1O3RA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 64
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3rA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3rA01
1E2XA 3P7NA 1HSJA 1U5TA 4HLXA 4XETA 2QQAA 1IRGA 1DGWA 1SD7A 5LHGA 3ZMSA 5J6XA 3PLQA 3P9KA 4HMZA 3IIAA 4MH0E 5KHIA 3QRFF 2XAFA 2BNMA 3D0JA 1P6RA 3EQLF 2MC3A 2UY9A 3H9AA 1V4RA 1KU9A 3BY6A 3FXQA 5D5WB 2RGVA 4Q0VA 1XDSA 1LDJA 2CG4A 3L00A 3VHRA 3F21A 1Z9CA 1FYKA 1XSVA 1TNSA 5D5VB 3BPVA 5HDNA 1HW1A 5JVTA 3LFKA 3V7SA 2L3DA 1ZNPA 4M6XA 2E7WA 1Z91A 3FM3A 2XAQA 1T38A 1BI2A 5I8TA 2QJVA 4R52A 1KGSA 3GVAA 1MKMA 5L3CA 5CVRA 4LLNA 3T5XA 1WWXA 4OINF 1FT9A 4PIXA 4YIFA 1UCXA 2PFWA 3LAGA 2Z3YA 4KWKA 3U10A 1O3QA 3GYHX 4JBAA 4EWDA 1SFEA 3I59A 2C6YA 3FE5A 5EZWA 3JSOA 1U5TB 4META 3FXRA 3BALA 3WW2A 2OQGA 3GWZA 3HHHA 2ZNYA 1ZN2A 5CVVA 1QQIA 4L9JA 1KQ9A 1HW2A 1P4WA 1QXRA 3DEUA 2Q8KA 2V6CA 5LRSA 3ZN0A 4Z2YA 3IDCB 5L3FA 2FBHA 2CAVA 5D8LB 2D93A 2G7UA 3Q9VA 3CUQC 1ONVA 3B73A 5LGUA 1RL3A 4AVBA 2HEOA 5CVJA 4G7ZF 4WXDA 3WW3A 2A69F 2BNOA 2VE9A 3MPBA 3SMHA 4EM1A 3M8EA 3L09A 2ZO4A 3F8NA 2DI3A 1R22A 5E1ZB 2EA7A 1W4MA 2ZKLA 2HR3A 4LEJA 1SMYF 5LEJA 2BV6A 3TNPB 1ZRCA 1FZPB 3U2RA 2CWEA 2J5OA 1QZZA 2W25A 3I59B 5I8SA 3BPZA 3C3WA 3H92A 3ML6A 4HVOA 4CZZA 2LF7A 2EVXA 1WKMA 1BM9A 2GA1A 4PJYA 5A2QK 4WZCA 3OOPA 4HVRA 2GWRA 1S6LA 1R23A 5FFZA 4A6EA 4LK1F 2O3FA 3VEPA 3F8MA 3M9AA 2VXZA 3QP5A 4CO8A 5C8WA 2P5KA 4JVAA 5JHUA 2VT2A 3EYIA 4L9TA 4OIOF 1KQ0A 5BPXA 2HYGD 1CAXB 3P9CA 3CLPA 4R1HA 4QGMA 5FO5A 1IUYA 1LEBA 1CAUA 1YLLA 1KYZA 1QZYA 5LEKA 3RPUA 2GA2A 2PAKA 3I54A 5J7MA 3BJAA 3O3KA 1VP6A 1IF1A 3BWGA 3MCZA 1ZLJA 4LB5A 4ONUA 3IWFA 2V1DA 5E17F 1ZGJA 1RTVA 2GH2A 4M6YA 3N4MA 4L0ZB 3LWCA 3UKNA 2MD5A 2R7FA 2QDRA 2H0VA 5DDGA 2Z2SB 2V1UA 2O03A 4JTNA 4P55A 1IXRC 1YYVA 1YTYA 1GHCA 3SQNA 4YFNF 1FXZA 1J59A 3E3VA 3NQOA 5I91A 5JR3A 1F9NA 3DXJF 3UKTA 1PDNC 1YS6A 2XASA 2Y75A 4L2NA 1DGRA 5EFUA 1XDUA 2JT1A 4Q0SA 4IETA 4P9GA 1ZGAA 2EFNA 3E6CC 1X8EA 3HTSB 2XVCA 1ZZ7A 4KFCA 2PN6A 3KEQA 4A2UA 3M8FA 3CO2A 2K9ZA 3V8JA 1CAUB 4KWLA 3USSA 3ZN1A 4ZU5A 4UHTA 1J3QA 3IBMA 4UVAA 5I93A 5D8KB 2QBYA 4YNIA 4I0BA 1V3FA 3F22A 3G3ZA 3L9FA 4L9NA 4UBGA 2OA2A 3DPLC 1J1LA 1KU7A 3O6BB 3JAMZ 2L4AA 2BBYA 3TOBA 5FD5A 4BQAA 1FOKA 1T39A 2PYTA 2MH9A 1X8MA 4K8FA 4BAYA 3BROA 3FMRA 1DZTA 1YFYA 3HSFA 3ES1A 3V7RA 4HQEA 4MUVA 4MGZE 4HF0A 2OPKA 3JTGA 2P8TA 4KU8A 5BV6A 1IZ1A 3GLXA 4B8XA 3WTVC 4AD9A 3CL1A 2QZ8A 1QY4A 5DCFA 4LUKA 1LNWA 1YIOA 2STWA 3CJNA 1G6NA 3WW4A 2Z99A 3CTAA 2MPFA 4J1WA 4IEXA 2ETHA 2EAAA 3GUDA 5T3NA 5CYVA 3GZ6A 4P5OA 5EEHA 4ZZLA 1F5TA 5FB2A 3F8BA 4KUMA 4LFUA 3LOIA 4RGSA 3TNQA 2D1HA 3KZYA 3CO7C 3KP4A 4A5MA 2OZUA 3IHUA 2F5FA 4WK8F 4GYGA 4E2GA 2IC1A 2QBYB 4CICA 1HKQA 1ZVFA 4OFGA 1ZRDA 3T0YA 3WGHA 1Y0UA 1J3RA 1RZ4A 1B4AA 3FZ3A 3LQRA 3ZMTA 4A0XA 3WTZA 4XFGA 1HKSA 4XSXF 3E5UA 2O1QA 4KMFA 