1O3RA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
total genus 64
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3rA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3rA01
2NRAC 1BC7C 1PDNC 2E1CA 4MGIE 5FO5A 3R4KA 4HX7A 4DINB 3H92A 4RB3C 1MZBA 2RN7A 1QBJA 4TLFA 4I02A 4QM9A 4M71A 5ICCA 2JPCA 2H6BA 5ED4A 3D5LA 3E6CC 2VOOA 4EM2A 1UCRA 4FX4A 5D8KB 1OYWA 3SHRA 1WRJA 2IA0A 2Z3YA 2D93A 1FZPB 1XRUA 3ZN1A 2KJBA 4Q5SF 4YFXF 1J3QA 1FBQA 4IEXA 3EJKA 2Z9OA 2V1DA 2FMYA 4N0BA 3ZPLA 3NSTA 3BWGA 1ZARA 2CAVA 2PN6A 4PCQA 2W57A 2GWRA 1U5TC 2R3SA 3GX4X 4G7ZF 2GC3A 4GXOA 2STWA 5KHKA 4HN1A 2F5DA 1PM7A 5IT9Z 4EROA 1I6XA 2JT1A 2P6SA 5E8IA 3CJXA 3U1DA 1HSTA 1DPUA 1O3RA 4OOIA 5C6CA 1FX7A 1Q1HA 3KLOA 3MQ0A 5F64A 5JSOA 4JQFA 5K1YA 2QM3A 2O3FA 2BGCA 1VTNC 3T5XA 4MTDA 3V8LA 2HQRA 1FSEA 5L3FA 2HFHA 5A2QK 1TQ5A 2EA7A 1T0FA 3JZVA 2KIUA 2PHDA 1G4DA 3L2HA 4HSLA 2QYOA 4PIZA 1W7PA 2Q8KA 1YLFA 5JVTA 1ZH5A 2A6HF 1JUHA 1YHFA 4EJWA 2YX4A 2K0GA 2X4HA 2WFPA 2FQ3A 2XRNA 4ENJA 2CFXA 2FBIA 4LB6B 5KHIA 1BIBA 3BROA 2D2WA 4XF4A 3GVAA 1R58A 4P9UA 3SXYA 5HOOA 3I4PA 3GFMA 2PG4A 3OGJA 2HWVA 1LDKB 1TQPA 4L9VA 3USSA 2QJVA 1IRFA 3LA2A 4Z82A 3OCPA 2LF7A 5K5RA 3J80K 4MGKE 4FBFA 4YSFA 2ZCWA 3WW2A 3FM5A 3PNAA 3HQXA 5I91A 4Q0SA 5LEJA 1IUYA 3WTWC 2PI0A 5D5WB 1PUEE 2XGXA 1Q5OA 2PMHA 5ILSA 5DDGA 2J5PA 4IF4A 2XUBA 1IN7A 2HKOA 3JSOA 3WTYC 1FP1D 2DK5A 2A07F 5JR3A 5HI0A 3UKVA 1FXZA 4IEUA 4LLNA 1VJ2A 5HLGA 3LA3A 4GYGA 1LVAA 5ILUA 2A69F 1OD5A 1OPCA 3NQOA 3ELNA 5KBFA 3MZHA 2E1NA 2HYFA 5DUIA 1EH7A 4XFBA 3K2ZA 2DW4A 3TDZC 2PYTA 3C3WA 4FAHA 5LHHA 1FP2A 3ABUA 2PAEA 3QAHA 4L0ZB 2MHFA 2CQKA 1CAVA 3WTZA 2DFIA 3LWFA 4MGRA 2O03A 1KYWA 1CF7A 4IEYA 3RKXA 1J7KA 4GULA 4G7HF 2ISZA 1J1LA 2YPRA 5J6XA 4YARA 2NAZA 5J8FA 4BHPA 4ZH4F 5L3DA 3WTXC 2ZXJA 2PHLA 3IWZA 4M9XA 4CXFA 3P9CA 3MEXA 2PFWA 4XFIA 1BI3A 5BS6A 1LEBA 1XDSA 3V7SA 4ESBA 1J0RA 1KU2A 4UVCA 4IVNA 1ZG1A 3R61A 2D5HA 5F6FA 2IXLA 1RUNA 4P96A 3GEZA 3ACLA 1U2WA 2HEOA 4LULA 4EJVA 1IN5A 1R22A 1QWRA 2VN2A 1S29A 1UHMA 5JFRA 2NNYA 1P4XA 3ZP5A 4UV8A 5LHGA 4I3PA 2D1HA 3IC7A 5D5UB 2D1VA 3GWZA 5D6EA 3QU6A 1MJAA 3HSFA 4M9SA 3OTFA 4KWJA 4LK0F 3DXJF 4K2EA 3NKTA 4HW0A 1KQ0A 3OD0A 2GU9A 2KIFA 1CAWA 1MJ9A 4PJYA 4EWAA 4RGUA 2VC1A 3QACA 5FFXA 2ZNZA 1ZZ9A 1GQGA 2VT3A 4QWQA 2L54A 2FF4A 4O9EA 2DQRA 2EB7A 3E3VA 2QWWA 1O5UA 4BQAA 1TW2A 2XVCA 3BOQA 3JTHA 4LUKA 1F1ZA 5CLSA 1ON2A 3IL2A 1UFMA 1DGRA 4XLNF 5KK1A 4IETA 2JZYA 1JGSA 3EQEA 3RKWA 4L18B 3E5QA 3GXOA 1ZLJA 3LQRA 5KHHA 4Q0PA 2V6CA 3BPVA 4FHTA 2GC0A 1XSVA 1X8MA 2ZKZA 4QMAA 5H6RA 2K9ZA 4K8FA 4IRGA 4LFUA 4EJOA 3IWFA 2DTRA 4EQQA 1FC3A 1XCBA 3HRUA 1WLTA 2PAKA 4ZZDA 2XAFA 4X6RB 4CDGA 3RPQA 4A2UA 3K69A 5TRDA 3UKNA 1XD7A 1SAXA 1O5LA 3CO6C 3I7DA 2D40A 3I54A 1LJ9A 2DPDA 4CGZA 2K4JA 3I53A 2O1QA 1Y0UA 2D5FA 4RGSA 4IEZA 4RS8A 3KSCA 4HV6A 3TDUC 5HDKA 3V7RA 2RV8A 1X3UA 3NEUA 3WW3A 1X7NA 2XKOA 2BYVE 3FWEA 5JAXA 2QBYB 3BJ6A 1YO5C 3H50A 2L4MA 4ZU5A 4CYDA 2XLFA 5DCMA 1W7PD 3LFKA 1GXPA 3M70A 5LRRA 4RB2C 1P6RA 4O5VA 2RC4A 3DN7A 1XDUA 1SD5A 4XF0A 3S0MA 5DD8A 4ZYHA 4AQ2A 1O57A 3GW2A 4I09A 1UW8A 2IP2A 1ZGAA 2Q0OA 5E1ZB 4X6QB 3IDCB 3HOSA 1QZZA 3KMHA 3TO7A 1XGOA 4F7ZA 5KHGA 3HT2A 4I0BA 1C0WA 4OFGA 3O6BB 3KEQA 3GLXA 1PP8F 4UVAA 1ZG3A 3RJPA 4YFKF 1O3SA 2VE8A 4KA4A 4YG2F 2QUFA 3CL1A 1P2FA 2QBYA 2DO7A 4WF2A 4UXAA 1LKNA 1SEFA 1F5TA 2RNJA 2PBIA 2RGVA 1FYKA 2Y0OA 2A5YB 2MC3A 4A0YA 1PMIA 2HOEA 4KU7A 4HX8A 5BPIA 1DUXC 3PLQA 1F9NA 2OU2A 3WW4A 3LOIA 2V1XA 1R1TA 2DI3A 2ZFWA 3DFGA 4E2QA 5E8GA 1UB9A 5DCMB 5I0TA 3KLNA 4JTNA 2RDPA 2QZ8A 5FDBA 1SD7A 1WKMA 2IVMA 3G3ZA 2IT0A 3D0JA 2OBPA 3FZVA 1R00A 3WU0A 3H8UA 4HLTA 4LA3A 5K8SA 3PVBB 4HYEA 1R23A 2F4PA 1RGSA 2ZO4A 2XHKA 2DLLA 1CAVB 5DCFA 1EV7A 4B8XA 4NHJA 4QXKA 2GXGA 3ETQA 1BOAA 4WVZA 5DD4A 3V8JA 3FF5A 3SFZA 1SQ4A 1H9GA 3EO6A 1IN4A 3P7NA 3C1DA 4IRHA 1WQ2A 1CAUB 2ATFA 4AQ6A 2ACJA 3H3ZA 3KP7A 1XGSA 3BU7A 5FLJA 4ENKA 5I8YA 3ML6A 2UYBA 4HVQA 4I7HA 5FQ0A 4L5IA 5EFUA 1ZZ6A 2PTMA 3UKTA 4GO1A 5E18F 3S7IA 3NVCA 1NZCA 1RI7A 1R36A 4WXCA 3JSPA 2FA5A 2CGPA 3O14A 3JAMK 4R8HA 1S8NA 3KEOA 2M1BA 1DZTA 5D4SA 3MYXA 4A5MA 1RL3A 1HBXG 4AIKA 4HVOA 4RAYA 1SD4A 4UBGA 1NXMA 1ZNPA 2GH2A 2W24A 2MD5A 1ZN2A 4UBHA 2G7HA 4WK8F 3QP6A 5BUVA 5J48A 4D7SA 3U0ZA 3LSTA 4RB1A 1Z05A 1RUOA 5E1RA 1YFWA 2YX7A 2DT5A 1JHFA 4BH9A 3F3XA 1IXRC 1B4AA 1UHWA 3CUOA 1FY7A 3FXRA 4EGYA 2VONA 2G7UA 4FX0A 3COAC 1REPC 4ZYEA 3DP7A 1H1IA 1IN8A 4ZU7A 4I0AA 1XE7A 4DNCA 5EEHA 3JAMZ 2Z69A 4GCVA 2RKHA 4Z2YA 4IHTA 1A04A 3L7WA 3ABTA 1X82A 3J7AO 2HQNA 3M3IA 4MNUA 1FLIA 3EETA 2PLYA 4XBFA 3WTSC 4AXOA 5IT9K 2G9WA 4KDPA 4I2OA 1SD6A 2M5WA 2A68F 2WV0A 4CICA 2JPBA 3SZPA 2Y75A 5JSPA 1DZRA 1SFNA 3R6SA 2QNKA 3DF8A 1U78A 1BI2A 2V1UA 4J1XA 4XRFA 2DU9A 1U5TA 3I59B 2MH9A 1GXQA 4IEOA 4QGLA 1GVJA 1CGPA 4RGXA 4LLOA 3EQLF 1IAWA 6PAXA 3VOEA 1XSXA 2CWEA 3WE3A 1OYIA 2BEOA 3V7CA 2VODA 1K6OA 3H1YA 4L9NA 5FLIA 3MFKA 1HKSA 4FT8A 1YFHA 2NYXA 2KKOA 5A2QZ 3GFJA 3F6OA 2UZKA 4PDKA 1ONVA 4IERA 1USTA 2F5FA 5EZWA 4E2SA 2DQLA 3I64A 2VECA 1DPRA 3V8KA 4A0ZA 4IEVA 4P9GA 