1O3PB

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 52
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3pB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3pB01
1JIMA 2Z9JA 2GCTB 2VWMA 1TGNA 2ZEBA 4HI3A 3ZVAA 1ZHPA 2B0FA 5HM9A 6GCHF 3BTEE 3A7VA 1LCYA 1CQQA 1C1NA 4OS7A 2FDAA 1ZYOA 1L4DA 1GBJA 1G3DA 2OUAA 4UE7H 1NTPA 4GCHG 2FESH 1TGSZ 1HAHH 1L4ZA 1DOJA 5JYIA 1NT1A 3F6UH 4JYVH 1W10U 2I6SA 3UNRA 1NROH 2CGAA 1T32A 2SGQE 1DXPA 4DT7B 5JBCS 3GY8A 5JB9S 1OWEA 4Y79A 1TX7A 4CHAB 5DP4A 2BLOA 3MU4A 4BOHA 7KMEH 2V3OH 1Z6JH 2GZ8A 1O2RA 1P2OA 1TWXB 3PTNA 1DANH 4DIIH 3GISB 3SI3H 1S6HA 1FLEE 1Y3XA 3U9AH 3DT0H 4YTAA 2A4GA 1TMBH 3M7TA 4AG2A 1LDTT 4CR9A 2BDAA 4HGCA 1KXAA 2QAAA 1E36B 2O8UA 1O2MA 3KQCA 4FU8A 4AFUA 1O2IA 1Q31A 4AFSA 7LPRA 2XWBI 1ZHMA 2R3YA 3DA9B 2W3KA 1WQSA 2UUKB 2H6MA 2BMGB 4K8YA 4LOYH 4AX9H 2ALVA 1HV7A 3DD2H 1OPHB 3TGKE 1G3BA 3U1JB 5K7RA 4D7FA 3PROA 3A80A 1GJBB 4YLUA 2UUJB 2A45B 2ODYB 3AW1A 1D4PB 5F03A 1HJAC 1IOEA 1GHZA 2TGAA 4JZDH 5FCKA 2PR3A 2TBSA 1QBOA 1P3EA 5A0CA 1AD8H 2BY8X 1G2MA 2VH6A 5BRRE 2ZTXA 1P10A 1QURH 1V2WT 6CHAB 1UVOA 2ODPA 1C2MA 1FY8E 5DP5A 1SSXA 3TJOA 4BANB 5L2YH 2J94A 2PTCE 1UTPA 4A5TS 2H5CA 4JCNA 4MQAA 1GI3A 2AIQA 4FUJA 3A89A 1MMJN 1OP0A 2J95A 3B8JA 5PTPA 1O3PB 1ZTJA 2BX4A 1SBWA 1T7CA 1K1PA 3GYMA 1XXFA 2IPHA 2Y7XA 1C4U2 1LHEH 4LZ4B 3BTME 4CRBA 3PM3A 3A7ZA 1C1TA 4B71A 1KY9A 2G4TA 2Y82A 4YESB 5GWZA 1IQGA 4KTUA 1RIWB 3ZVBA 1V2OT 1RTLA 1BMNH 2GGVB 3SUDA 3V12A 3JZ2B 1PYTC 4X6OA 4ABHA 7GCHG 3ZZCA 4OS4A 1MTUA 4YZUA 1H1BA 1ZPCA 1FDPA 1XUIA 1GG6C 1GWAA 1PQ7A 4CRGA 2FTLE 2FOMB 2VB0A 1U6QA 2QXHA 4O3TA 5AFYH 4O3UA 1KXCA 3TK5A 3P8NA 2ZU4A 4MNXA 1BTYA 2FI4E 1A5GH 4X6NA 3V3MA 1XVMA 1J16A 2A5IA 1MZAA 2ZFFH 1BUIA 1FN8A 2D2DA 1VZQH 1HGTH 1GI2A 3OX7U 1C2GA 5ESTE 5C5OA 1O2TA 2FTMA 3AAUA 2ZCKP 1T8NA 3UFAA 2ANYA 1LMWB 1A3BH 3BTKE 1SGFG 3BSQA 4ISLA 2GCTC 3E91A 1BDAA 1OXGA 4O9VA 1BTHH 2JH5D 1K28D 2P8OB 2SGFE 2XBYA 1Z71A 2ZA5A 1XM1A 5T6FA 4JYUH 5JPMH 2ZHWH 2VWOA 4ZHAA 1N8OC 1T4UH 1RRKA 2J9NA 2BDCA 3D65E 1ZSLA 5DP8A 5EXLA 4FVDA 2A31A 3SNCA 1HCGA 3RXOA 4OS6A 3W94A 1FIZA 1VGCB 1MTNC 4BAMB 1KXFA 4DJZB 1MKWK 1GI9B 4I8LA 3SNAA 2R0LA 3BIVH 1PFXC 2FI3E 5GXPA 1ZJDA 2F9BH 2Z9LA 1F5LA 3SW2B 4OGYA 2A7JA 4K2YA 4D9RA 3Q76A 4Q7YA 1BRBE 1IQNA 3MOCA 1ABIH 5EOKA 4THNH 2HRVA 4YLQH 3TK9A 3M36A 1GVKB 3T28A 1SLWB 1KLJH 2A2QH 1L2EA 2GMTC 1ZOMA 3TJVA 2SNWA 1SGNE 1GBAA 3T25A 1K1JA 3ZVDA 2F91A 2Z9KA 2FS8A 1ELTA 2FX4A 3TIUA 1GBTA 1OYQA 2BQ7B 2QIQA 1JMOH 4GAWA 1VITH 2ZI2H 2C4FH 1DX5M 3RXHA 1HAVB 4FUGA 4CBNA 2A4QA 3AW0A 3T27A 1W0ZU 3I78A 1GG6B 2VINA 3GYLB 1FY4A 4B76A 5DO4H 4YOIA 3RXQA 3SQHE 2ZP0H 5AHGH 3TH3H 2RA3A 5ABWA 1SC8U 2AMDA 3PV4A 3ENSB 1C1PA 1EB1H 2CV3A 1EZSC 1MUEB 4JZ1A 3BG4B 2SGEE 6LPRA 1TNKA 4LXBH 3QO6A 4JYTA 2FWWA 1O3GA 3RXMA 1SGRE 2QY0B 1ETSH 1GBBA 2ZQ2A 3A87A 1TBRH 5FX6A 2OC0A 2BOHB 3K6YA 1E35B 1HBTH 1QRXA 2GV7A 2Y7ZA 4A7IB 1P2MA 3RMOH 1P2JA 1EOLA 1MCVA 4H6TA 3GCTG 1O5BB 1XKBC 3LJOA 5JBTA 4HZHA 1CU1A 5FCRA 3MHWU 5E2OA 1A7SA 2OQUA 1O3HA 3ZZ3A 5F8XA 1P11E 1BTPA 3MI4A 2C3SA 1HAGE 4YT6H 3HKJB 3RC5A 2B9LA 1HRTH 2ZCHP 4NA7A 2EI8A 4NWLA 1S81A 2ZNKH 1EP6A 2TGTA 1RIWC 1IHTH 3KHVA 3SJIA 3U8OH 3KEEA 4A6LA 3MU1A 1ZGVA 1GBEA 1RFNA 1TGCA 5EXNA 3RMNH 1GHAG 3SV6A 3PMHB 1MBMA 3FZZA 2BVSH 3Q3YA 1ZZZA 3QWCH 7GCHF 3RXEA 2Z7FE 1O30A 1PPZA 2WPHS 2G4UA 4MPWA 1O0DH 1O5GH 1QL9A 4Y8ZA 3S7HB 1C9PA 1ZSKA 4WH8A 2ZHDA 1FUJA 2QF3A 5K0HA 2ZKSA 1TNGA 1ACBE 1K1LA 4JZIA 1AY6H 1XX9A 1BB0B 1S0RA 1DUAA 1AVWA 1BT7A 2ZPSA 3UR6A 1F0TA 2NU2E 3M5NA 4K1TA 3SUEA 2FOFA 2FOEA 1LVYA 1Y3YA 1GL0E 4NIXA 5DGJA 1D3TB 3NZIA 3I77A 1QTFA 3SU5A 2Y5FA 1BTZA 2P93A 5A8XA 3URDA 2P3UB 2UWPA 1GMCG 3UY9A 1IQFA 2AMQA 2RG3A 2FMJA 3HK3B 1G3CA 1L1GA 1TPPA 2FOAA 1AWHB 2FOBA 2FM2A 4GHQA 1P02A 1O31A 8GCHG 3A82A 1B7XB 4X1PU 5JBAS 2PKSB 4TPYA 5J4QA 1DXWA 3EE0B 1O33A 3ODDA 1CVWH 1V2KT 4UFGH 5CMXH 1LKBA 1HAIH 1GI5A 1Z8IB 1N6YA 1Y3UA 1GDNA 4ZH8A 1LVOA 2R9PA 1SHYA 3RXUA 2VIVA 4WMDA 2ODQA 4IC6A 1HAZB 3QX5H 1ELVA 2IN2A 1NU7B 2J92A 3STIA 2AS9A 1TPSA 1UTNA 1RTFB 1XMNB 4IS5A 4LZ1H 5EPYA 1VJ9U 3SJ8A 1A2CH 1MH0A 3C1KA 5DK1A 1ESTA 1EJMA 4XOJA 1ORFA 4AFZA 1TE0A 5E8EH 4H4FA 4B1TA 4FUIA 1A5HA 2YNAA 3BEFB 3ZZ4A 4CRFA 5I46H 1HUTH 1VR1H 2BHGA 1Q3XA 4U2WA 5ESBA 8ESTE 1W7XH 1O3AA 1SGCA 2DE9A 1W2KH 3GCHC 3SZNA 1V2ST 3MH5A 2BD8A 4ABJA 3SHCH 3ZYEA 1AU8A 1YLDA 2Z3DA 5F6MA 1GDQA 3STJA 3KL6A 1K21H 5A09A 1DDJA 4NWKA 1LHGH 4YOGA 2F83A 1NFYA 2OXSA 3KGPA 1QR3E 4B73A 7ESTE 3NUMA 2XBXA 1ZHRA 3NK8A 3V7TA 1ELGA 2BVRH 2Q1JA 3M3TA 4CREA 3HGPA 1GBCA 1WV7H 2PGBB 1O5CB 5AFZH 2CHAC 1ZPBA 1UTJA 1YF4A 1BHXF 1JOUB 4IBLH 3TLOA 1CBWC 1PJPA 1A4WH 1DPOA 1C5QA 2D26C 3NXPA 4Y0YE 2WPJS 4IN1A 1BHXB 2BLQA 1QY6A 4MNVA 3LGUA 4YO9A 1Z8RA 2RCEA 1FJSA 1KXEA 1G36A 1NS3A 1O3MA 2BXTH 1AFEH 3MU8A 4U32A 2BLWA 1TMTH 1YCPK 2LNCA 2SGAA 3OSYA 3VB7A 1TMUH 1DT2A 2ZGCA 5JB8S 1XUGA 1K1MA 2CN0H 1ID5H 1GBDA 4X0WU 3EA8A 3N7OA 1BMLA 4ZKNU 3T26A 3LGVA 1WBGB 2OLGA 4MTBA 4TYDA 3LGWA 2FEQH 2O8WA 4NSVA 3U8TH 3SUFA 4XSKU 3SGAE 1C2DA 2QV1A 1GHVH 