1O57A 1FPQA 2QUFA 3C3VA 3J7AO 2F4PA 1TQPA 2A6HF 4M73A 2VOOA 4HN0A 4MGIE 4MNUA 3NSTA 1BIBA 4G7OF 3ETQA 1T2KA 1LB2A 4KU7A 2EK5A 3QPTA 1ZG5A 3FHIB 2FNPA 2HJIA 2JRTA 2VONA 3RIRA 2QVOA 1L3LA 1TBXA 4BYYA 2PEXA 2Y48A 3RYPA 1FP2A 1NE4A 2GQQA 4AIKA 5HOOA 2DU9A 1H1MA 1IXCA 5DUKA 1CAVA 3KMHA 3U11A 3KEOA 2ETEA 1U5TC 4UV8A 5ERIA 2IPQX 3TO7A 4KT5C 1O3SA 3HTUA 3RYRA 4MV2A 2IJLA 1NZCA 4ZYGA 4XSZF 4S05A 3SXWA 1D5VA 2AXLA 1S29A 2XHKA 2PQQA 4HBNA 1KQ8A 5L3DA 1U2WA 4RGRA 4KMUX 5HS8A 1QGPA 3IWZA 1I27A 2IXLA 1ZG1A 5I0SA 2VBZA 2H6BA 4NB5A 1KU2A 4A6DA 1R36A 3KP2A 2O6GE 5AVPA 2EV0A 5H6RA 3E6MA 1YFWA 4Y15A 3KZZA 1IN6A 2COMA 2GXBA 4M9XA 3NVCA 2J5PA 3OF1A 2OZJA 1FSEA 3SCFA 5AONA 1SQ4A 4P96A 2Z9OA 1WI9A 2CQKA 2GC1A 2KRFA 4IEVA 4XF3A 2NAZA 1TLHB 3ABTA 4HX4A 2XAJA 1YWKA 2IW5A 4HSJA 3QOPA 3QAHA 3H7YA 3LWFA 5A2QZ 1SFXA 2PBIA 4UXNA 1CAVB 2QLZA 1FBQA 4ESJA 2GU9A 2RC4A 3FFQA 3WODF 4G7HF 4L5JA 2PA7A 4QXKA 3JTHA 2MLGA 4LULA 3GZ5A 1USTA 4B09A 2JTVA 5ILVA 3JAMK 4FT8A 2FXAA 2KIMA 4WVZA 4AIJA 5K8SA 4GULA 3D82A 3BJ6A 2A68F 4EJUA 3WGGA 1U8RA 2ZNZA 3R0JA 3G7DA 3GYDA 5ICEA 1ZRFA 3DFGA 3GEZA 3BJOA 4PCQA 4MGKE 4HLYA 3CUOA 4Z82A 2ADUA 5I0UA 4FAHA 3MZYA 1O5UA 3VFZA 2MA3A 3TO6A 4MEYF 2P7VB 4XF9A 1JHHA 4MTDA 4I3PA 4EM0B 1YLFA 3ACLA 1P4AA 3P9IA 5BUVA 3ECHA 2FQ3A 2HQRA 3Q9SA 4O9GA 3PNAA 5JSOA 4KIFA 5FLXZ 1Q3EA 3WTSC 1R1TA 1ZREA 2F5EA 3EJKA 1E17A 3GX4X 2VC1A 1XCVA 1VJ2A 2EFPA 1G3YA 5IT9Z 3L2CA 5FLJA 1DUXC 3WE2A 3I7DA 4OOIA 2PTMA 1HW5A 3EHKA 4L9VA 1XCBA 4QMAA 5IT3A 2IA2A 1DDNA 2A07F 5FPXA 1RI7A 4UVCA 4GCVA 4Q4ZF 2DO7A 2ZXJA 3F6VA 1UIJA 2ISYA 1W5TA 1WQ2A 3U9GA 4N9HA 1YFXA 3H3ZA 2D1VA 1IN7A 4IRHA 4RB0A 2Z5UA 1SD4A 2VC0A 1LR5A 4E2QA 1BI1A 1X3UA 4N9IA 4TV7A 4IEQA 2NNYA 4IRGA 2FBKA 3HRSA 2GC3A 3HOTA 5H6QA 1GVJA 2A61A 4AVPA 4WXCA 4EWAA 3L2HA 5H20A 2ZKZA 1BC7C 5LLQA 3IKTA 2O0YA 2EFWA 2L54A 5CU1A 5LGNA 2GZWA 3WTUC 2CFXA 2YPRA 3KLNA 5KHGA 2GIVA 2XLGA 4IEPA 3HSEA 5E1WA 1J58A 2N7GA 1Z6TA 2L01A 1BOAA 4JQFA 5FDBA 2IP2A 3PVBB 2XROA 4XF0A 4QM8A 5ILSA 2M30A 1XSDA 3I58A 3QU6A 4XEZA 1TW2A 2Q0OA 2K4BA 1LJ9A 2HFHA 2ELHA 1OR7A 2MHFA 2GXGA 1D3YA 5DUIA 1OKRA 2IT0A 3N97A 5F1RA 4O6JA 1YW7A 5F64A 1CAXA 2V1XA 4UVBA 4Y17A 4P9FA 2VECA 1UPIA 2Q30A 2V9VA 2UXNA 3ERED 1USSA 4I0AA 5DD8A 5FQ0A 4IRIA 3FZVA 3K9TA 2D2WA 4ENJA 2FF4A 1UIKA 1ZZ6A 2FRHA 5E1XA 2PQ8A 4ESFA 5L3BA 2CW0F 5DEQA 4PGGA 5D4SA 2PAEA 2D5HA 1XE8A 3TGNA 1XD7A 4YFKF 4JTOA 4FX0A 1BJAA 4ZU4A 4XLPF 2D45A 4MZUA 1W5SA 4G6DA 1ULYA 4L18B 1MJAA 3HHGA 3E97A 4G6QA 5I0RA 1HXDA 4HN1A 3GF2A 5FD6A 4ZH4F 1O7FA 4Q47A 4LLOA 4HX7A 1IW7F 5BPDA 3RDIA 1FBSA 1EY2A 3CEWA 3H1WA 4Q0UA 2WC2A 4YFXF 1VR3A 2P17A 1MZBA 4D0PA 2OQRA 3EETA 1J5YA 4KA4A 2BNNA 5K5OA 1KU3A 4ZYEA 3CF6E 3QACA 3O2PE 1K7AA 3NW4A 3S7IA 1LVAA 4RB3C 4KNYA 1TQMA 4ON0A 3HQXA 2BEOA 3R60A 1RUNA 1ZX5A 5J48A 5ED4A 4AQ6A 4M9ZA 1R1VA 3PQKA 4UV9A 2MH2A 1LKNA 