1O3PB

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 52
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3pB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3pB01
1A5HA 1O3FA 3SU5A 5FCRA 4AFSA 4IBLH 4BOHA 3A7TA 2BZAA 2HNTC 2ZTYA 3FAOA 3NZIA 1O5EH 1T8NA 3RU4E 3SU4A 4VGCC 2XC0A 1UCYK 1Y3XA 6CHAC 7GCHF 1QQUA 2BZ6H 2F83A 1WOFA 5TCCA 2FYQA 3SNBA 3V13A 1V3XA 1E0FD 1DLEA 3O8BA 1P03A 4JYTA 1TAWA 1C5RA 3S9BA 1KXDA 4D8NA 1FI8A 5F6MA 2ULLA 4ZKOU 4Y76A 5GPIB 5DP8A 2FP7B 2H6MA 4NWLA 2O9QA 1ELGA 2BY7X 3RLWH 1ABJH 3GICB 2Z9GA 4GSOA 4CREA 4LOYH 4JYVH 2SGEE 1SR5C 1S5SA 2BLOA 1YYY1 2QY0B 1S85A 2QN5T 1O36A 1P2JA 5DKMA 3M5MA 2PGQB 3ZZDA 3UR6A 2BDGA 2M5TA 1O3EA 5L2ZH 1GBBA 1O3CA 1TPPA 3PWCA 2VWMA 4X8UH 4VGCB 3TLOA 6CHAB 1DSUA 1MAXA 1DX5M 1GI0A 1SGTA 1SMFE 3A8CA 1YF4A 3RXCA 1TMUH 1TNLA 1LHCH 1AKSA 4I8JA 1OYTH 3A7WA 1HFDA 1DXWA 1BRBE 3UY9A 1WU1A 1SGQE 2OP9A 2FPZA 1DE7H 3GCOA 2G55A 3BG4C 1CGHA 5HGGA 1O32A 1T32A 4ZKSU 3A7VA 2ZTXA 4HGCA 2P94A 4ZHMU 1AU8A 4B76A 4WXVA 1EOJA 1Z7KA 1ANEA 1MD8A 1IQGA 1V2RT 1P01A 2C90B 4Y11E 1GPZA 2PFEA 4FUHA 1F0SA 1UCYH 2F9VA 5HM2A 1VITG 2G4UA 1IQJA 1C5XB 3H7OA 5FHTA 2QAAA 4IMQA 1C2HA 1SGPE 1ELTA 4KTSA 3GY5A 1ARCA 4INLA 1J14A 1DWDH 2Y5HA 2C3SA 2BD8A 5EW1H 2NU4E 3IITA 1QHRB 1ZSLA 2TGAA 2KAIA 2EI7A 3BG4B 2CF8H 1FY1A 1KTTB 3TGKE 4H6TA 1AKSB 2BOHB 4FUEA 3BTWE 3TGJE 5JB8S 3KNXA 4ABFA 5I46H 1FY3A 1O30A 1NZQH 5C1UA 2BY9X 1HUTH 2A1DB 1SQAA 1SLWB 1GMHF 4X1NU 1MTUA 2NU0E 1HAVA 2BM2A 2CMYA 5FX5A 4SGAE 5LH8A 2TGDA 4A5TS 1SGIB 5I25A 1GL1A 2VNTA 4MQAA 3ATKA 4NFEA 4DIHH 2GGVB 2AGGX 2BLVA 2BQWB 4U01A 1MKXK 3SOSA 2Y81A 1S84A 2FMJA 4DGJA 1SGEE 1ZRKA 2OQ5A 3D62A 1H4WA 5HMAA 1F2SE 1Z8IB 1UTJA 1WCZA 1FXYA 3ZZ7A 1DXPA 3KN2A 2GTBA 4X2YA 1RS0A 1J16A 2NU3E 2Q6FA 1AZ8A 1BTHH 1PPFE 5C5NA 3ZZ9A 4LXBH 3SZNA 1FPHH 1CHGA 2PTNA 2WYGA 1HV7A 1YCPM 4D9QA 1AN1E 2DUCA 1XVOA 1MTSA 3SBKA 1P05A 2R2MB 4K69A 3TU7H 3Q76A 3ZVDA 6GCHG 1D3PB 2KAIB 2QA9E 2YOLA 1O2HA 1EJMA 1O3BA 4F4OC 1P10A 2GD4B 2V0BA 1C1WH 1C5VA 1IQEA 1NU7B 3T27A 2XYAA 3RXHA 1QY6A 1CT0E 3BSQA 1O3DA 2FLRH 2GVFA 1RTLA 3QUMP 3U8RH 2BVRH 3GISB 5GCHG 3U8TH 1N8OB 1HAVB 2HPQH 2YNAA 3E0NB 1K1NA 2BDCA 2ZC9H 3SHCH 3TK5A 2F9BH 4ZH8A 1UVOA 2H5CA 4X8SH 1F0UA 4Y0YE 2FO9A 1UTQA 3E3TA 5A8YA 1K1OA 3VFEA 5C2ZA 1FJSA 3RXPA 2BD4A 3UPEA 2ZDMA 2Q6GA 3SJ8A 2GCHF 2XXLA 5DP5A 3OTJE 4ZXYH 1SGFG 2PUXB 2LPRA 2G5NA 4MG3A 2ZZUH 2Q1JA 4Q7YA 2WUBA 1TGSZ 1BTWA 4OS1A 1NN6A 3MH7A 5AVDA 2PKSC 3RLYH 3VB6A 5K7RA 1ARBA 2ASUB 1THRH 1GWAA 2R0KA 4F49A 1YPEH 3KQCA 4X6MA 3M7QA 3NUMA 9LPRA 5GIBA 1MKXH 2EEKA 3ZZBA 2QIQA 5EG4A 2W3IA 3PV4A 1BHXB 3F68H 4O3TA 3DA9B 2UUYA 4H42U 1SVPA 2B9LA 3MHWU 4AYYB 1GJCB 1DDJA 1TBZH 1G2LA 1C5SA 3PO1C 1AGJA 1FPCH 5EQSA 1YPMH 2ZQ1A 1EX3A 1SGFA 1O2UA 3MU0A 1GI4A 3V0XA 2BTCE 4Y8ZA 2BB4A 3RXJA 3SORA 1MUEB 3I78A 4B2AA 3A86A 4IN2A 1HBTH 1A1RA 1PPEE 3N7OA 4NA9H 4FUJA 1BQYA 5EQRA 2THFB 3PMAB 2O8UA 2J95A 1V2PT 2C8WB 3KEEA 3A82A 3SJKA 4DW2U 2PKSB 5GXPA 1MKWH 1QQ4A 1ZZZA 1RGQA 3GDSA 4WF8A 1ELVA 1L1GA 3H7TA 1F0RA 1NFXA 1P2OA 1KXCA 5SGAE 1ZPCA 5BPEA 4LZ4B 5LPFA 2A2XH 1BMAA 2ZPRA 2Z3EA 1TABE 1TOMH 3PO1B 4D9RA 1NRNH 1TOCB 1GJAB 1O33A 1FY5A 2VIPA 4UFEH 2OC7A 1ZOMA 2HNTE 2JETC 1KDQA 5FXLA 1V2WT 4YOGA 1XVMA 3PTNA 2ZI2H 3QWCH 1HAHH 1K9OE 3GCTF 1QA7A 1GGDC 2UWPA 2AIPA 1DT2A 1O3JA 2PLXA 4AG2A 2ZPQA 2FLBH 5EPNA 3LU9B 1O38A 3OX7U 1O2OA 1HPGA 2ZWLH 3BF6H 1C1SA 3RDZA 1FIZA 1GHZA 1D6RA 4I8KA 3SU3A 1S0QA 1Y8TA 2C4FH 1GBTA 2ZHFH 4YT6H 3RXLA 1PQAA 1QRXA 3QK1A 1O2ZA 4CRAA 2BY8X 1VGCB 2UWOA 4TY7A 2FI5E 4KTUA 3PROA 1T8MA 1H8IH 5EODA 4WXIA 3GY7A 3FZZA 1O2WA 3DT0H 2BQ7B 1NPMA 2O8TA 2SGDE 3E91A 3FANA 2AYWA 2FEQH 4A1XA 1JRTA 2R3YA 1V2ST 5TJXA 4Y10E 3UR9A 1MZDA 1QTFA 2FI3E 4ISOA 4DT7B 3CS0A 1LO6A 1V6DA 4NCYA 4M7GA 3S7HB 5LPRA 3UOUA 1ID5H 3FZDA 2B7DH 3PLBA 3G01A 1C9TA 4X8VH 1GGDB 1UVPA 2OC8A 1HRTH 1B5GH 4OS7A 2GZ8A 1W3CA 2J38A 3ENSB 4FU9A 3SNCA 3VEQB 3BN9A 1FN8A 2D1JA 3EGKH 5DG6A 1AWFH 7KMEH 3MH6A 4NWKA 4X1RU 1HJ9A 2BVSH 1OYQA 1JIRA 4A1VA 2FOAA 4E7NA 3M35A 5IYTA 3T2NA 1UO6A 4BAOB 4DIIH 1O37A 2D8WA 4NGAH 4ZKNU 1O3MA 3E6PH 3SUDA 2ZHWH 4LZ1H 1ZHPA 2VWLA 1UHBA 2STAE 2ZA5A 3MNXA 1O2NA 5E8EH 3L6PA 3HK6B 3K6YA 1XUIA 3S9AA 1KLTA 1O2GH 3RXEA 5JBCS 1TX7A 4FU8A 4O97A 4B2CA 4FU7A 3A84A 3VXFH 1UMAH 4CHAC 3DUXH 1TBRH 4GLYA 4WMDA 1S81A 4UFFH 3ATMA 1A5IA 6ESTA 3PMBB 2YNBA 4MPVA 3S69A 1O2VA 1ZR0A 1DY9A 1PYTC 1RRKA 1YCPK 4YZUA 4AZ2B 2XNIA 5A8ZA 2VVVA 1KTSB 2BMGB 5FBIA 4SGBE 1DLKB 2RCEA 1T7CA 1KLJH 4ISHH 3I77A 4BTUB 4WWYA 3RMOH 4UD9H 1AUTC 2XBWA 1O3GA 1OWDA 2G8TA 4DURA 2CGAA 1C5OH 1E38B 3KCGH 2ESTE 1TQ7B 5G4BA 5EW2H 1AFEH 2QXIA 1GG6B 1V2NT 1WV7H 2ALPA 2ODPA 1KIGH 7GCHG 1RTKA 2H2ZA 1GI9B 1QURH 1ELCA 4JYUH 4B75A 4H6SB 4MNXA 1MBQA 3GDVA 4XBDA 1UHBB 1N6XA 1P02A 3LPRA 1ZMJA 2Y5FA 1GBMA 1SQTA 1T31A 1LTOA 3LGUA 5JPMH 2VH0A 1W0ZU 1G3EA 2BY5X 3NPSA 2FXRA 1DUEA 4IS5A 3PYHA 1W13U 1C1TA 1K2I1 2VVCA 4FUIA 4ZHLU 1P12E 1HDTH 1QJ1B 4ZHAA 1GBJA 3LC5A 3MNCA 1GVZA 4NSVA 3LGTA 1OSSA 1C4Y2 1AWHB 4AORA 1P2IA 1ELEE 4QT8C 2ZFFH 4TYDA 4B1TA 