1IW7F 4IPAA 3S2WA 1D3YA 4U7DA 4AD9A 2VBZA 1ZG5A 1BC8C 4KIFA 2EWNA 1BI0A 1ON1A 4HDUA 2A3SA 1IRGA 2XV4S 3VEPA 2UWMA 2OD5A 1KA8A 3I5UA 4PIXA 1WSUA 2P5LC 4YIFA 1TTYA 2A6EF 4XF3A 4OIPF 4TV7A 3U9GA 4EGZA 1QNTA 5D4RA 5E1XA 3H7JA 1MD0A 1UPIA 3IBMA 4B29A 1ZRFA 2ZBKA 4ORFA 2XL7A 4ZU4A 1E17A 2X0LA 3EBRA 1YFYA 1RC6A 3K1NA 1IXSB 5E20A 1CAWB 4L5JA 1G3SA 3L2CA 3WU1B 3FXQA 1WGPA 4A5NA 3FHIB 2H0VA 1H0MA 4MGYE 3KCCA 1VR3A 4L0YB 2HTJA 5CVJA 3QU3A 3KP3A 2CYYA 5ERIA 1I1SA 2EA4A 4I98B 4ENMA 4JTOA 3TNPB 5FPXA 1O4TA 3RKYA 1BI1A 3SMHA 3WGHA 1IF1A 2EFPA 5AVPA 3ZN0A 3TOBA 5EEGA 2W84A 2B0LA 2P5KA 3ZMDA 3RPUA 3MWMA 4E2GA 1XMKA 2F5EA 4UUVA 2XAQA 4A6DA 3G7DA 4LB5A 2QQ9A 4KN7X 3F23A 4CZZA 3IIAA 2HS5A 1CAXA 1IPJA 2V9VA 3EYYA 4JV4A 2YR2A 2ETHA 4NQWA 3KGLA 2GIVA 1YTYA 3MPBA 2WTEA 4KUMA 5E1WA 2HYGD 3TGNA 1XE8A 4DQ2A 1RZ4A 4U0WA 4EJUA 2EFQA 3JTGA 5IT3A 4HZFA 1RIOH 4MX3A 4U7BA 1R5GA 3FXUA 3F21A 4XFCA 4ENNA 3RNSA 4BXUA 1I1GA 3HT1A 3H1WA 4M9ZA 1IXCA 3NJZA 1JXSA 4B09A 1U6GA 3E6MA 4O9GA 5AIPA 3ZMZA 2Z2SB 2OYZA 3DV8A 3LAPA 3R0JA 4P55A 1SFUA 3TKYA 1YW7A 5DYMA 4L2NA 1UIKA 5CADA 3LQQA 2CO5A 2EV6A 3VB2A 1K78A 3O3KA 3TNQA 2W25A 2HZTA 4UNOA 2H27A 2AXLA 4LG0A 4D0PA 3ZDSA 3HHGA 3H9AA 5BXXA 5KVRA 1S7OA 1TW3A 3K1MA 3T1BA 1H1MA 2E7XA 4ETSA 5L3GA 4WCGA 2MBFA 4MH0E 2M8EA 4MZUA 1D8KA 2RQPA 1J75A 2IC1A 4L9TA 3ZMSA 1R7JA 2BBYA 4HLXA 4KNYA 4HSJA 5LGTA 1SMTA 2OA2A 4D7TA 4WX9A 5FFZA 3H3UA 1ZZ8A 2IXIA 1XMAA 1FSHA 2DCTA 3WGIA 2I45A 4L11A 4FAGA 1KU3A 4LUMA 3ES4A 1GHCA 1MJBA 1ZZ7A 1YWKA 5H20A 3CUQC 3F72A 2W85A 1YFUA 2STTA 3DKWA 2Y0MA 2ADUA 1HQCA 3PFIA 4Y13A 3CO2A 4HA8A 1HW1A 1FBSA 2F2EA 3K9TA 2P8TA 1U5TB 1Z1DA 4EWEA 1O7LA 4S05A 3KP2A 1QXRA 2CV6A 4HN0A 5T3NA 2F5CA 4KFCA 1PP7U 4HQMA 2IXHA 5J3UA 5L3CA 4WWCA 3FZ3A 2VQAA 2V09A 4META 2DPUA 3HTUA 4XF1A 3FHZA 4XSZF 4XLPF 1O7FA 2DBBA 1TNTA 1FWZA 3BPZA 5H6QA 1ZRDA 5C8WA 3SCFA 1BBYA 1I5ZA 4BHBA 5K5OA 1NE6A 4KL1A 1W5SA 4EWDA 3CF6E 1NE4A 4YRDA 3ERED 3CUQA 4KU8A 2D45A 2VOPA 4AVCA 2HR3A 3DEUA 1E2XA 3GZ5A 5LGUA 2QCSB 3MDPA 1J2XA 3SHFA 5FQ0B 2BV6A 5BV6A 3B02A 5JHUA 3F8FA 2B5HA 2OA4A 1P4WA 3RIRA 1ZLKA 1ZVFA 3GYDA 2OAZA 3IDBB 2YSRA 2BNMA 3I59A 2K7LA 5CVUA 4Q0UA 2GA1A 2LDUA 3EDPA 4U88A 1L3JA 3B73A 5I8SA 2VE9A 2CAUA 1ZGJA 4BHCA 3HYIA 4R1HA 4MV2A 3M7GA 4MUVA 5HVQC 2Q2EA 5FPZA 1W5TA 2QQAA 1Z91A 4HF2A 3U10A 4IEWA 2RVCA 1YQAA 4P5OA 4MTEA 4IJAA 5HS9A 1J3PA 1XCVA 4UVBA 1STZA 5LBQA 2O61A 3KZYA 2FU4A 1W7PB 3EYIA 1EP0A 3IRRA 2E7WA 2J5OA 2L4AA 2MA3A 4BNCA 3L09A 3LA7A 5CYVA 4R52A 3E97A 4E70A 1NYWA 1OYYA 1J5YA 2ESHA 4WBBA 1KGSA 3CUQB 3TO6A 3RTRA 3SQNA 3VFZA 4RAZA 2R7DA 3F22A 3HOTA 1IPKA 2P7VB 2HKXA 2C0ZA 3E5UA 1BJAA 3DQVC 3GF2A 1QPMA 3BJAA 2Q4SA 4HDVA 1KYZA 3FFQA 1R1UA 2PEXA 2IJLA 3BDDA 1KQ8A 5FD5A 3R0AA 3KGZA 2MLGA 4A0XA 3K1PA 5E17F 4O6JA 1D5VA 5HLIA 3BJOA 4LK1F 1O3TA 4EVIA 3CEWA 2E9QA 4WZCA 2FE3A 1SMYF 1I27A 4UV9A 1T2KA 4KN4X 2CW0F 3HRTA 1ZRRA 3W6JB 1HKTA 4HF0A 5I0SA 4AWXB 1B6AA 2NNNA 5DUKA 2QVSB 4YNIA 2FBHA 3IKTA 3U11A 2Q30A 3ELKA 1H9TA 4ZZLA 2LNBA 2GC1A 4G8XA 4Z07A 4KMUX 4MQ9F 4ZYGA 2O8QA 2Q0AA 1CAUA 3K0LA 1MDMB 2JTVA 3ZMTA 3TO9A 1USSA 3Q5FA 2FEZA 4XF9A 4G6DA 1HXDA 1B59A 2VBYA 5CJ9A 2EV5A 4LJZF 2LSOA 3KP4A 1IN6A 1TQIA 3MZYA 3GBFA 1IZ1A 4AVBA 2UY8A 1ZAOA 1L0OC 1T6SA 3BPXA 2FOKA 3KETA 1ZREA 3OF1A 4KMFA 2O8XA 2TDXA 4ON0A 2XAHA 3KP5A 3GUDA 3IRQA 4PIYA 3L9FA 1ULYA 2VBXA 3J80Z 3AAFA 4JVAA 1JHHA 4G6QA 1G6NA 1AWCA 3F8NA 3BB6A 2EK5A 4EM0B 3S7EA 2K4BA 1Z7UA 2GZWA 3QPHA 3TQNA 4ONUA 1UCXA 2M45A 4Q0QA 4Y17A 2OZUA 2HTSA 5LEKA 2UY9A 1ZX5A 1TBXA 2FMLA 3ULQB 2N7GA 2PFBA 2A61A 2M30A 4Q48A 2L01A 4HVRA 4XETA 3VHRA 2IXKA 3O2PE 3CJNA 1EYBA 2GA2A 1TQMA 4HV5A 4QGMA 4Q47A 4EJTA 2EA2A 4EMSA 3M8FA 3GZ6A 4ESJA 3GO5A 4XFGA 1ZRCA 3IKVA 5HS8A 2FNAA 2ZNYA 3LAJA 2DK8A 1YLLA 3WODF 1BN5A 5JSRA 1TNSA 3CTAA 1RNLA 3FMQA 3CLOA 2O0YA 3GFIA 3WE2A 1CX4A 1YS7A 2KXLA 3GFLA 4F8AA 2K27A 4A12A 5TJJA 2VPVA 3FM3A 5ICGA 2ESNA 4MQVA 3GYHX 2IXCA 2VXZA 2H94A 2NS0A 5FLXK 1SFXA 4MEYF 2PJPA 1B1BA 1EY2A 1Y9QA 4LGWA 4JBAA 2P6TA 2P4WA 5D5XB 3ROUA 1DGWA 1HW5A 1U8RA 4GYIA 4M72A 4HBLA 5FD6A 5BOXA 4G9YA 3N4MA 3SZTA 3D0SA 3MCZA 1FBUA 5ILVA 2MH2A 4M6YA 5FB2A 2XROA 2EAAA 2KRFA 1QO0D 5ICFA 4BIFA 4WXDA 2COMA 5BQTA 1YFXA 1B9NA 3JW4A 3WTTC 1S3JA 2GC2A 4J1WA 3C7JA 4UXNA 5JI6A 5HDNA 3SCHA 3DPLC 1MGTA 5F1RA 2Q1ZB 1G3WA 1B9MA 1J59A 1S6LA 1LR5A 3KFWX 2XASA 3WG9A 5I8TA 4HMZA 3G73A 3E5XA 4U0YA 3J81Z 2WC2A 3MAJA 5J8CA 4YIIA 1OI6A 5LRSA 3IHUA 3RZZA 4IRIA 5J7MA 4BYYA 1FT9A 2UXXA 1DDNA 2FXAA 2LKPA 5K5QA 3RDIA 3PQJA 4OINF 5LGNA 2FSWA 2DAOA 1S7AA 3BP8A 4HOBA 4U0VA 2OZJA 1L3LA 1CF7B 3M9AA 5DV5A 2BNOA 1R5HA 4M6XA 1LB2A 5CVIA 4KYWA 2FRHA 1LDDA 4QM8A 4UHTA 3QRFF 2BE5F 4P9FA 1ODDA 2CG4A 4N9IA 2MLKA 3L00A 4IHSA 1J3RA 1Q43A 1K78B 1XSDA 3HSRA 3E6DA 3HTSB 2K86A 2IXJA 4CO8A 2OPKA 4A6EA 2PQ8A 2MPFA 3TOAA 1VP6A 1G3YA 5D1IA 4IXAA 3V4GA 4O3MA 3M1EA 3FMSA 3HRMA 3QPTA 5D8LB 2XL9A 3M8EA 4LEJA 2ZKLA 4RB0A 4AVAA 4LTAA 5D5VB 4XFAA 3HUGA 1FOKA 3WGGA 1KU9A 1LQ1A 1FYLA 4G94A 2FBKA 3I0TA 3REOA 4Q29A 3BCWA 1YYVA 4QLCU 1ZYRF 2QENA 