3MWMA 4HV5A 4MQVA 4G9YA 2VN2A 2K7LA 4EM2A 3ECOA 1FYMA 5FQ0B 3NL1A 2EA4A 4AQ2A 1Z7UA 2M1BA 5HS7A 1TNTA 2CV6A 4EROA 1RGSA 3T8RA 4XFBA 3FMQA 3Q5FA 2QCSB 1RUOA 4L0YB 3K2ZA 4I02A 1TTYA 4QM9A 5K1YA 1IN8A 4J1XA 3DN7A 3LAJA 4YG2F 5FLXK 1PP7U 1QXJA 4XFHA 2M87A 4S04A 1C0WA 2IXHA 3K0LA 3T8TA 4IHSA 1AWCA 2QYOA 1H9GA 4FX4A 1XSXA 4HF2A 3OCPA 1SAXA 4ZU7A 3GO5A 2UWMA 1HSTA 2YR2A 3V7CA 1OI6A 5IT9K 1BI0A 5HDKA 1J75A 2DPDA 3C1DA 5K5RA 2NRAC 2P6TA 4IESA 3JW4A 3HSRA 4EJOA 2BE5F 3ZMZA 1OD5A 1S7OA 1DP7P 4XFIA 3SCHA 1GQHA 1Q1HA 3WTTC 4NVPA 1G3SA 5ILUA 4Q5SF 1TQIA 2VBXA 2HGCA 3D5LA 1U12A 3F8CA 3TDZC 4ZZDA 2ZJ2A 4EWEA 3DF8A 4CHUA 2GAUA 4I98B 2ZMEA 2G9WA 3RI4A 3IDBB 2ACJA 2K02A 3SCGA 1O3RA 1RIOH 3L7WA 3TKYA 5D5UB 2W57A 3SHFA 2JPCA 2VODA 3KCCA 4DINB 4JV4A 3V8LA 4IJAA 1YUDA 2FBIA 3DV8A 2HS5A 3FHZA 1EPZA 1B59A 4CDGA 3JSPA 4ENNA 1D8JA 3BU7A 1Q5OA 4HSLA 1IN4A 5AIPA 1TW3A 4Q48A 2F5CA 1JHFA 4D7TA 3SZPA 3LZZA 5TRDA 3FM5A 5HLIA 4XBFA 4QWQA 1F1ZA 3I0TA 1GQGA 2I45A 2ET1A 3FF5A 4RGXA 3MZHA 2F5DA 1XMKA 3QPHA 1GXPA 1Z1DA 1FBUA 4QX5A 2XRNA 1CAWA 3U0ZA 1BIAA 3CUQB 4YRDA 2RNJA 1B9MA 1MGTA 4CGZA 1NE6A 1YO5C 1SEFA 2NS0A 2DQLA 2A3SA 3J80Z 3IL2A 4UUVA 1EP0A 2Q0AA 2EA2A 4M74A 4I2OA 4MTEA 1U6GA 4EJTA 4GXOA 1K79A 5DCMA 3MYXA 4WX9A 3DQVC 2VT3A 5ICFA 3KE2A 6PAXA 1WA4A 4RGUA 2XAGA 1J3PA 1ZZBA 2ZMEB 5HVQC 4MX3A 2HTJA 2STTA 4IERA 4U0VA 5D5XB 1NHAA 4U0WA 4U0YA 4G8XA 1B6AA 4HAMA 4ORFA 2L4MA 4PIZA 1IRFA 1H9TA 1JUHA 4LK0F 3R6SA 1LEAA 3CDHA 1WGPA 1REPC 1ZRRA 2RDPA 3OTFA 4MGYE 1I1SA 2JPBA 3RKWA 1G3TA 2HWVA 4AXOA 3SFZA 3F23A 3K1NA 3OGJA 4YARA 4M9SA 4YYOA 2X4HA 4HA8A 5E8GA 3MDPA 1CAWB 2WWYA 4DQ2A 2P4WA 2UYBA 5LGTA 1J0RA 2IRFG 3EUHA 1YS7A 4OMZA 4E2SA 2ESNA 2EJRA 2OBPA 3ZMDA 3E6BA 2KXLA 4KL1A 1IAWA 3ES4A 2IXIA 1U3EM 5DCMB 1Z05A 4FBFA 3VB2A 4KIBA 1EH6A 1T98A 1FI2A 3NJZA 5JSRA 3KP3A 1D8KA 4GO1A 4AVAA 1TQ5A 4EQQA 1YHFA 3IKVA 2PJPA 1JXSA 1UB9A 3OD0A 5CVUA 1R5GA 3M70A 5JSPA 1EV7A 1ON2A 4HYEA 2ISZA 3RJPA 2B0LA 4A5NA 2Q1ZB 4PDKA 4R8HA 3ZPLA 3DL3A 3C7JA 4ZYHA 2RV8A 1IN5A 2R7DA 4PZJA 2CGPA 5C6CA 4EVIA 2FU4A 2B8MA 1OFNA 2PMHA 4WCGA 4O9EA 4LUMA 2HYFA 3W6KB 4CXFA 2K4JA 1SMTA 4LA2A 3M7GA 3IC7A 1UFMA 1FP1D 1ZG3A 2HZTA 1FLIA 2XLFA 3CJXA 1QBJA 3MEXA 1JE8A 1X7NA 1V70A 2XV4S 4Q29A 2A6EF 3HOSA 2RKHA 1K6OA 4E70A 5L3GA 1Y9QA 5ICGA 2MNGA 2QQBA 1XGOA 4AVCA 2A5YB 4ETSA 3DPTA 3COAC 2MLKA 2PHLA 3S7EA 3LQQA 3SHRA 2EFOA 4HBLA 2FOKA 4LTAA 1U78A 1P92A 4UBHA 1I5ZA 3HRMA 4BIFA 2CAUA 1T6SA 3J81K 2P7CB 4B29A 2AS5F 3WE3A 2YU3A 1SD5A 1W7PA 5KHKA 3GFLA 2XGXA 5E8IA 2GC0A 5ICCA 4AWXB 3R4KA 2P5VA 5FLIA 4QGLA 4IVNA 2LDUA 2W84A 3VOEA 5I0TA 3I71A 1QPMA 4OIQF 2O61A 2QVSB 2FMYA 2M5WA 2Z69A 4HQMA 3ISPA 4LLGF 4IF4A 4BH9A 2EFQA 2BYVE 3GW2A 3KP5A 3FXUA 4UXAA 4F8AA 3J80K 2DAOA 1K78A 4KN4X 3RNSA 3PQJA 1UHMA 4IEWA 1LQ1A 2ET7A 4HDUA 4KYWA 4F7ZA 3H3UA 5JFRA 2QENA 1X82A 1ZH5A 2G7HA 