4AB9A 1O34A 2A5AA 2FOMB 1DWCH 1O5DH 4MNWA 3F9HA 2JH5D 1CBWB 2WUCA 1TRNA 5BRRE 2ZHEH 1HIAA 5E2PA 1ETSH 2ZGXH 3LT3A 3MNBA 4OGYA 2XWBI 3I29A 1GI7B 4I33A 4ESTE 2ZCHP 1CA0C 1W2KH 1OX1A 3EA7A 4NA8A 2ZDAH 5DPAA 8GCHF 3HPTB 2QF0A 1MCTA 1YCPH 4K3JA 1OKXA 3URDA 1ACBE 1CT4E 1X7AC 1CT2E 2WPIS 2CJIA 1O39A 4OS4A 3NWUA 1EZUC 3M36A 1G3BA 4XSKU 2B8OH 1GBAA 1C1MA 3BTME 4ZUHA 3FP6E 3L3TA 3GY6A 5ABWA 2HALA 1LDTT 2H5DA 1HYLA 4AGKA 1G37A 3QGJA 3OU0A 4FVDA 1GCTC 4Q7XA 4YOJA 4A7IB 1P2KA 2PW8H 3U1IB 3A8BA 1C5PA 1QJ6B 1C1QA 3RXQA 1C2FA 1AZZA 2C8YB 1YBWA 4GAWA 1GHWH 2OINA 3PWBA 1XKAC 4BXWA 1CA0B 1U6QA 4MPXA 4X1SU 3M3SA 3VB5A 3ZZ8A 2BLWA 1BRUP 2A5IA 3SV6A 1Y3WA 4HTCH 1O0DH 1HIAB 1TRMA 1QA0A 4BXSA 1ELAA 3GOVB 2BD2A 4CH2B 2PSXA 2ZGBH 2ANWA 3TGIE 3S9CA 2VJ1A 5A2MH 4CBNA 1IAUA 5F8ZA 2G51A 3VB7A 4Z6AH 1TMBH 1ZTKA 1C5YB 3U9AH 3A7YA 1Y3VA 1W8BH 3ZZ3A 3MU4A 1GHAF 1EXFA 1SC8U 1GCTB 2AGEX 2P3TB 2VIOA 1WQVH 2Z9IA 1GMHG 3RXSA 1GBEA 1P11E 1XMNB 2EI6A 4ABAA 3RXKA 3EQ0H 1QB9A 2ZU3A 2WPHS 4ABEA 3ZVGA 2R0LA 4X2WA 3VPKA 1DOJA 4IC6A 3P92A 1TWXB 1SOZA 1O3IA 2Y7ZA 1C5QA 3KQDA 1TRYA 4TWWA 5ESBA 4JK6A 2BDBA 1BA8B 4NZLA 2BXTH 3STIA 2P3FH 2VH6A 1AUJA 4OS6A 5ETXA 1O2SA 1YPHC 3TJUA 5JYIA 1IHSH 5CMXH 4K8BA 4CRGA 1GJ8B 2A0QB 1QGFA 1E36B 4AOQA 1GI3A 2BD5A 5A09A 1BOQA 1FIWA 2GV7A 5DGJA 1SQOA 3QLPH 1F0TA 4WY3A 2CV3A 1B0FA 2FOBA 1Y5BT 3RC6A 1IQHA 4YO9A 1SLVB 1GBIA 1C2LA 1KYNA 2TBSA 3AVZA 1NTPA 2Y7XA 4ABDA 2EC9H 3BTFE 1QIXB 1GHYH 2CN0H 4ABJA 3RXUA 4DY7B 2VIQA 1A0LA 3Q3YA 5AFZH 1AD8H 2ZFQH 1FV9A 1V2MT 1DFPA 1WTGH 2I6SA 2FM2A 1H8DH 1TGTA 4FUBA 1KSNA 2TGTA 1V2LT 4IW4E 1WTHD 3T26A 1GBKA 2SNVA 5AHGH 2DE9A 1KY9A 1IHTH 2FDAA 5EXNA 4WH8A 2ANYA 1A2CH 2GCHG 3KQBA 3SUEA 1YPJH 5T6DA 1ANCA 1PPZA 2WV5A 1GI2A 3E1XB 1TNIA 1MQ6A 4MNYA 4X0WU 2TRMA 1GI6A 1K1LA 1YKTA 1AVWA 4XOJA 1DY8A 4RKOB 1YPKH 1OP8A 1OXGA 2WPKS 5DP3A 3UWJH 1DPOA 1S82A 3NKKA 2JH6D 1A0HB 4Y7BA 2P16A 4OS2A 1V2OT 2VIVA 1RD3B 2HPPH 1B7XB 2BDAA 2GP9B 1ANDA 4O3UA 5C3NA 1C1VH 1G36A 3B8JA 1PPHE 5B6OA 1BTYA 4ASHA 2IJOB 2OC1A 2C8XB 3GY4A 1AMHA 2F9NA 3RXIA 3RMNH 1GDQA 1EB1H 4WMEA 3URCA 2FODA 1O2IA 1EAXA 1VITF 4GVUA 1Y3YA 4INKA 3U69H 4WH6A 4TPIZ 3K6ZA 1O2PA 1LKAA 2WPJS 1CHOF 4Y79A 1V2UT 2OTVA 2PSYA 2F91A 2FOFA 2R3UA 1VITH 1EP6A 1UJ1A 1K28D 4NSYA 4K8YA 1Z6JH 4FUCA 2V3HH 5PTPA 1F5RA 3BV9B 3DD2H 2PHBA 5E0HA 1FLEE 1SLXB 1ELFA 1SG8B 4FVBA 4YTAA 2Z9LA 5DP9A 1TNGA 1C1OA 1EAUA 3HKIB 3EA9A 4BAQB 3QTOH 2B5TB 1YM0A 2VB0A 1P04A 5A8XA 4KGAA 3M7UA 5EOKA 3K2UA 1H9LB 1GDNA 2TPIZ 2O8MA 1L2EA 4JZDH 4B71A 1ELBA 3Q3KA 2P59A 1KXAA 3LOXA 1LMWB 1GVKB 1DANH 4UONA 2ZQ2A 1GMCF 1XKBC 3MWIU 4MVNA 5FCKA 4DVAU 2HVXA 2XC4A 4KKDA 1QL8A 1AHTH 3PMJA 5AFYH 3SHAH 2AMQA 2A7JA 1EAIA 1EAWA 1XUHA 3GCTG 1WBGB 1ZLRA 2OXSA 2ZCKP 3M3VA 3SU2A 4JZIA 2BDIA 3BTKE 2H9EH 1EQ9A 2F9PA 5C20A 3RXAA 3RXMA 1NROH 2ZDNA 4DOQA 4ZAEA 2XTTB 1BTZA 3AW1A 4CRBA 2A5KA 1PYTD 4YLUA 3BTTE 4NIVA 4X8TH 3ZZAA 2WPMS 3ZZCA 2QYIA 3LJJA 4X2VA 5DJ7A 1QL7A 1HXEH 3ITIA 1A3EH 4HZHA 1EJAA 1GL0E 2H9HA 2G5VA 1PQ8A 3EE0B 3HATH 1C2DA 1RFNA 1D4PB 1VCWA 3RXBA 5L6NH 1C1PA 1QRWA 4MPWA 3OY6U 1P06A 3SJIA 4ABHA 1BB0B 5J4SA 1HGTH 2J34A 2BX4A 1K1PA 1P3CA 1ETTH 1IOEA 1UTLM 1TPSA 1O31A 1TIOA 1HAZB 1GHBF 1GI1A 3GDUA 1IQFA 3MFJA 4K1TA 3TPIZ 4K2YA 3RP2A 3PLPA 2FX4A 1C2KA 2ANMH 1XX9A 2SGFE 1QNJA 1QRZA 3SU6A 3SI4H 1XUKA 1BRCE 5IDKA 2ZIQH 1P3EA 1P9UA 2FOCA 2J94A 4ABGA 1DM4B 2JH0D 2A4OA 1KLIH 1SI5H 4A1TA 3R3GB 1BMNH 1S83A 3LC3A 5A0CA 2P8OC 1DICA 3EAJA 2ZU1A 3ESTA 1BIOA 1IQMA 1DS2E 2ZU5A 1C5ZB 3DFLA 4NIXA 4D7GA 2QGRA 1ZTLA 1QBOA 4Q2KA 2OBOA 1M9UA 2STBE 3D23A 1C4U2 2GKVE 1A0JA 1OWKA 2A7HA 3RXDA 1YLCA 3SNDA 4RN6A 4XBCA 2Z9JA 3MMGA 2ILNA 5JDUB 3GCHC 4Z0KA 1BMMH 1ZMLA 4XDEA 3ZZ4A 3UNSA 2XC5A 1DUAA 1GCDA 3IG6B 3SUFA 1C5UA 3LH1A 3BEFB 2GCTC 1HCGA 2BQ6B 1SOTA 2HLCA 1OP0A 1FAXA 2RA3A 2H1UA 1TGCA 1EP5A 3M61U 2JETB 3KGPA 2Z3CA 2AGIX 3PM3A 2IN2A 2C8ZB 3BTDE 2SFAA 1WSSH 3D65E 2W7SA 3AW0A 1TA2A 1UK3A 2A31A 2J4IA 4TPYA 4NIYA 1KDQB 3O8DA 3TK6A 1ZSJA 2P8OB 3HK3B 2BHGA 1ZTJA 2BD9A 1TGBA 4ZROA 3RMMH 4BANB 1EZQA 3TK9A 2CF9H 1BRAA 2Z94A 3MI4A 4D76A 1RIWC 1HAPH 5DP7A 1HXFH 3RXTA 2QC2A 1LKBA 3A88A 1NY22 2BD7A 3GCHB 1JOUB 4UFGH 1UK4A 3FP7E 1MMJN 3RMLH 3TH3H 2BYAX 3SU0A 3TNTA 4AYVB 2ANKH 1QL9A 1GBHA 1O2TA 2AERH 3VB3A 3IWMA 2GCTB 3RXRA 1DWBH 1VCQA 3ZYEA 1XM1A 3NCLA 4UDWH 2ZPSA 2BDYA 1GMDF 1OOKB 5GJ4B 1V2KT 1GBFA 4GCHF 8LPRA 3SUGA 1YPHE 3C27B 1J17T 1SGCA 1EATA 1SPJA 1A4WH 4R8TB 2PWXA 2J2UA 1H9HE 4NFFA 3JZ2B 2O8WA 3P95A 2SGPE 2ZFRH 2ODQA 1O2KA 4RKJB 2VIDA 2ZFPH 4Y8XA 3SGBE 3T62A 1P09A 1W7XH 2SNWA 3A89A 3RUOA 2G00A 2V6NA 3MTYA 4XE4A 1GI5A 1AE8H 1DITH 1RIWB 1ETRH 2XW9A 2BVXH 8ESTE 3QGNB 2DE8A 3UUZA 8GCHG 1GVLA 1ZGIA 3FP8E 3SGQE 1L1NA 1CQQA 4XBBA 2V3OH 2TIOA 2GT7A 2W5EA 4GPGA 4FUGA 1NESE 5H4IB 3DHKH 3RXOA 3BTQE 2V35A 1MTWA 2FOHA 1EJNA 1AY6H 1MBMA 1RXPA 3TIUA 2FESH 1C4V2 4DG4A 3AAVA 2WYJA 2C93B 2A4GA 2FI4E 4MTBA 2IPHA 1Y5AT 4CR5A 4MLFB 1TA6A 4KP0A 3E90B 1G2MA 3VGCC 7ESTE 1K22H 5CE1A 1AVGH 5GDSH 2ZGHA 5DO4H 3QX5H 4CHAB 1A61H 2OUAA 1C2IA 1INCA 