1XUFA 1SB1H 3Q3XA 2A7CA 2JH0D 2ZFSA 4E06H 1ZSJA 1A0JA 3LONA 1O2UA 4Y8YA 1C1VH 1QBVH 5DG6A 2VIOA 5FAHA 1C5UA 1MD8A 1QRWA 1CO7E 2BDHA 5FBIA 2HNTE 1JRSA 2F9NA 1C5VA 1FY5A 1SG8B 3TPIZ 1S5SA 3P8OA 3RC6A 2STAE 1P57B 3QZQA 2PGQB 1EPTA 2BX3A 1AB9C 1JWTA 2WUCA 2W5EA 3T62A 3M5LA 1KTTB 4INKA 2BY6X 3SNDA 2BXUH 5HMAA 1D6WA 5F8ZA 2WUBA 1J14A 1EZXC 5EU8A 3KCGH 3SU1A 2PLXA 1K22H 4WF8A 1P2IA 4I8JA 1O2WA 2PW8H 1MTVA 4NIWA 4ABIA 1DM4B 2PWXA 2G55A 1NFUA 3S69A 1ZR0A 1YGCH 4Y6DA 1TNHA 4Y7AA 1P01A 2ZCLP 3V0XA 1ZMJA 3A7WA 1C1OA 2ZPQA 4MLFB 4TWYA 1C5LH 3PMJA 4KP0A 4TPIZ 1Z7KA 3P8FA 1SL3A 4IN2A 3M37A 1AIXH 1QFKH 3AVZA 2JETB 2C93B 3BF6H 3DHKH 4ZXXH 5TCCA 3RXCA 3UQVA 4K60A 2Z9GA 4RSPA 1QL8A 2STBE 1CHOG 4Y10E 3PWBA 4GPGA 2H2ZA 5A8YA 1DWBH 4MDSA 3GCNA 1P09A 3G01A 2AFQB 3QUMP 1RD3B 4FU7A 3L3TA 3QK1A 1QQ4A 1OP8A 2EA3A 4WMEA 1K1OA 4Y7BA 1SLVB 1P06A 3PLPA 1UK2A 5C1XA 1B5GH 1QCPA 1WUNH 2J4IA 4IC5A 3TK6A 1IQKA 3A85A 3OU0A 5A8ZA 5FPYA 1QL7A 1WU1A 2O8TA 2PSXA 4NG9H 1TRMA 1ZJKA 2I6QA 1DSTA 2AH4X 1MKXH 1SQAA 3MYWA 4KTSA 1NZQH 3QDZB 2PKAA 4U01A 4BTUB 3A7XA 2ZFRH 3TU7H 1X7AC 2ZDVH 4K3JA 3A8AA 3LT3A 4F4OC 1F5RA 4DIHH 5DP9A 1Z1IA 1CHOF 2B5TB 1O5AB 4DURA 3ZZAA 3ZVGA 1C1QA 3VB6A 1YPKH 4NSYA 1P2NA 1C5PA 2BQWB 1GI1A 4AB8A 2SGPE 1NY22 5E2PA 1JRTA 4R8TB 4FU9A 2PUQH 1W14U 2P3FH 2QN5T 3RXPA 1GPZA 1FPHH 3VB5A 3IG6B 1NPMA 3SJ9A 4AB9A 1LHFH 5C5NA 4B2AA 1P0SH 1YP9A 4MPVA 1C1UH 4MPUA 2CJIA 3TH4H 1F5KU 4X6MA 3TNSA 1LO6A 3ELAH 3ATWA 3UUZA 2GP9B 1KYNA 3UPEA 1K2I1 4E7NA 3MNSA 2EC9H 5HXFA 3F68H 1LPZB 3F1SB 1OKXA 2FYRA 2XC5A 4Q7XA 2BD5A 1LQDB 2ULLA 1V2JT 1SR5C 1GMDF 1EUFA 5DPAA 3I29A 1MTWA 3RXRA 1ZMNA 3BTFE 2F9OA 1DE7H 1GJDB 1ANCA 6CHAC 1UVUH 1GCDA 4GHTA 1DITH 1O38A 3PO1B 5FX5A 1GHWH 1TQ0B 1NC6A 3GCHB 2G5VA 3PLBA 1IHSH 1ZRKA 4GCHF 1W11U 3LC3A 2GCHF 4RN6A 1VJAU 2ZTZA 3VB4A 4DG4A 3K6ZA 1BQYA 3E90B 4Q80A 3ZZ6A 4GUXA 2VGCB 2W26A 2HGTH 4CRAA 1QJ1B 5C1YA 1GI8B 1QQUA 4X2YA 2A4OA 1W13U 3QZRA 1BBRE 4Y0ZE 3RXSA 3FFGA 2O8LA 1NFWA 1TOCB 4ABAA 1ZGIA 3KN2A 3ZZ9A 1O3IA 2SGDE 8LPRA 2QXJA 5FPTA 1SFIA 1Y3WA 2ZF0H 2ZWLH 5EXMA 3B9FH 3LU9B 1C5SA 5F8TA 4ZXYH 5LPFA 4WXIA 1GI6A 1ZLRA 1V2QT 3BV9B 4OS2A 1BRUP 3EA9A 3NPSA 2ZECA 1H9LB 1P3CA 1UCYK 3SV9A 4ZKSU 5C67A 1QJ7B 1D3QB 1DY9A 2WINI 1BA8B 2BM2A 1EB2A 1TALA 1G30B 3GDVA 6ESTA 3RP2A 1QJ6B 1N8OB 1F2SE 1WOFA 5GJ4B 3H7TA 3F9FA 1DICA 4A1XA 1CT0E 4I7YH 1O3LA 4BXSA 1PPHE 1QB1A 3F9HA 2ZU2A 1J17T 4MVNA 1YPGH 5LH8A 2BD3A 2ZU3A 4Y71A 3BG4C 1A61H 1O37A 3RXKA 1VCWA 1MCTA 3P8GA 4NIYA 1CGIE 3VB3A 1YPEH 1M9UA 3U1IB 5GDSH 2GV6A 1C2KA 3M7QA 1TPOA 1C4Y2 1ETRH 1FI8A 3MTYA 1F0SA 1AKSA 1OWJA 2F9UA 4U30A 2HLCA 1EKBB 1MBQA 3KIDU 1IQLA 3HATH 1SGIB 3SN8A 2Y5GA 3RDZA 4NA8A 3SJOA 4F49A 1UCYH 5CE1A 1AFQC 1V2TT 4A1VA 2WPKS 1BCUH 4VGCC 3ZVFA 3SQEE 3HKIB 1WTHD 5CHAB 1BMMH 1WTGH 4Q7ZA 5LGOA 1S83A 1QB9A 3ZVCA 1C5RA 1DLKB 2ANKH 4X8TH 1YLCA 4MG3A 1EAIA 3ATKA 1TLDA 4K1SA 5E0GA 2HALA 1LVBA 5DKMA 2NU3E 1V2UT 2VNTA 1BTXA 4BAQB 4SGBE 2BLVA 4CR5A 2PHBA 9ESTA 5JBBS 5HM2A 5H4IB 4MNYA 1NN6A 1V2PT 5TJXA 1GBIA 1FY1A 2PSYA 2O9QA 3LC5A 2ZDAH 1AO5A 4NIVA 1EP5A 1O3BA 3AASA 3SORA 4AZ2B 3ZZDA 1TBQH 2GTBA 1GBLA 2A5AA 4D9QA 1F0UA 3E0PB 4MPXA 4IMQA 1PPBH 1QBNA 1D3PB 4DCDA 4RKOB 4ISIH 2F9PA 2XBWA 3RXJA 3U69H 2FZZA 5EQRA 2Q6GA 1V3XA 1AMHA 4OS1A 2XXLA 3ZZ5A 3S0NA 4BTIB 2ZFQH 1HFDA 2WPMS 2ZC9H 4O03A 2P95A 1QHRB 1SLXB 1UTKA 2AERH 1V2VT 2Z6BD 1OS8A 3GY7A 2BDIA 4IMZA 1ABJH 2AGGX 4JK5A 1EXFA 3ZYDA 2GDDA 1C2LA 2WYGA 2ZPRA 5B6OA 2ASUB 2A2XH 2P59A 1FQ3A 1O2HA 4WMFA 1ELFA 1BIOA 1JBUH 1GHYH 2UWOA 1OWDA 5EW1H 1BBRK 2BD4A 3EA7A 1NM6A 2BY7X 1CA0B 3RU4T 4AN7A 1SPJA 2H1UA 3EQ0H 1O2LA 1AE8H 2FLRH 2R3UA 3PMBB 3MO9A 3EAJA 1GMHG 3M3VA 1EOJA 1VCPA 2ZHEH 1MTNB 1H9IE 3P92A 4WY3A 1TPAE 2M5TA 2V0BA 1GI4A 1CT2E 1TAWA 2Y6TA 4FUDA 4WWYA 1T31A 2QGRA 2IJOB 2Y80A 1ARBA 1CSOE 1FIWA 2BD7A 3TJUA 1WCZA 1OWHA 1RTKA 2JETC 2OD3B 1UCYE 3CP7A 4X1NU 2Y5HA 3F9GA 1TBZH 1TRNA 4AFQA 1HAPH 1ELDE 3BEUA 3SNEA 3FAOA 1C1SA 1GBFA 1AKSB 1FAKH 1O2GH 4AORA 2XC4A 1FNIA 2D8WA 3RXTA 4NA9H 2ZZUH 4I8KA 3UQOA 1O3KA 1SVPA 1THRH 1BJVA 1H8DH 1AVXA 2VH0A 2BQ6B 2C8XB 3BN9A 3HPTB 1HB0B 2QYIA 3SBKA 5L2ZH 3C27B 1NU9A 2PKAB 1HNEE 3A86A 3E1XB 1ESBA 2HPPH 3FANA 3JZ1B 5E0HA 4TY6A 1KIGH 1Z8JB 2ANWA 3UR9A 4YOJA 3RXIA 4B75A 1O5DH 1UTOA 1SGDE 1O2SA 2ESTE 3UWIA 1AFQB 4ISHH 3VXFH 1ELEE 3CS7A 1W0YH 4X8SH 3LPRA 3QLPH 1GJ8B 1HIAA 3VPKA 1PPEE 1MZDA 1OYTH 1IQMA 3GY3A 1G37A 3LGIA 3GY2A 2ZDMA 4ABEA 1AN1E 3ATIA 1GI0A 1TFXA 1O3EA 2XBVA 2VIDA 4ESTE 1GVLA 1T4VH 4KELA 5GCHG 1EAUA 3KQBA 1LHDH 4GVUA 3A84A 3EGKH 1SGTA 3ESTA 4X8UH 1EZQA 4DOQA 1CHGA 2NWNA 3MWIU 3U98H 5LPRA 1GGDB 5LPEA 3FP8E 1C5YB 2JKHA 2Q6FA 2D1JA 2TPIZ 1YM0A 1GJ4H 3P95A 4XBBA 4A1TA 3IITA 4CH2B 2Z94A 2XTTB 4FUHA 1SOTA 2ZGHA 1EPTC 1TYNA 1S6FA 1CGJE 3FP6E 1TABE 1HJ9A 1YPLH 1RXPA 1MD7A 1AHTH 1P04A 3LGTA 4K69A 5DJ7A 3P17H 2QXGA 1G9IE 2GX4A 1ZTLA 3FZDA 1IQHA 1CGHA 3E3TA 1ARCA 2EEKA 4M7GA 1MTSA 5EPNA 2QXIA 2A5KA 2HOBA 2KAIA 2OP9A 2VIWA 4X6PA 1LHCH 2BB4A 2BOKA 1L1NA 1OX1A 1GJ6A 4X8VH 5DP6A 3ZVEA 1Q2WA 2DUCA 5A0AE 