5L3BA 2L02A 2P7CB 4AIHA 3RI4A 2Y48A 2Z5UA 3OOPA 4LA2A 1EH8A 2QLZA 1MDMA 4OIQF 1BIAA 4OIRF 5BPDA 1KQ9A 1UIJA 4I01A 1XGMA 2EVXA 2EJRA 2YU3A 1ZZBA 2QDRA 4Q4ZF 3LAGA 1QZYA 5LHIA 2B9UA 2AS5F 3HHHA 4QGNA 3Q9SA 1JE8A 3BALA 4KIBA 2EV0A 4NVPA 3I71A 4XFFA 5CU1A 3NRVA 2K02A 1G3TA 1WI9A 2P17A 4L9JA 4YYOA 1BM9A 5FCCA 1EH6A 3CO7C 3CLPA 2FQPA 2EFWA 4AIJA 4IEQA 2IA2A 1OMIA 1V3FA 3D82A 1XB4A 1Z6TA 1U3EM 3WW1A 4S04A 1D8JA 2L3DA 4HX4A 2GXBA 1ZZCA 1OKRA 4M74A 3T0YA 2VT2A 1EPZA 4PGHA 1XGNA 4OU0A 1KU7A 2P5VA 2EFNA 3C3VA 2ZMEA 4HBNA 1K7AA 1DP7P 3ZMVA 5HDGA 3ST7A 3ECHA 3LWCA 2XIGA 2Z33A 1FI2A 1Q3EA 3WTUC 2ZJ2A 2QQBA 3H1MA 1YW8A 4KWKA 5L3EA 3PQKA 4IESA 2IA1A 3RYPA 4AVPA 2PMUA 1LRHA 5I0RA 3ES1A 3NL1A 4CHUA 3QOPA 4MEXF 4KIGA 1YIOA 4LLLA 2PQQA 1T39A 2GAUA 4R79A 3E6BA 2HDCA 1LDJA 2ISYA 2IPQX 4BAYA 1Z9CA 3U2RA 2VBWA 3DPTA 2IRFG 4OMZA 5I0UA 1YUDA 4KT5C 1TLHB 4PZJA 1V4RA 3F6VA 2M87A 2V79A 2ETEA 2MNGA 2OZ6A 5BMZA 2HJIA 4XFHA 3KZZA 5LLQA 3WTVC 3FJSA 4JK1X 2ZMEB 1FPQA 1F4KA 2PA7A 1QQIA 4M73A 4LLGF 5BPXA 3OV8A 2H09A 1V70A 3ZQ7A 2PAMA 4ZYDA 3KP6A 3N97A 4ASNA 3BY6A 4IEPA 2QVOA 1P92A 3T8RA 1LEAA 4HQEA 4OLLA 1U12A 4EM1A 3W6KB 2XAGA 5HS7A 1W4MA 4Y15A 2OQRA 2XLGA 5JR7B 2B8MA 3P9IA 2KJCA 5HLHA 5E16A 3LZZA 3ISPA 5I93A 4KICA 3F8CA 1T98A 1XN7A 1AOYA 1CAXB 5DEQA 2OQGA 1UD1A 4XSXF 5JCTA 4ESFA 1RTVA 2XKPA 1FYMA 5AONA 1Y3TA 2LF8A 4QX5A 4NB5A 2UYAA 4RGRA 4PGGA 2JSCA 2BNNA 4EV0A 1YG2A 3HRSA 4N9HA 4GGGA 1WA4A 1SFEA 3HSEA 4H7LA 4H0EA 4RD7A 3EUHA 3NW4A 4HAMA 3FMRA 3FX3A 2UXNA 3KE2A 1J58A 1YS6A 5CVVA 1WWXA 4HLYA 4LG0B 1GQHA 3QP5A 4WXHA 2R7FA 1QXJA 2KIMA 4KWLA 2JRTA 1X8EA 1YW9A 5FLHA 1T38A 1Z6RA 3FE5A 3C18A 5FLXZ 1MKMA 4MGZE 5CVRA 3P9KA 3R60A 2VC0A 2WWYA 5AIQA 4OMYA 3RYKA 3EHKA 5D6FA 3T8TA 1QY4A 3I58A 5KHJA 3CDHA 2HGCA 1HW2A 2FNPA 4HF1A 3HIFA 4LMYA 4G7OF 1HSJA 2CSOA 1ZHFA 2EFOA 3Q9VA 1J9IA 1LNWA 4OIOF 1HKQA 1OR7A 1QGPA 4YFNF 3SCGA 3SXWA 3DL3A 3F8BA 4MHGA 2H6CA 1P4AA 3ECOA 3BZ6A 2C6YA 2XAJA 1O3QA 2ET1A 3J81K 5FGMA 1K79A 5BY5A 2XLAA 1R1VA 1FNNA 4Q0VA 2GQQA 3VODA 1OFNA 2ET7A 4LD5A 2O6GE 2IW5A 3H7YA 5ICEA 1NHAA 2Z99A 2ELHA 3ZMUA 3RYRA 4XEZA 3F8MA
chains in the Genus database with same CATH superfamily
1XYNA 4LBLA 5GTIC 4HX7A 4TLFA 2WWJA 2X09A 3FBYA 2BPA2 2JPCA 2JDNA 5ED4A 3D5LA 3E6CC 2VOOA 1HA8A 2D93A 1NLQA 4QHBA 3ZN1A 4BM8A 4YFXF 1J3QA 4IEXA 2XJVA 1IHMA 2V1DA 3OGSA 1F9KA 2KHMA 3ZPLA 3BWGA 3VWBA 2AEZA 2CAVA 1WJ5A 4M3EA 1X58A 1MIJA 1U5TC 4GWNA 4IV3B 4GXOA 4HN1A 2DJNA 1PM7A 5IK7A 5IT9Z 4HKWA 5C5UA 1TT0A 3PTYA 3BTZA 3U1DA 2VMHA 3THCA 3OGRA 5C6CA 4P9JA 2R7QA 3HOXJ 3OPZA 3MQ0A 5A7OA 5K1YA 5EG0B 1WCSA 2ELKA 1UKGA 3I4NJ 1MMGA 3RZDJ 1VTNC 3T5XA 1AR61 1LOFC 3ZKUA 3DKYA 3N9LA 4NWVA 4OI4A 1G9DA 3BUCA 3JZVA 4HSLA 3L2HA 1IKQA 2AH2A 1W7PA 5FLVA 3MMYB 4HONA 4UW3A 4EJWA 4HRIA 4H4KC 4C2UA 5F0HA 2K0GA 5DUUA 2NVQJ 1Y56A 3H0GJ 5KNLA 2E2HJ 4Q5OA 1JJ6C 1PMJX 2E33A 3WG2A 2D2WA 4CVUA 4XF4A 1AZDA 1X4PA 2JG8C 3OGJA 3WF3A 5ISLA 2VBDA 4L9VA 3IAQA 1DQ6A 3LA2A 5FY0A 4Z82A 4AG4A 1CQ9A 4JGYC 2RE9A 3IDEA 1AR81 2QSGX 4KBZA 3J80K 1RUE1 3A0NA 4MGKE 4FBFA 3SH5A 4YG0A 1HJGA 3WW2A 4IOAF 2WABA 1US3A 3PNAA 1XG1A 3HQXA 1OA4A 5FZGA 5I91A 1T08B 2R4GA 2R93J 3N9MA 1U9NA 4W1UA 1W2UA 2PHRA 2XVGA 4HG6B 5D5WB 3JBG1 3I2DA 3T0DA 2XGEA 1V55H 5DDGA 2J5PA 2VBPA 2R5ZB 4QQOA 2XUBA 4FFGA 4OI0A 1G7YA 4C2MJ 4BQXA 2VKDA 5JR3A 5HI0A 5KAIC 3UKVA 1FXZA 4LLNA 4AUXA 3PVOA 5FPUA 1VJ2A 2VUCA 3R0RA 2EIBA 2WYSA 4XDQA 2WLQA 1NCRC 3MZHA 3WF0A 4A6OA 2G0EA 3KX2A 1PVC1 1UZ0A 3TDZC 4QDQA 1RUG1 2F48A 3C3WA 2BBVA 1H2MA 3NNFA 4QTRA 5BNPC 4W6WA 1AR63 3ABUA 3M3EA 2BZTA 3L2VA 3PHMA 2R7RA 2DFIA 3ZOBA 4ATFA 2O03A 4PLMA 1FAYA 3RZMA 1TZLA 3GTJJ 2LR8A 2ISZA 3DEEA 1J1LA 2C1FA 5IFTA 2YPRA 4FPJA 4KGQA 1MW7A 1LGNA 4BHPA 1EV12 2ZXJA 1WW6A 3PUIA 1MS4A 4XQWA 4Q4X1 1LEBA 1FX5A 3V7SA 4M3CE 4UVCA 1E3PA 2XONA 2P6HA 5LY2A 4B3XA 3TN92 3GEZA 3A0HC 1HDPA 4EJVA 4V2FA 1JTZX 3AM2A 1QWRA 1S9HA 3F2ZA 4Z1VA 1RUC1 5D21A 1BR2A 2CWMA 4UV8A 1SZBA 2ZGNA 2YGMA 3QU6A 3G6EI 1G86A 2UUZA 4M9SA 3OTFA 4KWJA 3ZRGA 3NKTA 5A1LA 1L7QA 2GU9A 2NVTJ 1VI0A 4EWAA 5L7OA 3U1KA 2VY0A 2WT1A 1BW6A 3QACA 2ZNZA 1Y9MA 3NO8A 4AM3A 2R071 5IYBJ 1DP3A 2DQRA 1WLCA 2RR13 2XDVA 3KCXA 4MSVA 3JR9A 4HETA 2WZR3 4XYXA 2WA3A 3RFRA 1DGRA 4XLNF 5DAXA 2JZYA 2AQEA 3RKWA 5A33A 4YZ1A 4B4PA 2WNOA 2D3SA 2WS91 3VD5A 2ZXQA 1MR5A 3DBLB 1GOHA 5KHHA 2V6CA 1WMDA 2F4OB 3BPVA 3P3NA 2GC0A 4IV1A 2XHNA 1X8MA 2ZKZA 3CMAI 2OF7A 5L19A 4LFUA 3ZQHA 4EJOA 5A3LA 5JIAA 1ND3B 2W00A 4X6RB 3N9NA 3K69A 3PUSA 3ECQA 3CO6C 3N05A 5FIXA 1X4OA 3RQ4A 2DPDA 3UETA 2X5IA 1RMU2 4PQ9A 2F5VA 1A8DA 3RGBA 4W6XA 3O8HA 3DUIA 5FYSA 1RITA 4RS8A 1W2NA 1Y8QB 3WW3A 1DYPA 2XKOA 3FWEA 5JAXA 3ZR5A 3H0DA 1XJAA 4DW6A 3DCQA 3H50A 4DIQA 4CYDA 3ZMOA 2XLFA 4QU2A 2RM23 1MMAA 1W7PD 3DLLF 2RQQA 3LFKA 5J1YA 2OUHA 4N4NB 5HNHA 2CUZA 4IV1C 2VMGA 1DQ4A 5L7OC 3MN2A 1UOBA 4ZYHA 4W6YA 4S2DA 3GW2A 4A3JJ 3NWTA 2FQ4A 2SBAA 5E1ZB 1ZGAA 5CKMA 2BY0A 1OH4A 3HXLA 3KMHA 2LOOA 1WCQA 3OY8A 4WVMA 3MLKA 1I5PA 1HN0A 2B42B 1IDZA 2HPIA 4D6SA 1NH3A 2CJJA 4LO4B 1ZG3A 1VBC2 4CEYC 