4HI3A 3V3MA 1GJBB 1YP9A 2RDLA 3ZV9A 2Z6BD 1D3DB 1S0RA 1AVXA 1ESTA 5TCAA 2ZGCA 1P2MA 3P8NA 5HYOA 1XUJA 2GZ9A 1JMOH 1MU6B 4CR9A 1CGIE 3LGIA 1LHFH 4OS5A 1C1RA 5T6GA 1GJ7B 5E0GA 4Y8YA 1VR1H 1SGNE 1W10U 3E0PB 4J1YA 2QXGA 2Y6TA 1EASA 1AFQC 1UTKA 3PTBA 1OP2A 4CRCA 1A5GH 4B74A 3ZV8A 1ESBA 1OPHB 1GHAG 1P8VC 5A0AE 1G3DA 1D3TB 2OBQA 3VGCB 1IQLA 3O8RA 4JK5A 1O2XA 5T3HA 3MO3A 1VZQH 1TNKA 2SGAA 1O5AB 1FDPA 1AI8H 4PROA 3VB4A 1A3BH 2G81E 1TPAE 1ELDE 3M7TA 3GYLB 1GBDA 3SN8A 6LPRA 2J9NA 3RC4A 1GBCA 3SV7A 3AAUA 1NFWA 1BT7A 1CSOE 3RXFA 4FUFA 4YT7H 1DWEH 2ZTZA 4KELA 1LQDB 1NT1A 1VJAU 2PTCE 4RSPA 1RJXB 2R2WU 2JKHA 1F5KU 4ZMAH 3W94A 2ZGJA 4JZ1A 1AFQB 4B2BA 1LPZB 4X1QU 1GJ6A 1NC6A 2UWLA 1LHDH 5AF9H 1Z1JA 3UWIA 1TFXA 1AB9C 1HJAC 2AFQB 3LIWA 3M37A 3MH4A 4KTCA 1NS3A 3SU1A 1GHVH 1O2LA 5T6FA 3P6ZB 1T8OA 1C5MD 1EOLA 4TWYA 4E7RG 3FVFB 3MU5A 4YESB 4I8GA 4X6NA 5C1XA 2HNTF 5DP4A 1AO5A 1W12U 2PV9B 4ABIA 1BBRE 3MU8A 4FXGH 2A4RA 2OQUA 1BITA 3ZYDA 1J8AA 1L1JA 3UREA 4DJZB 4U30A 1O3OA 3KIDU 1T4UH 4HFPB 1P0SH 1JBUH 1MU8B 2GMTC 1HNEE 1K1IA 3CENA 3RU4D 1D3QB 1N6YA 1UVUH 4H4FA 1IQIA 3MO9A 3F1SB 1O2YA 3HGPA 1N1LA 1BJVA 2VINA 4AB8A 1YPLH 1LQEA 5DK1A 1LPKB 3V7TA 3UIRA 1SGRE 1YLDA 2FOEA 4YM9A 4BAHB 3L33A 1FQ3A 1KXBA 1G32B 5HM9A 5JBTA 2OD3B 1G9IE 1XUGA 4MPUA 5EXMA 1QR3E 1AB9B 1HJAB 4K5ZA 2ZCLP 1FY4A 4GHTA 3B23B 3P8FA 2FIRH 1CGJE 1LCYA 1SHHB 1ZSKA 1YPGH 1TYNA 3MYWA 1PQ5A 1W11U 3LKWA 4ISIH 2VVUA 2Z7FE 3SI3H 2Y82A 1ZHMA 1P2QA 3MO6A 2FX6A 4UFDH 3BEUA 2HGTH 3UFAA 3E8LA 2D26C 1BJUA 1ZPZA 3SGAE 2UUFB 3LDXH 2GMTB 1W14U 4I8LA 4BAKB 3QN7A 3S7KB 4TY6A 3OYPA 1LVMA 3LJOA 2AEIH 4AX9H 2QXJA 2ALVA 3BEIB 1AE5A 1LVYA 2VU8E 1CHOG 2VIWA 1F7ZA 1THPB 4DCDA 1QBNA 2ZU2A 5FAHA 1H9IE 3LGYA 1L0ZA 1EB2A 1Y59T 4BTTB 5L2YH 2WV4A 2FTLE 2J92A 2UUJB 1BCUH 1QBVH 1BMLA 5EGMA 2AH4X 1NRQH 3P8GA 3ZVAA 2XWAA 1HLTH 3A83A 5F8XA 1V2TT 2P3UB 2A7CA 4K60A 4AGJA 3GCNA 2PR3A 1E37B 1SFQB 4D7FA 2ZECA 1DVAH 1SGYE 3MNSA 4GUXA 3R0FA 1C2JA 2XBXA 3U1JB 4X2XA 3LGWA 3T25A 2P95A 7LPRA 5JB9S 3T29A 3PMHB 3KQEA 2EA3A 3A8DA 2HOBA 1GMCG 1O3NA 1CU1A 1A46H 1SB1H 1N8OC 2ZNKH 2QCYA 1HJ8A 1TBQH 1O35A 1O5GH 3P17H 1XUFA 1QB1A 3M5LA 5EXLA 5C5OA 3TNSA 1EKBB 1PPBH 3ELAH 3A81A 4Y0ZE 4ABBA 5C67A 3LGVA 1ZYOA 3ATLA 4NA7A 4Q80A 3MH5A 1TMTH 2GZ7A 1O2QA 3DFJA 1C2MA 4O9VA 1EZSC 1B0EA 1FY8E 3OY5U 1TALA 2AIQA 1SSXA 3T28A 1W7GH 3WY8A 1HB0B 5L30H 2QXHA 3ATIA 1J15A 1KXFA 1LVOA 3GYMA 2BX3A 3RM0H 3A8AA 3VXEH 1OWEA 4JZFH 1Z71A 1GJ4H 2ZDKA 1JWTA 2BXUH 1WQSA 3E16B 2BLQA 1FUJA 3Q00A 3F9GA 3NXPA 4A6LA 1C5TA 1MKWK 2FOGA 3BTHE 1MAYA 1TNHA 1SGDE 2FYRA 2CHAC 3A87A 4WVPE 5CHAC 4B73A 3SJOA 1SL3A 1NRRH 1YGCH 1F92A 1GHBG 1ZMNA 2ZF0H 1TB6H 1A7SA 2BOKA 2ZDLA 3A7XA 1Z8GA 2AMPA 3MOCA 4BTIB 5A0BA 3JZ1B 3QDZB 1LPGB 3LONA 1BBRK 2G52A 2G4TA 2CXVA 1NRPH 1QFKH 1VCPA 1E34B 1ABIH 1OWHA 2Q6DA 4INHA 2F9UA 1IQNA 3RU4T 1L4DA 3T5FH 1MD7A 1ZGVA 2LNCA 1MCVA 1C5WB 1BHXF 4ZKRU 2GDEH 1C1NA 2F3CE 1MH0A 1PQ7A 1BTPA 1BZXE 1W0YH 5GWZA 1O5CB 1UTNA 2QF3A 1Y3UA 1O3AA 1PPCE 2FTMA 3U8OH 4U32A 2ZEBA 1LVBA 5FPYA 3A85A 4MNVA 3P70B 1TLDA 3SV2H 2FZZA 2CHAB 3FFGA 1HAOH 4IN1A 2SGQE 2A4QA 4IMZA 2FWWA 3KL6A 3PLKA 3UNQA 4O03A 1S6FA 5CHAB 1BTXA 1J9CH 3W95A 1C5LH 6GCHF 3RXVA 3ATWA 5F03A 1P9SA 1ANBA 3EYDA 3ZZ5A 1GBLA 1HAIH 1UVSH 2PGBB 1V2QT 3SNAA 3GY2A 3UNRA 1GHXH 2D2DA 2I6QA 3RC5A 5GCHF 2AMDA 5ESTE 1UTOA 1TQ0B 3SQEE 2ZHQH 1FZZA 4WJG2 3QTVH 2RG3A 1V2JT 2XBYA 3QZRA 2IOTA 1MTVA 3ODFA 4GHQA 4UE7H 1PJPA 1ORFA 1GJ9B 3RM2H 1UVTH 1PPGE 2O8LA 3M5NA 2NWNA 1GI8B 2WINI 1Y5UT 1YC0A 1NU9A 3U98H 1OWJA 3ZVEA 1NFYA 1O3PB 5E0JA 1OS8A 1S6HA 4WMFA 1ZRBA 1E35B 1WUNH 1VGCC 5FX6A 1TPOA 4E06H 1HAGE 3MU1A 1BBRH 3SJ9A 2VWOA 3ZVBA 3AASA 4JMYA 1GJ5H 1GMDG 4AFZA 1D6WA 4GCHG 1WYKA 2BD3A 1LHGH 3K9XB 5JBBS 8KME2 1JXPA 3UOPA 2ZFSA 2XCFA 1FNIA 4YOIA 1NM6A 1OWIA 1AIXH 2F9OA 2ODYB 1C2GA 1EPTA 4THNH 5EPYA 1V2VT 1G3CA 2UUKB 3KHVA 1FONA 2H9TH 4OGXA 4BAMB 2W26A 1ZPBA 1THSH 1SHYA 3TJNA 1Z6EA 1EPTC 2W7UA 3M3TA 3UTUH 1BUIA 4X6PA 1ESAA 2ZO3H 1FMGA 1CVWH 1AQ7A 5EQQA 3SV8A 3ODDA 1UCYE 1ZHRA 3GY3A 2XRCA 4AG1A 2K1QA 3S0NA 4JZEH 1MTNC 2GX4A 3CS7A 2AS9A 5HXFA 3PB1E 1P57B 1PFXC 2FS8A 1TE0A 3C1KA 1XXFA 2XBVA 4I8HA 1JRSA 3SV9A 1UK2A 2Z3DA 4MDSA 2BY6X 5LPEA 2A2QH 4A92A 1C1UH 3KF2A 1WAYB 1K1JA 1T4VH 1EUFA 2A45B 3F6UH 4Q7ZA 2FS9A 2ZKSA 1TX8A 4JCNA 1MZAA 3BIUH 3EDXB 1Q31A 1O2RA 4FUDA 4CRDA 1NFUA 1QB6A 1G30B 2VGCC 1BDAA 4AN7A 1IQKA 1TNJA 1UTMA 1K1MA 4UEHH 1EPTB 1O2JA 4CBOA 1Q2WA 1TX6A 1TONA 3TJVA 1O3LA 2ZG0H 3CP7A 1F5LA 2B0FA 1DSTA 1O5FH 3QO6A 3Q77A 2OCVB 3TJOA 2ZHDA 4Y6DA 5EU8A 1MTNB 4CH8B 3RXGA 1TGNA 2ZP0H 3M5OA 1GG6C 2BDHA 1GJDB 3ZVFA 1O5BB 4AFQA 2GV6A 2W3KA 3D49H 1L4ZA 4YLQH 1O3HA 1QJ7B 1O3KA 3B9FH 1K21H 1SBWA 1QCPA 1Q3XA 1ZJDA 3V12A 2VWNA 3BIVH 3O8CA 3TVJB 3P8OA 3F9FA 1Z8JB 4I7YH 3BG8A 1H1BA 2HWLB 2VGCB 2A32A 2PUQH 3A80A 3EA8A 3TH4H 1CA8B 1CE5A 2WPLS 4CRFA 2Y80A 4LK4A 4X6OA 4NG9H 2NU2E 1SFIA 3ZVCA 1Z1IA 4I31A 4AFUA 3HKJB 5J4QA 1C9PA 2R9PA 2ZU4A 2ZDVH 4K1EA 4IGDA 2GT8A 1JIMA 1D9IA 5FPTA 1RTFB 2ZFTA 3HGNA 1CBWC 4R0IA 2PKAA 3OSYA 4E05H 1BTUA 2NU1E 3LH3A 3UQOA 1XXDA 1KXEA 1UTPA 4ISNA 2OLGA 5F8TA 9ESTA 2HRVA 3K65B 5FBEA 2GDDA 3TH2H 1ZJKA 1NRSH 3F9EA 4J2YB 5LGOA 3TITA 3GY8A 1C5NH 1T8LA 3A7ZA 1MQ5A 1EZXC 1LHEH 3STJA 3BTEE 4Y71A 4IC5A 5FPSA 4XFQA 4NZQA 2XCNA 1O2MA 3SQHE 3SNEA 5K0HA 4BNRA 4U2WA 1CO7E 4I32A 3ZZ6A 2OC0A 1SLUB 2Z9KA 2QV1A 2Y5GA 1HAXB 3SO3A 3NK8A 5JBAS 1FN6A 3H5CB 1NO9H 3QZQA 3UQVA 3Q3XA 2P93A 4K1SA 4ISLA 1C2EA 2EI8A 5C1YA 1VJ9U 1Z8RA 4Y7AA 2RA0A 1P2NA 1FAKH 4NIWA 5E2OA 4ZXXH 5DP6A 3BTGE 4X1PU 3SW2B 2TGPZ 1HAYB 2PKAB 1GDUA