4FUEA 5AF9H 3RXBA 5GCHF 2XNIA 4UFEH 1J15A 3UWJH 1O3DA 4OS5A 3KQEA 3SNBA 2B7DH 2TIOA 1TNIA 1YPMH 5C3NA 1Y5AT 2GT8A 1IQEA 1Z6EA 4FUFA 1GVZA 1AGJA 1XKAC 2VIQA 4NCYA 4NZLA 1DWCH 4ABBA 2FLBH 2SNVA 3S9AA 4ABFA 4D76A 3RLYH 1SQTA 1GMCF 3VGCB 3SGBE 2OC7A 1CBWB 1O35A 5SGAE 2BY9X 2ZFPH 3RXVA 1IQJA 4ZROA 8GCHF 4XFQA 5GPIB 3O8CA 2AYWA 9LPRA 3RXAA 3FVFB 1G3EA 3A7TA 3SU2A 4XE4A 2Z3CA 4GLYA 2UUFB 1UVPA 1F7ZA 4I8GA 5BPEA 1O32A 2BVXH 4JMYA 3RMLH 1VITF 1MKXK 1P12E 1QB6A 1PQ5A 2C8WB 1PQAA 5FPSA 1FMGA 4D8NA 3GY5A 2FPZA 5T6DA 3SO3A 1MKWH 1TA2A 3NWUA 4OGXA 4DY7B 4CHAC 5C2ZA 3SU6A 2CMYA 2ZHQH 5EQQA 1XVOA 4X1SU 1D6RA 2OBOA 5L30H 2ZFTA 1YPHE 2FOHA 2RDLA 1O2PA 3BIUH 1HJAB 2G51A 2W7UA 2Y81A 3BTHE 1GJ7B 1TX8A 4D7GA 3O8RA 1WAYB 2OTVA 3O8BA 2ZGBH 1O2OA 4NFEA 1PPFE 2CHAB 5EQSA 1O5FH 1O2NA 1HAOH 3D49H 2OC8A 3S7KB 2HNTF 1UVSH 5FBEA 3GCTF 4Q2KA 1OOKB 2PFEA 1BRCE 2BZ6H 2GT7A 4JZEH 3M35A 2W7SA 1BJUA 4NZQA 1C5ZB 1G32B 3PWCA 3UNQA 1HDTH 3A83A 3UNSA 2A0QB 1A0LA 1IAUA 4B74A 1D9IA 1AVGH 2WV5A 1B0FA 2CF8H 2PKSC 2VWLA 2QF0A 3MNBA 3PO1C 3KF2A 2ZTYA 2NU1E 1TIOA 1O2YA 1UTMA 4CRDA 1GHXH 2FXRA 2GDEH 4X1QU 4KTCA 4X2VA 4YT7H 3RMMH 2J34A 3LJJA 1GJAB 2A7HA 2FP7B 3LH1A 1O2XA 3BTTE 2H9TH 3UOUA 1GHAF 3UIRA 3R3GB 2FS9A 4FUBA 1LTOA 3UREA 4CBOA 8KME2 1NESE 5EGMA 3A8CA 2FOCA 2HWLB 1RS0A 3PYHA 1UK4A 2FI5E 3RXDA 2GD4B 1O36A 1O3CA 3GY4A 1W3CA 2V3HH 2OC1A 1KDQB 1AZZA 3OYPA 5C20A 2J2UA 5IDKA 1QNJA 1T8MA 4J2YB 1LKAA 1AUTC 1UVTH 1PPCE 1W12U 3RXGA 3GY6A 3GCOA 1ZMLA 3P6ZB 3RXFA 4A92A 1NFXA 2GVFA 3ZV9A 4ZHLU 1DY8A 3SU3A 1O3JA 1AUJA 2XCFA 1THSH 4KKDA 1H9HE 2OCVB 2PUXB 4ZKRU 2V6NA 1BMAA 1YCPH 3T2NA 1O39A 4TWWA 3VXEH 4KGAA 1E34B 5C1UA 1DSUA 3ATLA 3VEQB 1EJNA 1YPJH 1NRQH 1THPB 2HVXA 3TITA 5GIBA 1FZZA 1B0EA 2YNBA 1UO6A 1AWFH 3OTJE 3O8DA 4TY7A 4X2WA 3S9CA 1GBKA 3GOVB 1UHBA 1P9SA 1Y5BT 2SFAA 3B23B 4JK6A 1EJAA 1TA6A 1SLUB 1MQ6A 3TGJE 4BAOB 1FN6A 1WQVH 1OP2A 2H9EH 3DFLA 5L6NH 1OSSA 2THFB 1T8OA 1FPCH 3M5OA 1SOZA 2GZ9A 1NRSH 1O5EH 1SMFE 3M5MA 4X1RU 2CF9H 2TGDA 2RA0A 2ALPA 1S85A 3VGCC 2BY5X 3MO6A 1EPTB 2A4RA 2F3CE 2ZU1A 3Q00A 2NU0E 1RJXB 1Y5UT 4UDWH 1V6DA 4YM9A 2VJ1A 3SJKA 3IWMA 4AGJA 1PYTD 2ANMH 4MNWA 1A46H 1IQIA 3NKKA 4DVAU 3CS0A 1ELCA 2WV4A 2VU8E 1UTLM 1F0RA 2OBQA 1E37B 4HTCH 3SU4A 1A5IA 3MH6A 1TGBA 1SHHB 3EYDA 1P05A 4IGDA 1VITG 2J38A 4GSOA 2G00A 1O3OA 4Y8XA 1KTSB 3T5FH 1T8LA 2TGPZ 1TNLA 3ATMA 2C8YB 1XUKA 1Y3VA 2G5NA 1UK3A 1PQ8A 4X2XA 1C2HA 1XUJA 5DP7A 1P8VC 3QN7A 3RM0H 2P16A 1C5TA 1O2QA 1YYY1 3TJNA 1SQOA 3LGYA 2QA9E 1EAWA 1O3FA 1GJ5H 1QIXB 1Y59T 3BG8A 1HAVA 3ODFA 1QA0A 4VGCB 1E38B 1NRRH 3L6PA 1CE5A 1FAXA 1C5NH 4I32A 1N6XA 2AGEX 3RU4D 1BBRH 1NRPH 4XBCA 1C2FA 5JDUB 2XC0A 2BD2A 3AAVA 3Q77A 1INCA 2K1QA 1YKTA 1VGCC 4AG1A 2UUYA 4ZKOU 3BTDE 3M61U 1ESAA 3LIWA 1BTWA 4UFDH 3R0FA 5E0JA 1GHBF 3M3SA 3ZZ7A 1TB6H 1S0QA 4ABGA 1KLIH 4INLA 2ZDKA 4I8HA 2AEIH 3LOXA 1GI7B 1H4WA 1HPGA 4Z0KA 1C4V2 1OWIA 4DW2U 2ZDLA 1BRAA 3GDUA 4R0IA 3T29A 1DUEA 1Z8GA 3VFEA 1D3DB 3KQDA 2WPIS 3RM2H 4CRCA 4BAHB 4LK4A 2BYAX 1XXDA 3BTGE 1HXEH 4ABDA 1G2LA 3PLKA 4AOQA 1EASA 3ZZ8A 1K9OE 2VVCA 1DWEH 1J8AA 3HGNA 3K2UA 1AE5A 1HXFH 1V2MT 1F92A 3A8BA 2R2WU 1LPKB 1YCPM 1P9UA 1J9CH 2ZG0H 5DP3A 4UEHH 1EAXA 1C1WH 5G4BA 2GCHG 4AYYB 1QGFA 1ZTKA 1BOQA 1N1LA 1MAYA 1K1NA 4FVBA 1MU6B 1O2VA 3A88A 2OQ5A 1GCTB 3P70B 5EODA 4ZUHA 2XYAA 1ELBA 1C5OH 3E16B 2ZIQH 3K65B 1LQEA 3SUGA 1TX6A 1A0HB 1KXBA 3H7OA 3LKWA 1EQ9A 2GMTB 4WH6A 1HLTH 1TNJA 3SU0A 1PPGE 1OWKA 1L0ZA 1C2IA 1GJCB 5HGGA 3SHAH 4E7RG 1YPHC 1UMAH 1HIAB 5CHAC 2JH6D 3HK6B 4CH8B 5A0BA 1KDQA 1BITA 1MU8B 1V2RT 2EI7A 3MNCA 4H42U 3DUXH 2CXVA 2VVUA 2ZGJA 1SGQE 2G52A 4UD9H 2R2MB 5EG4A 2W3IA 1O2ZA 1VCQA 3RU4E 3NCLA 2ZDNA 4O97A 4K5ZA 2A1DB 1V2LT 2VGCC 2Z3EA 2H9HA 4UFFH 2FODA 2ZO3H 1TOMH 3OY6U 5I25A 3UOPA 3TGIE 1K1IA 1NO9H 1HJ8A 3SV2H 3TNTA 2FYQA 4BXWA 2BZAA 4FXGH 2YOLA 1DS2E 2EI6A 2B8OH 1CT4E 1KLTA 2C90B 4BAKB 3SV7A 4B2BA 1AI8H 1L1JA 2FIRH 5EW2H 3PTBA 1GCTC 4BTTB 4I33A 3H5CB 1E0FD 1C5WB 1S84A 1O3NA 3M7UA 4AGKA 3K9XB 3WY8A 1P2KA 3LDXH 4J1YA 3EDXB 3FP7E 1ANDA 4QT8C 4Z6AH 5T3HA 4Y76A 2VIPA 2Q6DA 2R0KA 1SFQB 3E6PH 4JZFH 3SI4H 4I31A 1LPGB 3Q3KA 3KNXA 1DFPA 2WPLS 3A81A 2AGIX 1RGQA 1MAXA 1C9TA 4Y11E 1QRZA 1GMDG 3TH2H 2PV9B 3BEIB 1TONA 2XRCA 5J4SA 1CA8B 1EX3A 1C1MA 5FHTA 2ZU5A 1FY3A 5TCAA 2G8TA 4IW4E 1P2QA 3BTWE 3UTUH 3SV8A 4WVPE 3MU0A 1KSNA 1ZPZA 3W95A 4SGAE 2BDGA 2FO9A 1C5XB 3MNXA 1UJ1A 1SI5H 1W8BH 1SGPE 1TGTA 1C5MD 1WSSH 3GICB 3PB1E 1YBWA 4UONA 1LVMA 2H5DA 2F9VA 2BDBA 5ETXA 1P03A 3E0NB 1YC0A 2P3TB 1CA0C 1SGFA 1W7GH 4XDEA 3QTOH 4ZMAH 4ZAEA 2V35A 1SGYE 3DFJA 4HFPB 4ISOA 2TRMA 4E05H 3TVJB 1ZRBA 1O2JA 4AYVB 2LPRA 1C2JA 2WYJA 1Y8TA 2DE8A 1A1RA 5HYOA 1DVAH 2HNTC 1ELAA 2UWLA 3MFJA 4NFFA 3LH3A 1JIRA 3QGJA 1V2NT 4BNRA 3L33A 1C2EA 1SGEE 1GL1A 5AVDA 5IYTA 2GZ7A 3A8DA 1S82A 3U8RH 2XW9A 2AIPA 1HYLA 2BTCE 2Z9IA 1Z1JA 1O34A 1GHBG 2A32A 1FXYA 3QTVH 3D23A 3ZZBA 3URCA 3ZV8A 4INHA 2P8OC 1UHBB 2PTNA 3OY5U 4H6SB 3MH4A 4WXVA 3F9EA 3MU5A 1ANBA 2NU4E 3ITIA 2G81E 1C1RA 2VWNA 3SGQE 4PROA 1NRNH 5FXLA 4K8BA 3E8LA 1TQ7B 1ETTH 1GJ9B 6GCHG 2ILNA 2KAIB 2FX6A 3D62A 3BTQE 1GDUA 1GBMA 1H8IH 2ZHFH 4ASHA 1ANEA 1FV9A 3SOSA 3RC4A 2QCYA 2GKVE 3PMAB 1GMHF 1AZ8A 2O8MA 3MMGA 1GBHA 1O2KA 4K1EA 1QA7A 2P94A 1TRYA 2ZQ1A 1EZUC 1BZXE 4WJG2 1BTUA 2XWAA 1WYKA 1GGDC 1AB9B 4XBDA 1A3EH 4DGJA 1MQ5A 3RUOA 2XCNA 3MO3A 5T6GA 1UTQA 3GDSA 4ZHMU 4B2CA 2OINA 1HAYB 3CENA 4NGAH 1XUHA 3MH7A 3RXLA 3QGNB 2C8ZB 1EATA 1DLEA 1KXDA 3RLWH 2IOTA 2AMPA 4ISNA 2HPQH 5A2MH 1HAXB 1DWDH 3V13A 2VVVA 2QC2A 2BD9A 2ZGXH 2BDYA 1JXPA 4RKJB 3A7YA 1AQ7A 2FOGA 3S9BA 4FUCA 1FONA