5CADA 4Z07A 1QWRA 2EWNA 5LRRA 1OYYA 2P6SA 3W6JB 1BC8C 4XLNF 1O3TA 1NYWA 4GYIA 2WFPA 5KBFA 1T0FA 2FE3A 3I4PA 3T1BA 1ZYRF 1RNLA 4A12A 3HRTA 1XN7A 4MGRA 1OMIA 3BZ6A 3FJSA 1W7PB 1P2FA 2LNBA 5BQTA 2OZ6A 3S2WA 2KIFA 2M8EA 4EMSA 4LA3A 3WTXC 2RQPA 5D6FA 2PFBA 2VOPA 3RZZA 2XIGA 2IXCA 1PM7A 4Q0QA 3NEUA 2CYYA 5E18F 2K0GA 2Q2EA 3GFJA 2VBWA 4KN7X 4WXHA 2C0ZA 3BB6A 3D0SA 2GC2A 1OYIA 2Y0MA 3GBFA 2XL7A 1JGSA 2OAZA 1K78B 5E20A 4IHTA 3SXYA 3ZP5A 1CGPA 3RYKA 3WW1A 2P5LC 4IEUA 3BDDA 4HVQA 3OV8A 3GFIA 3KGLA 4HLTA 2IA0A 4WBBA 1EYBA 2LSOA 1ZAOA 4XRFA 3KP6A 2BGCA 2CO5A 2X0LA 5FCCA 2IXJA 4LLLA 1MD0A 3F6OA 5BPIA 2HTSA 1XGNA 5K5QA 1AOYA 3C18A 3H50A 1O5LA 2OA4A 4HX8A 3ROUA 1Q43A 3R0AA 1FNNA 1OPCA 2TDXA 2KIUA 4Y13A 1YW9A 4UNOA 1EH7A 2K27A 3FWEA 2HDCA 2ZFWA 5HDGA 2PI0A 3KGZA 3K1MA 5JI6A 3HYIA 1BI3A 1KA8A 4P9UA 2DCTA 3GFMA 3ULQB 2IVMA 3ZQ7A 2IXKA 4IEZA 5HLHA 2RN7A 2DK8A 3DKWA 2PHDA 4FAGA 1SD6A 3KP7A 3K1PA 4ENKA 2OD5A 3E6DA 4PGHA 1PMIA 4H7LA 1FY7A 3F72A 2JSCA 2ATFA 1HBXG 1XE7A 1S8NA 1STZA 1YFHA 1J7KA 2PG4A 2FQPA 3I53A 4X6QB 3MAJA 5J3UA 3TO9A 3U1DA 5I8YA 3MQ0A 2KJBA 1Y3TA 4L11A 1HKTA 2DT5A 4WWCA 3SZTA 4A0YA 2OYZA 2XKOA 1WLTA 1XGMA 2B5HA 1WRJA 2YSRA 2VQAA 4ENMA 4RB1A 2XL9A 2ZCWA 4EGYA 2HOEA 1FC3A 2UZKA 1A04A 1ODDA 4G94A 2R3SA 1ON1A 1S7AA 4BHPA 3QP6A 3ZMUA 4EJVA 3IRRA 3ELKA 5J8CA 5KHJA 4RAZA 5BMZA 5HI0A 4MEXF 3V4GA 1H0MA 2K86A 1J9IA 1RC6A 3EDPA 3NRVA 5BOXA 3B02A 4IPAA 3S0MA 3FX3A 1I1GA 1FSHA 4O3MA 1YQAA 4IEOA 3WTYC 1YG2A 3REOA 1G3WA 5J8FA 4LG0A 3KETA 2O8QA 3EYYA 3O14A 3CUQA 3KFWX 1CX4A 1XRUA 1IPKA 2EB7A 1HQCA 3RPQA 2UXXA 4BHCA 1XMAA 1ZZ8A 3BPXA 3FMSA 3R61A 5F6FA 1L3JA 2XLAA 4IEYA 4M72A 2Y0OA 1ZLKA 2LF8A 4EGZA 4WF2A 2PMUA 3HRUA 3TQNA 3HT1A 1YW8A 3TDUC 4KDPA 1KYWA 3M3IA 3HT2A 5HLGA 1VTNC 5BXXA 2V09A 3LA2A 5E16A 5JCTA 3EQEA 4H0EA 1LRHA 4ASNA 4OIRF 1XB4A 1SFUA 3H7JA 3BOQA 4QGNA 3E5QA 3GXOA 3IRQA 3J81Z 2QQ9A 3ZMVA 5JAXA 3WU1B 3WGIA 4OLLA 4DNCA 3G73A 2DTRA 3PFIA 1R5HA 1MDMA 5FPZA 2ESHA 4LG0B 1DPUA 1IXSB 4LD5A 3VODA 1ZZ9A 4OIPF 5E1RA 5L3EA 1UD1A 4TLFA 1MJBA 5EEGA 1XGSA 3V8KA 4L5IA 5BY5A 1O7LA 3ABUA 3RKXA 3K69A 3F8FA 1FWZA 4K2EA 4CYDA 3LA3A 3BP8A 1S3JA 2YX7A 2W85A 3F3XA 2UYAA 2F2EA 2H94A 3I5UA 2E9QA 1BBYA 5AIQA 4LB6B 1SFNA 2B9UA 4D7SA 1G4DA 3WU0A 1UW8A 4MQ9F 4KWJA 4XF1A 2XUBA 3QU3A 2PAMA 3E5XA 5FFXA 2DFIA 1NXMA 3ELNA 2WV0A 1MJ9A 4HW0A 3CLOA 1O4TA 4XFFA 1P4XA 1B1BA 1R58A 4OMYA 3RTRA 2Z33A 4PIYA 4BHBA 4FHTA 4I7HA 4I09A 5CJ9A 3LA7A 3TOAA 2LKPA 1MDMB 4YSFA 2W24A 4HF1A 1R00A 2FEZA 2FNAA 5JR7B 4U7DA 1PUEE 3M1EA 2L02A 3EBRA 3MFKA 2H09A 3LAPA 2E7XA 3ST7A 3NKTA 3HIFA 1F4KA 4XFAA 3WG9A 4EJWA 4MHGA 2UY8A 4RS8A 4YIIA 1EH8A 4IXAA 2OU2A 1LDDA 2CSOA 5CLSA 4BNCA 5CVIA 1WSUA 4LMYA 2E1CA 4HDVA 4O5VA 2FSWA 2QM3A 3HUGA 4LJZF 1ZARA 4HZFA 1DZRA 2M45A 4XFCA 1L0OC 1OYWA 5LBQA 2MBFA 5FGMA 2VBYA 3AAFA 2DLLA 1IPJA 4I01A 2HKOA 