4CUBA 3RJPA 1O3SA 2VE8A 3CL1A 2QUFA 2ZGSA 4KG8A 2DO7A 2WB1N 4CPBD 1B09A 4YVSC 3DF0A 1F5TA 3BR1A 4Z2WA 1ZM1A 1Z78A 1FOXA 2Y0OA 2HBUA 1NXD1 3CF2A 2A5YB 4A0YA 2HOEA 1DBNA 4HX8A 1QJY2 3PLQA 5GZDA 1RXGA 5HBAA 4RS5A 3EPZA 4M4PA 4P9IA 2V1XA 1XNKA 4LKFA 1UAIA 2DVGA 2YPJA 4BXFA 1UWWA 2K9QA 3NWSA 4JTNA 5LBEA 2L9RA 3SYTA 3W20A 2RHPA 5FZ0A 5GZFA 4RR3A 2IVMA 1BK1A 3UGFA 4A3MJ 1SCSA 3O5SA 4JX5A 2E31A 5DAPA 1Y6IA 2ZBJA 1R23A 3OY8B 3KEYA 3LOBA 1SMVA 3TN91 4AFDA 4B8XA 3AFGA 4XIKA 1BQPA 2V5DA 2ME0A 4QXKA 4DBQA 1WBFA 2ECCA 2EPFA 2GXGA 4K3UA 5DD4A 5FYVA 3FF5A 1H9GA 3LSIA 2FZ1A 1IN4A 3TEWA 4IRHA 1PGL1 1ODMA 4SBVA 4AEKA 1OSGA 2WIIB 5DABA 1WPKA 3OEAA 2HZDA 3R4SA 3H5RA 3BU7A 5F04A 5FLJA 1POQA 4UUSB 1R64A 1VPHA 2WZPP 4LBJA 5E18F 5GAHJ 2V4VA 1RI7A 1ASJ1 2CGPA 1XTAA 1DZTA 2WADA 3ALQA 3LFMA 1YNAA 1WMEA 4UBGA 1NXMA 1ZNPA 2JA5J 1BOBA 1GZTA 4JDNA 2X05A 1HLVA 4ZDPA 4WK8F 2FBEA 1NG7A 4YG6A 3AKRA 2PN5A 4D7SA 3U0ZA 4Y7NJ 1UF2C 2VOTA 2F6CA 1JHFA 4WM7B 2M0CA 4XL9A 3F3XA 1IXRC 4Q2FA 3BTIA 4AEJA 1T33A 4FX0A 4NDLA 4XR6A 4ZYEA 3DP7A 1X1AA 1XE7A 4R9BA 4AFAA 5G04L 1PIV1 4Z2YA 4IHTA 1A04A 4DYCA 2QQKA 5JI7A 4MYEA 2R1DA 1H4HA 1X82A 1KS4A 2E63A 3J7AO 3M3IA 5K4LA 4LO5B 4BLIA 4OAZA 4DO0A 3WHUA 2QKLB 2DA7A 1UY2A 2A68F 4XRSG 5HNFA 4P08A 4A3FJ 4AAXA 1DZRA 3R6SA 3DF8A 1H88C 1BI2A 4J1XA 4LBMA 4W65A 3WD5A 5F3IA 2O14A 3LEIA 2MH9A 4Q8KA 5FP3A 1CGPA 3ACIA 1A6IA 5FMOL 3V7CA 1K6OA 2ZJPF 1EAH3 4L9NA 4O7XA 1LNSA 3ON7A 3JRIA 1Y1VJ 2RR11 2FUG2 4B4CA 3VL9A 4IL6C 4QPGC 5FAXA 3A4UA 4E7ZA 3HPHA 4IERA 3DU6A 2BDRA 1GLNA 2VECA 4IW3A 3OYMA 4OUSA 2VASA 5M5YJ 1AKHB 3CJIB 1TWHJ 1IC8A 4AF9A 3S2WA 1D3YA 1WJDA 5IP7J 2ZGQA 2FD5A 4YGDA 1NK3P 2WR9A 1SFPA 3CZUA 5JOZA 3S8PA 2DVAA 5FYZA 3QCWA 3JQWA 4U36A 1GZWB 2EWNA 4GWJA 1BI0A 5FKKA 1W06A 2UWMA 4CCLA 3V42A 3KD4A 2E34A 3WG3A 4AWDA 3NWKA 1JUMA 4JOMA 4G6TB 3O1RA 4OIPF 5D4RA 2HWC1 3IBMA 1QDOA 4OQ8A 2VU9A 2ZBKA 2XL7A 4CCNA 3O0XA 2X0LA 4BEHB 1LU1A 2R7SA 4QKFA 3EBRA 5FKLA 2YC2A 3B9CA 3FK6A 4OAYA 2ADEA 3ZYFA 1W6MA 1OVSA 2X8KA 1Z0HA 4E7KA 4L92A 3L2CA 1JJ8C 1WHUA 1VBD3 1H0MA 3WOGA 3HBLA 4AEDA 1VR3A 1RINA 4L0YB 4XOGA 2E1MC 5B1BH 4Q4Y1 3PU3A 4M3CA 1QU0A 1D1CA 5FOJB 4LJHA 1WCKA 1S0FA 5IOZA 4AYUA 3ZMDA 4CSWA 3RPUA 4XUPA 1XMKA 1SFYA 2JWPA 1CR7A 3GCXA 2BBAA 4N90A 1IJWC 3PJYA 3W58A 3WP3A 4CDUB 2Z5WA 3F23A 2VCBA 4BQ1A 3EYYA 5E89A 2YR2A 2ETHA 2W9XA 1PK6C 4QD2A 5FZFA 5JZGB 4XHBA 3HNYM 4FCAA 4OUMA 5GPAA 3LSRA 2O0OA 2YFZA 4Q4V3 4U0WA 2PHUA 3CJQB 5JVGF 2W52A 2X51A 5BNNA 4MX3A 2DFHA 3FXUA 3F21A 2PJRB 1OOPB 4XFCA 5CNAA 1UZWA 3FLRA 1MBKA 1HRV3 1NA1B 1W6OA 5DUVA 2DJIA 2QQPA 4XVHA 3VUOA 2FJ1A 2RS13 1DQ2A 3ZXGA 4B44A 4B09A 3AKSA 3T2TA 5AIPA 1JUIA 1WVRA 3DV8A 3INAA 2V1NA 2FHRA 3WDTA 2EQRA 3IKWA 1UIKA 2JKBA 2RMU1 1Y1WJ 5IFPA 3VB2A 1WMFA 4FPGA 4R9CA 1MZFA 4TTGA 3ACHA 1LOAA 2HWB1 5HXMA 3HHGA 5BXXA 2ES3A 1W03A 4Z2AA 1TW3A 2E7XA 5L3GA 1N77A 1RIRA 5FWEA 1G59A 1QOOA 3M3YJ 1OURA 4CH7A 4K1ZA 2RQPA 3BGAA 5M3MJ 1POV3 4Q4W2 4QB2A 3IH3A 4NAMA 4PLNA 5CG8A 2Z16A 4P9LA 4WX9A 1OVPA 4GKXA 1R1A2 1POV0 4F3QA 1ZZ8A 1HQNA 2XQXA 2DCTA 1GUUA 1AF9A 4L11A 1D0GA 4C30A 2IUWA 4JZRA 1ZBE2 4EN7B 5DDJ3 1NG0A 1W6QA 5H20A 3ZYGA 3OYKA 2OCEA 2ICWG 4Q8LA 4CDQB 3VYTB 1WH7A 4Y13A 3VBSB 4HA8A 3K9TA 2JDHA 5M5WJ 1AHSA 1LOGA 3BCBA 1J83A 5LCWL 1U5TB 1D2SA 1S2BA 3J7LA 2Y6HA 3OOXA 1BR4A 2CV6A 1NCQB 5J3UA 4B1MA 5CBLA 3OB8A 1FOWA 2VJIA 3VPRA 5C4JJ 5CYYA 2DPUA 3HTUA 3WUCA 3RQIA 2OUJA 3FHZA 4CCEA 4XSZF 4XLPF 2DBBA 4KI5M 2LG4A 2JX9A 3BPZA 4WVMB 3TP0A 3C7EA 1JU4A 5C8WA 1OCZH 1BBYA 5EZGA 3MBWA 4BHBA 2ZFUA 1W5SA 3CJIC 1D0YA 3AP6A 1LHUA 2WS93 4YRDA 2ZGLA 2D45A 2VZSA 4AVCA 2VQ0A 1NZIA 3GZ5A 2QCSB 1LOCA 2W68A 5FQ0B 3ZKYA 3KLSA 5BV6A 4HPQA 4BPZA 1QJEA 3F8FA 1ODNA 3WUDA 3JRBA 4NOTA 1P4WA 4WM7A 5A7PA 2YSRA 2BNMA 5EJ1B 2K7LA 5CVUA 3H42B 1C3HA 5A6XA 4U88A 2CH0A 1L3JA 4PBPA 5I8SA 1GBGA 1ZGJA 4MUVA 2VB6A 5HVQC 1OBNA 2DURA 3R05A 5F3EA 4IV3A 4E4DX 2A6XA 5FREA 4ZHNA 4BDZA 3CCRI 5CA6A 1XCVA 2LP0A 1XNBA 3MFAA 4YWAA 1W7PB 2VZRA 4XOPA 5IHRA 1LJ7A 2JG9A 1GU3A 4RQPB 2WZR2 1D0XA 3L09A 1UQXA 1MZ6A 2VTFA 4E70A 3CJRB 4COWA 4WBBA 3IAS2 3PM1A 1I3QJ 3TO6A 3AMQA 2VOWA 2X10A 3F22A 2ZXIA 1RJ7A 4LXLA 4CZCA 3HOTA 2QE3A 3VBFB 5EZHA 4A42A 2ZPXA 3AMMA 3GF2A 2E5NA 3MV01 3BJAA 1SG3A 3FFQA 3VBRB 5J37A 2PEXA 2R7ZJ 4XICA 5J4YA 2ZEZA 1KQ8A 3R0AA 1MSEC 2AYHA 1D5VA 4Q4W3 5F0CA 4UB6C 2FE3A 3POJA 1OLME 5EF6A 3HRTA 1ZRRA 3W6JB 1Y39A 3RMYA 1VF9A 3HVDA 2NNNA 2OTJI 3S30A 3W5NA 4JX0A 4YNIA 5BNQA 1A6CA 3IKTA 3U11A 3LL7A 3ELKA 1H9TA 2R7UA 2LNBA 1W8ZA 4NIDA 4MQ9F 5H9RA 3DPRA 2DOEA 2JTVA 1RUJ3 1USSA 3MKYB 1AXKA 1QQP2 4D6QA 2DCKA 1XB9A 1B59A 2VBYA 5CJ9A 4LJZF 3I3BA 2LSOA 4M00A 3HKZN 5FXVA 1TQIA 1RMU1 1REFA 2M3AA 4ZJZA 2WB1A 1LPQA 2JDAA 2UY8A 1IGOA 4D94A 2FOKA 3KETA 2JICA 2CQ7A 2VPRA 1US2A 1N1VA 2TDXA 4AEDB 4ON0A 2XAHA 3KP5A 1U0JA 3GUDA 2ZX4A 5F5AA 3L9FA 3P5BA 2W87A 3JCUC 3SKVA 1JHHA 3O0WA 2EK5A 4EM0B 5FZ4A 4F83A 2WS92 3AZXA 5GAEJ 1JYXA 4XLCA 1LAJA 2A73B 5LEKA 2E26A 4AHZA 1DU3D 1SLLA 2PFBA 2A61A 4JGZA 1NY71 4HVRA 2YB7A 1BZWA 3KQ4B 1EYBA 4FP2A 1MQTA 