ZA 1VJ9U 4B2BA 1WAYB 1RIWC 1IQMA 2KCYA 1MD8A 1N6XA 4AFQA 1YCPH 2XTTB 1S6HA 4YT6H 4FUDA 1ELCA 2O8MA 1P9UA 3E6PH 2ULLA 1XKAC 1L4DA 1OSSA 2Z6BD 3HK3B 5HIZA 6GCHG 4CRCA 2GP9B 3P8NA 1RFNA 2BQ6B 3MNSA 3U1JB 4R8TB 5C1UA 1IQKA 1O2JA 3OAAD 5ESBA 2A0QB 2GVFA 2BZAA 2BMGB 3RC5A 1OXGA 2XBXA 1P9SA 2EI8A 1XXDA 1SFQB 2HGTH 1BRBE 3UQVA 1CHGA 3GDSA 1CGIE 1MABB 1GBEA 3LONA 2AMQA 1O3LA 2FOBA 3SV8A 2P3UB 1GVLA 5EJLA 2IN2A 2J9NA 2JETB 2H9EH 3E8LA 1EAIA 4ZCNA 3PV4A 3FP8E 2ANKH 1ETTH 3L3TA 1TX8A 3CENA 2QXIA 3G01A 3WWFA 5JB8S 4KTUA 3TK9A 2R3UA 2ZZUH 1CGHA 1KDQB 1TNGA 2VIOA 1UTNA 1W13U 2GZ8A 3RXKA 2WSSD 3O8RA 2XCNA 1QGFA 1MBQA 2SNWA 1D6WA 4FVDA 4MNWA 2WUCA 1W10U 2BXTH 3SNDA 3MNCA 2BDBA 1SR5C 1C1TA 3BG4B 5EPNA 2Y5FA 1MTVA 3RU4T 1BJVA 1AU8A 1TRNA 4ACBA 2V35A 1K1IA 1QRXA 4E06H 1FY8E 1OPHB 2PLXA 1ELDE 1B7XB 2OC8A 4YM9A 1KY9A 1O2PA 1UHBB 7LPRA 1C2FA 1C5SA 1SQRA 4JCNA 3A87A 2ZCHP 3SV6A 4CBOA 2HVYB 2G8TA 3NZIA 2JKHA 3BTGE 4MDSA 4ZAEA 3DFLA 3DSGA 1O36A 3M35A 1TOCB 1W0KD 2UWPA 2O8TA 1P04A 1G3BA 4ZHLU 1N8OB 1C5UA 1ZJKA 3D62A 2FOAA 4IC5A 1BJUA 1WCZA 4AC9A 1A0JA 3RU4D 3SNBA 1GHAF 1F92A 4YXWD 1SHHB 4PROA 1QJ6B 3ZZAA 1S0QA 4F4OC 2VWLA 5DP8A 3T5FH 1O3DA 2VNTA 2GJGA 1SGCA 1O3PB 1BTYA 2VWMA 4IBLH 1CHOG 3A85A 3PMHB 3SU3A 1GJ4H 1GGDC 1FY4A 2XWBI 3EYDA 3UR6A 4Q63A 1QR3E 1TFXA 4WMDA 1AI8H 1AHTH 1NZQH 3MH7A 4LOYH 3MO3A 2A4GA 1B5GH 1EP6A 1E38B 1GI5A 3M3TA 1C1QA 1C2GA 7GCHF 1MKWK 1W0ZU 2F9PA 2XW9A 4AFUA 1P02A 4AFZA 4RI0A 1A61H 1OP8A 2R2WU 1NBMD 4DJZB 3OY5U 1V2TT 3SORA 4OS7A 3RXFA 2Z3DA 1VITH 1SHYA 2RDEA 4R0IA 5T6DA 3FKSD 3ZVFA 3TITA 3PMBB 2PKSB 4I8JA 4B6FA 3MU4A 5DP6A 1LPZB 3ESTA 5JYIA 1DUAA 3I78A 3F6UH 3VFEA 1FN8A 1FONA 1GMCF 4GHTA 3ZYDA 1AWFH 5FCRA 2J97A 2BDYA 4XRNA 3SQHE 3P8OA 1P10A 1O3OA 1TABE 4X6OA 3RXRA 1QJ7B 4E7RG 1AKSA 3TU7H 1TB6H 5BRRE 2VIVA 1WTHD 