chains in the Genus database with same CATH superfamily
1A5HA 1O3FA 3SU5A 5FCRA 4AFSA 4IBLH 4BOHA 3A7TA 2BZAA 2HNTC 2ZTYA 3FAOA 3NZIA 1O5EH 1T8NA 3RU4E 3SU4A 4VGCC 2XC0A 3OAAD 1UCYK 1OHHD 1Y3XA 6CHAC 7GCHF 2GJGA 2V7QD 1QQUA 1YWUA 2BZ6H 2F83A 1WOFA 5TCCA 2XNDD 2FYQA 3SNBA 3V13A 1V3XA 1E0FD 1DLEA 3O8BA 1P03A 4JYTA 2W6ID 3DCLA 1TAWA 1C5RA 3S9BA 4ZCNA 1KXDA 4D8NA 1FI8A 5F6MA 2ULLA 4ZKOU 4Y76A 5GPIB 5DP8A 2FP7B 2H6MA 4NWLA 2O9QA 1ELGA 2BY7X 3RLWH 1ABJH 3GICB 2Z9GA 4GSOA 4CREA 4LOYH 4JYVH 2SGEE 1SR5C 1S5SA 2BLOA 1YYY1 2QY0B 1S85A 2QN5T 1O36A 1P2JA 5DKMA 3M5MA 2PGQB 3ZZDA 3UR6A 2BDGA 2M5TA 1O3EA 5L2ZH 1GBBA 1O3CA 1TPPA 3PWCA 2VWMA 4X8UH 4VGCB 3TLOA 6CHAB 1DSUA 5EJ1A 1MAXA 1DX5M 1GI0A 1SGTA 2PP6A 1SMFE 3A8CA 1YF4A 3RXCA 1TMUH 2J98A 1TNLA 1LHCH 1AKSA 4I8JA 1OYTH 3A7WA 1HFDA 1DXWA 1BRBE 3UY9A 1WU1A 1SGQE 2OP9A 2FPZA 1DE7H 3GCOA 4ACBA 2G55A 3BG4C 1CGHA 5HGGA 1O32A 2QF4A 1T32A 4ZKSU 3A7VA 2ZTXA 4HGCA 2P94A 2WV9A 4ZHMU 1AU8A 4B76A 4WXVA 1EOJA 1Z7KA 1ANEA 1MD8A 1IQGA 1V2RT 1P01A 2C90B 4Y11E 1GPZA 2PFEA 4FUHA 1F0SA 1UCYH 2F9VA 5HM2A 1VITG 2G4UA 1IQJA 1C5XB 5KEDA 3H7OA 5FHTA 2QAAA 4IMQA 1C2HA 1SGPE 2YMSC 1ELTA 4KTSA 3GY5A 1ARCA 4INLA 1J14A 1DWDH 2K8IA 2Y5HA 2C3SA 2BD8A 5EW1H 4FETA 2NU4E 3IITA 1QHRB 1ZSLA 2TGAA 2KAIA 2EI7A 3BG4B 2CF8H 1FY1A 2J98B 1KTTB 3TGKE 4H6TA 1AKSB 2BOHB 4FUEA 3BTWE 3TGJE 5JB8S 3KNXA 4ABFA 5I46H 1FY3A 1O30A 1NZQH 5C1UA 2BY9X 1HUTH 2A1DB 2EY4C 1SQAA 1SLWB 1GMHF 4X1NU 1MTUA 2NU0E 1HAVA 2BM2A 2CMYA 5FX5A 1E1QD 4SGAE 5LH8A 2TGDA 4A5TS 1SGIB 5I25A 1GL1A 2VNTA 3WWFA 4MQAA 3ATKA 4NFEA 4DIHH 2GGVB 2AGGX 2BLVA 2BQWB 4U01A 1MKXK 2YMSB 2Y81A 1S84A 2FMJA 3SOSA 1SGEE 4DGJA 1ZRKA 2OQ5A 3D62A 5C0UA 1H4WA 5HMAA 1F2SE 1Z8IB 1UTJA 1WCZA 1FXYA 3ZZ7A 1DXPA 3KN2A 2GTBA 4X2YA 1RS0A 1J16A 2NU3E 2Q6FA 1AZ8A 1BTHH 1PPFE 5C5NA 3ZZ9A 4LXBH 3SZNA 1FPHH 1CHGA 2PTNA 2WYGA 1HV7A 1YCPM 4D9QA 1AN1E 2DUCA 1XVOA 1MTSA 1E1RD 3SBKA 1P05A 2R2MB 4K69A 3TU7H 3Q76A 3ZVDA 6GCHG 1D3PB 2KAIB 2QA9E 2YOLA 1O2HA 1EJMA 1O3BA 4F4OC 1P10A 2GD4B 2PKAB 2V0BA 1C1WH 1C5VA 1IQEA 2QF5A 1NU7B 3T27A 2XYAA 3RXHA 1QY6A 1CT0E 3BSQA 1O3DA 2FLRH 2GVFA 1RTLA 3QUMP 3U8RH 2BVRH 3GISB 5GCHG 3U8TH 1N8OB 1HAVB 2HPQH 2YNAA 3E0NB 1K1NA 2BDCA 2ZC9H 3SHCH 3TK5A 2F9BH 2JIZD 4ZH8A 1UVOA 2H5CA 1YY3A 4X8SH 1F0UA 4Y0YE 4TSFD 2FO9A 1UTQA 3E3TA 5A8YA 1K1OA 3VFEA 5C2ZA 1FJSA 3RXPA 2BD4A 3UPEA 2ZDMA 2Q6GA 3SJ8A 2GCHF 2XXLA 5DP5A 3OTJE 4ZXYH 1SGFG 2PUXB 2LPRA 2G5NA 4MG3A 2ZZUH 2Q1JA 4Q7YA 2WUBA 1TGSZ 3PV2A 1BTWA 4OS1A 1NN6A 3MH7A 5AVDA 2PKSC 3RLYH 3VB6A 5K7RA 2ASUB 1ARBA 1WXRA 1THRH 1GWAA 2R0KA 4F49A 1YPEH 3KQCA 4X6MA 3M7QA 3NUMA 9LPRA 5GIBA 1MKXH 2EEKA 3ZZBA 2QIQA 5EG4A 2W3IA 3PV4A 1BHXB 3F68H 4O3TA 3DA9B 2UUYA 4H42U 1SVPA 5DN6D 2B9LA 3MHWU 4AYYB 1GJCB 1DDJA 1TBZH 1G2LA 1C5SA 3PO1C 1AGJA 1FPCH 5EQSA 1YPMH 2ZQ1A 1EX3A 1SGFA 1O2UA 3MU0A 1GI4A 3V0XA 2BTCE 4Y8ZA 2BB4A 3RXJA 3SORA 1MUEB 3I78A 4B2AA 3A86A 4IN2A 1HBTH 1A1RA 1PPEE 3N7OA 3N7DA 4NA9H 4FUJA 1BQYA 3FN8A 5EQRA 2THFB 3PMAB 2O8UA 5C17A 2J95A 4XD7D 1V2PT 2C8WB 3KEEA 3A82A 3SJKA 4DW2U 3NRLA 2PKSB 5GXPA 1MKWH 1QQ4A 1ZZZA 1RGQA 3GDSA 4WF8A 1ELVA 1L1GA 3H7TA 2WPDD 1F0RA 1NFXA 1P2OA 1KXCA 5SGAE 1ZPCA 5BPEA 4LZ4B 5LPFA 2A2XH 1BMAA 2ZPRA 2Z3EA 4FOUC 1TABE 1TOMH 3PO1B 4D9RA 1NRNH 1TOCB 1GJAB 1O33A 1FY5A 2VIPA 4Z1MD 4UFEH 2OC7A 1ZOMA 2HNTE 3F0PA 2JETC 4P00A 1KDQA 2M2AA 5FXLA 1V2WT 4YOGA 1XVMA 3PTNA 2ZI2H 3QWCH 1HAHH 5EJLA 1K9OE 3GCTF 1QA7A 5DSFA 1GGDC 2UWPA 2AIPA 1DT2A 1O3JA 2PLXA 4AG2A 2ZPQA 2FLBH 5EPNA 3LU9B 1O38A 3OX7U 1O2OA 1HPGA 2ZWLH 3BF6H 1C1SA 3RDZA 1FIZA 1GHZA 1D6RA 4I8KA 3SU3A 1S0QA 1Y8TA 2C4FH 1GBTA 2ZHFH 4YT6H 3RXLA 1PQAA 1QRXA 3QK1A 1O2ZA 4CRAA 2BY8X 1VGCB 2UWOA 4TY7A 2FI5E 4KTUA 3PROA 1T8MA 1H8IH 5EODA 4WXIA 3GY7A 3FZZA 1O2WA 3DT0H 2BQ7B 1NPMA 2O8TA 2SGDE 3E91A 3FANA 2AYWA 2FEQH 4A1XA 1JRTA 2R3YA 1V2ST 5TJXA 4Y10E 3UR9A 3F2FA 1MZDA 1QTFA 2FI3E 4ISOA 4DT7B 3CS0A 1LO6A 1V6DA 4NCYA 4M7GA 3S7HB 5LPRA 3UOUA 1ID5H 2IJD1 3FZDA 2B7DH 3PLBA 3G01A 1C9TA 4X8VH 1GGDB 1UVPA 2OC8A 1HRTH 1B5GH 4OS7A 2GZ8A 1W3CA 2J38A 3ENSB 4FU9A 3SNCA 2KX4A 3VEQB 3BN9A 1FN8A 2D1JA 3EGKH 5DG6A 1AWFH 7KMEH 3MH6A 4NWKA 4X1RU 1HJ9A 2KCAA 2BVSH 1OYQA 1JIRA 4A1VA 2FOAA 4E7NA 3M35A 5IYTA 3T2NA 1UO6A 4BAOB 4DIIH 1O37A 2D8WA 4NGAH 4ZKNU 1O3MA 3E6PH 3SUDA 2ZHWH 4LZ1H 1ZHPA 2VWLA 1UHBA 2STAE 2ZA5A 3MNXA 1O2NA 5E8EH 3L6PA 3HK6B 3K6YA 1XUIA 3S9AA 1KLTA 1O2GH 3RXEA 5JBCS 1TX7A 4FU8A 4O97A 4B2CA 2L74A 4FU7A 3U28C 3A84A 3VXFH 1UMAH 4CHAC 2LELA 3DUXH 1TBRH 