2JRMA 2W1QA 1GQPA 4UF0A 1RUD3 4MGTA 1JOBA 3ZYPA 1VB4A 2R5YA 3CTAA 4K20A 1DF0A 3CLOA 2O0YA 3NV4A 2JD4A 3O1MA 1BJZA 1O59A 2IFWA 3VHPA 3CCJI 4A12A 4IGOA 2EIMH 5CFDA 3SKJE 4Y4YA 1HKDA 4MQVA 2VXZA 2H94A 3WR0A 1ACCA 1B1BA 1OQDA 1QGLA 3AG2H 5T54A 3LDBA 3ITQA 1U8RA 5A80A 4GYIA 1S0DA 3DTKA 3H3LA 4HBLA 1H6XA 1MBHA 5BOXA 2A6ZA 3KF3A 4P5HA 3S6PA 3AYEA 1HIXA 4U87A 4BY1J 4C1XA 2M2EA 3L9JT 2ZHLA 5BQTA 1YFXA 5GAGJ 5KHDA 4XMAA 3WTTC 1TWGJ 4UXNA 2CNAA 4ZXKA 2BV4A 1MGTA 5B1AH 2WZR1 2Q1ZB 5J1RA 1JW6A 5CIRA 4GWMA 1FMVA 3RZGA 1S6LA 1UX7A 2WAAA 5JIUA 1ZQ3P 3J81Z 3WSOA 4HXCA 1JZ7A 3MIFA 2DYCA 4FTSA 1F36A 3MAJA 1SEUA 1DGWY 4YIIA 1JZ2A 1U0AA 2ARAA 5J7MA 4BYYA 3U1XA 2HI3A 4IQ4A 3SEZA 1MNDA 4AVVA 4ES8A 5LGNA 3U4SA 2FSWA 2DAOA 3AVRA 3NQHA 1S7AA 3RSJA 2OZJA 2CY6A 1AJOA 1L3LA 3M9AA 4XMYA 2AZ5A 4M6XA 2DMTA 5CVIA 4M3CB 3K10A 1LDDA 4W97A 2WY7Q 4N9IA 3L00A 4IHSA 3S2DJ 2KQRA 2ORZA 5C3RA 2K86A 5JLWA 4A6EA 2KLOA 3V0BB 2CQNA 3QD6A 2EBIA 1N3OA 3FMSA 3HOYJ 4MFEA 1AYN3 1GICA 4LEJA 4RB0A 5TISC 1LEDA 1I3AA 3VKOA 3HN3A 1EJ9A 2YUSA 2JIGA 3HUGA 2LY2A 3AXDA 2ECBA 4Q29A 3BCWA 4QLCU 3K3NA 5J47A 5L9VA 4YGBA 2ZACA 3A03A 1AXYA 4DXSA 3LE0A 4IUGA 3J7ZI 5A3UA 4M3GA 4P00B 2Z5UA 1EH8A 2LK2A 5LWBA 3WP4A 4OIRF 3H8RA 5BNPB 1D1AA 3F95A 1KQ9A 3T3YA 1XGMA 1WJAA 2YU3A 5EDNA 2DN0A 3LAGA 3GJAA 1QZYA 3DU5A 1LECA 5C4XJ 3M1CA 1R1A1 1PO12 3Q9SA 3J7HA 1VAMA 1RUI3 4XM3A 4GMP1 1ENRA 4XFFA 1TT5B 3V64A 5C9AC 5M5XJ 3SEPA 4B3NA 2E36A 1WI9A 1YJ9I 4KT6A 4AYBN 2P17A 4OHVA 2PMZA 1ZBE1 1BM9A 1LENA 3PNYA 1O6UA 3LIGA 4GDFA 2IA2A 2W46A 5EEAA 3D82A 2GOMA 4HX4A 1A36A 4HNTA 1V5FA 1XQNA 5C4WC 5F5CA 1OKRA 4C9YA 2DT6A 4M74A 1Z3XA 1W2OA 2V6EA 2VT2A 4RFRB 1EPZA 2X6OA 3AFHA 3S15J 1LKXA 4HBNA 2ZEWA 3ZMVA 3ECHA 2X6WA 4XLHA 4D0QA 3WTUC 2ZJ2A 3TOJA 1YW8A 5A32B 4A3IJ 4C3HJ 4AVPA 1LHOA 1LVKA 3A1YA 4KWUA 2MC4A 4MEXF 1YIOA 3VBUB 1T39A 2QQLA 1DFQA 4NIIA 2GAUA 3AK0A 2HDCA 3ACFA 2IPQX 5FO9B 1RUJ1 4BQQA 2VBWA 2IRFG 1VQPI 4CP2A 4KT5C 3BIEA 1OQ1A 2AC1A 3OBTA 1Z7LA 3JB4C 3F6VA 2M87A 1MNEA 2ETEA 2OZ6A 5BMZA 3RS6A 2VL4A 4LT5A 5LD2C 3CC2I 1U9OA 3G4SI 1FPQA 1F4KA 3K4AA 3FIWA 1LHVA 1EAH2 1J84A 3OV8A 4Z92B 2H09A 2WAEA 1V70A 2ZGRA 2JB8A 4FP3A 3N97A 1K4SA 1QJY1 3FXKA 3T8RA 3NARA 4OLLA 3IDAA 5C4WB 5IVBA 1U12A 4J25A 1NTCA 2RJ2A 4GMP3 4A7KA 2QBXA 4Y15A 2OQRA 2PQSA 2DOAA 5IK8A 1CVNA 4QPGA 4RQPC 3Q8EA 2M4GA 2WWSA 5E16A 1IRZA 1XN7A 2LRPA 5DEQA 1UD1A 1U5IA 2JUCA 1C5HA 2NVYJ 1E5HA 5FP7A 1RTVA 1YRZA 1Y3TA 2BHZA 2R16A 2UYAA 2JWTA 5D8AC 5J36A 4RGRA 1ZA4A 2JSCA 2D43A 2VUDA 2PMWB 5DDJ1 2KRHA 3I3EA 2TEPA 3ZPOA 1BYHA 1Q8SA 1VQKI 5FTTC 1IS6A 4H0EA 3S3OA 2R30A 3WF4A 5LK5A 2DU1A 1YS6A 4LG0B 1WWXA 1GQHA 3MW4A 3ZVXA 3C2GA 3TRSB 4S0HB 4LHNA 2IAIA 4B3AA 2HWE2 4IE7A 5C3EJ 4KWLA 4BIOA 3IH4A 3ZPYA 5GLVA 3THPA 1VFCA 1X8EA 2FDIA 1YW9A 2Y34A 1T38A 1Z6RA 3BR3A 3A7QA 5FLXZ 1MKMA 1R083 4MGZE 3NAPA 3R60A 4A3BJ 4C91A 2WWYA 1PVC2 3ZOIA 4OMYA 3S1QJ 4YW1A 4XIOA 1JMUB 4IXLA 2ZXWH 2LTNA 1X1BA 4HF1A 1CIYA 4CXXA 4G7OF 3NNGA 2I07B 2HWB2 2C6SA 2Z79A 3L2UA 3LSGA 1OPMA 1ZHFA 3Q9VA 3AX4A 2WAOA 1GZWA 1Y9GA 5FZ7A 3SC7X 3L2QA 3DBHB 4V19K 4MHGA 4EATA 1O3QA 2C6YA 1YI7A 4O65A 1RETA 5FGMA 1H89C 2K9MA 3T2PA 4Q0VA 1VBC3 1UU6A 2Z99A 2ELHA 5A1AA 4XEZA 1PIV2 2NRAC 1MPXA 2Q8OA 2KIQA 2X9DA 4QX0A 3AYCA 5F6LB 4RB3C 1K42A 1MZBA 4EJRA 1RHI1 5M3FJ 2BVLA 5JXHA 1QJY3 2M34A 2H6BA 3W21A 1EUUA 1UCRA 4FX4A 1E5RA 5D8KB 1OYWA 2W08A 3CZJA 1XRUA 3BKZA 4Q5SF 4PHZA 1FBQA 3EJKA 2EF6A 4PJJA 4N0BA 4BK4A 3NSTA 1ZARA 4XJ9A 2OXBA 1JN2P 2DYSH 3TW6A 3BR5A 2H1KA 5CEHA 1I6XA 5FYHA 4BQOA 2JT1A 1UNBA 1K4TA 1ETOA 2AO9A 4OHWA 2M0MA 4OOIA 2XJQA 1LU2A 1O8PA 3V0BA 4COZA 5JPMB 1VRH2 4M6VA 2E71A 4BGDA 4NMIA 3TEYA 2BGCA 3FKIJ 3ZR6A 5F3GA 3V8LA 2XB5A 1BEV1 2HFHA 4DY5A 4ZZ8A 1W6OB 1T0FA 2KIUA 2PHDA 2WLPA 2QYOA 2PX9A 3ZFFA 1ST8A 2A6HF 4ZZ5A 4UOJA 2GNBA 2YX4A 3LD8A 4QKBA 2X4HA 1B35C 1AR91 3UT0A 2FBIA 4LB6B 3H3VK 1BIBA 4ASLA 2GNTA 3S57A 1N25A 3GVAA 4P9UA 3GFMA 2CTVA 1DQ0A 2EALA 2HWVA 4NUBA 1TQPA 2G1MA 3UESA 2QJVA 1QOSA 3BTXA 2XPVA 2LF7A 1ZYBA 3ASIA 2P37A 2WQZC 1R082 5FYIA 1LCLA 2HPMA 5LEJA 1IUYA 4MO3M 4V2VA 3IV5A 4MG2A 2P3JA 2HQ5A 4CA9A 2RM21 2OQ6A 2JE9A 4IF4A 5J4VA 1IN7A 1FP1D 2DK5A 3TMOA 4XLAA 3HUGB 3NNJA 4IEUA 2WO3A 2DA1A 5A3NA 2VLAA 2VMIA 4GYGA 4LBOA 4F92B 1OD5A 1VBC1 1OPCA 3OMYA 2D5VA 2XUEA 1VRH1 2E1NA 5DUIA 4XFBA 2VULA 2W2IA 2DBNA 1UY0A 4RLFA 2PYTA 4FCYA 5BNPA 2RS51 1HRI1 1LHWA 4AGGA 2WFF3 1JOJA 4JGZC 1MSFC 3ZLIA 2K2SA 2D6OX 4HNVA 2VO5A 4G7HF 3LPFA 2OC6A 4P1WA 5J8FA 1XYPA 1GWKA 3AYDA 4GJZA 3WTXC 4UFHA 2FDJA 5IVJA 3WX5A 1AR73 1D7PM 5GM0A 2JJ7A 2PFWA 1BI3A 1XDSA 2XG3A 4BXXJ 4OQ9A 2QF7A 4XJAA 3FHNA 5F6FA 1SCRA 2WNVC 1GANA 2IXLA 5ABJA 1U2WA 2HEOA 3K4DA 1R22A 3SISA 3DTIA 1UHMA 2NNYA 2X5IB 1MS0A 3QH7A 1XC5A 2Y9YA 4LQRA 4AI0A 5D5UB 3GWZA 2WRAA 4LR4A 4FPHA 1RKWA 3AZVA 2DMPA 3BI3A 3HSFA 5BNOC 2IFRA 4K2EA 1MS5A 2IZWA 1KQ0A 2BWAA 3SZGA 1CN1A 1CAWA 1V6LA 1Q1VA 2D6NA 3WDUA 1POV1 1BEV3 4KISA 3KHBA 3RJRA 2EICA 3K7AJ 5CFCC 2L54A 1AA7A 4O9EA 5KR7A 3BG5A 4CZSA 2QWWA 1O5UA 1ENHA 4XLFA 4RL7A 2XVCA 1VB2A 4LUKA 