1H1IA 4JK1X 5HS9A 5D6EA 2ZBKA 3KSCA 4QLCU 4RAYA 4AIHA 1Z6RA 4NQWA 2DW4A 1BN5A 3CO6C 1B9NA 3BCWA 3H1MA 1CF7A 4R79A 4NHJA 2NYXA 2RVCA 3RKYA 2YX4A 3EO6A 2PLYA 3LSTA 2XKPA 1QNTA 4LGWA 1J2XA 1R7JA 2E1NA 5LHIA 3H1YA 4Q0PA 2FA5A 1I6XA 2HKXA 5DD4A 4EV0A 5TJJA 2KJCA 2WTEA 4N0BA 2DPUA 2FMLA 1UCRA 2DQRA 2QNKA 4U88A 3H8UA 2DK5A 2IA1A 1DPRA 2NNNA 1R1UA 4XF4A 2H6CA 2XAHA 1GXQA 2EV6A 1PP8F 2KKOA 5D4RA 2JZYA 3DP7A 4ZYDA 2D40A 2H27A 4M71A 2DBBA 4U7BA 4RD7A 2O8XA 1ZZCA 4A0ZA 3I64A 4X6RB 4RB2C 1FYLA 5FLHA 1FX7A 4ESBA 4HV6A 2Q4SA 5BS6A 3ZDSA 2VE8A 4KIGA 5KVRA 2QWWA 4HOBA 5DV5A 5D1IA 3WTWC 2D5FA 1W7PD 2V79A 3KLOA 5KHHA 4KICA 2HQNA 4GGGA 2VPVA 1LDKB 5LHHA 1QO0D 5DYMA 1YFUA 4OU0A 1CF7B 1UHWA 5KK1A 2EV5A 3JZVA 4BXUA 1ZHFA 3UKVA
chains in the Genus database with same CATH superfamily
2ME0A 1HSJA 3OS0A 1SBFA 1U5TA 1RUF3 3P6BA 3VZOA 2JJ6A 1VQPI 1IRGA 1DGWA 4IXLA 4FFHA 2JUCA 3PLQA 1S0GA 5L19A 4HMZA 3SDBA 3IIAA 3GBGA 2K40A 4Q4W2 4S2GA 3FMGA 1CWPA 3EQLF 2UY9A 4IE0A 4XKVA 3FKJA 3BZCA 2OVUA 4XMIA 3T1MA 1KU9A 3FXQA 4C2TA 2W48A 1G9DA 2F4OB 2RGVA 4FCAA 4Q0VA 2CG4A 1S2KA 2QQOA 2WNVA 1XSVA 3GZTB 5D5VB 3BPVA 3H8RA 5HDNA 1AYM3 5FMCA 1HW1A 3MF6A 3V7SA 1W6NB 2JB4A 3FM3A 1BI2A 2BWAA 5I8TA 4P08A 4R52A 3HOZJ 2YXSA 3GVAA 2X6WA 4DNYA 2QE3A 1UXZA 4B1RA 4YIFA 1RUF1 3LAGA 1VQLI 3C8XA 4KWKA 1MZFA 2HWC3 3RSNA 5F5AA 1R4NB 3MIEA 2HQAA 3F2ZA 4UW5A 5IK8A 1QJX2 1SFEA 4F3QA 4CYCA 2C6YA 2A6VA 2DTZA 4META 4BQ4A 5JPMB 3BALA 2OF7A 2R6QA 1ODMA 2X5IB 3HHHA 4A44A 1ZN2A 1QQIA 4UAPA 3FBIB 4L9JA 3NARA 5IHRA 1C5HA 4AIDA 4JGZB 1OCCH 1P4WA 4Y7NJ 3L2WA 5BNOC 5DQ0A 4C8DA 5LRSA 3ZN0A 4HANA 2YUEA 5L3FA 2FBHA 2CAVA 3ZQCA 3DYOA 3Q9VA 1CR7A 5L7OA 3CZJA 1RL3A 2HEOA 4WXDA 3WW3A 1WBLA 2R7XA 3VKOA 2VE9A 1DP3A 5H9QA 2ZHKA 3TBIA 4ANJA 4BXFA 3DU5A 1ZK8A 5C3OA 1CJPA 4FVVA 5E1ZB 4BLJA 3Q8AA 1BMV1 2XB6C 1BW6A 2HR3A 4UUSA 1UU4A 3MW4A 4JQRA 5AC92 1X3ZB 3A03A 2GNDA 1OCZH 2DUOA 3LFMA 1ZRCA 2WT1A 1WH7A 3UJQA 4CU9A 5M3FJ 3WG1A 2VBPA 4B7EA 3NWTA 4XRSA 3HM5A 4FPFA 2EIJH 4P5YA 3J7YJ 2LF7A 2EVXA 4Y22B 2D7FA 5FZEA 2RS11 1WKMA 1BM9A 5FZIA 5DG2A 5A2QK 1GUIA 4YVWC 1W6MB 4AHYA 2GWRA 1RKTA 2XF6A 3G2BA 1DQ0A 2W1QA 1R23A 5A3WA 4PLMA 2ZHNA 1YJWI 1UZVA 1SBDA 2V7FA 1FNYA 3PMEA 3BGAA 2VC9A 3VEPA 2L9VA 1KS4A 2BVBA 3VZKA 2VXZA 3QP5A 2K9LA 2VMEA 4GFBA 4JDNA 3OYAA 5LA1A 1LOBA 4L97A 2VT2A 3TN92 5BPXA 2HYGD 2WWSA 4SLIA 4XE9A 3WG2A 4QGMA 5FO5A 2RE9A 1LEBA 1CAUA 1WLDA 4COUA 3WDTA 1FPN2 2PAKA 5J7MA 1RUG3 1KDKA 3WY6A 1WHUA 1W8WA 3IWFA 4UYBA 3CCQI 2ZEWA 1ZGJA 5ABJC 3TEDA 1O8PA 3N4MA 2NN8A 4YLZA 4ASLA 1N47A 2H0VA 5JR2A 3I3MA 5DDGA 2Z2SB 2A73B 2P6HA 2JVGA 2V1UA 2QQNA 4KWUA 5GZFA 3FFZA 3AL0B 1A6QA 1YYVA 3A0BC 4F83A 4ITVA 1Q56A 5FYBA 3H0OA 4BE0A 5I91A 3VBFC 1R083 2A6YA 1PDNC 2Y75A 5FKMA 4GWJA 2C4XA 1B8IB 3VDCA 3BC8A 1XPWA 5CKQA 3V0BA 1XTAA 1KEXA 1QH7A 2QQKA 2GNBA 4A3DJ 4IQJA 3HTSB 3LSJA 