3SZEA 4GLYA 4WMDA 1S81A 4UFFH 3ATMA 1A5IA 2KZ4A 6ESTA 3PMBB 2YNBA 4MPVA 3S69A 1O2VA 1ZR0A 1DY9A 1PYTC 1RRKA 1YCPK 3OTPA 4YZUA 4AZ2B 2XNIA 5A8ZA 2VVVA 1KTSB 2BMGB 5FBIA 5F53A 4SGBE 1DLKB 2RCEA 1T7CA 1KLJH 4Q63A 1UW7A 4ISHH 3I77A 4BTUB 4WWYA 3RMOH 4UD9H 1AUTC 2XBWA 1O3GA 1OWDA 2G8TA 4P02A 4DURA 2CGAA 1C5OH 1E38B 3KCGH 2ESTE 1TQ7B 5G4BA 3AK5A 5EW2H 1AFEH 2QXIA 1GG6B 1V2NT 1WV7H 2ALPA 2ODPA 1VKYA 1KIGH 7GCHG 1RTKA 2H2ZA 1GI9B 1QURH 1ELCA 4JYUH 4B75A 4H6SB 4MNXA 1MBQA 2YMSD 3GDVA 4XBDA 1UHBB 1N6XA 1P02A 3LPRA 1ZMJA 2Y5FA 5HIZA 2XOKD 1GBMA 1SQTA 1T31A 1LTOA 3LGUA 5JPMH 2VH0A 1W0ZU 1G3EA 2BY5X 3NPSA 2FXRA 1DUEA 4IS5A 3PYHA 1W13U 1C1TA 1K2I1 3CNRA 2VVCA 4FUIA 4ZHLU 1P12E 1HDTH 1QJ1B 4ZHAA 1GBJA 3LC5A 2KM0A 1GVZA 3MNCA 4NSVA 3LGTA 1OSSA 1C4Y2 1AWHB 4AORA 1P2IA 1ELEE 4QT8C 2ZFFH 4TYDA 4B1TA 4B6FA 4AB9A 3PV5A 1O34A 2A5AA 3OE7D 1W0JD 2FOMB 1DWCH 1O5DH 4MNWA 3F9HA 2JH5D 1CBWB 2WUCA 1TRNA 5BRRE 2ZHEH 5CDFE 1HIAA 5E2PA 1ETSH 2ZGXH 3F0OA 3LT3A 3MNBA 4OGYA 2XWBI 3I29A 1GI7B 4I33A 4ESTE 2ZCHP 1CA0C 4AC9A 1W2KH 1OX1A 3EA7A 4NA8A 2ZDAH 4I86A 5DPAA 8GCHF 3HPTB 2QF0A 1MCTA 1YCPH 4K3JA 1OKXA 3URDA 1ACBE 1CT4E 1X7AC 1CT2E 2WPIS 2CJIA 1O39A 4OS4A 3NWUA 1EZUC 3M36A 1G3BA 4XSKU 2B8OH 1GBAA 1C1MA 3BTME 4ZUHA 3FP6E 1QZ8A 3L3TA 3GY6A 5ABWA 2HALA 1LDTT 2H5DA 1HYLA 4AGKA 1G37A 3QGJA 3OU0A 4FVDA 1GCTC 4Q7XA 4YOJA 4A7IB 1P2KA 2PW8H 3U1IB 3A8BA 1SQRA 1C5PA 5GNDA 1QJ6B 1C1QA 3RXQA 1C2FA 1AZZA 2KCYA 2C8YB 1YBWA 4GAWA 1GHWH 2OINA 3PWBA 1XKAC 4BXWA 1CA0B 1U6QA 4MPXA 4X1SU 3M3SA 3VB5A 3ZZ8A 2BLWA 1BRUP 2A5IA 3SV6A 1Y3WA 4HTCH 1O0DH 1HIAB 1TRMA 1QA0A 4BXSA 1ELAA 3GOVB 2BD2A 4CH2B 2PSXA 2ZGBH 2ANWA 3TGIE 3S9CA 2VJ1A 5A2MH 4CBNA 1IAUA 5F8ZA 2G51A 3VB7A 3OEED 5KECA 4Z6AH 1TMBH 1ZTKA 1C5YB 3U9AH 3A7YA 1Y3VA 1W8BH 3ZZ3A 3MU4A 1GHAF 1EXFA 1SC8U 1GCTB 2AGEX 2P3TB 2VIOA 1WQVH 2Z9IA 1GMHG 3RXSA 1GBEA 1P11E 1XMNB 2EI6A 4ABAA 3RXKA 3EQ0H 1QB9A 2ZU3A 2WPHS 4ABEA 3ZVGA 2R0LA 4X2WA 3VPKA 1DOJA 4IC6A 3P92A 1TWXB 2HLDD 1SOZA 1O3IA 2Y7ZA 1C5QA 3KQDA 1TRYA 4TWWA 5ESBA 4JK6A 2BDBA 1BA8B 4M9FA 1KMHB 4NZLA 2BXTH 3STIA 2P3FH 2VH6A 1AUJA 4OS6A 5ETXA 1O2SA 4RT1A 1YPHC 3TJUA 5JYIA 1IHSH 5CMXH 4K8BA 4CRGA 1GJ8B 2A0QB 1QGFA 1E36B 4AOQA 1GI3A 2BD5A 5A09A 1BOQA 1FIWA 2GV7A 5DGJA 1SQOA 3QLPH 1H8HD 1F0TA 4WY3A 2CV3A 1B0FA 2FOBA 1Y5BT 3RC6A 1IQHA 4YO9A 1SLVB 1GBIA 1C2LA 1KYNA 2TBSA 3AVZA 1NTPA 2Y7XA 4ABDA 2EC9H 3BTFE 1QIXB 1GHYH 2CN0H 4ABJA 3RXUA 4DY7B 2VIQA 3FO8D 1A0LA 3Q3YA 5AFZH 1AD8H 2ZFQH 1FV9A 1V2MT 1DFPA 1WTGH 2I6SA 2FM2A 1H8DH 1TGTA 4FUBA 1KSNA 2TGTA 1YLNA 1V2LT 4IW4E 1WTHD 3T26A 1GBKA 2SNVA 5AHGH 2DE9A 1KY9A 1IHTH 2FDAA 5EXNA 4WH8A 2ANYA 1A2CH 2GCHG 3KQBA 3SUEA 1YPJH 2EQNA 5T6DA 1ANCA 1PPZA 2WV5A 1GI2A 3E1XB 1TNIA 1MQ6A 4MNYA 4X0WU 2TRMA 1GI6A 4ACAA 1K1LA 1YKTA 1AVWA 4XOJA 1DY8A 4RKOB 1YPKH 1OP8A 1OXGA 2WPKS 5DP3A 3UWJH 1DPOA 1S82A 3NKKA 2JH6D 1A0HB 4Y7BA 2P16A 4OS2A 1V2OT 2VIVA 1RD3B 2HPPH 1B7XB 2BDAA 2GP9B 1ANDA 4O3UA 5C3NA 1C1VH 1G36A 3B8JA 1PPHE 5B6OA 1BTYA 4ASHA 2IJOB 2OC1A 2HVYB 2C8XB 3GY4A 1AMHA 2F9NA 3RXIA 3RMNH 1GDQA 1EB1H 4WMEA 3URCA 2FODA 1O2IA 1EAXA 1VITF 4GVUA 1Y3YA 4INKA 3U69H 4WH6A 4TPIZ 3K6ZA 1O2PA 1LKAA 2WPJS 1CHOF 4Y79A 1V2UT 2OTVA 2PSYA 2F91A 2FOFA 2R3UA 1VITH 1EP6A 1UJ1A 2KCOA 1K28D 4NSYA 4K8YA 1Z6JH 4FUCA 2V3HH 5PTPA 1F5RA 3BV9B 3DD2H 2PHBA 5E0HA 1FLEE 1SLXB 1ELFA 1SG8B 4FVBA 4YTAA 2Z9LA 5DP9A 1TNGA 1C1OA 1EAUA 3HKIB 3EA9A 2KCPA 4BAQB 3QTOH 2B5TB 1YM0A 2VB0A 1P04A 5A8XA 4KGAA 3M7UA 5EOKA 3K2UA 2JDID 1H9LB 1GDNA 2TPIZ 2O8MA 1L2EA 4JZDH 4B71A 1ELBA 3Q3KA 3UAIC 2P59A 1KXAA 3LOXA 1LMWB 1GVKB 1DANH 4UONA 2ZQ2A 1GMCF 1XKBC 3MWIU 4MVNA 5FCKA 4DVAU 2HVXA 2XC4A 4KKDA 1QL8A 1AHTH 3PMJA 5AFYH 3SHAH 2AMQA 2A7JA 1EAIA 1EAWA 1XUHA 3GCTG 1WBGB 1ZLRA 2OXSA 2ZCKP 3M3VA 3SU2A 4JZIA 2BDIA 3BTKE 2H9EH 1EQ9A 2F9PA 5C20A 3RXAA 3RXMA 1NROH 2ZDNA 4DOQA 4ZAEA 2XTTB 1BTZA 3AW1A 4CRBA 2A5KA 1PYTD 4YLUA 3BTTE 4NIVA 4X8TH 3ZZAA 2WPMS 3ZZCA 2QYIA 3LJJA 4X2VA 5DJ7A 1QL7A 1HXEH 3ITIA 1A3EH 4HZHA 1EJAA 1GL0E 3FOAA 2H9HA 2G5VA 1PQ8A 3EE0B 3HATH 1C2DA 1RFNA 1D4PB 3FKSD 1VCWA 3RXBA 3GS9A 5L6NH 1C1PA 1QRWA 4MPWA 3OY6U 1P06A 3SJIA 2RDEA 4ABHA 1BB0B 5J4SA 1HGTH 2J34A 2BX4A 1K1PA 1P3CA 1ETTH 1IOEA 3PRBA 1UTLM 1TPSA 1O31A 1TIOA 1HAZB 1GHBF 1GI1A 3GDUA 1IQFA 3MFJA 4K1TA 3TPIZ 4K2YA 3RP2A 3PLPA 2FX4A 2VBCA 1C2KA 2ANMH 1XX9A 2SGFE 1QNJA 1QRZA 3SU6A 3SI4H 1XUKA 1BRCE 5IDKA 2ZIQH 1P3EA 1P9UA 2FOCA 2J94A 4ABGA 1DM4B 2JH0D 2A4OA 1KLIH 1SI5H 4A1TA 3R3GB 1BMNH 1S83A 3OFND 3LC3A 5A0CA 2P8OC 1DICA 3EAJA 2ZU1A 3ESTA 1BIOA 1IQMA 1DS2E 2ZU5A 1C5ZB 3DFLA 4NIXA 4D7GA 2QGRA 1ZTLA 1QBOA 4Q2KA 2OBOA 1M9UA 2STBE 3D23A 1C4U2 2GKVE 1A0JA 1OWKA 2A7HA 3RXDA 1YLCA 3SNDA 4RN6A 4XBCA 2Z9JA 3MMGA 2ILNA 5JDUB 3GCHC 4Z0KA 1BMMH 1ZMLA 4XDEA 3ZZ4A 3UNSA 2XC5A 1DUAA 1GCDA 3IG6B 2IPQX 1NBMD 3SUFA 1C5UA 3LH1A 3BEFB 2GCTC 1HCGA 2BQ6B 1SOTA 2HLCA 1FAXA 2RA3A 2H1UA 3MQKC 1TGCA 1EP5A 3M61U 2JETB 3KGPA 2Z3CA 2AGIX 3PM3A 2IN2A 2C8ZB 3BTDE 2SFAA 1WSSH 3D65E 2W7SA 3AW0A 1TA2A 1UK3A 2A31A 2J4IA 4TPYA 4NIYA 1KDQB 