4OZOA 4IETA 2TNFA 2L7ZA 1UU5A 1JGSA 3EQEA 2YBPA 3UKGA 4DUXA 1IUFA 5JI9A 3LFUA 2HWE1 3GXOA 1ULEA 2VG9A 1WGXA 1TME3 5DXDA 4CUAA 3V56A 2JVGA 4CEWC 2A5ZA 1ETQA 2AXTC 1B35B 1JH5A 3VKFC 2Y6KA 2RREA 3O0VA 3OBRA 4B47A 5H6RA 2ILMA 2K9ZA 2PAKA 1WLTA 4CDXA 1SPPA 3VD7A 3U75A 3VB9A 2WSVA 4D7YA 3O1UA 5TRDA 1SAXA 3WT3A 2R072 2D40A 3ZIWA 1H1AA 5FV3A 4CGZA 4LIUA 3O7OA 3GNEA 4AZZA 5EV7A 1COV3 2FZ2A 1PIV3 1Y0UA 5A7WA 3BN6A 4C3JJ 4HV6A 3TDUC 5HDKA 4B7KA 3WDVA 3ZIXA 3PIGA 5F39A 2BYVE 4RLQA 1YO5C 1S0EA 1K5MB 1V6KA 4QX7A 2OCCH 4RB2C 3J8F3 4ISRA 4O5VA 2RC4A 4AFCA 4MO7A 1XDUA 5DD8A 2LUWA 4AAPA 4AQ2A 1O57A 4I09A 1NQDA 1D0ZA 4WVVA 3ZDVA 1WW7A 3BLYA 4X6QB 3IDCB 4PSWA 1GNYA 3HOSA 1QZZA 2HWC2 4CP0A 3M3CA 3AZZA 3HT2A 4NRPA 1W90A 1KEXA 4OFGA 1RUG2 5A3WA 3VD9A 3N35A 1TMF3 5LW9A 2IS2A 2DCEA 5FZLA 1PP8F 1UMQA 4CP1A 1X33A 2J1RA 3W3CA 5JOXA 3AXEA 2ZAAA 5JMOA 4YG2F 5CZKA 1SEFA 3WY6A 5JHFA 1AVBA 2RGVA 4OYUA 1QHGA 1F31A 2MC3A 2Y0SA 2GM4A 2CW7A 5BPIA 3HOVJ 5A7WB 1A78A 2OU2A 4WM8C 4QAWA 3ZO0B 2WZEA 1TP4A 3AC0A 3A0KA 1R1TA 2R0HA 4EN8B 5E8GA 4UUSA 4XCBA 5I0TA 3OSGA 1M4WA 3E7LA 1VBB3 1U8BA 4CPBA 5FZ6A 1WKMA 2PHXA 3G3ZA 2IT0A 4BQYA 4A3DJ 2WO7A 2OBPA 5IATA 1R00A 1R49A 3KV6A 3OYWA 4HYEA 4CTEA 2ZO4A 2ARCA 4DFSA 2VUJA 2DCJA 1JT0A 3ETQA 4EQVA 2HEYF 3MW2A 1BOAA 4RHV2 1K61A 1JXNA 2WINB 4JDOA 4DS0A 1JYWA 4C3IJ 1CESA 4AVSA 2ME6A 3OSDA 4AQ6A 3J7NA 3O1PA 4AC0A 3FXOA 2ACJA 1B8IB 3H3ZA 4CDWB 2WJSA 2LBFB 1SHWB 2UYBA 4XZPA 5DDJ2 1HDKA 2BY2A 4L5IA 5EFUA 2NN8A 2DBIA 4COVA 1D4M1 1NZCA 3U14A 1GLHA 3N9PA 4NHLA 3ZXSA 3WINE 4R8HA 1S8NA 2QQ8A 4GXLA 2M1BA 3OYBA 1ND2B 5D4SA 4XABA 3VKNA 4IHWA 1MEC2 5A3MA 3BTCA 1DQ1A 2L7MP 3JXSA 2W91A 5DMYA 2KFDA 5JOYA 5DAQA 2NQYA 1N1SA 3DYMA 1ETYA 3QP6A 3MIGA 4KMQA 3ZQFA 3D6EA 5JDBA 3Q8AA 4Q4X2 2W92A 2WV1A 1PGL2 4UW4A 2KA3A 4UFLA 4BH9A 2AREA 2J22A 1EKEA 1AR71 1FY7A 1HRV1 2G7UA 3WNNA 2QQNA 2Z4FA 5C70A 2J1AA 1S7EA 1EAH1 1X19A 3WNLA 2WNVB 4ZU7A 1UZCA 5GPCA 1D2QA 5J09A 2LC2A 3JAMZ 5CFDC 2GLOA 4G3YC 5A33B 3ABTA 2V26A 2NOGA 5FMOS 2UWAA 3L1PA 5IUQA 1T2XA 5A6QA 1PO21 1FV3A 2ZZJA 2D97A 3DECA 4XBFA 4Y22B 3O1OA 1F35A 3PJQA 5IT9K 4LE3A 4KDPA 4QX3A 1BBT3 3ZN6B 1FTZA 3TL4X 1F15A 4H7MA 4DYRA 5JSPA 4AYBA 2VZ1A 1W8WA 4GB31 2K9NA 2V1UA 4XRFA 2DU9A 3JRAA 4UFKA 3I59B 3ZSMA 1GXQA 1W0UA 4IEOA 2VOKA 1VQLI 4RGXA 2ZZQA 2JSPA 3A22A 1W2AX 3EQLF 4E9KA 1JGGA 3GCMA 3VOEA 1XSXA 3WE3A 2BEOA 4PDWC 1HKSA 1IOAA 2RJLA 1W6QB 2ZX2A 3WNKA 5IYYA 1H6YA 3CC4I 4LBQB 5A2QZ 2UZKA 1XOYA 3EMRA 2VCAA 1ONVA 4FE7A 1ZELA 1R4NB 1STMA 5AFEA 4BJTA 3NV1A 4Y22A 3OBAA 3HNMA 2B9SA 1G2HA 3KYLA 4AD9A 4QDSA 3PMEA 4AL9A 3VDDB 2ID4A 4INDA 4N43C 1VIWB 4HDUA 2A3SA 1QQP3 4QQPA 2XGDA 2XV4S 3KT7A 2VC9A 2K85A 3I5UA 1WSUA 2GDFA 1TTYA 4BJ5C 4EGZA 1ENQA 1QNTA 3GTKJ 5E1XA 3H7JA 1MD0A 1UPIA 2Q8CA 1BLZA 3PTRB 5AC91 1GP4A 1YFYA 2PHFA 1RC6A 3K1NA 2QTWB 1IXSB 1AXZA 4Z6YA 2AGSA 2XOMA 2GN3A 2BGPA 1CAWB 3KV4A 4L5JA 3FXQA 4A3EJ 3VN4A 4A5NA 2QZ3A 4EN9B 3NJYA 1NA1A 1UAAA 3AMHA 1AL0G 4Y1UA 2CYYA 3HZJA 5ERIA 1I1SA 3JB8A 4I98B 2HYJA 3B93A 3TNPB 5KCMA 3RKYA 3MKWB 4KJZA 3IZOA 1IF1A 3CIHA 5AVPA 1QA6A 2P5KA 3MWMA 3PNVA 1PVC3 4MLOA 1Q8QA 1W9SA 4HK9A 2CQQA 4A6DA 2WDBA 3A01A 1PZ9A 4CZZA 3AMNA 4ZDLA 2HDWA 1UXXX 2X85A 2LFBA 3CMMA 4KNCA 1IPJA 5ABJC 4FPEA 4H14A 1HC8A 4JV4A 1MS3A 5EGOB 1SDDB 5K0UB 3KGLA 3CF5F 5CAZA 1YTYA 3MPBA 2JDZA 4AEMA 1AYM3 4IE6A 3ZFEC 4EJUA 5FKNA 3B6CA 2WKKA 2MYSA 4HZFA 1RIOH 1NK2P 2BW3B 1R5GA 4U7BA 4KITB 1NA1C 4JX6A 1NUKA 3RNSA 1RR8C 3QH6A 1I1GA 3JBG3 4JHZA 3HT1A 4M9ZA 1IXCA 4I3GA 1GWLA 2XJTA 5FZHA 3T0BA 1R6RA 4TWTA 4XUQA 5LATA 2NM1A 2DMNA 2EZHA 4QXBA 1JU3A 4O9GA 2K9SA 4RA0A 2R7VA 3RZOJ 3ZN5A 4LKDA 3R0JA 2DFEA 4JQTA 1IO2A 2CO5A 2EV6A 3VKMA 4QKDA 3O3KA 3TNQA 5LB6A 5HCAA 2W25A 3VBSC 4BS9A 2H27A 2AXLA 4LG0A 4D0PA 4Q26A 3ZDSA 4UAPA 5DAVA 1S7OA 1OCCH 3CMEI 1HX6A 4PDWA 1R1A3 1QPIA 3T1BA 4FQGA 4WCGA 1I50J 2M8EA 3DPRB 3LB9A 2YV8A 4UUTA 4X8NA 1D8KA 2AR6A 1J75A 3I2HA 2DMUA 4DXTA 1T95A 3RG0A 2LTPA 4KNYA 3OS2A 1SMTA 2OA2A 3J7YJ 1KITA 3C8XA 4D7TA 4XJUA 1OQYA 4ARXA 1EV11 5FFZA 2W1OA 5FUNA 2IXIA 3W6VA 3X2QH 3ZXKA 1XMAA 4LITA 1AHDP 1JOPA 4N53C 2I45A 2DTWA 1YRNB 4P14A 4LUMA 3ES4A 4A3CJ 2NLRA 2VCCA 4OUEA 2KD7A 1YFUA 3DKWA 1RB8G 3M8LA 1AL21 4AQSA 3RMXA 2V73A 5AC93 2ZJCA 2DXIA 4JYKA 4BA6A 2EZKA 5FUPA 4I99C 5CG9A 1B8IA 4HQMA 2BOIA 5L3CA 3BG6A 3FZ3A 2DVBA 2BTVC 4XDPA 2V09A 1PX3A 4A45A 4XDOA 4Q4X3 2HWB3 3HC7A 4NBQA 4ZTJA 2HEVF 3CMYA 3HBZA 5C8CC 4D9JA 1SLBA 1DDLA 5H6QA 2I10A 3VBRA 4J01A 3I9V2 3MO4A 2V72A 5IVYA 2Y31A 3ERED 1BHGA 5GLTA 1SANA 4ANJA 5B4NA 2OJED 2R061 2VOPA 5CFCB 1X3ZB 3DEUA 2BUKA 3SHFA 2BV6A 4UFJA 3D4KA 4P5YA 2JA6J 5JHUA 4BWOA 3D8CA 5IK4A 4DRVA 2FDHA 2XF5A 3VYSB 4IO9F 1E5IA 3AL5A 1B72A 4FXKB 2R7TA 2GA1A 3ZCOA 1HQWA 3EDPA 1IPSA 3B73A 4FQZA 1HV0A 1TG7A 5BNGA 4GA9A 4CCCA 2BY3A 2P81A 2CAUA 4Q1PA 5F7UA 2XBO3 4R1HA 2W48A 3ZXDA 1MBJA 1D0HA 5FROA 3OBZA 1W5TA 2DUOA 2QQAA 4XLEA 1Z91A 4HF2A 3AZYA 5K7ZA 2RVCA 1YQAA 4MTEA 1WW5A 4IJAA 4CDWA 1FOD1 2VR4A 3SEQA 5EP9A 2FDKA 1WJCA 3ZFFB 3EYIA 1EP0A 4UB8C 2HNHA 1IDYA 1HOMA 