3IAS2 2PN6A 1Q8VA 2IS1A 4YELA 1HJGA 2K9ZA 3CO2A 3SFIA 1YCIA 3V8JA 1NLSA 2OQ6A 4L9BA 4DEVA 4WM7A 3ZN1A 3CMAI 1GWLA 3IBMA 2JE8A 5EGOB 2UU8A 3W2WA 5I93A 1SCSA 4K9SA 4JGYC 1Z67A 2CGNA 5IATA 3BG6A 1V3FA 2L2OA 3L9FA 1CZTA 1LGBA 4UBGA 3KVBA 2DJIA 1WUVA 2F4LA 1J1LA 1KU7A 4DUWA 1WD3A 2XGDA 3QYEA 2WO1A 1UELB 2W1SA 2VPRA 2BBYA 4M3GA 2RDSA 1R081 2VGDA 4K8FA 1MVQA 3HSFA 2KDZA 1DQ2A 2OPKA 1VBD2 2P8TA 1D4VB 2D6KA 5DCFA 5E3OA 4LUKA 2VZVA 3CTAA 4Q26A 5DDJ2 2EAAA 3GUDA 5CYVA 4DRVA 1REEA 1BZWA 4HXCA 4C90A 3TP3A 4A3BJ 1F5TA 2HOTA 5FB2A 3SKJE 2HYXA 3OYCA 1VPHA 3CO7C 5HV0A 5EZGA 2NVUB 5CA6A 2OZUA 2F5FA 4M00A 1ND2B 4AHXA 1HKQA 4A7KA 5LA0A 3T0YA 3WGHA 4YIRX 4LBQD 4XC9A 5JVVA 3ZMTA 1RMU1 4YZ3A 1OOPB 4ATFA 1RJ8A 4Y5SA 1FPQA 3LEKA 1ASJ1 3J7AO 2MEV3 1KXGA 4M73A 2VOOA 4J00A 1BIBA 5LK5A 1LB2A 1W8ZA 2X10A 1ZG5A 3FHIB 4LG3A 3RIRA 1HXS2 2VE1A 2VASA 2QQVA 2PEXA 2ENRA 4AVSA 2GQQA 3ZXJA 4AIKA 1YQ8A 2DU9A 5DUKA 1KD7A 2EILH 1F4AA 3PNYA 2VZOA 1W2UA 4DBRA 3RYRA 2AQEA 2E19A 2X5IC 4XSZF 4P9IA 5M5WJ 5A6QA 3W2VA 4HK8A 3S1NJ 4AWDA 1RUD3 4FETA 1KQ8A 1U2WA 1US3A 5HS8A 1GP4A 2IBDA 3KS7A 3OYMA 1ZG1A 3A21A 2O0OA 4IGQA 5I0SA 2VBZA 1O8SA 5CPRB 3MLLA 4O61A 3OS1A 5AVPA 2O6GE 5E89A 1QJY3 3KV4A 4WVWA 4TTGA 1OFCX 3I2DA 4BK4A 3PVEA 2DCEA 4PJNA 2Z9OA 2VQHA 2BY0A 3WNMA 3NKGA 1DFQA 3W5MA 4BJ6C 2XAJA 4UUTA 2A6WA 4QPIA 4QB2A 4E7LA 1U8BA 2Q5TA 5A2QZ 4PUSA 4UXNA 1CAVB 1Z78A 4A7YA 1RUE3 2GU9A 2RC4A 4YW4A 2HWF2 3JTHA 5F32A 3GZ5A 3SH3A 1S0JA 4V2WA 2X85A 1D1BA 1W2TA 4A3JJ 2DXIA 4AIJA 5E79C 5K8SA 4YM2A 1RINA 2NMNA 4GULA 2RS52 4MXVA 4A3CJ 4IE5A 4ZS2A 3K2AA 3ZXEA 4EN6B 1ASJ2 1XU1A 2AHQA 3GYDA 2TUNA 1QJU2 2BY3A 4IL6C 1F5JA 4S2DA 1OH4A 3K46A 3J8F2 1JYVA 3BG3A 5I0UA 3MZYA 1XNTA 1AUYA 3VFZA 4IDZA 3W5NA 4BIOA 5F8PA 4ZS3A 4FPOB 4XF9A 5FPVA 5HBAA 4MTDA 4AGRA 4CPBD 2XWBB 1EUTA 2OUHA 3IAPA 3I2FA 2HQRA 3Q9SA 4JGZA 1EAH2 1VQ9I 4QX2A 4WVMA 3WTSC 1QU3A 2BQPA 3AL0C 3S16J 3ZM8A 4FFIA 4M3FA 1JKQC 4ZTFA 4XABA 4IV3B 3T0BA 1WMFA 5A32B 1G3YA 2BDRA 3POJA 3L2CA 1LTEA 1OA4A 1XSRA 4A41A 3FK6A 4QMAA 5FMOL 1BR2A 3BR5A 1RI7A 5GPAA 3A01A 3WU2C 5BYNA 3ZYFA 3F6VA 5BNNB 1WQ2A 4XIDA 3DCQA 3HGGA 2HWD3 3USUB 2IGMA 3K70D 3PO3J 1MBFA 3KF3A 1IN7A 1O91A 4RB0A 3MPPG 2CUFA 4A3ZA 1BI1A 4BBRJ 4OMDA 5DTDA 3N3HA 2A7AA 4OYUA 4QTRA 5FUNA 1V6JA 4KMQA 1B35B 1W6MA 1BC7C 2WS93 1HV1A 2WYSA 1HDPA 2M7BA 4EN9B 5CU1A 5LGNA 1JH5A 4XAEA 3V0AB 4QKDA 1RPWA 3CKHA 4BK5A 1FMD3 1V6MA 1XSDA 3I58A 4XEZA 2K4BA 1LJ9A 2NYYA 3ZFEB 1H4GA 2ELHA 1FOYA 5DUIA 2NXNB 5F1RA 2DMUA 5CG8A 4UVBA 1Z0HA 2VECA 1UPIA 2Q30A 3AK0A 2V9VA 3OY8B 2UXNA 3NNMA 3Q8BA 1PGW1 2FF4A 1JI8A 1GOHA 5E1XA 4FE7A 2L7FP 2CW0F 5LZ6A 5D4SA 2PAEA 4ZZ5A 5HXMA 1XD7A 2YGMA 4LBLA 1MEC2 3AP7A 1J83A 3ZCOA 1SEUA 3VBHC 2E51A 4L18B 1MJAA 2Q2EB 1ZBA1 3AMMA 3GF6A 4LE3A 3JUUA 3JRDA 2BXZA 2L7MP 1O7FA 4HX7A 3LCPA 3WUCA 1IW7F 3SJMA 1FMD1 1OQEA 1FBSA 