3O8DA 3TK6A 1ZSJA 2P8OB 3HK3B 2BHGA 1ZTJA 2BD9A 1TGBA 4ZROA 3RMMH 4BANB 1EZQA 3TK9A 2CF9H 1BRAA 2F43B 2Z94A 3MI4A 4D76A 1RIWC 1HAPH 5DP7A 1HXFH 3RXTA 2QC2A 1LKBA 3A88A 1NY22 2BD7A 3GCHB 1JOUB 4UFGH 1UK4A 3FP7E 1MMJN 3RMLH 3TH3H 2BYAX 3SU0A 3TNTA 4AYVB 2ANKH 1QL9A 1GBHA 1O2TA 2AERH 3VB3A 3IWMA 2GCTB 3RXRA 1DWBH 1VCQA 3ZYEA 1XM1A 3NCLA 4UDWH 2ZPSA 2BDYA 1GMDF 1OOKB 5GJ4B 1V2KT 1GBFA 4GCHF 8LPRA 3SUGA 1YPHE 3C27B 1J17T 1SGCA 1EATA 1SPJA 1A4WH 4R8TB 2PWXA 4ASUD 1FX0B 2J2UA 1H9HE 4NFFA 3JZ2B 2O8WA 3P95A 2SGPE 2ZFRH 2ODQA 1O2KA 4RKJB 2VIDA 2ZFPH 5C94A 4Y8XA 3SGBE 3T62A 1P09A 1W7XH 2SNWA 3A89A 3RUOA 2G00A 2V6NA 3MTYA 4XE4A 3WWBA 1GI5A 1AE8H 1DITH 1RIWB 1ETRH 2XW9A 3KQ5A 3F2GA 2BVXH 8ESTE 3QGNB 2DE8A 3UUZA 8GCHG 1GVLA 1ZGIA 3FP8E 3SGQE 1L1NA 1CQQA 4XBBA 2V3OH 2TIOA 2GT7A 2W5EA 4GPGA 4FUGA 1NESE 5H4IB 3DHKH 3RXOA 3BTQE 2V35A 1MTWA 2FOHA 1EJNA 1AY6H 1MBMA 3DSPA 1RXPA 3TIUA 2FESH 1C4V2 4DG4A 3AAVA 2WYJA 2C93B 2A4GA 2FI4E 4MTBA 2IPHA 1Y5AT 4CR5A 4MLFB 4RI0A 1TA6A 4KP0A 2V3MA 3E90B 1G2MA 3VGCC 7ESTE 1K22H 5HIYA 5CE1A 1AVGH 5GDSH 2ZGHA 5DO4H 3QX5H 4CHAB 1A61H 2OUAA 1C2IA 1INCA 4HI3A 3V3MA 1GJBB 4DT4A 1YP9A 2RDLA 3ZV9A 2Z6BD 1D3DB 1S0RA 1AVXA 1ESTA 5TCAA 2ZGCA 1P2MA 3P8NA 5HYOA 1XUJA 2GZ9A 1JMOH 1MU6B 4CR9A 1CGIE 3LGIA 1LHFH 4OS5A 1C1RA 5T6GA 1GJ7B 5E0GA 4Y8YA 1VR1H 1SGNE 1W10U 3E0PB 4J1YA 2QXGA 2Y6TA 1EASA 1AFQC 1UTKA 3PTBA 1OP2A 4CRCA 1A5GH 4RT0A 4B74A 3ZV8A 1ESBA 1OPHB 1WDIA 4YXWD 3DSGA 1GHAG 1P8VC 5A0AE 1G3DA 1D3TB 2OBQA 3KYFA 1IQLA 3VGCB 3O8RA 4JK5A 1O2XA 5T3HA 3MO3A 1VZQH 1TNKA 2SGAA 1O5AB 1FDPA 2JJ1D 1AI8H 4PROA 3VB4A 1A3BH 2G81E 1TPAE 1ELDE 3M7TA 3GYLB 1GBDA 3SN8A 6LPRA 2J9NA 5EJZA 3RC4A 1GBCA 3SV7A 3AAUA 1NFWA 1BT7A 1CSOE 3RXFA 4FUFA 4YT7H 1DWEH 2ZTZA 4KELA 1LQDB 1NT1A 1VJAU 2PTCE 4RSPA 1RJXB 2R2WU 2JKHA 1F5KU 4ZMAH 3W94A 2ZGJA 4JZ1A 1AFQB 4B2BA 1LPZB 4X1QU 1GJ6A 2WHXA 1NC6A 2UWLA 1LHDH 5AF9H 2OK5A 1Z1JA 4XRNA 3UWIA 1TFXA 1AB9C 1HJAC 2AFQB 3LIWA 3M37A 3MH4A 4KTCA 1NS3A 3SU1A 1GHVH 1O2LA 5T6FA 3P6ZB 1T8OA 1C5MD 1EOLA 4TWYA 4E7RG 5KGOA 3FVFB 3MU5A 4YESB 4I8GA 4X6NA 5C1XA 2HNTF 5DP4A 1AO5A 1W12U 2PV9B 4ABIA 1BBRE 3MU8A 4FXGH 2A4RA 2OQUA 1BITA 3ZYDA 1J8AA 1L1JA 3KYGA 3UREA 4U30A 4DJZB 2K0QA 1O3OA 3KIDU 3W1EA 1T4UH 4HFPB 1P0SH 1JBUH 1MU8B 2GMTC 1HNEE 1K1IA 3CENA 3RU4D 3SYJA 1D3QB 1N6YA 1UVUH 4H4FA 1IQIA 3MO9A 3F1SB 1O2YA 3HGPA 1N1LA 1BJVA 2VINA 4AB8A 1YPLH 1LQEA 5DK1A 1LPKB 3V7TA 3UIRA 1SGRE 1YLDA 2FOEA 4YM9A 4BAHB 3L33A 1FQ3A 1KXBA 1G32B 5HM9A 5JBTA 2OD3B 1G9IE 1XUGA 4MPUA 1E79D 1QR3E 5EXMA 1AB9B 1HJAB 4K5ZA 2ZCLP 1FY4A 4GHTA 3B23B 3P8FA 2FIRH 1CGJE 1LCYA 1SHHB 1ZSKA 1YPGH 1TYNA 3MYWA 1PQ5A 1W11U 3LKWA 4ISIH 2VVUA 2Z7FE 3UB0A 4F55A 3SI3H 2Y82A 1ZHMA 1P2QA 3MO6A 2FX6A 4UFDH 3BEUA 2HGTH 3UFAA 3N7EA 3E8LA 2D26C 1BJUA 1ZPZA 3SGAE 2UUFB 3LDXH 2GMTB 1W14U 4I8LA 4BAKB 3QN7A 3S7KB 4TY6A 3OYPA 1LVMA 3LJOA 2AEIH 4AX9H 2QXJA 2ALVA 3BEIB 1AE5A 1LVYA 2VU8E 1CHOG 2VIWA 1F7ZA 1THPB 4DCDA 1QBNA 2ZU2A 5FAHA 1H9IE 3LGYA 1L0ZA 1EB2A 2KR7A 1Y59T 4BTTB 5L2YH 2WV4A 2FTLE 2J92A 3H09A 2UUJB 1BCUH 1QBVH 1BMLA 5EGMA 2AH4X 1NRQH 3P8GA 3ZVAA 2XWAA 1HLTH 3F3BA 3A83A 5F8XA 1V2TT 2P3UB 2A7CA 4K60A 4AGJA 3GCNA 2PR3A 1E37B 1SFQB 3ZIAD 4D7FA 2ZECA 1DVAH 1SGYE 3MNSA 4GUXA 3R0FA 1C2JA 2XBXA 3U1JB 4X2XA 3LGWA 3T25A 2P95A 7LPRA 5JB9S 3T29A 3PMHB 4TT3D 3KQEA 2EA3A 5B6LA 3A8DA 2HOBA 1GMCG 1O3NA 1CU1A 1A46H 1SB1H 1N8OC 2ZNKH 2QCYA 1HJ8A 1TBQH 2RFKC 1O35A 1O5GH 3P17H 1XUFA 1QB1A 3M5LA 4OM9A 5EXLA 5C5OA 3TNSA 1EKBB 1PPBH 3ELAH 3A81A 4Y0ZE 4ABBA 5C67A 3LGVA 1ZYOA 3ATLA 3PRDA 4NA7A 4Q4LA 4Q80A 3MH5A 1TMTH 2GZ7A 1O2QA 3DFJA 1C2MA 4O9VA 1EZSC 1B0EA 1FY8E 3OY5U 1TALA 2AIQA 1SSXA 3T28A 1W7GH 3WY8A 1HB0B 5L30H 2QXHA 3ATIA 1J15A 1KXFA 1LVOA 3GYMA 2BX3A 3RM0H 3A8AA 3VXEH 1OWEA 4JZFH 1W0KD 1Z71A 1GJ4H 2ZDKA 1JWTA 2BXUH 1WQSA 3E16B 2BLQA 1FUJA 3Q00A 2W6JD 3F9GA 3NXPA 4A6LA 1C5TA 1MKWK 2FOGA 3BTHE 1MAYA 1EFRD 1TNHA 1SGDE 2FYRA 5CHBA 2CHAC 3A87A 4WVPE 1SKYE 5CHAC 4B73A 3SJOA 1SL3A 1NRRH 1YGCH 1F92A 1GHBG 1ZMNA 2ZF0H 1TB6H 1A7SA 2BOKA 2ZDLA 3A7XA 1Z8GA 2AMPA 3MOCA 4BTIB 5A0BA 3JZ1B 3QDZB 1LPGB 3LONA 1BBRK 2G52A 2G4TA 5C0TA 2CXVA 1NRPH 1QFKH 1VCPA 1E34B 1ABIH 1OWHA 2Q6DA 4INHA 2F9UA 1IQNA 3RU4T 1L4DA 3T5FH 1MD7A 1ZGVA 2LNCA 1MCVA 1C5WB 1BHXF 4ZKRU 2GDEH 1C1NA 2F3CE 1MH0A 1PQ7A 1BTPA 1BZXE 1W0YH 5GWZA 1O5CB 1UTNA 2QF3A 1Y3UA 1O3AA 1PPCE 2FTMA 3U8OH 4U32A 2ZEBA 1LVBA 5FPYA 3A85A 4MNVA 3P70B 1TLDA 3SV2H 2FZZA 2CHAB 3FFGA 1HAOH 4IN1A 2SGQE 2A4QA 4IMZA 2FWWA 3KL6A 3PLKA 3UNQA 4O03A 1S6FA 5CHAB 1BTXA 1J9CH 3W95A 1H8ED 1C5LH 6GCHF 3RXVA 4B6EA 3ATWA 5F03A 1P9SA 1ANBA 3VG8A 3EYDA 3ZZ5A 1GBLA 1HAIH 1UVSH 2PGBB 1V2QT 3SNAA 3GY2A 3UNRA 1GHXH 2D2DA 2I6QA 3RC5A 2AHME 5GCHF 2AMDA 5ESTE 2J97A 1UTOA 5EIYA 1TQ0B 3SQEE 2ZHQH 2WZQA 1FZZA 4WJG2 3QTVH 2RG3A 1V2JT 2XBYA 3EE7A 1NBME 3QZRA 2IOTA 1MTVA 3ODFA 4GHQA 4UE7H 1PJPA 1ORFA 1GJ9B 3RM2H 1UVTH 1PPGE 2O8LA 3M5NA 2NWNA 1GI8B 2WINI 1Y5UT 1YC0A 5FL7D 1NU9A 3U98H 1OWJA 3ZVEA 1NFYA 1O3PB 3OEHD 5E0JA 1OS8A 1S6HA 4WMFA 1ZRBA 1E35B 