2JMWA 3JRFA 2J5OA 5IK5A 2MA3A 1OKQA 4BNCA 2RS33 4R52A 1JKOC 3E97A 1J5YA 1BXHA 2ESHA 2VJXA 5C5TA 3MD2A 1QZEA 1GP6A 2GMMA 1ENSA 1IPKA 5C3SA 2J7MA 3H8XA 1RC9A 1BJAA 4CDUA 1ASJ2 5FXXA 4A3XA 4GRIA 1QPMA 2Q4SA 4HDVA 3C2HA 2PLV2 3BDDA 3PL0A 2EZLA 1DHKB 3K1PA 2EXKA 1HB3A 1H8AC 1OHFA 1O3TA 3CEWA 1A3KA 1ZR4A 1AL22 1KS5A 1I27A 3BTJA 2XJSA 2CW0F 3MUY1 1MZEA 5I0SA 2QVSB 4U2AA 4NROA 2Q30A 2R5YB 4ZZLA 3CHXA 4I76A 4Z07A 2Q0AA 1IZ3A 3OD4A 4YGEA 1CAUA 2LKXA 3K0LA 5FXWA 3GZEA 3VBHB 1KONA 1MNMC 4LBQD 3ZMTA 3TO9A 2QA4I 4MVTA 2GH8A 2FEZA 2VZPA 2VZTA 2LM3A 1HXDA 3ILRA 2IWGB 5ANNA 1VMFA 2Y6JA 5H2FC 4JKMA 2NMOA 5C9AA 1IZ1A 4QDRA 4AVBA 3LIHA 1ZAOA 3KVAA 4IOCF 4KMFA 2O8XA 5FMBA 4AIDA 3PJRA 3UNGC 3IAPA 1T6BX 4PIYA 5CFDB 1D4M3 2WNUA 2VBXA 3G2BA 3K6GA 3J80Z 4JVAA 2BHYA 1OUXA 1G6NA 5H9QA 1AYM1 1X1DA 3TQNA 1SLAA 4ONUA 4BE2A 2M45A 3K4MA 4Y17A 2VTXA 2BY1A 2HTSA 4CXYA 4JRLA 1W2TA 3CMGA 1APNA 1HB4A 1ZX5A 2GNDA 5F5IA 2FMLA 2CDOA 4QSHA 4CCJA 3RI8A 4YFZA 2L01A 1RJ8A 2HYXA 4P02B 2WO1A 3VHRA 4YG3A 3M07A 2IXKA 3S17J 1RXFA 4LKEA 5K0UA 4UW6A 2GA2A 4XRMA 1TQMA 4QGMA 2G9FA 3WQ0A 4EMSA 3L2RA 2VMEA 2HVQA 1IS3A 4N43B 2M9HA 3T2QA 1VBD2 2IS1A 1CJDA 4LBKA 2C9AA 3CESA 3LAJA 2DK8A 1VBA1 2W4SA 4ZKTB 3WODF 4LHLA 3Q8BA 5JSRA 4QPOA 1RNLA 2EXIA 5D2AA 3FMQA 1XPXA 4X0GA 3K46A 3GFIA 1ZBA3 2KXLA 1X3WB 2K27A 2VPVA 3PO2J 4P9WA 3QOEA 2ESNA 4CEWA 2NS0A 3O1VA 5FLXK 5BYNA 4MEYF 1Y9QA 1EY2A 1LODA 3PSFA 1BK0A 2V4AA 1R5ID 5EGOA 3PIPF 1GR3A 2RR12 3POFA 3ACGA 1DGWA 1VQOI 3LNQA 3DPRC 1MH4A 4M72A 1PGW1 2PMZN 5I0DA 1LFUP 2L7FP 4A7ZA 3PUHA 1RUG3 3D0SA 4URTA 3NRUA 1XS9A 2EAAA 1QO0D 5ICFA 2JG8B 2Q8DA 4BIFA 3VHOA 2COMA 1R71A 1B9NA 2HVRA 4I0WB 4W50A 3C7JA 1SBDA 2ZHKA 4NPMA 5HDNA 2ZMEC 5FRAA 3FHQA 5C4WA 1J59A 2BVMA 5A3TA 3RQ0A 2CDPA 4CDXB 1JYVA 5I8TA 3G73A 4OWRB 4CCOA 4U0YA 1HRI2 2WC2A 2HWE3 3BZCA 2FCTA 3FFZA 1K3IA 3LSPA 5FZMA 4ITVA 3NAPC 1RUF3 1JI6A 1FT9A 3ABKH 2FXAA 4XZUG 2LKPA 3RDIA 3PQJA 4OINF 1APLC 2TRTA 2XRLA 5LZ6A 4HOBA 4BJ6C 2E2IJ 4LK7A 5KC5A 4DXZA 5F5QA 2BNOA 5HCFA 4EN0A 4JKKA 1A6QA 4KYWA 2FRHA 1H9PA 3ZQGA 1ODDA 4K40A 1V6OA 3BTAA 2MLKA 3ETPA 5LBFA 2EZIA 2QDNA 3OUHA 5F6KA 4RQPA 1W0NA 1WI3A 4GJYA 1XSDA 3E6DA 3TW7A 1G9FA 4QIWN 2IXJA 4CO8A 3O1TA 2MPFA 3D3AA 1G3YA 3OYCA 2DCYA 4M3CF 1PO22 2LLKA 1CD3G 3M8EA 1G8WA 3S93A 1FPN3 4AVAA 4RAFA 2VW1A 5A32A 2BW8A 4XFAA 4ZDOA 4RDUA 1FOKA 4RHV3 1LQ1A 1VBE2 3GZNB 3N7LA 1ETVA 1ZYRF 1KD7A 2E1MB 3AP5A 1QVUA 3HR9A 3AKPA 2BGOA 1UX6A 3OOPA 4UY8I 2QLZA 1MDMA 2YPDA 5T55A 1UIJA 4I01A 2EVXA 3ZYHA 2QQOA 5IPAA 3B3QE 4Q4ZF 4YW6A 2E32A 2AS5F 1WZXA 3VZNA 1N47A 5C71A 1JE8A 1QMJA 2L9LA 3WNPA 4KIBA 2EV0A 2Q1MA 5CU1A 3NMBA 3NRVA 4CEYA 2B45X 4RS5C 2P34A 2IS6A 2K02A 2KRCA 1G3TA 4YM3A 1OD3A 1YQ5A 3CO7C 3CLPA 5DZFA 1LFBA 2Y30A 2CL2A 1Z6TA 2DODA 1U3EM 1D8JA 1FEXA 1C8M3 2BZDA 2GXBA 2R1BA 1ZZCA 2RAEA 1IV8A 4XKBA 3CCUI 1WA6X 3OYWB 4CYCA 4XKWA 5E3NA 1XGNA 5FZ9A 3SQOA 4AVTA 1B35A 1VQ6I 1K7AA 5HDGA 3ZX7A 1TVGA 1W04A 1Q3EA 1ETXA 2QQBA 4CU8A 3JRHA 5ANQA 1UPSA 4IESA 2XXZA 2IA1A 4IZZA 2BP6A 2UWBA 5L9BA 4CHUA 3HB9A 2VQGA 4PJNA 3QOPA 5C3QA 1FV2A 2PQQA 3UJQA 4B1LA 2KZVA 2Y6FA 3E6BA 4ZONA 2ISYA 4BAYA 1Z9CA 3U2RA 1VQ4I 4Y1XA 3FK7A 1XE0A 4BE0A 5GLWA 1TLHB 3GZTB 1V4RA 2Y6LA 2RS11 1VALA 1UYYA 4N7IA 4D5FA 4XFHA 2CUJA 2PA7A 4M73A 1J1TA 2P5BA 3KP6A 1O8SA 2NS7A 2M7AA 4ASNA 2VGDA 3I97A 2NP0A 4JDMA 1LEAA 3NNLA 4MGQA 3HOZJ 4FPLA 2XAGA 5HS7A 5JR7B 2B8MA 3H0OA 4MXWB 5HLHA 3G1LA 3ISPA 5DQ0A 1DGLA 5I93A 4FPFA 2MD0A 3I2FA 4AI3A 3CCLI 4BKXA 1AOYA 1CAXB 2WN2A 5EYYA 4XN3A 2OQGA 4BCUA 1OH3A 4XSXF 4ESFA 2JXAA 2XKPA 1A8MA 3AYAA 1FYMA 1TWAJ 5CKQA 5E3LA 3CLQA 1FPN2 3TYJA 2XPJA 1YG2A 5A1FA 3HRSA 3OGVA 2R5ZA 1VBE3 4GGGA 1SFEA 4OHZA 3EUHA 2W0XA 2RMU2 4NHMA 2KISA 3FMRA 1QU3A 1JYIA 3WHCA 1KQRA 4FOWA 2SLIA 4HLYA 3ENRA 2A05A 1P8JA 2R7FA 4BZ4A 1QXJA 4D7NA 2KIMA 3U4XA 3HKZA 2JRTA 4YVSA 3C18A 5EYXA 5LA2A 4CCMA 2HDDA 5FKBA 4HL0A 2VC0A 2VNVA 4FE4A 3M1HA 4GZ9A 3RYKA 4AOCA 5D6FA 4Q1RA 4M3BA 2YU2A 3CDHA 1XU1A 2VKVA 1HW2A 4LMYA 1W05A 1C1FA 2HWD2 3UL2A 2WNVA 1WCDJ 4HG2A 1POGA 4OIOF 1HKQA 3L2YA 4NWWA 3FISA 1LOBA 1QGPA 1W6MB 2H6CA 4RA2A 3BZ6A 2XAJA 2D6KA 3A21A 2BXYA 2XLAA 1R1VA 2IGMA 3MZ8A 2O6GE 3H7YA 2Y64A 5FXZA 1NHAA 4Y4RA 2L7KA 2XBO1 3I4IA 3I3MA 4DEVA 1YXWA 3ZMUA 4QPIB 3VV1A 4B48A 4OULA 4J00A 1PDNC 5DPNA 1BR1A 2E1CA 5C9AB 4MGIE 1MMSA 1I39A 5C3PA 5JMCA 5FZCA 3BT9A 3R4KA 1W8FA 3ORJA 1YI2I 2J1VA 2JA2A 3H1CA 4I02A 4N43A 4QM9A 4MADA 1URXA 2CV0A 4EM2A 2DUPA 3MGUA 1G9CA 2R042 3SHRA 1WRJA 2Z3YA 3LF7A 2KJBA 2IS4A 2KP6A 2Z9OA 5KAFC 2NOJB 2WBKA 2OKXA 3HOUJ 4XACA 2LALA 2R3SA 2GXAA 4BQ2A 1MEC1 1L7RA 5DZEA 2JE7A 3VBHC 5FR3A 5KHKA 2XR4A 2F5DA 1OKOA 4EROA 4PT6A 2P6SA 3KS7A 3CJXA 2VI6A 3C2BA 4L0PA 1PZ7A 4B4RA 1MH3A 1HSTA 2J1TA 5IVEA 4UW5A 1FX7A 2JG8A 3KLOA 3ZN6A 2EINH 5JSOA 1AU7A 5L73A 3LDKA 4BXSV 2QM3A 2O3FA 4NIHA 4MTDA 1GSLA 4LO8A 4SLIA 5GZGA 1H9WA 2HQRA 3WHBA 1FSEA 5A2QK 1VNDA 2EA7A 2RDQA 5M0TA 3RCOA 3ZXJA 4GH4B 1G4DA 5IAXA 4PIZA 1GV9A 3B01A 1YLFA 1ZH5A 4PJ0C 4BE3A 4IEJA 4XHXA 5FP9A 2E7AA 3A02A 2WFPA 2FQ3A 4ENJA 3JD71 