1YM0A 4A1TA 1O2NA 2ZFFH 3SN8A 3RMNH 3B8JA 1QTFA 3MH4A 2ZECA 4FUHA 2J2UA 2ZKSA 3O8DA 4FETA 1Y59T 3MTYA 3RXDA 1GJCB 6GCHF 2L74A 4NIXA 1KLIH 3H7TA 1CE5A 1ARBA 6LPRA 3RDZA 2RG3A 3KF2A 5FL7D 1C9PA 5FPYA 1GMHG 1MUEB 1ZHPA 3MU0A 3RP2A 1MTWA 1EZUC 2KCPA 1GBTA 3VB6A 1AE8H 3BTFE 1HAYB 4JYVH 2ODPA 4B1TA 2A45B 1J17T 2B8OH 3IWMA 2PV9B 4GAWA 3TLOA 5IDKA 1UVSH 2XC4A 3QLPH 3LJJA 3UTUH 2OINA 3ZZ7A 2VWOA 1JBUH 1SG8B 2OQ5A 1H9HE 2SGQE 4K8YA 1NTPA 5GNDA 3FOAA 3RXUA 2TBSA 1TMBH 1TWXB 2KAIA 2BVSH 1ZPCA 2FIRH 3VPKA 2QV1A 1W0YH 4ABFA 5CHAC 3SUGA 4DG4A 1KTTB 1THSH 2Y7XA 3A7TA 2OD3B 4Z1MD 3S9BA 1DX5M 3V13A 1A5IA 2G4TA 2UWOA 4WH8A 1ZHRA 4MPVA 1GJ6A 2VH0A 5DSFA 2ALVA 3LGWA 3MO9A 3KQDA 3R0FA 1VR1H 4NA9H 1KMHB 1HRTH 1TA6A 3N7EA 1O3AA 1BBRE 1U6QA 1BZXE 2IOTA 1Y5UT 1K1JA 1EB2A 3IITA 2CF9H 1O2SA 2H9TH 1B0FA 1UCYH 1MKXH 3RXJA 2J34A 1V2UT 3SJ9A 1BA8B 1OHHD 3GY7A 1QQUA 4H6TA 1C1UH 1FI8A 3T27A 1TA2A 1V2VT 3BN9A 4XDEA 5F53A 1GVZA 1WXRA 2FS8A 2QE7D 1G2MA 1IHTH 2TGDA 4BAQB 1IQJA 1IQLA 1DFPA 1V2PT 2ALPA 3PO1C 1C5PA 1WBGB 1BBRK 1EP5A 3NXPA 4U30A 4O3TA 3M61U 3K65B 3SGBE 4CRFA 2AGIX 2O8UA 2FTLE 1CHOF 1CSOE 1ZOMA 1TX7A 2UUFB 4ISLA 3Q3YA 4TWWA 1S83A 1E37B 3H5CB 2ZGJA 1K0HA 1PQ8A 1LO6A 1K1MA 2R0LA 1SC8U 1C5RA 5L6NH 4X2VA 3BEFB 4ESTE 1F2SE 1O5CB 1SI5H 1C9TA 1TQ7B 3ZVEA 1O34A 1MTUA 1UVTH 3SU5A 1GJ5H 1H9LB 3OTPA 3MFJA 2D1JA 1SQAA 1LKAA 4OS4A 1INCA 1YC0A 5EW1H 1DANH 2ZDMA 3SZNA 5E8EH 1ELFA 1RTLA 1SGTA 4BAMB 1E34B 2XBYA 4FXGH 3PB1E 1EAWA 2W3IA 3LGUA 5E2OA 2FPZA 3NWUA 1AFQC 1BIOA 3ZIAD 1AUTC 1PQ7A 4DGJA 1ELTA 2NU3E 2P3TB 5DP5A 4ZKRU 1Y3XA 3NUMA 1F0SA 2AYWA 1QRZA 1DUEA 1NFYA 3O8CA 2FTMA 3DSOA 4Y7AA 4IS5A 2WPMS 2BY8X 2ILNA 3PWBA 1ELGA 3QGNB 1BOQA 4RT0A 1C5NH 4LXBH 2PKAA 4OM9A 5GIBA 3RXMA 3U8RH 3ZV8A 5C2ZA 4I8KA 1VCWA 1SGYE 2XWAA 2CXVA 2ANMH 5A09A 1A2CH 1BDAA 