3H1CA 4YFXF 1VBB2 4NIDA 1UZCA 1JU4A 3AP9A 4W8JA 5FR3A 1ZRIA 3O2PE 1K7AA 5C3RA 2WZPP 3NW4A 1AR62 2BEOA 3R60A 1RUNA 1F5FA 2R072 5ED4A 3CDZB 4AQ6A 1QA6A 3PQKA 3IH2A 5FYVA 1PIV2 1WCDJ 2MH2A 2RMU2 2FCVA 1NOVA 4YGCA 2VN2A 1H8AC 3VKMA 1LHWA 5FQ0B 3WP3A 4C0HA 3QQAA 2AYHA 5A7NA 4Y1VA 3NJYA 4E27A 1Y4WA 2JG9B 3RMXA 1EA3A 2VTXA 3GTJJ 3WP4A 2RQQA 1S0FA 4HPKB 3SEEA 1RRJA 3T8RA 3BTLA 1ETYA 1QNWA 1SVMA 3WHTA 2V4AA 3FMQA 1RUOA 4BA6A 3NQHA 4OMCA 4UFMA 5A3LA 1X1CA 1AR82 1IN8A 3DN7A 4HRIA 2X53S 4S04A 3W3CA 4Q4Y3 3OUHA 4IHSA 2L9NA 1AWCA 4FX4A 2PQSA 4ZU7A 1RUH1 1HSTA 3V7CA 2WFF2 1JTYA 3BQYA 5ANNA 5A6ZA 2P37A 5IT9K 1BI0A 1UPSA 3AG3H 1AHDP 2W52A 3C1DA 5K5RA 1HKDA 2VTXJ 1OCOH 3ZMZA 1XS9A 2RDNA 1C1LA 1DZQA 1W9YA 4M0HA 4R9AA 4DYCA 3OPZA 2ZXWH 4IOCF 2VCAA 2ZJ2A 4CHUA 4H4KC 3CMYA 4A6OA 4XLEA 2FUG2 3IDBB 1X1AA 1ZBA2 1O3RA 1ULCA 1RIOH 3SHFA 2W7NA 3F9KA 3RQ0A 2CH0A 2HVQA 3V8LA 1K83J 5FJ8J 2QQPA 1ZKGA 4PI2A 4D5CA 5LD2C 3HOYJ 1U5XA 5AIPA 2XONA 2YS9A 2JDPA 3J7LA 3T0DA 1MNEA 2AR6A 3FBNB 1X33A 3LDRA 4QWQA 4OQ8A 4OI4A 2WNEA 2I45A 2WO3A 4RGXA 5J1YA 1UOBA 2J42A 2LUWA 4K40A 1GXPA 3B3QE 1N78A 2XRNA 1CAWA 4NIGA 3CUQB 5CFCB 4Y20B 2LTNA 2JSPA 5JXIA 2VW2A 4LOCA 1SEFA 1WCQA 2VJIA 3BZKA 3MLKA 2Y8KA 3ZXGA 2DQLA 3ZR5A 2ZAHA 3N05A 2Q0AA 4MTEA 1I9RA 4GXOA 5FOBB 4PFOA 2VT3A 2OTLI 3JQWA 2P2KA 1WA4A 5BNGA 4BY7J 1N3QA 4Q4W3 1BA5A 4JKKA 2ZMEB 3C7HA 2E2JJ 2STTA 4FSJA 3T30A 1NCRA 1B6AA 4PQ9A 5DPNA 4BE3A 5FXVA 2L4MA 1IRFA 4LK0F 3R6SA 3O1VA 1LEAA 2G9FA 2R0FA 3CDHA 1WGPA 2ZHMA 1REPC 3DYPA 1UU5A 5T5JA 4MGYE 1I1SA 2BHYA 3RZKA 2JPBA 2ZEXA 5GLUA 4IV3C 1O4XA 1DYKA 3I3QA 1G3TA 2HWVA 3VD7A 3BTYA 4B8EA 2JX9A 2OUJA 3SFZA 3F23A 4E7ZA 2VD7A 2M4KA 4BWOA 4M9SA 5FLVA 2X4HA 1WCUA 2WWYA 5F2SA 4RQPB 5BNNC 1QJX3 2E60A 5D8AB 3TWIA 1FV3A 2NMOA 2ESNA 1ZBE2 3ZMDA 2V9PA 3S93A 2DUPA 4YGEA 3BLYA 4FBFA 3VB2A 1BR1A 2LALA 3FL7A 1LFUP 3GTQJ 4AYBA 2GDFA 3NJZA 2EALA 3KP3A 3PUAA 2LFBA 4GO1A 5LA2A 3AZXA 2LKSA 1SLCA 3BCBA 3JB4C 1UB9A 2NVXJ 4S0HB 4KG8A 2WY8Q 5CBLA 1R5GA 1PK6B 1EV7A 1IS5A 1QKQA 4EN7B 4HYEA 4A5NA 2B0LA 3ZFEC 2Q1ZB 3A1YA 4JP0A 2HDDA 3S3NA 5H9RA 2RV8A 4PZJA 1PZ7A 2VOXA 4QKFA 2CV2A 2VI6A 1PJRA 1SC7A 2HOSA 1FMVA 1JUPA 3WF4A 4XJZA 4HKLA 5AC93 1HLVA 3OYDA 2K4JA 2Y34A 2HZTA 3L2YA 2ZGOA 4M3BA 4Q29A 2A6EF 2QTWB 4GWMA 4CSWA 1ENQA 2MGQA 1LKXA 3COAC 2HWE2 3S7EA 2DDAA 2XVKA 2VKEA 3SHRA 3DKYA 2FOKA 4LTAA 5T54A 4A3FJ 3W6VA 4COWA 2IFWA 5IFTA 1JYNA 1PVC1 3OL4A 4BLIA 3OMYA 3I2JA 2BOLA 3NNFA 5IYBJ 4B29A 4RDUA 2AS5F 3S3OA 2XJRA 4IEJA 1OKOA 1N25A 3HKZA 2GC0A 4D6SA 5ICCA 3R4KA 4CP2A 3TN93 4QGLA 4IVNA 2LDUA 3ILNA 3OJBA 3AG1H 1QPMA 2VQLA 3AFKA 1NK2P 1RVF2 1JN2P 4ZPIA 2VU9A 4CCCA 3HOUJ 2CY6A 1FPN3 2BYVE 4QSHA 4XJUA 4F8AA 3J80K 4IV1A 4COYA 4KN4X 1TZLA 3RNSA 3PQJA 5CNAA 1UHMA 2X6XA 1S2BA 2Y0SN 2GXAA 1LQ1A 4AE2A 2JG9C 4XJ8A 1OF4A 1Q8QA 1GDTA 4CDUC 4GB31 5JOXA 2CQXA 1W6OB 