1WUNH 1VGCC 5FX6A 1TPOA 4E06H 1HAGE 3MU1A 1COWD 1K0HA 1BBRH 3SJ9A 5IK2D 2VWOA 3ZVBA 2WSSD 3AASA 4JMYA 1GJ5H 1GMDG 4AFZA 1D6WA 4GCHG 1WYKA 2BD3A 1LHGH 3K9XB 5JBBS 8KME2 1JXPA 3UOPA 2ZFSA 2XCFA 1FNIA 4YOIA 1NM6A 1OWIA 1AIXH 2F9OA 2ODYB 1C2GA 1EPTA 4THNH 5EPYA 1V2VT 1G3CA 2UUKB 3WW7A 1MABB 1FONA 3KHVA 2H9TH 2L6OA 4OGXA 4BAMB 2W26A 1ZPBA 1THSH 1SHYA 3TJNA 1Z6EA 1EPTC 2W7UA 3M3TA 3UTUH 1BUIA 4X6PA 1ESAA 2ZO3H 1FMGA 1CVWH 1AQ7A 5EQQA 3SV8A 3ODDA 1UCYE 1ZHRA 3GY3A 2XRCA 4AG1A 2K1QA 3S0NA 4JZEH 1MTNC 2GX4A 3CS7A 2AS9A 5HXFA 3PB1E 4HG6A 1P57B 1PFXC 2FS8A 3F2HA 1TE0A 3C1KA 1XXFA 2XBVA 4I8HA 1BMFD 1JRSA 3SV9A 1UK2A 2Z3DA 4MDSA 2BY6X 5LPEA 2A2QH 4A92A 1C1UH 3KF2A 1WAYB 1K1JA 1T4VH 1EUFA 2A45B 3F6UH 4Q7ZA 2FS9A 2ZKSA 1TX8A 4JCNA 1MZAA 3BIUH 3EDXB 1Q31A 1O2RA 4FUDA 4CRDA 1NFUA 1QB6A 1G30B 2VGCC 1BDAA 4AN7A 1IQKA 1TNJA 1UTMA 1K1MA 4UEHH 1EPTB 1O2JA 4CBOA 1Q2WA 1TX6A 3N99A 1TONA 3TJVA 1O3LA 2ZG0H 3CP7A 1F5LA 2B0FA 1DSTA 1O5FH 3QO6A 3Q77A 2OCVB 3TJOA 2ZHDA 4Y6DA 5EU8A 1MTNB 4CH8B 3RXGA 1TGNA 2ZP0H 3M5OA 1GG6C 2BDHA 1GJDB 3ZVFA 1O5BB 4AFQA 2GV6A 2W3KA 3D49H 4F48B 1L4ZA 4YLQH 1O3HA 1QJ7B 1O3KA 3B9FH 1K21H 1SBWA 2LP6A 1QCPA 1Q3XA 1ZJDA 3V12A 2VWNA 3BIVH 5HKKD 3O8CA 3TVJB 3P8OA 3F9FA 1Z8JB 4I7YH 3BG8A 1H1BA 2HWLB 2VGCB 2A32A 2PUQH 3A80A 3EA8A 3TH4H 1CA8B 1CE5A 2WPLS 4CRFA 2Y80A 4LK4A 4X6OA 4NG9H 2NU2E 1SFIA 3ZVCA 1Z1IA 4I31A 4AFUA 3HKJB 5J4QA 5T1VA 1C9PA 2R9PA 2ZU4A 2ZDVH 4K1EA 4IGDA 2GT8A 1JIMA 1D9IA 5FPTA 1RTFB 2ZFTA 3HGNA 2JJ2D 1CBWC 2CK3D 4R0IA 2PKAA 3OSYA 4E05H 1BTUA 2NU1E 3LH3A 3UQOA 1XXDA 1KXEA 1UTPA 4ISNA 2OLGA 5F8TA 9ESTA 2J5UA 2HRVA 3K65B 5FBEA 2GDDA 3TH2H 1ZJKA 1NRSH 3F9EA 4J2YB 5LGOA 3TITA 3GY8A 1C5NH 1T8LA 3A7ZA 1MQ5A 1EZXC 1LHEH 3STJA 3BTEE 4Y71A 4IC5A 5FPSA 4XFQA 4NZQA 2XCNA 1O2MA 3SQHE 3SNEA 5K0HA 4BNRA 4U2WA 1CO7E 4I32A 3DSOA 3ZZ6A 2OC0A 1SLUB 2QE7D 2KFWA 2Z9KA 2QV1A 2Y5GA 1HAXB 3SO3A 3NK8A 5JBAS 1FN6A 3H5CB 1NO9H 3QZQA 3UQVA 3Q3XA 2P93A 4K1SA 4ISLA 1C2EA 2EI8A 5C1YA 1VJ9U 1Z8RA 4Y7AA 2RA0A 1P2NA 1FAKH 1S6LA 4NIWA 5E2OA 4ZXXH 5DP6A 3BTGE 4X1PU 3SW2B 2TGPZ 1HAYB 1OP0A 2F4LA 1GDUA
chains in the Genus database with same CATH topology
1A5HA 1O3FA 3SU5A 5FCRA 4AFSA 4IBLH 4BOHA 3A7TA 2BZAA 2HNTC 2ZTYA 3FAOA 3NZIA 1O5EH 1T8NA 3RU4E 3SU4A 4VGCC 2XC0A 1UCYK 1Y3XA 6CHAC 7GCHF 1QQUA 2BZ6H 2F83A 1WOFA 5TCCA 2FYQA 3SNBA 3V13A 1V3XA 1E0FD 1DLEA 3O8BA 1P03A 4JYTA 1TAWA 1C5RA 3S9BA 1KXDA 4D8NA 1FI8A 5F6MA 2ULLA 4ZKOU 4Y76A 5GPIB 5DP8A 2FP7B 2H6MA 4NWLA 2O9QA 1ELGA 2BY7X 3RLWH 1ABJH 3GICB 2Z9GA 4GSOA 4CREA 4LOYH 4JYVH 2SGEE 1SR5C 1S5SA 2BLOA 1YYY1 2QY0B 1S85A 2QN5T 1O36A 1P2JA 5DKMA 3M5MA 2PGQB 3ZZDA 3UR6A 2BDGA 2M5TA 1O3EA 5L2ZH 1GBBA 1O3CA 1TPPA 3PWCA 2VWMA 4X8UH 4VGCB 3TLOA 6CHAB 1DSUA 1MAXA 1DX5M 1GI0A 1SGTA 1SMFE 3A8CA 1YF4A 3RXCA 1TMUH 1TNLA 1LHCH 1AKSA 4I8JA 1OYTH 3A7WA 1HFDA 1DXWA 1BRBE 3UY9A 1WU1A 1SGQE 2OP9A 2FPZA 1DE7H 3GCOA 2G55A 3BG4C 1CGHA 5HGGA 1O32A 1T32A 4ZKSU 3A7VA 2ZTXA 4HGCA 2P94A 4ZHMU 1AU8A 4B76A 4WXVA 1EOJA 1Z7KA 1ANEA 1MD8A 1IQGA 1V2RT 1P01A 2C90B 4Y11E 1GPZA 2PFEA 4FUHA 1F0SA 1UCYH 2F9VA 5HM2A 1VITG 2G4UA 1IQJA 1C5XB 3H7OA 5FHTA 2QAAA 4IMQA 1C2HA 1SGPE 1ELTA 4KTSA 3GY5A 1ARCA 4INLA 1J14A 1DWDH 2Y5HA 2C3SA 2BD8A 5EW1H 2NU4E 3IITA 1QHRB 1ZSLA 2TGAA 2KAIA 2EI7A 3BG4B 2CF8H 1FY1A 1KTTB 3TGKE 4H6TA 1AKSB 2BOHB 4FUEA 3BTWE 3TGJE 5JB8S 3KNXA 4ABFA 5I46H 1FY3A 1O30A 1NZQH 5C1UA 2BY9X 1HUTH 2A1DB 1SQAA 1SLWB 1GMHF 4X1NU 1MTUA 2NU0E 1HAVA 2BM2A 2CMYA 5FX5A 4SGAE 5LH8A 2TGDA 4A5TS 1SGIB 5I25A 1GL1A 2VNTA 4MQAA 3ATKA 4NFEA 4DIHH 2GGVB 2AGGX 2BLVA 2BQWB 4U01A 1MKXK 3SOSA 2Y81A 1S84A 2FMJA 4DGJA 1SGEE 1ZRKA 2OQ5A 3D62A 1H4WA 5HMAA 1F2SE 1Z8IB 1UTJA 1WCZA 1FXYA 3ZZ7A 1DXPA 3KN2A 2GTBA 4X2YA 1RS0A 1J16A 2NU3E 2Q6FA 1AZ8A 1BTHH 1PPFE 5C5NA 3ZZ9A 4LXBH 3SZNA 1FPHH 1CHGA 2PTNA 2WYGA 1HV7A 1YCPM 4D9QA 1AN1E 2DUCA 1XVOA 1MTSA 3SBKA 1P05A 2R2MB 4K69A 3TU7H 3Q76A 3ZVDA 6GCHG 1D3PB 2KAIB 2QA9E 2YOLA 1O2HA 1EJMA 1O3BA 4F4OC 1P10A 2GD4B 2V0BA 1C1WH 1C5VA 1IQEA 1NU7B 3T27A 2XYAA 3RXHA 1QY6A 1CT0E 3BSQA 1O3DA 2FLRH 2GVFA 1RTLA 3QUMP 3U8RH 2BVRH 3GISB 5GCHG 3U8TH 1N8OB 1HAVB 2HPQH 2YNAA 3E0NB 1K1NA 2BDCA 2ZC9H 3SHCH 3TK5A 2F9BH 4ZH8A 1UVOA 2H5CA 4X8SH 1F0UA 4Y0YE 2FO9A 1UTQA 3E3TA 5A8YA 1K1OA 3VFEA 5C2ZA 1FJSA 3RXPA 2BD4A 3UPEA 2ZDMA 2Q6GA 3SJ8A 2GCHF 2XXLA 5DP5A 3OTJE 4ZXYH 1SGFG 2PUXB 2LPRA 2G5NA 4MG3A 2ZZUH 2Q1JA 4Q7YA 2WUBA 1TGSZ 1BTWA 4OS1A 1NN6A 3MH7A 5AVDA 2PKSC 3RLYH 3VB6A 5K7RA 1ARBA 2ASUB 1THRH 1GWAA 2R0KA 4F49A 1YPEH 3KQCA 4X6MA 3M7QA 3NUMA 9LPRA 5GIBA 1MKXH 2EEKA 3ZZBA 2QIQA 5EG4A 2W3IA 3PV4A 1BHXB 3F68H 4O3TA 3DA9B 2UUYA 4H42U 1SVPA 2B9LA 3MHWU 4AYYB 1GJCB 1DDJA 1TBZH 1G2LA 1C5SA 3PO1C 1AGJA 1FPCH 5EQSA 1YPMH 2ZQ1A 1EX3A 1SGFA 1O2UA 3MU0A 1GI4A 3V0XA 2BTCE 4Y8ZA 2BB4A 3RXJA 3SORA 1MUEB 3I78A 4B2AA 3A86A 4IN2A 1HBTH 1A1RA 1PPEE 3N7OA 4NA9H 4FUJA 1BQYA 5EQRA 2THFB 3PMAB 2O8UA 2J95A 1V2PT 2C8WB 3KEEA 3A82A 3SJKA 4DW2U 2PKSB 5GXPA 1MKWH 1QQ4A 1ZZZA 1RGQA 3GDSA 4WF8A 1ELVA 1L1GA 3H7TA 1F0RA 1NFXA 1P2OA 