1H9IE 1C5MD 1OX1A 3C27B 5C1YA 1YPEH 3L6PA 4X2WA 2HNTF 4A92A 2VIQA 3FO8D 1TNIA 5A2MH 1GMHF 2FI5E 3GY4A 1GI7B 2GCTC 1DOJA 3MOCA 3SQEE 1P2KA 3HGPA 1HAHH 4TY7A 3RMMH 2SGEE 4DT4A 2A7HA 3AW1A 2PW8H 1O3FA 1O3HA 4H6SB 1S6LA 2IPHA 1TMUH 2BY6X 2TIOA 3A81A 1YPHC 2QYIA 4WJG2 1YWUA 1T7CA 4TT3D 3RXLA 3E0NB 2BVXH 5FHTA 3KNXA 4ZXYH 3NKKA 2ZHWH 3TVJB 1P3CA 3ZVGA 1S0RA 4F48B 4Y8XA 3MNBA 6ESTA 2BLWA 1O35A 1G3EA 1FPCH 1NFXA 3QX5H 5EXLA 1O3BA 2H5DA 3RXBA 2NU4E 3PLKA 2ZDNA 2P94A 2O8WA 1BCUH 2ZFRH 1BTHH 3F2HA 3N7DA 1A0LA 2A4QA 2WPLS 1GBLA 1HLTH 1HAXB 2BXUH 1GVKB 1KSNA 2Z3EA 5FCKA 1GHYH 3F0OA 3UUZA 9LPRA 3D65E 2ZDLA 2OBQA 1O37A 2ZQ1A 2AIQA 3F1SB 1C4V2 4WMEA 2PKAB 1D3TB 1HJ8A 2W7SA 4GSOA 2ZFPH 1GG6C 2BX4A 1BB0B 3M5NA 8GCHG 4K3JA 3RXSA 5A8XA 4JZIA 3S0NA 3ATWA 4ZROA 1VKYA 1BRUP 2ZDKA 3M36A 4Q4LA 2CMYA 3EA9A 3UPEA 3V0XA 1DPOA 5BPEA 1AD8H 1HJ9A 2ZGXH 2ZU5A 2ZPQA 3F3BA 4HI3A 1OYTH 5EIYA 2HALA 3BTME 1YLCA 2ZHDA 2CV3A 5EXMA 1C2JA 3TJOA 3GY2A 5EQSA 3Q77A 1V2NT 2DUCA 3MNXA 2ZO3H 3TGKE 1C2KA 3M7UA 3RXQA 1HJAB 2ZWLH 3GCHC 1WU1A 3MI4A 3RXCA 1HFDA 2SGDE 2I6QA 3STIA 1MQ5A 3RC6A 3T29A 1MTNB 3FP6E 1DSTA 4CH8B 1DXPA 3VG8A 2BLQA 3BIUH
chains in the Genus database with same CATH topology
1O2HA 4K1EA 2QGRA 3Q3XA 1MTSA 3ZZ5A 3S9CA 1C5YB 3SV2H 1T4UH 3QDZB 3BG4C 3GICB 3OYPA 2Y6TA 3GYLB 2ZGHA 4TWYA 1O5DH 3OX7U 4NFEA 2G4UA 5C5NA 2CHAC 5AHGH 2Z9KA 4ABDA 5F8ZA 2B5TB 3EQ0H 2C8WB 2YOLA 1DY9A 3ZVCA 1KXEA 1HB0B 1ZHMA 4KTSA 2GD4B 1TLDA 1DE7H 1FY5A 1Y3UA 2P93A 1QB9A 2TGAA 1TPPA 1ZPBA 1Q3XA 4JK5A 3LH1A 4XE4A 4LZ4B 3D49H 3SU2A 3A8BA 4YZUA 1C5XB 1J14A 2YNAA 4CBNA 3P6ZB 3MH6A 4DOQA 4YESB 3RXGA 1NS3A 4J1YA 2ZG0H 5EQRA 1LTOA 3KEEA 1IQNA 3A8DA 2HLCA 4WMFA 3A84A 1L1NA 1WUNH 1F5RA 1QIXB 4Y10E 1DWBH 2OUAA 1K1PA 1AUJA 1DT2A 1SL3A 3UNQA 3R3GB 4BANB 1A7SA 2FOEA 2WPKS 1QFKH 