2HU9A 1YO8A 1V5EA 1MS9A 3I4PA 2CGOA 2PG4A 1WZ2A 2BFUS 4Y24A 3ZQCA 3BC8A 3A01B 1IRFA 1ERDA 2YBKA 2ZHNA 1BVVA 3PUBA 1CQTA 3HPNA 2ZCWA 2CFOA 2CUFA 3FM5A 3BCAA 2XSJC 2YZ4A 4E7LA 2XH6A 3WTWC 2PI0A 4XJ8A 2XGXA 1FMD1 1XSRA 1Q5OA 2PMHA 5ILSA 1PYVA 3BQZA 2K5CA 5D8AA 2YC4A 5KXCA 3D5OA 3WTYC 4ARYA 3I2JA 3PMSA 3JUUA 1NCQA 1ULFA 5K0UC 4LO6B 2RNGA 3G1OA 1EUTA 1AR62 4QKNA 3DYOA 3DGTA 4A4AA 5K7PA 1JKPC 4LOCA 2R6QA 1I9RA 1LVAA 4G12A 3ELNA 5KBFA 5CISA 2DW4A 2VCMA 2VKHA 1FP2A 4QHZA 3WNXA 1CX1A 1X50A 1LFPA 2MHFA 2CQKA 1CAVA 2JD9A 3WTZA 3G1MA 3LWFA 4DZPA 2ENRA 1KYWA 5FY5A 1HRV2 5C3OA 4HANA 3ERMA 5J6XA 4AI8A 2NAZA 2BJSA 1ULCA 4YW5A 4DRRA 2QGUA 3IWZA 4M9XA 2PLV3 1HV1A 4XFIA 2AHQA 5BS6A 4YM2A 3GHNA 1WFXA 2GIZA 1J0RA 4JP0A 4ESBA 2CYFA 4BU2A 1KU2A 4IVNA 1ZG1A 4DGWB 1RVF2 4FTHA 2D5HA 3IPVB 2VIXA 3ZFGA 4LE4A 1RUNA 4P96A 1IN5A 1AYN1 1S29A 5JFRA 1R093 2XPUA 5HCBA 3GCWA 5LHGA 4Y5TA 4I3PA 5FYUA 4BJ0A 3IC7A 2D1VA 2RS31 5D6EA 3ZSEA 1R9TJ 1WCMJ 2V9PA 4RM3A 2VW2A 2W3JA 1S55A 4LK0F 5JWPA 3DXJF 4DOZA 4HW0A 5FZ3A 1W8TA 4NNJA 3OD0A 5LA1A 1MJ9A 4PJYA 4RGUA 3ZMNA 4JAAA 1Z3YA 1TNFA 5FFXA 2C26A 3HEFA 1GQGA 4NHKA 4HK8A 1ETKA 1AR83 2W39A 3B9IA 3KYCB 2EB7A 3E3VA 2VVDA 3DEMA 3CCMI 2DA2A 4LHKA 4II2A 3RJ2X 3U07A 1ON2A 3IL2A 1UFMA 1LUJB 3DCFA 1I1EA 4YRVA 1VMJA 4L18B 3E5QA 1N3PA 4XAEA 4EN6B 2X1CA 5HCHA 2QQUA 4Q0PA 2RDSA 3ZYJB 2HEWF 4IRGA 3C7HA 2ADDA 4ZZDA 2XAFA 3TN93 1CZTA 2PELA 1TEIA 2NS8A 4CDGA 1V9U1 4B1RA 2NVXJ 3UKNA 3PSIA 1JZ4A 1YJKA 4PUSA 3I54A 1LJ9A 2WA0A 3M3OA 4G4FA 2R0FA 2Q8EA 1WJEA 3U37A 3I53A 2D5FA 4RGSA 4IEZA 3AL6A 3KSCA 3B6AA 1BA5A 2RV8A 1X3UA 3VL8A 1X7NA 4GKYA 3KF5A 3BJ6A 3HAGA 1VAKA 2WSUA 4GALA 4ZU5A 2ZMKA 3IMNA 5DCMA 4PI2A 2RS53 4IKFA 2QQVA 2FOWA 4W4ZA 1P6RA 3DN7A 1SD5A 4JCKA 2KM2A 2YYOA 2BXZA 1UW8A 2IP2A 3VGIA 1XNTA 3OYFA 1T8IA 2A71A 1DGWX 3POIA 3TO7A 1X2NA 4I0BA 4ZYAA 1VBD1 4GB33 3KEQA 2FCVA 3I3LA 2QSFX 2D6MA 1OCTC 2YS9A 4UVAA 3BPSA 4Q4Y3 3VDXA 4R4ZA 4YFKF 5EG0A 5EWSA 3S2HJ 1QEXA 4A3LJ 1GKBA 1QJX1 1P2FA 4UXAA 3SJMA 1XXNA 4KBBA 2XBO2 2RNJA 3VDDA 3OIQA 4QB1A 2X1EA 2CV2A 1DGRN 2VQUA 3OOUA 4M3DA 3PIOF 4LMFA 1VBB2 4KU7A 4V1PA 4PBOA 4PJMA 2DU0A 3WW4A 3LOIA 5FO7B 2DI3A 1IKPA 1VQ7I 2CU5A 5JR2A 1YITI 2X48A 1ULDA 1WW4A 3VBHA 5DCMB 3KLNA 2E6VA 3KIOA 1W6PA 2QZ8A 1N1YA 3VBOB 1SD7A 2Y0IA 2YUEA 3WDXA 3FZVA 1UOJA 4M3FA 1NAEA 3TBDA 4A3GJ 3H8UA 2W82A 4XK4A 4JQRA 4LA3A 5K8SA 3VBUC 3PVBB 4UT5A 4CEWB 2F4PA 1RGSA 4AK3A 4QXCA 1AR92 2GNMA 2XAUA 5EIYB 1EV7A 2JDYA 2XJPA 4WVZA 3V8JA 5F8PA 3SFZA 1F4AA 1SQ4A 2E51A 3ZYRA 1QJZA 3EO6A 4LHSA 1OJLA 4YW3A 3K4CA 3C1DA 1X1CA 4OHYA 1WQ2A 1OCRH 1CAUB 1YC61 2P4EA 1LEMA 1DU0A 2QKDA 3DEWA 5DM7F 2IBDA 3MHZA 4CDWC 2JKXA 5IW0A 1H30A 2QFEA 2XJRA 3ZGKA 2A3YA 3KP7A 4WZFA 1H8TC 1XGSA 5HODA 1AKHA 3CJIA 1R091 3S1MJ 2WY8Q 3OSFA 4A3ZA 3ML6A 4FTBA 3QPLA 4I7HA 1VMHA 2PTMA 3UKTA 2Y38A 3NVCA 4LBQA 2FA5A 1JZ3A 1MBEA 4DMIA 3JAMK 3ZYBA 3OYIA 5IVCA 5F08A 2HWF1 4X8PA 4A5MA 1QH7A 1UZVA 5EQUA 3WG7H 4TLGA 1DZQA 5IWFA 2W24A 2MD5A 1QXPA 5FJ8J 5DZGA 5JPNB 2G7HA 1Y7BA 2GP3A 5BUVA 5J48A 2ZB9A 4S2GA 2C24A 2XUMA 4RB1A 1Z05A 2CMPA 3IH2A 1T0FC 2YX7A 2DT5A 1RVF3 4XXPA 1UHWA 3CUOA 3FXRA 4EGYA 1COV1 1W0OA 1RHI2 1O4ZA 3COAC 1H1IA 5H9SA 2XC7A 1XU2A 1OLMA 4P9XA 4GCVA 2RKHA 3OEBA 3U21A 3H36A 3L7WA 1N3QA 4PDWB 4KG0A 3BG3A 4YPJA 1FLIA 3EETA 4RGKA 3K2AA 2YROA 5FPVA 2VMCA 3WTSC 4AXOA 3V0AA 2YMZA 4I2OA 1K12A 1SD6A 3PUQA 2M5WA 2ZXHA 4DPNA 1LE8B 4CICA 2Y75A 2VQTA 1SFNA 1U78A 1U5TA 2FDGA 4DOUA 1Q8OA 1GVJA 1BMV2 2A6VA 4Y1YA 1IAWA 6PAXA 3ESWB 2YU1A 4QU1A 5FBJA 1OYIA 1E5SA 2VODA 3EUHC 3H1YA 1W9FA 3WU2C 5FLIA 2ERFA 3MFKA 4NC7A 4FT8A 1RMU3 3BTLA 2B7YA 2NYXA 5E3OA 3AG1H 4AFBA 2C9KA 5EZWA 2K46A 2DTZA 2WUHA 2DQLA 3I64A 2R7EB 1DPRA 5FPLA 2BERA 2J42A 4A0ZA 4ES9A 1RYYA 4YLZA 3D1NI 4IPAA 4U7DA 5K7FA 4OI1A 3IUOA 3JQXA 4KIFA 4CU9A 5FRMA 1U5XA 3ME2A 1X36A 2X1DA 1IRGA 3VEPA 3QYBA 2OD5A 5A7NA 1KA8A 2W1WA 4PIXA 2P5LC 4YIFA 2A6EF 4XF3A 3U9GA 5ERLA 2OW4A 2ZKNA 1K83J 2OX0A 2YXSA 4ORFA 2A3XA 1UHSA 3U78A 1SPPB 4A7YA 5JXJA 2F4MB 1VBA2 1CJPA 1OLRA 3MKLA 2QSHX 2N8GA 1T6GC 1IQDC 1IS5A 5E20A 3O12A 4BDVB 5DM6F 1G3SA 3UYJA 3AP7A 1WGPA 4NC6A 2H0VA 4WM8A 4YGCA 4MGYE 1YQ2A 2HTJA 5CVJA 1QRYA 2LRDA 5E79C 3OGGA 3W2AA 2GMPA 2A75A 4ENMA 3W5MA 3VDAA 2VQLA 2VNRA 5GALA 1BI1A 4YELA 3M4OJ 3WGHA 4B43A 5DS9A 3ZN0A 1RUF1 5EEGA 2B0LA 4CUCA 4E2GA 5FZOA 5AFBA 2F5EA 4NN0A 2XAQA 3I4MJ 3UJOA 1NX9A 3QYEA 4LB5A 2QQ9A 2WA4A 3O1SA 3PVEA 1W8OA 2R32A 4XORA 3IIAA 2Y60A 2RJKA 2NZ9A 3E0JB 5B66C 4GB32 2OT7A 2V9VA 4NQWA 3UV9A 2B9VA 3HN1A 2I74A 4R4XA 1BKZA 1XE8A 3FLPA 2LREA 4DQ2A 4GQ7A 1SBEA 1M1EB 1CPNA 5IT3A 1PHMA 2E35A 4TZDA 5F0FA 2DF7A 4AR2A 3Q9OA 4BXUA 2ZJRF 3HQUA 3OYLA 3NJZA 1JXSA 4FPYA 1F8VA 1CIWA 3E6MA 2I5UA 5CQEA 3ZMZA 2Z2SB 5A7SA 2MEV3 1SFUA 5EYRA 1YW7A 2E5ZA 2GOXB 5DYMA 4ZTFA 1K78A 2HZTA 4FTEA 2Y33A 4D3WA 5FZOB 3MPPG 3Q3SA 3H9AA 3MLLA 1H1MA 2HOSA 2VZVA 2WFF1 1UJ8A 2IEKA 2WNUC 3ZMSA 1R7JA 3GTOJ 2X53S 3KZ4C 4HSJA 3VZJA 4A93J 4A3KJ 4N7UA 1DLCA 5F32A 3H3UA 1OF4A 3KVBA 1TWCJ 4WM7C 2X6XA 1JBCA 1FSHA 3WGIA 4YVSB