1KXCA 5SGAE 1ZPCA 5BPEA 4LZ4B 5LPFA 2A2XH 1BMAA 2ZPRA 2Z3EA 1TABE 1TOMH 3PO1B 4D9RA 1NRNH 1TOCB 1GJAB 1O33A 1FY5A 2VIPA 4UFEH 2OC7A 1ZOMA 2HNTE 2JETC 1KDQA 5FXLA 1V2WT 4YOGA 1XVMA 3PTNA 2ZI2H 3QWCH 1HAHH 1K9OE 3GCTF 1QA7A 1GGDC 2UWPA 2AIPA 1DT2A 1O3JA 2PLXA 4AG2A 2ZPQA 2FLBH 5EPNA 3LU9B 1O38A 3OX7U 1O2OA 1HPGA 2ZWLH 3BF6H 1C1SA 3RDZA 1FIZA 1GHZA 1D6RA 4I8KA 3SU3A 1S0QA 1Y8TA 2C4FH 1GBTA 2ZHFH 4YT6H 3RXLA 1PQAA 1QRXA 3QK1A 1O2ZA 4CRAA 2BY8X 1VGCB 2UWOA 4TY7A 2FI5E 4KTUA 3PROA 1T8MA 1H8IH 5EODA 4WXIA 3GY7A 3FZZA 1O2WA 3DT0H 2BQ7B 1NPMA 2O8TA 2SGDE 3E91A 3FANA 2AYWA 2FEQH 4A1XA 1JRTA 2R3YA 1V2ST 5TJXA 4Y10E 3UR9A 1MZDA 1QTFA 2FI3E 4ISOA 4DT7B 3CS0A 1LO6A 1V6DA 4NCYA 4M7GA 3S7HB 5LPRA 3UOUA 1ID5H 3FZDA 2B7DH 3PLBA 3G01A 1C9TA 4X8VH 1GGDB 1UVPA 2OC8A 1HRTH 1B5GH 4OS7A 2GZ8A 1W3CA 2J38A 3ENSB 4FU9A 3SNCA 3VEQB 3BN9A 1FN8A 2D1JA 3EGKH 5DG6A 1AWFH 7KMEH 3MH6A 4NWKA 4X1RU 1HJ9A 2BVSH 1OYQA 1JIRA 4A1VA 2FOAA 4E7NA 3M35A 5IYTA 3T2NA 1UO6A 4BAOB 4DIIH 1O37A 2D8WA 4NGAH 4ZKNU 1O3MA 3E6PH 3SUDA 2ZHWH 4LZ1H 1ZHPA 2VWLA 1UHBA 2STAE 2ZA5A 3MNXA 1O2NA 5E8EH 3L6PA 3HK6B 3K6YA 1XUIA 3S9AA 1KLTA 1O2GH 3RXEA 5JBCS 1TX7A 4FU8A 4O97A 4B2CA 4FU7A 3A84A 3VXFH 1UMAH 4CHAC 3DUXH 1TBRH 4GLYA 4WMDA 1S81A 4UFFH 3ATMA 1A5IA 6ESTA 3PMBB 2YNBA 4MPVA 3S69A 1O2VA 1ZR0A 1DY9A 1PYTC 1RRKA 1YCPK 4YZUA 4AZ2B 2XNIA 5A8ZA 2VVVA 1KTSB 2BMGB 5FBIA 4SGBE 1DLKB 2RCEA 1T7CA 1KLJH 4ISHH 3I77A 4BTUB 4WWYA 3RMOH 4UD9H 1AUTC 2XBWA 1O3GA 1OWDA 2G8TA 4DURA 2CGAA 1C5OH 1E38B 3KCGH 2ESTE 1TQ7B 5G4BA 5EW2H 1AFEH 2QXIA 1GG6B 1V2NT 1WV7H 2ALPA 2ODPA 1KIGH 7GCHG 1RTKA 2H2ZA 1GI9B 1QURH 1ELCA 4JYUH 4B75A 4H6SB 4MNXA 1MBQA 3GDVA 4XBDA 1UHBB 1N6XA 1P02A 3LPRA 1ZMJA 2Y5FA 1GBMA 1SQTA 1T31A 1LTOA 3LGUA 5JPMH 2VH0A 1W0ZU 1G3EA 2BY5X 3NPSA 2FXRA 1DUEA 4IS5A 3PYHA 1W13U 1C1TA 1K2I1 2VVCA 4FUIA 4ZHLU 1P12E 1HDTH 1QJ1B 4ZHAA 1GBJA 3LC5A 3MNCA 1GVZA 4NSVA 3LGTA 1OSSA 1C4Y2 1AWHB 4AORA 1P2IA 1ELEE 4QT8C 2ZFFH 4TYDA 4B1TA 4AB9A 1O34A 2A5AA 2FOMB 1DWCH 1O5DH 4MNWA 3F9HA 2JH5D 1CBWB 2WUCA 1TRNA 5BRRE 2ZHEH 1HIAA 5E2PA 1ETSH 2ZGXH 3LT3A 3MNBA 4OGYA 2XWBI 3I29A 1GI7B 4I33A 4ESTE 2ZCHP 1CA0C 1W2KH 1OX1A 3EA7A 4NA8A 2ZDAH 5DPAA 8GCHF 3HPTB 2QF0A 1MCTA 1YCPH 4K3JA 1OKXA 3URDA 1ACBE 1CT4E 1X7AC 1CT2E 2WPIS 2CJIA 1O39A 4OS4A 3NWUA 1EZUC 3M36A 1G3BA 4XSKU 2B8OH 1GBAA 1C1MA 3BTME 4ZUHA 3FP6E 3L3TA 3GY6A 5ABWA 2HALA 1LDTT 2H5DA 1HYLA 4AGKA 1G37A 3QGJA 3OU0A 4FVDA 1GCTC 4Q7XA 4YOJA 4A7IB 1P2KA 2PW8H 3U1IB 3A8BA 1C5PA 1QJ6B 1C1QA 3RXQA 1C2FA 1AZZA 2C8YB 1YBWA 4GAWA 1GHWH 2OINA 3PWBA 1XKAC 4BXWA 1CA0B 1U6QA 4MPXA 4X1SU 3M3SA 3VB5A 3ZZ8A 2BLWA 1BRUP 2A5IA 3SV6A 1Y3WA 4HTCH 1O0DH 1HIAB 1TRMA 1QA0A 4BXSA 1ELAA 3GOVB 2BD2A 4CH2B 2PSXA 2ZGBH 2ANWA 3TGIE 3S9CA 2VJ1A 5A2MH 4CBNA 1IAUA 5F8ZA 2G51A 3VB7A 4Z6AH 1TMBH 1ZTKA 1C5YB 3U9AH 3A7YA 1Y3VA 1W8BH 3ZZ3A 3MU4A 1GHAF 1EXFA 1SC8U 1GCTB 2AGEX 2P3TB 2VIOA 1WQVH 2Z9IA 1GMHG 3RXSA 1GBEA 1P11E 1XMNB 2EI6A 4ABAA 3RXKA 3EQ0H 1QB9A 2ZU3A 2WPHS 4ABEA 3ZVGA 2R0LA 4X2WA 3VPKA 1DOJA 4IC6A 3P92A 1TWXB 1SOZA 1O3IA 2Y7ZA 1C5QA 3KQDA 1TRYA 4TWWA 5ESBA 4JK6A 2BDBA 1BA8B 4NZLA 2BXTH 3STIA 2P3FH 2VH6A 1AUJA 4OS6A 5ETXA 1O2SA 1YPHC 3TJUA 5JYIA 1IHSH 5CMXH 4K8BA 4CRGA 1GJ8B 2A0QB 1QGFA 1E36B 4AOQA 1GI3A 2BD5A 5A09A 1BOQA 1FIWA 2GV7A 5DGJA 1SQOA 3QLPH 1F0TA 4WY3A 2CV3A 1B0FA 2FOBA 1Y5BT 3RC6A 1IQHA 4YO9A 1SLVB 1GBIA 1C2LA 1KYNA 2TBSA 3AVZA 1NTPA 2Y7XA 4ABDA 2EC9H 3BTFE 1QIXB 1GHYH 2CN0H 4ABJA 3RXUA 4DY7B 2VIQA 1A0LA 3Q3YA 5AFZH 1AD8H 2ZFQH 1FV9A 1V2MT 1DFPA 1WTGH 2I6SA 2FM2A 1H8DH 1TGTA 4FUBA 1KSNA 2TGTA 1V2LT 4IW4E 1WTHD 3T26A 1GBKA 2SNVA 5AHGH 2DE9A 1KY9A 1IHTH 2FDAA 5EXNA 4WH8A 2ANYA 1A2CH 2GCHG 3KQBA 3SUEA 1YPJH 5T6DA 1ANCA 1PPZA 2WV5A 1GI2A 3E1XB 1TNIA 1MQ6A 4MNYA 4X0WU 2TRMA 1GI6A 1K1LA 1YKTA 1AVWA 4XOJA 1DY8A 4RKOB 1YPKH 1OP8A 1OXGA 2WPKS 5DP3A 3UWJH 1DPOA 1S82A 3NKKA 2JH6D 1A0HB 4Y7BA 2P16A 4OS2A 1V2OT 2VIVA 1RD3B 2HPPH 1B7XB 2BDAA 2GP9B 1ANDA 4O3UA 5C3NA 1C1VH 1G36A 3B8JA 1PPHE 5B6OA 1BTYA 4ASHA 2IJOB 2OC1A 2C8XB 3GY4A 1AMHA 2F9NA 3RXIA 3RMNH 1GDQA 1EB1H 4WMEA 3URCA 2FODA 1O2IA 1EAXA 1VITF 4GVUA 1Y3YA 4INKA 3U69H 4WH6A 4TPIZ 3K6ZA 1O2PA 1LKAA 2WPJS 1CHOF 4Y79A 1V2UT 2OTVA 2PSYA 2F91A 2FOFA 2R3UA 1VITH 1EP6A 1UJ1A 1K28D 4NSYA 4K8YA 1Z6JH 4FUCA 2V3HH 5PTPA 1F5RA 3BV9B 3DD2H 2PHBA 5E0HA 1FLEE 1SLXB 1ELFA 1SG8B 4FVBA 4YTAA 2Z9LA 5DP9A 1TNGA 1C1OA 1EAUA 3HKIB 3EA9A 4BAQB 3QTOH 2B5TB 1YM0A 2VB0A 1P04A 5A8XA 4KGAA 3M7UA 5EOKA 3K2UA 1H9LB 1GDNA 2TPIZ 2O8MA 1L2EA 4JZDH 4B71A 1ELBA 3Q3KA 2P59A 1KXAA 3LOXA 1LMWB 1GVKB 1DANH 4UONA 2ZQ2A 1GMCF 1XKBC 3MWIU 4MVNA 5FCKA 4DVAU 2HVXA 2XC4A 4KKDA 1QL8A 1AHTH 3PMJA 5AFYH 3SHAH 2AMQA 2A7JA 1EAIA 1EAWA 1XUHA 3GCTG 1WBGB 1ZLRA 2OXSA 2ZCKP 3M3VA 3SU2A 4JZIA 2BDIA 3BTKE 2H9EH 1EQ9A 2F9PA 5C20A 3RXAA 3RXMA 1NROH 2ZDNA 4DOQA 4ZAEA 2XTTB 1BTZA 3AW1A 4CRBA 2A5KA 1PYTD 4YLUA 3BTTE 4NIVA 4X8TH 3ZZAA 2WPMS 3ZZCA 2QYIA 3LJJA 4X2VA 5DJ7A 1QL7A 1HXEH 3ITIA 1A3EH 4HZHA 1EJAA 1GL0E 2H9HA 2G5VA 1PQ8A 3EE0B 3HATH 1C2DA 1RFNA 1D4PB