1MU8B 3RM2H 1SGRE 4INHA 1LQEA 1TALA 1SGNE 3M5MA 3RXPA 3GCNA 3M3SA 1QBNA 1YPKH 1MBMA 2OC0A 3A7XA 3LDXH 4XFQA 1TONA 3V7TA 1WQVH 1P2NA 3M5OA 1FMGA 3F9HA 4YOGA 3AASA 5I46H 5EG4A 1YCPM 5J4SA 3QZRA 2VIPA 4BTTB 4A6LA 1DWDH 5E2PA 1HAOH 2DE9A 3AAUA 3LC3A 2EI7A 2C8XB 3EAJA 1C5LH 1GWAA 1KIGH 1UK4A 2C90B 4Y76A 5ESTE 1UK3A 1WQSA 1H4WA 4XOJA 2QA9E 5L2ZH 1AZZA 1O5EH 2Z94A 4QT8C 3ZZCA 4RN6A 1C5QA 1Z8GA 1NU9A 3F68H 1F0RA 4Y79A 4OS1A 3KCGH 2F9VA 2CJIA 1FQ3A 4ZHAA 1GHWH 1UJ1A 2NU1E 1G30B 3TNTA 1YKTA 3KGPA 5E0JA 2F3CE 1TOMH 4XBDA 3CP7A 3QTOH 5GDSH 1J8AA 4MPXA 1EPTB 8GCHF 5FX5A 4OGYA 1B0EA 1P06A 4J2YB 1ABJH 1P2MA 3TJVA 1FUJA 1NRSH 4X1QU 2NWNA 3SHAH 3UWJH 3K9XB 2FM2A 1EZQA 4ZHMU 1K1NA 1SQOA 3E90B 5J4QA 1ETSH 2HNTC 2ANWA 4XSKU 3K2UA 4WF8A 4A1VA 1OWKA 2PSYA 1DITH 1MCTA 2ZTYA 2F9NA 1J15A 1TNHA 2ZDVH 3Q76A 1O3GA 1XKBC 2C8ZB 4CRAA 2FOGA 4SGBE 2GV6A 4INLA 1LHEH 5AFZH 3LOXA 3RU4E 2GZ7A 1JWTA 5GPIB 3CS0A 4NIVA 4GCHF 5E0HA 1UTLM 4CRBA 1DXWA 3PYHA 1UMAH 1MAXA 1O2RA 1Z8RA 5I25A 6CHAB 4RSPA 2FX4A 2R0KA 1GBAA 3SNAA 2WYJA 1TRYA 2XC0A 1BMMH 5GCHG 3RMLH 1NROH 2ZC9H 3ZVDA 2UUJB 1IOEA 1E0FD 1GBBA 2Q6DA 3QO6A 4I33A 1Y3WA 1D3PB 3FAOA 3TK5A 2QXJA 1N1LA 1EZSC 2ZA5A 1O2VA 1TGTA 4KTCA 2WUBA 1UO6A 4JZDH 1AWHB 2SGPE 1XUHA 1NC6A 3I29A 4UFEH 1TPSA 2BM2A 2XBVA 1UTKA 2O9QA 4B2AA 3JZ1B 1BTWA 1DWCH 2LNCA 4YO9A 3SV7A 1EZXC 2FO9A 1S6FA 2H1UA 2FYQA 2XCFA 1BQYA 4B75A 1RIWB 4BNRA 3C1KA 4K8BA 3TGJE 4IW4E 2R9PA 1ZYOA 2SNVA 3PTNA 1ZPZA 2A5AA 1EATA 1AVGH 1GHBG 4OS5A 2Z9GA 3KIDU 4DIHH 4GLYA 4YOJA 5DG6A 2Y5GA 4B74A 2BY7X 3BTHE 3F9EA 3HKIB 1NRPH 3VB4A 1O39A 5JB9S 1HAPH 4AZ2B 2PTCE 5TCAA 3RXHA 3MU5A 2VVVA 1KLTA 3ATMA 5EW2H 1YYY1 2UUYA 1FN6A 3A7VA 2V0BA 3NPSA 3T62A 1BTUA 1EKBB 3PTBA 8LPRA 3KN2A 3UR9A 8ESTE 2ZIQH 2FOFA 4ZXXH 4NZLA 1LHGH 3SI3H 3PMAB 1PJPA 1IAUA 2B9LA 3SUFA 