chains in the Genus database with same CATH superfamily
1JIMA 2Z9JA 2GCTB 2VWMA 1TGNA 2ZEBA 4HI3A 3ZVAA 1ZHPA 2B0FA 5HM9A 6GCHF 3FOAA 3BTEE 3A7VA 1LCYA 1CQQA 1C1NA 4OS7A 2FDAA 1ZYOA 1L4DA 1GBJA 3SYJA 1G3DA 2OUAA 4UE7H 1NTPA 4GCHG 2FESH 1TGSZ 1HAHH 1L4ZA 1DOJA 1E1QD 3WWBA 5JYIA 1NT1A 3F6UH 4JYVH 1W10U 2I6SA 3UNRA 1NROH 2CGAA 3AK5A 1T32A 2SGQE 1DXPA 4DT7B 5JBCS 3GY8A 5JB9S 1OWEA 4Y79A 1TX7A 3DSPA 4CHAB 5DP4A 2BLOA 3MU4A 4BOHA 7KMEH 2V3OH 1Z6JH 2GZ8A 1O2RA 1P2OA 1TWXB 3PTNA 1DANH 4DIIH 3GISB 3SI3H 1S6HA 1FLEE 1Y3XA 3U9AH 3DT0H 4YTAA 2W6JD 2A4GA 2LP6A 1TMBH 3M7TA 4AG2A 1LDTT 4CR9A 2BDAA 3WW7A 4HGCA 1NBMD 1KXAA 2QAAA 1E36B 2O8UA 1O2MA 3KQCA 4FU8A 3SZEA 4AFUA 1O2IA 2KCPA 1Q31A 4AFSA 7LPRA 2XWBI 3OEED 1ZHMA 2R3YA 3DA9B 2W3KA 1WQSA 2UUKB 2H6MA 2BMGB 4K8YA 4LOYH 4AX9H 2ALVA 1HV7A 3DD2H 1OPHB 3TGKE 1G3BA 2WV9A 3U1JB 5K7RA 4D7FA 3PROA 3A80A 1GJBB 4YLUA 2UUJB 2A45B 5DN6D 2ODYB 3AW1A 1D4PB 5F03A 1HJAC 1IOEA 1GHZA 2TGAA 4JZDH 5FCKA 2PR3A 2TBSA 1QBOA 1P3EA 5A0CA 1UW7A 1AD8H 2BY8X 1G2MA 2VH6A 5BRRE 2ZTXA 1P10A 1QURH 1V2WT 6CHAB 1UVOA 2ODPA 1C2MA 1FY8E 5DP5A 1SSXA 3TJOA 4BANB 1OHHD 5L2YH 2J94A 2PTCE 1UTPA 4A5TS 2H5CA 4JCNA 4MQAA 1GI3A 2AIQA 4FUJA 3A89A 1MMJN 1OP0A 2J95A 3B8JA 5PTPA 1O3PB 1ZTJA 2BX4A 1EFRD 1SBWA 4B6EA 1T7CA 1K1PA 3GYMA 1XXFA 2IPHA 2Y7XA 1C4U2 1LHEH 4LZ4B 3BTME 4CRBA 3PM3A 3A7ZA 1C1TA 4B71A 1KY9A 2G4TA 2Y82A 4YESB 5GWZA 3CNRA 1IQGA 4KTUA 1RIWB 3ZVBA 3NRLA 1V2OT 1RTLA 1BMNH 2GGVB 3SUDA 3V12A 2YMSD 3JZ2B 1PYTC 3U28C 4X6OA 4ABHA 7GCHG 3ZZCA 4OS4A 1MTUA 4YZUA 1H1BA 1ZPCA 5KECA 1FDPA 1XUIA 1GG6C 3OTPA 1GWAA 1PQ7A 4CRGA 2FTLE 2FOMB 2VB0A 1U6QA 2QXHA 4O3TA 5AFYH 4O3UA 1KXCA 3TK5A 2IPQX 3P8NA 2ZU4A 4MNXA 1BTYA 2FI4E 1A5GH 4X6NA 3N7DA 3V3MA 1XVMA 1J16A 2A5IA 4YXWD 1MZAA 2ZFFH 4FETA 1BUIA 1FN8A 2D2DA 1VZQH 1HGTH 1GI2A 3OX7U 1C2GA 5ESTE 5C5OA 1O2TA 2FTMA 3AAUA 2ZCKP 1T8NA 3UFAA 2ANYA 2JDID 1LMWB 1A3BH 3BTKE 1SGFG 3BSQA 4ISLA 2GCTC 3E91A 1BDAA 1OXGA 4O9VA 1BTHH 2JH5D 1K28D 2P8OB 2SGFE 2XBYA 1Z71A 2ZA5A 1XM1A 5T6FA 4JYUH 5JPMH 2ZHWH 2VWOA 4ZHAA 1N8OC 1T4UH 1RRKA 2J9NA 2BDCA 3D65E 1ZSLA 5DP8A 5EXLA 4FVDA 2A31A 2XOKD 3SNCA 1HCGA 3RXOA 4OS6A 3W94A 1FIZA 1VGCB 1MTNC 5HIZA 4BAMB 1KXFA 4DJZB 1MKWK 3UAIC 1GI9B 4I8LA 2RDEA 3SNAA 2R0LA 3BIVH 1PFXC 2FI3E 2KX4A 5GXPA 1MABB 1ZJDA 2F9BH 2Z9LA 1F5LA 2HLDD 5FL7D 4OGYA 3SW2B 2A7JA 4K2YA 4D9RA 3Q76A 4Q7YA 1BRBE 1IQNA 3MOCA 1ABIH 5EOKA 4THNH 2HRVA 4YLQH 3TK9A 3M36A 1GVKB 3T28A 1SLWB 1KLJH 2A2QH 1L2EA 2GMTC 1ZOMA 3TJVA 2SNWA 1SGNE 2V7QD 1GBAA 3T25A 1K1JA 3ZVDA 2F91A 2Z9KA 2FS8A 1ELTA 2FX4A 3TIUA 1GBTA 1OYQA 2BQ7B 2QIQA 1JMOH 4GAWA 1VITH 2ZI2H 2C4FH 1DX5M 3RXHA 1HAVB 4FUGA 4CBNA 2A4QA 3AW0A 3T27A 1W0ZU 3I78A 1GG6B 2VINA 3GYLB 1FY4A 4B76A 5DO4H 4YOIA 3RXQA 3SQHE 1YWUA 2ZP0H 5AHGH 3TH3H 2RA3A 5ABWA 1SC8U 2AMDA 3PV4A 3ENSB 2KCAA 1C1PA 1EB1H 2CV3A 4P00A 1EZSC 1MUEB 4JZ1A 4TSFD 3BG4B 2SGEE 6LPRA 1TNKA 5DSFA 4LXBH 2KR7A 3QO6A 4JYTA 2FWWA 1O3GA 3RXMA 1SGRE 2QY0B 1ETSH 1GBBA 2ZQ2A 3A87A 1TBRH 5FX6A 2OC0A 2BOHB 3K6YA 1E35B 1HBTH 1QRXA 2GV7A 2Y7ZA 4A7IB 1P2MA 3RMOH 1P2JA 1EOLA 1MCVA 1E1RD 4H6TA 3GCTG 1O5BB 1XKBC 3LJOA 5JBTA 4HZHA 1CU1A 5FCRA 3MHWU 5E2OA 1A7SA 2OQUA 1O3HA 3ZZ3A 5F8XA 1P11E 1BTPA 3MI4A 2C3SA 1HAGE 4YT6H 3HKJB 3RC5A 2B9LA 1HRTH 2ZCHP 4NA7A 2EI8A 4DT4A 4NWLA 1S81A 2ZNKH 1EP6A 2TGTA 1RIWC 1IHTH 3KHVA 3SJIA 3U8OH 3KEEA 4A6LA 3MU1A 1ZGVA 1GBEA 4ASUD 1RFNA 1TGCA 5EXNA 3RMNH 1GHAG 3SV6A 3PMHB 1MBMA 3FZZA 2BVSH 3Q3YA 1ZZZA 3QWCH 7GCHF 3RXEA 2Z7FE 1O30A 1BMFD 1PPZA 2WPHS 2G4UA 4MPWA 1O0DH 1O5GH 1QL9A 4Y8ZA 3S7HB 1C9PA 1ZSKA 2L6OA 4WH8A 2ZHDA 1FUJA 2QF3A 5K0HA 2ZKSA 1TNGA 1ACBE 1K1LA 4JZIA 1AY6H 1XX9A 1BB0B 1S0RA 1DUAA 1AVWA 1BT7A 2KZ4A 2ZPSA 3UR6A 1F0TA 2NU2E 3M5NA 4K1TA 3SUEA 2FOFA 2FOEA 1LVYA 1Y3YA 1GL0E 4NIXA 5DGJA 1D3TB 3GS9A 3NZIA 3I77A 1QTFA 3SU5A 2Y5FA 1BTZA 2P93A 5A8XA 3URDA 2P3UB 2UWPA 1GMCG 3UY9A 1IQFA 2AMQA 2RG3A 1E79D 2FMJA 3HK3B 1G3CA 1L1GA 1TPPA 2FOAA 1AWHB 2FOBA 2FM2A 4GHQA 1P02A 1O31A 8GCHG 3A82A 1B7XB 4X1PU 5JBAS 2PKSB 4TPYA 5J4QA 1DXWA 4Z1MD 3EE0B 1WXRA 1O33A 3ODDA 1CVWH 1V2KT 4UFGH 3PV5A 5CMXH 1LKBA 1HAIH 1GI5A 1Z8IB 1N6YA 1Y3UA 1GDNA 4ZH8A 1LVOA 2R9PA 1SHYA 3RXUA 4RT0A 2VIVA 4WMDA 2ODQA 4IC6A 5EJLA 1HAZB 1S6LA 3QX5H 1ELVA 2IN2A 1NU7B 2J92A 2KCYA 3STIA 2AS9A 1TPSA 1UTNA 1RTFB 1XMNB 2WHXA 4IS5A 4LZ1H 5EPYA 1VJ9U 3SJ8A 1A2CH 1MH0A 3C1KA 5DK1A 1ESTA 1EJMA 4XOJA 1ORFA 4AFZA 1TE0A 5E8EH 4H4FA 2JJ1D 4B1TA 4FUIA 1A5HA 2YNAA 3BEFB 3ZZ4A 4CRFA 5I46H 1HUTH 1VR1H 2BHGA 1Q3XA 4U2WA 5ESBA 8ESTE 1W7XH 1O3AA 1SGCA 2DE9A 1W2KH 3GCHC 1K0HA 3SZNA 1V2ST 3MH5A 2BD8A 4ABJA 3SHCH 3ZYEA 1AU8A 1YLDA 2Z3DA 5F6MA 1GDQA 3STJA 3KL6A 1K21H 5A09A 1DDJA 4NWKA 1LHGH 4YOGA 2F83A 1NFYA 2OXSA 3KGPA 1QR3E 4B73A 7ESTE 3NUMA 2XBXA 1ZHRA 3NK8A 3V7TA 1ELGA 2BVRH 2Q1JA 3M3TA 4CREA 3HGPA 1GBCA 1WV7H 2PGBB 1O5CB 5AFZH 2CHAC 1ZPBA 1UTJA 1YF4A 1BHXF 3F2GA 1JOUB 4IBLH 3TLOA 1CBWC 1PJPA 1A4WH 1DPOA 1C5QA 2D26C 3NXPA 4Y0YE 2WPJS 4FOUC 4IN1A 1BHXB 2BLQA 1QY6A 4MNVA 3LGUA 4YO9A 1Z8RA 2RCEA 1FJSA 1KXEA 1G36A 1NS3A 1O3MA 2BXTH 1AFEH 3MU8A 4U32A 2BLWA 1TMTH 1YCPK 2LNCA 2SGAA 3OSYA 5GNDA 3VB7A 1TMUH 1DT2A 2ZGCA 5JB8S 1XUGA 1K1MA 2CN0H 1ID5H 1GBDA 4X0WU 3EA8A 3N7OA 1BMLA 4ZKNU 3T26A 3LGVA 1WBGB 2OLGA 4MTBA 3OAAD 4TYDA 3LGWA 2FEQH 2O8WA 4NSVA 3U8TH 3SUFA 4XSKU 3SGAE 1C2DA 2QV1A 1GHVH 1XUFA 1SB1H 3Q3XA 2A7CA 2JH0D 2ZFSA 4E06H 1ZSJA 2OK5A 1A0JA 3LONA 1O2UA 4Y8YA 1C1VH 1QBVH 5DG6A 2VIOA 5FAHA 1C5UA 1MD8A 1QRWA 1CO7E 2BDHA 5FBIA 2HNTE 1JRSA 2F9NA 1C5VA 1FY5A 1SG8B 3TPIZ 1S5SA 3P8OA 3RC6A 2STAE 1P57B 3QZQA 2PGQB 1EPTA 2BX3A 1AB9C 1JWTA 2WUCA 2W5EA 3T62A 3M5LA 1KTTB 4INKA 2BY6X 3SNDA 2BXUH 5HMAA 1D6WA 5F8ZA 2WUBA 1J14A 1EZXC 5EU8A 3KCGH 3SU1A 2PLXA 1K22H 4WF8A 1P2IA 4I8JA 1O2WA 2PW8H 1MTVA 4NIWA 4ABIA 1DM4B 2PWXA 2G55A 1NFUA 3S69A 1ZR0A 1YGCH 4Y6DA 1TNHA 4Y7AA 3F2FA 1P01A 4OM9A 2ZCLP 3V0XA 1ZMJA 2KM0A 3A7WA 1C1OA 2ZPQA 4MLFB 4TWYA 1C5LH 3PMJA 4KP0A 5HIYA 4TPIZ 1Z7KA 3P8FA 1SL3A 4IN2A 1SQRA 1AIXH 1QFKH 3AVZA 3M37A 2JETB 2C93B 3BF6H 3DHKH 4ZXXH 5TCCA 3RXCA 3UQVA 3FN8A 4K60A 5C17A 2Z9GA 4RSPA 1QL8A 2STBE 1CHOG 4M9FA 4Y10E 3PWBA 4GPGA 3UB0A 2H2ZA 5A8YA 1DWBH 4MDSA 3GCNA 1P09A 3G01A 2AFQB 3QUMP 1RD3B 4FU7A 5EJZA 3L3TA 3QK1A 1QQ4A 1OP8A 2EA3A 4WMEA 1K1OA 4Y7BA 1SLVB 1P06A 3PLPA 1UK2A 5C1XA 1B5GH 1QCPA 1WUNH 2J4IA 4IC5A 3TK6A 3PRBA 1FX0B 1IQKA 3A85A 3OU0A 5A8ZA 5FPYA 3W1EA 1QL7A 1WU1A 2M2AA 2O8TA 2PSXA 4NG9H 1TRMA 1ZJKA 2I6QA 1DSTA 2AH4X 1MKXH 1SQAA 3MYWA 3KYGA 3N7EA 4KTSA 1NZQH 3QDZB 1W0JD 2PKAA 4U01A 2W6ID 3A7XA 3N99A 4BTUB 2ZFRH 3TU7H 1X7AC 2ZDVH 4K3JA 3A8AA 3LT3A 4F4OC 1F5RA 4DIHH 5DP9A 1Z1IA 1CHOF 2B5TB 1O5AB 4DURA 3ZZAA 3ZVGA 1C1QA 3VB6A 1YPKH 4NSYA 1P2NA 1C5PA 2BQWB 1GI1A 4AB8A 1H8ED 2SGPE 2QF4A 1NY22 5E2PA 1JRTA 4R8TB 4FU9A 2PUQH 1W14U 2P3FH 2QN5T 4XD7D 3RXPA 1GPZA 1FPHH 3VB5A 3IG6B 1NPMA 3SJ9A 4AB9A 1LHFH 5C5NA 4B2AA 1P0SH 1YP9A 4MPVA 1C1UH 4MPUA 2CJIA 3TH4H 1F5KU 4X6MA 3TNSA 1LO6A 3ELAH 3ATWA 3UUZA 2GP9B 1KYNA 3UPEA 1K2I1 4E7NA 3MNSA 2EC9H 2XNDD 5HXFA 3F68H 1LPZB 3F1SB 1OKXA 2FYRA 2XC5A 4Q7XA 2BD5A 1LQDB 2ULLA 3VG8A 1V2JT 1SR5C 1GMDF 1EUFA 5DPAA 3I29A 1MTWA 3RXRA 1ZMNA 3BTFE 2F9OA 1DE7H 1GJDB 1ANCA 6CHAC 1UVUH 1GCDA 4GHTA 1DITH 1O38A 3PO1B 2JIZD 5FX5A 1GHWH 1TQ0B 1NC6A 3GCHB 2G5VA 3PLBA 1IHSH 1ZRKA 4GCHF 1W11U 3LC3A 2GCHF 4RN6A 1VJAU 2ZTZA 3VB4A 4DG4A 3K6ZA 1BQYA 3E90B 4Q80A 3ZZ6A 4GUXA 2VGCB 2W26A 2HGTH 4CRAA 3MQKC 1QJ1B 5C1YA 1GI8B 1QQUA 4X2YA 2A4OA 1W13U 3QZRA 1BBRE 4Y0ZE 3RXSA 3FFGA 2O8LA 1NFWA 1TOCB 4ABAA 1ZGIA 4ZCNA 3KN2A 3ZZ9A 1O3IA 2SGDE 8LPRA 2QXJA 5FPTA 1SFIA 1Y3WA 2ZF0H 2ZWLH 5EXMA 3B9FH 3LU9B 1C5SA 5F8TA 4ZXYH 5LPFA 4WXIA 1GI6A 1ZLRA 1V2QT 3BV9B 4OS2A 1BRUP 3EA9A 3NPSA 2ZECA 1H9LB 1P3CA 1UCYK 3SV9A 4ZKSU 5C67A 1QJ7B 1D3QB 1DY9A 2WINI 1BA8B 2BM2A 1EB2A 1TALA 1G30B 3GDVA 6ESTA 3RP2A 1QJ6B 1N8OB 1F2SE 1WOFA 5GJ4B 3H7TA 3F9FA 1DICA 4A1XA 1CT0E 4I7YH 1O3LA 4BXSA 1PPHE 1QB1A 3DSGA 3F9HA 2ZU2A 1J17T 4MVNA 1YPGH 1VKYA 5LH8A 2BD3A 2ZU3A 4Y71A 3BG4C 4B6FA 1A61H 1O37A 2L74A 3RXKA 1VCWA 1MCTA 3P8GA 2IJD1 4NIYA 1CGIE 3VB3A 1YPEH 1M9UA 3U1IB 5GDSH 2GV6A 1C2KA 2J5UA 3M7QA 1TPOA 1C4Y2 1ETRH 1FI8A 3MTYA 1F0SA 1AKSA 1OWJA 2F9UA 4U30A 2HLCA 1EKBB 1MBQA 3KIDU 1IQLA 3HATH 1SGIB 3SN8A 2Y5GA 3RDZA 4NA8A 3SJOA 1QZ8A 4F49A 1UCYH 5CE1A 1AFQC 1V2TT 4A1VA 2WPKS 1BCUH 4VGCC 3ZVFA 3SQEE 3HKIB 1WTHD 5CHAB 1BMMH 2WPDD 1WTGH 5CHBA 4Q7ZA 5LGOA 1S83A 1QB9A 3ZVCA 1C5RA 1DLKB 2ANKH 4X8TH 1YLCA 4MG3A 1EAIA 3ATKA 1TLDA 4K1SA 5E0GA 2HALA 1LVBA 5DKMA 2NU3E 1V2UT 2VNTA 1BTXA 4BAQB 4SGBE 2BLVA 4CR5A 2PHBA 9ESTA 5JBBS 5HM2A 5H4IB 4MNYA 1NN6A 1V2PT 5TJXA 1GBIA 1FY1A 2PSYA 2O9QA 3LC5A 2ZDAH 1AO5A 4NIVA 1EP5A 1O3BA 3AASA 3SORA 4AZ2B 3ZZDA 1TBQH 2GTBA 1GBLA 2A5AA 4D9QA 1F0UA 3E0PB 4MPXA 4IMQA 1PPBH 1QBNA 1D3PB 4DCDA 4RKOB 4ISIH 2F9PA 2XBWA 3RXJA 3U69H 2FZZA 5EQRA 2Q6GA 1V3XA 1AMHA 4OS1A 2XXLA 4TT3D 3ZZ5A 3S0NA 4BTIB 2ZFQH 1HFDA 2WPMS 2ZC9H 4O03A 2P95A 1QHRB 1SLXB 1UTKA 2AERH 1V2VT 2Z6BD 1OS8A 3GY7A 2BDIA 4IMZA 1ABJH 2AGGX 4JK5A 1EXFA 3ZYDA 2GDDA 1C2LA 2WYGA 2ZPRA 5B6OA 2ASUB 2A2XH 2P59A 1FQ3A 1O2HA 4WMFA 1ELFA 1BIOA 1JBUH 1GHYH 2UWOA 1OWDA 5EW1H 1BBRK 2BD4A 4Q63A 2GJGA 1YY3A 1NM6A 3EA7A 2BY7X 1CA0B 3RU4T 2QF5A 4AN7A 1SPJA 2H1UA 3EQ0H 1O2LA 1AE8H 2FLRH 2R3UA 3PMBB 3MO9A 4RI0A 3EAJA 1GMHG 5T1VA 3M3VA 1EOJA 1VCPA 2ZHEH 1MTNB 1H9IE 3P92A 4WY3A 1TPAE 2M5TA 2V0BA 5C0TA 1GI4A 1CT2E 1TAWA 2Y6TA 4FUDA 4WWYA 1T31A 2QGRA 2IJOB 2Y80A 1ARBA 1CSOE 1FIWA 2BD7A 3TJUA 1WCZA 1OWHA 1RTKA 2JETC 2OD3B 1UCYE 3CP7A 4X1NU 2Y5HA 3F9GA 1TBZH 1TRNA 4AFQA 1HAPH 