1GI8B 4AB9A 4BTIB 1H8DH 1MQ6A 2VGCC 3ENSB 3OTJE 1C1RA 1TQ0B 1W7GH 1T8OA 2BX3A 2GMTB 4CRDA 4AFSA 1K1OA 2HRVA 2PSXA 1A5HA 5A0CA 3ZVAA 4X2XA 1IQFA 2AEIH 4FUIA 2A7JA 1EAUA 1TMTH 1XUFA 4MPUA 1RS0A 3GY8A 1IQGA 1BMNH 4VGCC 2TGTA 1GBJA 1K21H 1K1LA 1AB9C 1P2IA 3T26A 5EGMA 5K7RA 1LVOA 2WV4A 5LGOA 1V2RT 4AN7A 1GI1A 7KMEH 1AQ7A 3GOVB 2P8OB 1QNJA 3MMGA 1YP9A 1CT0E 3GY5A 4X8VH 5T3HA 1DLKB 1VJAU 3HPTB 3SW2B 3SUEA 1ANEA 1O31A 2BD5A 1VZQH 2PR3A 1AIXH 3KQEA 1G36A 2FDAA 4INKA 1F5KU 1CA0B 1AKSB 1O3KA 1Z8JB 1V2OT 1KTSB 3LGVA 3SU1A 2YNBA 5FAHA 1TNLA 3BIVH 5F03A 2OTVA 5GXPA 1LVBA 1MZAA 4JMYA 4GUXA 4B76A 1GDUA 3U69H 1TBRH 2Y80A 3EGKH 3RXTA 2FOHA 2VH6A 2Y5HA 3M3VA 1V2JT 3SJOA 5EOKA 4DIIH 1FIZA 3S7HB 1GGDB 1O2QA 3ATLA 3P8GA 1IQEA 3SU0A 3LKWA 1WV7H 1A3EH 5GCHF 4AB8A 1VCQA 1G2LA 1S82A 4AG1A 1SGFA 1HIAA 2VINA 3T25A 1O2LA 2A7CA 1G3CA 2F9BH 3NCLA 3A8CA 1NESE 3OSYA 1ANCA 2F9OA 4WWYA 3P92A 4ISIH 4E7NA 2VWNA 1GCTB 1LMWB 2FMJA 2AGGX 1SVPA 3QWCH 5EU8A 2QN5T 1QBVH 2ZGCA 2KAIB 1C5ZB 4MNYA 1C1PA 1ZSLA 1LKBA 4WY3A 1W8BH 2ANYA 1GL0E 2ASUB 1FJSA 1AO5A 4D76A 4NCYA 2V3OH 4YLUA 2G00A 5L30H 4FUBA 1MH0A 4D9RA 5DP9A 4O9VA 1JMOH 1FV9A 1L2EA 1O2KA 3F9FA 1GBKA 1LCYA 3E1XB 1SGIB 1HUTH 2C8YB 4OS6A 5HMAA 1T8LA 1GHBF 2FI4E 1GJ9B 3VGCB 4CREA 4I8GA 5GWZA 2AIPA 1MCVA 1TRMA 2ZU4A 1HJAC 4Q7YA 3Q00A 4Y0YE 1S84A 1D4PB 5F8XA 2GDEH 1MTNC 1MKWH 4H42U 4KELA 1ELAA 4YLQH 1NT1A 3EDXB 4RKJB 4X6MA 3UQOA 2SGAA 1SGDE 3QUMP 3RXVA 2W7UA 3A7YA 1TGCA 3P17H 4MLFB 1V2QT 3MO6A 1J9CH 1ZTJA 4U01A 3U8TH 1MU6B 1YCPK 2ZHQH 1KYNA 1C2EA 5EQQA 3KHVA 1Y3YA 1HIAB 3U9AH 1GHVH 1M9UA 2ZEBA 3FFGA 4ABAA 4K60A 1QQ4A 1SOZA 2A1DB 1Z71A 1TPOA 4AORA 1EOJA 2EI6A 2RA3A 2PWXA 1RTKA 4E05H 3BTTE 2FLBH 1G3DA 3VXEH 4BOHA 4JZFH 1OP2A 1L1GA 1C2DA 4FU8A 1V6DA 1TGBA 3UNSA 1GHXH 1ZJDA 4K5ZA 2ESTE 5JBAS 1DSUA 4HFPB 