1ELDE 3BEUA 3SNEA 3FAOA 1C1SA 1GBFA 1AKSB 1FAKH 1O2GH 4AORA 2XC4A 1FNIA 2D8WA 3RXTA 4NA9H 2ZZUH 2J98A 4I8KA 3UQOA 1O3KA 1SVPA 1THRH 1BJVA 1H8DH 1AVXA 2VH0A 2BQ6B 2C8XB 3BN9A 3HPTB 1HB0B 2QYIA 3SBKA 5L2ZH 5KGOA 3C27B 1NU9A 2PKAB 1HNEE 3A86A 3E1XB 1ESBA 2HPPH 3FANA 3JZ1B 5E0HA 2F4LA 4TY6A 1KIGH 1Z8JB 2ANWA 3UR9A 4YOJA 3RXIA 4B75A 1O5DH 1UTOA 1SGDE 1O2SA 5B6LA 2ESTE 3UWIA 1AFQB 4ISHH 3VXFH 1ELEE 3CS7A 1W0YH 4X8SH 3LPRA 3QLPH 1GJ8B 2F43B 1HIAA 3VPKA 1PPEE 1MZDA 1OYTH 1IQMA 2K8IA 3GY3A 1G37A 3LGIA 3GY2A 2ZDMA 4ABEA 1AN1E 3ATIA 1GI0A 1TFXA 1O3EA 2XBVA 2VIDA 4ESTE 1GVLA 1T4VH 4KELA 5GCHG 1EAUA 3KQBA 1LHDH 4GVUA 3A84A 3EGKH 1SGTA 3ESTA 4X8UH 1EZQA 4DOQA 1CHGA 2NWNA 3MWIU 3U98H 5LPRA 1GGDB 5LPEA 3FP8E 1C5YB 2JKHA 2Q6FA 2D1JA 2TPIZ 1YM0A 1GJ4H 3P95A 4XBBA 4A1TA 3IITA 4CH2B 2Z94A 2XTTB 4FUHA 1SOTA 2ZGHA 1EPTC 1TYNA 2YMSC 1YLNA 1S6FA 1CGJE 4XRNA 3FP6E 1TABE 1HJ9A 1YPLH 1RXPA 1MD7A 1AHTH 1P04A 3LGTA 4K69A 3KQ5A 5DJ7A 3P17H 2QXGA 1G9IE 2GX4A 1ZTLA 3FZDA 1IQHA 1CGHA 3E3TA 1ARCA 2EEKA 4M7GA 1MTSA 5EPNA 2QXIA 2A5KA 2HOBA 2KAIA 2OP9A 2VIWA 4X6PA 5C94A 1LHCH 2BB4A 2BOKA 1L1NA 1OX1A 2EQNA 1GJ6A 4X8VH 5DP6A 3ZVEA 1Q2WA 2DUCA 5A0AE 4FUEA 5AF9H 3RXBA 5GCHF 2XNIA 4UFEH 1J15A 3UWJH 1O3DA 4OS5A 3KQEA 3SNBA 2B7DH 2TIOA 2HVYB 1TNIA 1YPMH 5C3NA 1Y5AT 2GT8A 1IQEA 1Z6EA 4FUFA 1GVZA 1AGJA 1XKAC 2VIQA 4NCYA 4NZLA 1DWCH 4ABBA 2FLBH 2SNVA 3S9AA 4ABFA 4D76A 3RLYH 1SQTA 1GMCF 3VGCB 3SGBE 2OC7A 1CBWB 1O35A 5SGAE 2BY9X 2ZFPH 3RXVA 1IQJA 4ZROA 8GCHF 4XFQA 5GPIB 3O8CA 2AYWA 9LPRA 3RXAA 3FVFB 1G3EA 3A7TA 3SU2A 1COWD 4XE4A 2Z3CA 4GLYA 2UUFB 1UVPA 1F7ZA 4I8GA 5BPEA 1O32A 2BVXH 4JMYA 4F48B 3RMLH 1VITF 1MKXK 1P12E 1QB6A 4ACAA 1PQ5A 2C8WB 1PQAA 5FPSA 1FMGA 4D8NA 2WZQA 2FPZA 3GY5A 5T6DA 3SO3A 1MKWH 1TA2A 3NWUA 4OGXA 4DY7B 4CHAC 5C2ZA 3SU6A 1NBME 2CMYA 2ZHQH 5EQQA 3OE7D 1XVOA 4X1SU 1D6RA 2OBOA 5L30H 2ZFTA 1YPHE 2FOHA 2RDLA 1O2PA 3BIUH 1HJAB 2G51A 2W7UA 2Y81A 3BTHE 1GJ7B 1TX8A 4D7GA 3O8RA 1WAYB 2OTVA 3O8BA 2ZGBH 1O2OA 4NFEA 1PPFE 2CHAB 5EQSA 1O5FH 1O2NA 1HAOH 3D49H 2OC8A 2AHME 3S7KB 2HNTF 3F0PA 1UVSH 5FBEA 3GCTF 2EY4C 4Q2KA 1OOKB 2PFEA 1BRCE 2BZ6H 2GT7A 4JZEH 3M35A 2W7SA 1BJUA 4NZQA 1C5ZB 1G32B 3PWCA 3UNQA 1HDTH 3A83A 3UNSA 2A0QB 1A0LA 1IAUA 4B74A 1D9IA 1AVGH 2WV5A 1B0FA 2CF8H 2PKSC 2VWLA 2QF0A 3MNBA 3PO1C 3KF2A 2ZTYA 2NU1E 5C0UA 1TIOA 1O2YA 1UTMA 4CRDA 1GHXH 2FXRA 2GDEH 4X1QU 4KTCA 4X2VA 4YT7H 3RMMH 2J34A 3LJJA 1GJAB 2A7HA 2FP7B 3LH1A 5KEDA 1O2XA 3BTTE 2H9TH 3UOUA 1GHAF 3UIRA 3R3GB 2FS9A 5CDFE 2PP6A 4FUBA 1LTOA 3UREA 4CBOA 8KME2 4RT1A 1NESE 4ACBA 5EGMA 3A8CA 2FOCA 2HWLB 1RS0A 3PYHA 1UK4A 2FI5E 3RXDA 2GD4B 2WSSD 1O36A 1O3CA 3FO8D 3GY4A 1W3CA 2OC1A 2V3HH 1KDQB 1AZZA 3OYPA 5C20A 2J2UA 5IDKA 1QNJA 1T8MA 4J2YB 1LKAA 1AUTC 1UVTH 5EIYA 1PPCE 1W12U 3RXGA 3GY6A 3GCOA 1ZMLA 3P6ZB 3RXFA 4A92A 1NFXA 2GVFA 3ZV9A 4ZHLU 1DY8A 3SU3A 1O3JA 1AUJA 2XCFA 1THSH 2YMSB 1H9HE 2OCVB 2PUXB 4KKDA 4ZKRU 2VBCA 2V6NA 1BMAA 1YCPH 3T2NA 1O39A 4TWWA 3VXEH 4KGAA 1E34B 5C1UA 1DSUA 3ATLA 3VEQB 1EJNA 1YPJH 1NRQH 1THPB 2HVXA 2RFKC 3F3BA 3TITA 5GIBA 1FZZA 1B0EA 2YNBA 1UO6A 1AWFH 3FKSD 3OTJE 3O8DA 4TY7A 4X2WA 3S9CA 1GBKA 3GOVB 1UHBA 1P9SA 1Y5BT 2SFAA 3B23B 4JK6A 1EJAA 1TA6A 1SLUB 1MQ6A 3TGJE 4BAOB 1FN6A 1WQVH 1OP2A 2H9EH 3DFLA 3ZIAD 5L6NH 1OSSA 2THFB 1T8OA 1FPCH 3M5OA 1SOZA 2GZ9A 1NRSH 1O5EH 1SMFE 3M5MA 4X1RU 2CF9H 2TGDA 2RA0A 5IK2D 2QE7D 2ALPA 1S85A 3VGCC 2BY5X 3MO6A 2J98B 1EPTB 2A4RA 2F3CE 2ZU1A 3Q00A 2NU0E 1RJXB 1Y5UT 4UDWH 1V6DA 4YM9A 2VJ1A 3SJKA 3H09A 3IWMA 4AGJA 1PYTD 2ANMH 4MNWA 1A46H 1IQIA 3NKKA 4DVAU 3CS0A 1ELCA 2WV4A 2VU8E 1UTLM 1F0RA 2OBQA 1E37B 1WDIA 4HTCH 3SU4A 1A5IA 2JJ2D 3MH6A 1TGBA 3WWFA 1SHHB 1SKYE 3EYDA 5EJ1A 1P05A 4IGDA 1VITG 2J38A 4GSOA 2G00A 1O3OA 4Y8XA 1KTSB 3T5FH 1T8LA 2TGPZ 1TNLA 3ATMA 2C8YB 1XUKA 1Y3VA 2G5NA 1UK3A 4HG6A 1PQ8A 4X2XA 1C2HA 1XUJA 5DP7A 1P8VC 3QN7A 3RM0H 2P16A 1C5TA 1O2QA 1YYY1 3TJNA 1SQOA 3LGYA 2QA9E 1EAWA 1O3FA 1GJ5H 1QIXB 1Y59T 3BG8A 1HAVA 3ODFA 1QA0A 4VGCB 1E38B 1NRRH 3L6PA 1CE5A 1FAXA 1C5NH 4I32A 1N6XA 2AGEX 3RU4D 1BBRH 1NRPH 4XBCA 1C2FA 5JDUB 4AC9A 2XC0A 2J97A 2BD2A 3AAVA 3PRDA 3Q77A 1INCA 2K1QA 2KFWA 1YKTA 1VGCC 4AG1A 2UUYA 4ZKOU 3BTDE 3M61U 1ESAA 3LIWA 1BTWA 4UFDH 5F53A 3R0FA 5E0JA 1GHBF 3M3SA 3ZZ7A 1TB6H 1S0QA 4ABGA 1KLIH 4INLA 2ZDKA 4I8HA 2AEIH 3LOXA 1GI7B 1H4WA 1HPGA 3F2HA 4Z0KA 1C4V2 1OWIA 4DW2U 2ZDLA 1BRAA 3GDUA 4R0IA 3T29A 1DUEA 1Z8GA 3VFEA 1D3DB 3KQDA 2WPIS 3RM2H 4CRCA 4BAHB 4LK4A 2BYAX 1XXDA 3BTGE 1HXEH 4ABDA 1G2LA 3PLKA 4AOQA 1EASA 3ZZ8A 1K9OE 2VVCA 1DWEH 1J8AA 3HGNA 3K2UA 1AE5A 1HXFH 1V2MT 1F92A 3A8BA 2R2WU 1LPKB 1YCPM 3EE7A 1P9UA 1J9CH 2ZG0H 5DP3A 4UEHH 1EAXA 1C1WH 5G4BA 2GCHG 4AYYB 1QGFA 1ZTKA 2KCOA 1BOQA 1N1LA 1MAYA 1K1NA 4FVBA 1MU6B 1O2VA 3A88A 2OQ5A 1GCTB 3P70B 5EODA 4ZUHA 2XYAA 1ELBA 1C5OH 3E16B 2ZIQH 3K65B 1LQEA 3SUGA 1TX6A 3F0OA 1A0HB 1KXBA 3H7OA 3LKWA 1EQ9A 2GMTB 4WH6A 1HLTH 1TNJA 3SU0A 1PPGE 1OWKA 1L0ZA 1C2IA 1GJCB 5HGGA 3KYFA 3PV2A 3SHAH 4E7RG 1YPHC 1UMAH 1HIAB 5CHAC 2JH6D 3HK6B 4CH8B 5A0BA 1KDQA 1BITA 1MU8B 1V2RT 2EI7A 3MNCA 4H42U 3DUXH 2CXVA 4Q4LA 2VVUA 2ZGJA 1SGQE 2G52A 4UD9H 2R2MB 5EG4A 2W3IA 1O2ZA 1VCQA 4P02A 3NCLA 3RU4E 2ZDNA 2LELA 4O97A 4K5ZA 2A1DB 1V2LT 2VGCC 2Z3EA 2H9HA 4UFFH 2FODA 2ZO3H 1TOMH 3OY6U 5I25A 3UOPA 3TGIE 1K1IA 1NO9H 1HJ8A 3SV2H 3TNTA 2FYQA 1H8HD 4BXWA 2BZAA 4FXGH 2YOLA 1DS2E 2EI6A 2B8OH 1CT4E 1KLTA 2C90B 4BAKB 3SV7A 4B2BA 1AI8H 1L1JA 2FIRH 5EW2H 3PTBA 1GCTC 4BTTB 4I33A 3H5CB 1E0FD 1C5WB 1S84A 1O3NA 3M7UA 4AGKA 3K9XB 3WY8A 3DCLA 1P2KA 1KMHB 3OEHD 3LDXH 4J1YA 3EDXB 3FP7E 1ANDA 4QT8C 4Z6AH 5T3HA 4Y76A 2VIPA 2Q6DA 2R0KA 1SFQB 3E6PH 4JZFH 3SI4H 4I31A 1LPGB 3Q3KA 3KNXA 1DFPA 2WPLS 3A81A 2AGIX 1RGQA 1MAXA 1C9TA 4Y11E 1QRZA 1GMDG 3TH2H 2PV9B 3BEIB 1TONA 2K0QA 3DSOA 2XRCA 5J4SA 2V3MA 1CA8B 1EX3A 1C1MA 5FHTA 2ZU5A 1FY3A 5TCAA 2G8TA 4IW4E 2CK3D 1P2QA 3BTWE 3UTUH 3SV8A 4WVPE 3MU0A 1KSNA 1ZPZA 3W95A 4SGAE 2BDGA 2FO9A 1C5XB 3MNXA 1UJ1A 1SI5H 1W8BH 1SGPE 1TGTA 1C5MD 1WSSH 3GICB 3PB1E 1YBWA 4UONA 1LVMA 1W0KD 2H5DA 2F9VA 2BDBA 5ETXA 1P03A 3E0NB 1YC0A 2P3TB 1CA0C 1SGFA 1W7GH 4XDEA 3QTOH 4ZMAH 4ZAEA 2V35A 1SGYE 3DFJA 4HFPB 5HKKD 4ISOA 2TRMA 4E05H 3TVJB 1ZRBA 1O2JA 4AYVB 2LPRA 1C2JA 2WYJA 1Y8TA 2DE8A 1A1RA 5HYOA 1DVAH 2HNTC 1ELAA 2UWLA 3MFJA 4NFFA 3LH3A 1JIRA 3QGJA 1V2NT 4BNRA 3L33A 1C2EA 1SGEE 1GL1A 5AVDA 5IYTA 2GZ7A 3A8DA 1S82A 3U8RH 2XW9A 2AIPA 1HYLA 2BTCE 2Z9IA 1Z1JA 4I86A 1O34A 1GHBG 2A32A 1FXYA 3QTVH 3D23A 3ZZBA 3URCA 3ZV8A 4INHA 2P8OC 1UHBB 2PTNA 3OY5U 4H6SB 3MH4A 4WXVA 3F9EA 3MU5A 1ANBA 2NU4E 3ITIA 2G81E 1C1RA 2VWNA 3SGQE 4PROA 1NRNH 5FXLA 4K8BA 3E8LA 1TQ7B 1ETTH 3OFND 1GJ9B 6GCHG 2ILNA 2KAIB 2FX6A 3D62A 3BTQE 4F55A 1GDUA 1GBMA 1H8IH 2ZHFH 4ASHA 1ANEA 1FV9A 3SOSA 3RC4A 2QCYA 2GKVE 3PMAB 1GMHF 1AZ8A 2O8MA 3MMGA 1GBHA 1O2KA 4K1EA 2P94A 1QA7A 1TRYA 2ZQ1A 1EZUC 1BZXE 4WJG2 1BTUA 2XWAA 1WYKA 1GGDC 1AB9B 4XBDA 1A3EH 4DGJA 1MQ5A 3RUOA 2XCNA 3MO3A 5T6GA 1UTQA 3GDSA 4ZHMU 4B2CA 2OINA 1HAYB 3CENA 4NGAH 1XUHA 3MH7A 3RXLA 3QGNB 2C8ZB 1EATA 1DLEA 1KXDA 3RLWH 2IOTA 2AMPA 4ISNA 2HPQH 5A2MH 1HAXB 1DWDH 3V13A 2VVVA 2QC2A 2BD9A 2ZGXH 2BDYA 1JXPA 4RKJB 3A7YA 1AQ7A 2FOGA 3S9BA 4FUCA 1FONA
chains in the Genus database with same CATH topology
1JIMA 2Z9JA 2GCTB 2VWMA 1TGNA 2ZEBA 4HI3A 3ZVAA 1ZHPA 2B0FA 5HM9A 6GCHF 3BTEE 3A7VA 1LCYA 1CQQA 1C1NA 4OS7A 2FDAA 1ZYOA 1L4DA 1GBJA 1G3DA 2OUAA 4UE7H 1NTPA 4GCHG 2FESH 1TGSZ 1HAHH 1L4ZA 1DOJA 5JYIA 1NT1A 3F6UH 4JYVH 1W10U 2I6SA 3UNRA 1NROH 2CGAA 1T32A 2SGQE 1DXPA 4DT7B 5JBCS 3GY8A 5JB9S 1OWEA 4Y79A 1TX7A 4CHAB 5DP4A 2BLOA 3MU4A 4BOHA 7KMEH 2V3OH 1Z6JH 2GZ8A 1O2RA 1P2OA 1TWXB 3PTNA 1DANH 4DIIH 3GISB 3SI3H 1S6HA 1FLEE 1Y3XA 3U9AH 3DT0H 4YTAA 2A4GA 1TMBH 3M7TA 4AG2A 1LDTT 4CR9A 2BDAA 4HGCA 1KXAA 2QAAA 1E36B 2O8UA 1O2MA 3KQCA 4FU8A 4AFUA 1O2IA 1Q31A 4AFSA 7LPRA 2XWBI 1ZHMA 2R3YA 3DA9B 2W3KA 1WQSA 2UUKB 2H6MA 2BMGB 4K8YA 4LOYH 4AX9H 2ALVA 1HV7A 3DD2H 1OPHB 3TGKE 1G3BA 3U1JB 5K7RA 4D7FA 3PROA 3A80A 1GJBB 4YLUA 2UUJB 2A45B 2ODYB 3AW1A 1D4PB 5F03A 1HJAC 1IOEA 1GHZA 2TGAA 4JZDH 5FCKA 2PR3A 2TBSA 1QBOA 1P3EA 5A0CA 1AD8H 2BY8X 1G2MA 2VH6A 5BRRE 2ZTXA 1P10A 1QURH 1V2WT 6CHAB 1UVOA 2ODPA 1C2MA 1FY8E 5DP5A 1SSXA 3TJOA 4BANB 5L2YH 2J94A 2PTCE 1UTPA 4A5TS 2H5CA 4JCNA 4MQAA 1GI3A 2AIQA 4FUJA 3A89A 1MMJN 1OP0A 2J95A 3B8JA 5PTPA 1O3PB 1ZTJA 2BX4A 1SBWA 1T7CA 1K1PA 3GYMA 1XXFA 2IPHA 2Y7XA 1C4U2 1LHEH 4LZ4B 3BTME 4CRBA 3PM3A 3A7ZA 1C1TA 4B71A 1KY9A 2G4TA 2Y82A 4YESB 5GWZA 1IQGA 4KTUA 1RIWB 3ZVBA 1V2OT 1RTLA 1BMNH 2GGVB 3SUDA 3V12A 3JZ2B 1PYTC 4X6OA 4ABHA 7GCHG 3ZZCA 4OS4A 1MTUA 4YZUA 1H1BA 1ZPCA 1FDPA 1XUIA 1GG6C 1GWAA 1PQ7A 4CRGA 2FTLE 2FOMB 2VB0A 1U6QA 2QXHA 4O3TA 5AFYH 4O3UA 1KXCA 3TK5A 3P8NA 2ZU4A 4MNXA 1BTYA 2FI4E 1A5GH 4X6NA 3V3MA 1XVMA 1J16A 2A5IA 1MZAA 2ZFFH 1BUIA 1FN8A 2D2DA 1VZQH 1HGTH 1GI2A 3OX7U 1C2GA 5ESTE 5C5OA 1O2TA 2FTMA 3AAUA 2ZCKP 1T8NA 3UFAA 2ANYA 1LMWB 1A3BH 3BTKE 1SGFG 3BSQA 4ISLA 2GCTC 3E91A 1BDAA 1OXGA 4O9VA 1BTHH 2JH5D 1K28D 2P8OB 2SGFE 2XBYA 1Z71A 2ZA5A 1XM1A 5T6FA 4JYUH 5JPMH 2ZHWH 2VWOA 4ZHAA 1N8OC 1T4UH 1RRKA 2J9NA 2BDCA 3D65E 1ZSLA 5DP8A 5EXLA 4FVDA 2A31A 3SNCA 1HCGA 3RXOA 4OS6A 3W94A 1FIZA 1VGCB 1MTNC 4BAMB 1KXFA 4DJZB 1MKWK 1GI9B 4I8LA 3SNAA 2R0LA 3BIVH 1PFXC 2FI3E 5GXPA 1ZJDA 2F9BH 2Z9LA 1F5LA 3SW2B 4OGYA 2A7JA 4K2YA 4D9RA 3Q76A 4Q7YA 1BRBE 1IQNA 3MOCA 1ABIH 5EOKA 4THNH 2HRVA 4YLQH 3TK9A 3M36A 1GVKB 3T28A 1SLWB 1KLJH 2A2QH 1L2EA 2GMTC 1ZOMA 3TJVA 2SNWA 1SGNE 1GBAA 3T25A 1K1JA 3ZVDA 2F91A 2Z9KA 2FS8A 1ELTA 2FX4A 3TIUA 1GBTA 1OYQA 2BQ7B 2QIQA 1JMOH 4GAWA 1VITH 2ZI2H 2C4FH 1DX5M 3RXHA 1HAVB 4FUGA 4CBNA 2A4QA 3AW0A 3T27A 1W0ZU 3I78A 1GG6B 2VINA 3GYLB 1FY4A 4B76A 5DO4H 4YOIA 3RXQA 3SQHE 2ZP0H 5AHGH 3TH3H 2RA3A 5ABWA 1SC8U 2AMDA 3PV4A 3ENSB 1C1PA 1EB1H 2CV3A 1EZSC 1MUEB 4JZ1A 3BG4B 2SGEE 6LPRA 1TNKA 4LXBH 3QO6A 4JYTA 2FWWA 1O3GA 3RXMA 1SGRE 2QY0B 1ETSH 1GBBA 2ZQ2A 3A87A 1TBRH 5FX6A 2OC0A 2BOHB 3K6YA 1E35B 1HBTH 1QRXA 2GV7A 2Y7ZA 4A7IB 1P2MA 3RMOH 1P2JA 1EOLA 1MCVA 4H6TA 3GCTG 1O5BB 1XKBC 3LJOA 5JBTA 4HZHA 1CU1A 5FCRA 3MHWU 5E2OA 1A7SA 2OQUA 1O3HA 3ZZ3A 5F8XA 