1C4Y2 1HDTH 1ZGVA 2Q6FA 4Q7XA 1O3NA 3ZZBA 1O0DH 9ESTA 2BY9X 4TY6A 2PTNA 1LPGB 3SU6A 1W7XH 2OLGA 2I6SA 5JBTA 1T32A 5HXFA 1V2WT 2ZHFH 4AYYB 5C3NA 5LPFA 1BRAA 2ZU3A 4NFFA 4D9QA 3SJIA 1JRSA 1NM6A 1ESTA 1TNKA 3QZQA 4CR9A 3SJ8A 1O3CA 2WYGA 3NK8A 2TRMA 1O3JA 4UFDH 3GY6A 5FBIA 4B73A 3U98H 4DY7B 4I8HA 3PWCA 4X6PA 4XBCA 3JZ2B 1ANBA 4U2WA 5A0AE 1EJMA 4LZ1H 1H1BA 3W95A 5C67A 2D8WA 1JIRA 2RDLA 1G32B 1C5TA 1F7ZA 1GJAB 1BT7A 1BTPA 4CR5A 3KQBA 1HAVA 4AG2A 1GHZA 2XYAA 4WXIA 2AMDA 1C1NA 4AGJA 1MMJN 4NIYA 1NY22 3ELAH 4K2YA 1LVYA 4UDWH 5LPEA 3DHKH 2WPHS 5FPTA 1JOUB 3RLYH 4ZUHA 1QL9A 2JETC 1XUIA 1ACBE 2CGAA 4A7IB 2GT7A 1HAIH 1KXFA 5EPYA 3ZZDA 1Z7KA 1O2WA 1O3MA 2OP9A 1KXDA 3BTKE 1QL7A 4I8LA 2ODYB 1P2OA 1EPTC 4XBBA 1AFQB 1TX6A 1C1MA 1VCPA 1QRWA 5FXLA 2BYAX 4UONA 1FDPA 2FZZA 4TPIZ 4KKDA 1SGPE 1MD7A 3STJA 1P12E 1O5BB 1W14U 1ZTLA 1ZRKA 1O33A 2QY0B 2VJ1A 2C93B 3Q3KA 3GDVA 2GCHG 1BBRH 1C2MA 3HK6B 1LHDH 3M7QA 5T6FA 4Y7BA 1JXPA 2BHGA 1P2QA 2BD7A 1P01A 3PMJA 3RUOA 4DVAU 1ELEE 5JBCS 1O2GH 2ZTXA 2BQWB 1MAYA 4DCDA 3GCTG 1OP0A 3AAVA 1IQIA 1C2LA 4HZHA 3URDA 2AH4X 1QA0A 2GX4A 1GMDG 1O2YA 2ZDAH 4Y11E 1N8OC 1PFXC 1GI9B 2NU2E 4IGDA 3LGIA 1G9IE 1IHSH 1PQ5A 1EX3A 1SMFE 1HXFH 3H7OA 7GCHG 1RD3B 3TH3H 1GI6A 1AVXA 2V3HH 4Q2KA 4NWLA 4ZKNU 3UOPA 1EXFA 3CS7A 4Q80A 4NIWA 1AZ8A 3ODFA 5F6MA 1KDQA 4GHQA 4MNXA 2BQ7B 1C2HA 4O03A 1FIWA 4RKOB 1VGCB 1TIOA 1AE5A 4ABEA 2JH0D 1Z1IA 4IMQA 2OC1A 1FZZA 1PYTC 3U1IB 1A1RA 5FPSA 1ZZZA 4NG9H 1SGQE 2M5TA 1S85A 1CBWB 1SQTA 3K6YA 3PROA 1D9IA 2ZP0H 1UHBA 5HGGA 1O30A 2PKSC 4HTCH 2G5NA 4Y6DA 4MNVA 4X2YA 2W3KA 1OKXA 3ITIA 2ZNKH 1GG6B 1W12U 2HOBA 3L33A 4MVNA 1X7AC 3ZZ9A 2EEKA 3QGJA 4NZQA 1T8MA 2ZCKP 3LPRA 2PUXB 2Z7FE 1GJ8B 3GISB 2GGVB 7ESTE 3V12A 2Z9IA 3E16B 1W11U 3A8AA 1XVOA 4BTUB 1P2JA 5H4IB 4IN1A 4TPYA 1UCYE 1KXBA 2BDIA 1OWEA 