1P11E 1BTPA 3MI4A 2C3SA 1HAGE 4YT6H 3HKJB 3RC5A 2B9LA 1HRTH 2ZCHP 4NA7A 2EI8A 4NWLA 1S81A 2ZNKH 1EP6A 2TGTA 1RIWC 1IHTH 3KHVA 3SJIA 3U8OH 3KEEA 4A6LA 3MU1A 1ZGVA 1GBEA 1RFNA 1TGCA 5EXNA 3RMNH 1GHAG 3SV6A 3PMHB 1MBMA 3FZZA 2BVSH 3Q3YA 1ZZZA 3QWCH 7GCHF 3RXEA 2Z7FE 1O30A 1PPZA 2WPHS 2G4UA 4MPWA 1O0DH 1O5GH 1QL9A 4Y8ZA 3S7HB 1C9PA 1ZSKA 4WH8A 2ZHDA 1FUJA 2QF3A 5K0HA 2ZKSA 1TNGA 1ACBE 1K1LA 4JZIA 1AY6H 1XX9A 1BB0B 1S0RA 1DUAA 1AVWA 1BT7A 2ZPSA 3UR6A 1F0TA 2NU2E 3M5NA 4K1TA 3SUEA 2FOFA 2FOEA 1LVYA 1Y3YA 1GL0E 4NIXA 5DGJA 1D3TB 3NZIA 3I77A 1QTFA 3SU5A 2Y5FA 1BTZA 2P93A 5A8XA 3URDA 2P3UB 2UWPA 1GMCG 3UY9A 1IQFA 2AMQA 2RG3A 2FMJA 3HK3B 1G3CA 1L1GA 1TPPA 2FOAA 1AWHB 2FOBA 2FM2A 4GHQA 1P02A 1O31A 8GCHG 3A82A 1B7XB 4X1PU 5JBAS 2PKSB 4TPYA 5J4QA 1DXWA 3EE0B 1O33A 3ODDA 1CVWH 1V2KT 4UFGH 5CMXH 1LKBA 1HAIH 1GI5A 1Z8IB 1N6YA 1Y3UA 1GDNA 4ZH8A 1LVOA 2R9PA 1SHYA 3RXUA 2VIVA 4WMDA 2ODQA 4IC6A 1HAZB 3QX5H 1ELVA 2IN2A 1NU7B 2J92A 3STIA 2AS9A 1TPSA 1UTNA 1RTFB 1XMNB 4IS5A 4LZ1H 5EPYA 1VJ9U 3SJ8A 1A2CH 1MH0A 3C1KA 5DK1A 1ESTA 1EJMA 4XOJA 1ORFA 4AFZA 1TE0A 5E8EH 4H4FA 4B1TA 4FUIA 1A5HA 2YNAA 3BEFB 3ZZ4A 4CRFA 5I46H 1HUTH 1VR1H 2BHGA 1Q3XA 4U2WA 5ESBA 8ESTE 1W7XH 1O3AA 1SGCA 2DE9A 1W2KH 3GCHC 3SZNA 1V2ST 3MH5A 2BD8A 4ABJA 3SHCH 3ZYEA 1AU8A 1YLDA 2Z3DA 5F6MA 1GDQA 3STJA 3KL6A 1K21H 5A09A 1DDJA 4NWKA 1LHGH 4YOGA 2F83A 1NFYA 2OXSA 3KGPA 1QR3E 4B73A 7ESTE 3NUMA 2XBXA 1ZHRA 3NK8A 3V7TA 1ELGA 2BVRH 2Q1JA 3M3TA 4CREA 3HGPA 1GBCA 1WV7H 2PGBB 1O5CB 5AFZH 2CHAC 1ZPBA 1UTJA 1YF4A 1BHXF 1JOUB 4IBLH 3TLOA 1CBWC 1PJPA 1A4WH 1DPOA 1C5QA 2D26C 3NXPA 4Y0YE 2WPJS 4IN1A 1BHXB 2BLQA 1QY6A 4MNVA 3LGUA 4YO9A 1Z8RA 2RCEA 1FJSA 1KXEA 1G36A 1NS3A 1O3MA 2BXTH 1AFEH 3MU8A 4U32A 2BLWA 1TMTH 1YCPK 2LNCA 2SGAA 3OSYA 3VB7A 1TMUH 1DT2A 2ZGCA 5JB8S 1XUGA 1K1MA 2CN0H 1ID5H 1GBDA 4X0WU 3EA8A 3N7OA 1BMLA 4ZKNU 3T26A 3LGVA 1WBGB 2OLGA 4MTBA 4TYDA 3LGWA 2FEQH 2O8WA 4NSVA 3U8TH 3SUFA 4XSKU 3SGAE 1C2DA 2QV1A 1GHVH 1XUFA 1SB1H 3Q3XA 2A7CA 2JH0D 2ZFSA 4E06H 1ZSJA 1A0JA 3LONA 1O2UA 4Y8YA 1C1VH 1QBVH 5DG6A 2VIOA 5FAHA 1C5UA 1MD8A 1QRWA 1CO7E 2BDHA 5FBIA 2HNTE 1JRSA 2F9NA 1C5VA 1FY5A 1SG8B 3TPIZ 1S5SA 3P8OA 3RC6A 2STAE 1P57B 3QZQA 2PGQB 1EPTA 2BX3A 1AB9C 1JWTA 2WUCA 2W5EA 3T62A 3M5LA 1KTTB 4INKA 2BY6X 3SNDA 2BXUH 5HMAA 1D6WA 5F8ZA 2WUBA 1J14A 1EZXC 5EU8A 3KCGH 3SU1A 2PLXA 1K22H 4WF8A 1P2IA 4I8JA 1O2WA 2PW8H 1MTVA 4NIWA 4ABIA 1DM4B 2PWXA 2G55A 1NFUA 3S69A 1ZR0A 1YGCH 4Y6DA 1TNHA 4Y7AA 1P01A 2ZCLP 3V0XA 1ZMJA 3A7WA 1C1OA 2ZPQA 4MLFB 4TWYA 1C5LH 3PMJA 4KP0A 4TPIZ 1Z7KA 3P8FA 1SL3A 4IN2A 3M37A 1AIXH 1QFKH 3AVZA 2JETB 2C93B 3BF6H 3DHKH 4ZXXH 5TCCA 3RXCA 3UQVA 4K60A 2Z9GA 4RSPA 1QL8A 2STBE 1CHOG 4Y10E 3PWBA 4GPGA 2H2ZA 5A8YA 1DWBH 4MDSA 3GCNA 1P09A 3G01A 2AFQB 3QUMP 1RD3B 4FU7A 3L3TA 3QK1A 1QQ4A 1OP8A 2EA3A 4WMEA 1K1OA 4Y7BA 1SLVB 1P06A 3PLPA 1UK2A 5C1XA 1B5GH 1QCPA 1WUNH 2J4IA 4IC5A 3TK6A 1IQKA 3A85A 3OU0A 5A8ZA 5FPYA 1QL7A 1WU1A 2O8TA 2PSXA 4NG9H 1TRMA 1ZJKA 2I6QA 1DSTA 2AH4X 1MKXH 1SQAA 3MYWA 4KTSA 1NZQH 3QDZB 2PKAA 4U01A 4BTUB 3A7XA 2ZFRH 3TU7H 1X7AC 2ZDVH 4K3JA 3A8AA 3LT3A 4F4OC 1F5RA 4DIHH 5DP9A 1Z1IA 1CHOF 2B5TB 1O5AB 4DURA 3ZZAA 3ZVGA 1C1QA 3VB6A 1YPKH 4NSYA 1P2NA 1C5PA 2BQWB 1GI1A 4AB8A 2SGPE 1NY22 5E2PA 1JRTA 4R8TB 4FU9A 2PUQH 1W14U 2P3FH 2QN5T 3RXPA 1GPZA 1FPHH 3VB5A 3IG6B 1NPMA 3SJ9A 4AB9A 1LHFH 5C5NA 4B2AA 1P0SH 1YP9A 4MPVA 1C1UH 4MPUA 2CJIA 3TH4H 1F5KU 4X6MA 3TNSA 1LO6A 3ELAH 3ATWA 3UUZA 2GP9B 1KYNA 3UPEA 1K2I1 4E7NA 3MNSA 2EC9H 5HXFA 3F68H 1LPZB 3F1SB 1OKXA 2FYRA 2XC5A 4Q7XA 2BD5A 1LQDB 2ULLA 1V2JT 1SR5C 1GMDF 1EUFA 5DPAA 3I29A 1MTWA 3RXRA 1ZMNA 3BTFE 2F9OA 1DE7H 1GJDB 1ANCA 6CHAC 1UVUH 1GCDA 4GHTA 1DITH 1O38A 3PO1B 5FX5A 1GHWH 1TQ0B 1NC6A 3GCHB 2G5VA 3PLBA 1IHSH 1ZRKA 4GCHF 1W11U 3LC3A 2GCHF 4RN6A 1VJAU 2ZTZA 3VB4A 4DG4A 3K6ZA 1BQYA 3E90B 4Q80A 3ZZ6A 4GUXA 2VGCB 2W26A 2HGTH 4CRAA 1QJ1B 5C1YA 1GI8B 1QQUA 4X2YA 2A4OA 1W13U 3QZRA 1BBRE 4Y0ZE 3RXSA 3FFGA 2O8LA 1NFWA 1TOCB 4ABAA 1ZGIA 3KN2A 3ZZ9A 1O3IA 2SGDE 8LPRA 2QXJA 5FPTA 1SFIA 1Y3WA 2ZF0H 2ZWLH 5EXMA 3B9FH 3LU9B 1C5SA 5F8TA 4ZXYH 5LPFA 4WXIA 1GI6A 1ZLRA 1V2QT 3BV9B 4OS2A 1BRUP 3EA9A 3NPSA 2ZECA 1H9LB 1P3CA 1UCYK 3SV9A 4ZKSU 5C67A 1QJ7B 1D3QB 1DY9A 2WINI 1BA8B 2BM2A 1EB2A 1TALA 1G30B 3GDVA 6ESTA 3RP2A 1QJ6B 1N8OB 1F2SE 1WOFA 5GJ4B 3H7TA 3F9FA 1DICA 4A1XA 1CT0E 4I7YH 1O3LA 4BXSA 1PPHE 1QB1A 3F9HA 2ZU2A 1J17T 4MVNA 1YPGH 5LH8A 2BD3A 2ZU3A 4Y71A 3BG4C 1A61H 1O37A 3RXKA 1VCWA 1MCTA 3P8GA 4NIYA 1CGIE 3VB3A 1YPEH 1M9UA 3U1IB 5GDSH 2GV6A 1C2KA 3M7QA 1TPOA 1C4Y2 1ETRH 1FI8A 3MTYA 1F0SA 1AKSA 1OWJA 2F9UA 4U30A 2HLCA 1EKBB 1MBQA 3KIDU 1IQLA 3HATH 1SGIB 3SN8A 2Y5GA 3RDZA 4NA8A 3SJOA 4F49A 1UCYH 5CE1A 1AFQC 1V2TT 4A1VA 2WPKS 1BCUH 4VGCC 3ZVFA 3SQEE 3HKIB 1WTHD 5CHAB 1BMMH 1WTGH 4Q7ZA 5LGOA 1S83A 1QB9A 3ZVCA 1C5RA 1DLKB 2ANKH 4X8TH 1YLCA 4MG3A 1EAIA 3ATKA 1TLDA 4K1SA 5E0GA 2HALA 1LVBA 5DKMA 2NU3E 1V2UT 2VNTA 1BTXA 4BAQB 4SGBE 2BLVA 4CR5A 2PHBA 9ESTA 5JBBS 5HM2A 5H4IB 4MNYA 1NN6A 1V2PT 5TJXA 1GBIA 1FY1A 2PSYA