2WINI 1KXAA 3UOUA 2GDDA 3FZDA 3D23A 4NSVA 4FUEA 4DT7B 2D2DA 4NA8A 3B23B 3EE0B 1GJBB 1XMNB 2GMTC 4ISOA 1CGJE 4X8TH 4AGKA 3GCHB 1O5AB 1AGJA 1WYKA 3BTWE 2JH6D 5IYTA 1Z1JA 3ATKA 1ESAA 1AVWA 1MKXK 1UCYK 1P09A 2FOCA 2FESH 1YPHE 1QA7A 5EODA 4HGCA 1P03A 2HPPH 4ABJA 1YPMH 1CVWH 1CA8B 1XXFA 1AMHA 5A0BA 3IG6B 1PPHE 2P3FH 4X1SU 2FXRA 3VB7A 4BAKB 1SLWB 4MQAA 1MZDA 4OS2A 2P8OC 4X0WU 1DICA 4I32A 2CHAB 2ZQ2A 3VB5A 4GPGA 3UREA 1FNIA 5LH8A 1NRRH 2Z9LA 1DM4B 5HM2A 1HAZB 1OWJA 5DO4H 1W2KH 2OC7A 1O2UA 4JYUH 5T6GA 1UTJA 1BRCE 3FZZA 3T2NA 1XVMA 3UY9A 1CA0C 1GJDB 1NRQH 3F9GA 2A5KA 2GCHF 2QIQA 1LPKB 1S5SA 1ETRH 2QF0A 3E3TA 3W94A 1ESBA 1ORFA 1DLEA 2J4IA 5AF9H 1QCPA 2J94A 3BEUA 1CT4E 2XRCA 3RC4A 1QY6A 3KL6A 2DE8A 2BOHB 1BUIA 1UK2A 3MWIU 1TE0A 1EAXA 4CHAB 3SGQE 2J95A 3GCTF 4H4FA 4MG3A 1C4U2 3LGYA 4Q7ZA 2A32A 4KP0A 1GMDF 1ZSJA 4TYDA 3LIWA 4Y8YA 5CMXH 1BTZA 1HCGA 2R3YA 4FUCA 3SV9A 5AFYH 1RXPA 2BTCE 1C1VH 4ABHA 3BTDE 2ODQA 1ZLRA 1GI2A 2BB4A 3ZVBA 2PHBA 1O2ZA 2A4RA 3BTEE 2H5CA 2Z3CA 2HVXA 5F8TA 2IJOB 4D7FA 5A8YA 3LU9B 4GVUA 1TYNA 3I77A 2FOMB 1AFEH 2FWWA 4I7YH 1GI0A 2GT8A 1A5GH 1NRNH 1EASA 2OCVB 5SGAE 3GYMA 4UD9H 2VB0A 2A5IA 3SHCH 1GCTC 3M7TA 3OU0A 4X6NA 3SOSA 3AW0A 2PFEA 1FPHH 4X8UH 1OWDA 1O2IA 1TBZH 1Y3VA 3O8BA 2J92A 4IMZA 3DFJA 3ATIA 3ZZ4A 2J38A 2PGBB 3SNCA 1TAWA 2AMPA 4X1RU 3T28A 1RJXB 2QC2A 3HGNA 2BLOA 4NWKA 5PTPA 1GDQA 4M7GA 1EUFA 2XXLA 2H6MA 1E36B 1J16A 2Q6GA 4MPWA 1BITA 3RXAA 2GTBA 1FLEE 2G51A 1GBDA 1V2MT 3VGCC 1F5LA 1GPZA 2Z9JA 3VEQB 3A88A 1PPBH 1C5OH 3GY3A 1QB1A 3GDUA 3QK1A 1TGSZ 5FX6A 1K22H 3ODDA 4UE7H 4ISNA 5JBBS 1TPAE 1OYQA 1P3EA 1O32A 1F0TA 1XUKA 2O8LA 3DUXH 3ZYEA 3RLWH 1KLJH 2ZI2H 1NFWA 4A5TS 2SGFE 1PPZA 1O2OA 1XUJA 1CT2E 4A1XA 3ZZ6A 1HBTH 3U8OH 3E91A 4YOIA 2AERH 3HKJB 1EJAA 1O5FH 1XX9A 2QAAA 1WTGH 3A80A 1N6YA 2H2ZA 1V2ST