1QWRA 3LPGA 1OYYA 3S15J 1VALA 1BC8C 5FKOA 4AYUA 1T0FA 3S8PA 1ZYRF 1LUJB 5GP9A 3OY8A 5GJ6A 3NRUA 2M9HA 4XLHA 1S0BA 3NNJA 2QKLB 2RS31 3BZ6A 5AFEA 4NRMA 1W9TA 2OZ6A 5FAXA 4LA3A 3WTXC 4QPOA 5F5IA 1OPMA 1A6CA 1X9PA 2W00A 5F5QA 2RR12 2CYYA 2PLV2 3G1MA 5E18F 2XB5A 2VQ0A 5GZDA 2Q2EA 3GFJA 1YC61 4F3JA 4AHZA 3BB6A 2P0WA 4ABZA 3D0SA 4XAAA 1G8WA 5A6YA 2Y9YA 2EIBA 4IHTA 3SXYA 5FKKA 3P3NA 3BDDA 3OV8A 3GFIA 3KGLA 2IA0A 2YGLA 4BU2A 4XW3A 3WP5A 1MMGA 2J1VA 2XUMA 1CVNA 4S2FA 1AKHB 4GQ7A 3A4CA 2ZZJA 2RM22 2VKDA 2BGCA 2CO5A 1VBD3 5FCCA 4LLLA 5BPIA 1YQ6A 3PTRB 4LITA 3AYAA 3H50A 3R0AA 1RHI3 4X8PA 1IUFA 3MUY1 4BZ4A 4Y13A 5DDJ3 1UMHA 4UNOA 2IGNA 4A3IJ 4NAOA 3WD5A 3DUIA 3FWEA 2NQYA 2DJNA 1Z7S2 1VBC2 1JHJA 2PI0A 3AG2H 4PSWA 4AOCA 1V6LA 3HYIA 4P9UA 1QGLA 1S0CA 3GFMA 2ZPXA 5T5LA 1NA1B 1DQ1A 2XSDC 1QNYA 2YMZA 5LY1A 4WM7C 2A6TA 1DU0A 3SLIA 1OCPA 1TG7A 2JDHA 2JSCA 1TEIA 4PJMA 1S8NA 1STZA 4LBJA 1J7KA 4QQPA 3SQOA 4DRRA 2FQPA 2EPFA 4ASMB 5A3NA 3MAJA 1O4YA 3TO9A 2ZGLA 3MQ0A 2KJBA 4L11A 2DT5A 3CMMA 2ZGPA 4LBOA 1WRJA 1VB2A 4WV8A 1V55H 3LSIA 1RHI1 2ZCWA 4EGYA 3LIHA 2VVDA 3PIOF 3VV1A 2NVQJ 1FC3A 4V2VA 3VDXA 3ZFFB 1OA3A 1N75A 1HXS3 1ON1A 3OEBA 4BHPA 4EE2A 1XU2A 5EJ3A 4C1XA 2R1DA 1FEXA 4QPGB 1R1A1 2IGKA 1WZ2A 5DZGA 4RQPC 3WUDA 1WJEA 2YG0A 1H0MA 1I6HJ 3ERMA 4XQ4A 2A5WA 1J9IA 3PJRA 1R4MB 2L9SA 3NRVA 4O7XA 5E88A 4NHXA 3FX3A 1KJLA 2ZZQA 1A3KA 3VGIA 4O3MA 2HWB2 1YQAA 1QMJA 2ZGRA 1JKRC 1U5IA 2R042 1G3WA 1LU1A 4LG0A 4AI9A 2W5FA 3O14A 2BJSA 3PIGA 1PK6C 3CUQA 2LG4A 3KFWX 1VE0A 2QEXI 4DXRA 4CZSA 4QB1A 1HQCA 1Z3XA 2Y9ZA 4GAZA 1LESA 5GAGJ 4A3LJ 3R61A 1L3JA 3OIPA 3KWVA 4B43A 2VZ3A 2DVFA 4KDPA 1KYWA 2XBO1 1IRXA 2O9LA 3OYIA 3HT2A 2VW1A 3LA2A 3DPRA 5JCTA 1MSEC 4YRVA 4OIRF 5EDNA 1SFUA 2HWF3 3H7JA 2BFUS 4QX8A 2JG8A 4QGNA 3GXOA 5F0FA 3VBSB 3IRQA 2VXJA 1W0OA 3E0JB 3LFIA 4EQVA 1J1TA 1Y43B 2GSYA 4OLLA 4QXHA 1QPIA 1GZWA 1UKGA 2JEMA 5CKNA 2RS53 2DTRA 1MBEA 1HOMA 2QZ3A 2Y33A 2GN7A 3MHZA 2ZGQA 2Z4FA 2HDWA 2ZTNA 5L3EA 1QJU3 3OGVA 1C8M2 1XGSA 4EZHA 4RMNA 2D98A 3J8F3 1FWZA 3ZMOA 4K2EA 2WIIB 2Z79A 1CPNA 2Y60A 5JXHA 2W85A 5J98B 5KXCA 5AIQA 3RS6A 1ETOA 1EKEA 2J22A 1UW8A 4MQ9F 4KWJA 4V2GA 3VBUB 2X1EA 4K6BA 1GBGA 1AR91 1X50A 3AMQA 3AC0A 1EAH3 3ELNA 3C7FA 4QPIC 1V5GA 4FFFA 3BODA 3POYA 4FFGA 1UYZA 1B1BA 5ACA1 3MFAA 3OWTA 4MHUA 4PIYA 3KHBA 3PFYA 1GT0C 3OY9A 4XILA 5IVCA 2CDPA 3BU0A 5FMBA 1K5MB 3L2RA 4LXLA 4CDQB 5B4NA 2IS4A 2RHPA 3K77A 1XNCA 2FNAA 3S30A 2L02A 3LOBA 5IK4A 1KZHA 3J7NA 4WM8B 3ST7A 4MXWB 2MG4A 3HIFA 4XFAA 5CAZA 2W91A 1MMAA 2AXTC 1LDDA 1WSUA 2E7AA 4HDVA 4O5VA 2QM3A 1ZARA 4HZFA 1WI3A 2M45A 2PN5A 1OYWA 3WF0A 3ZXKA 3I97A 3GTGJ 4BQNA 2EZHA 4XXPA 3AAFA 2PJRB 4DYQA 3ZKUA 5A3MA 2HKOA 2ZBJA 5CYYA 3O7OA 1M1EB 2BVMA 3K7AJ 2ZBKA 4E4HA 3KSCA 4QLCU 4AIHA 4XHXA 3AZWA 2KT0A 1BL0A 1Z6RA 3MZ8A 5GAHJ 1X19A 3ZQLA 2DW4A 1BN5A 3CO6C 3H1MA 2VJJA 4NHJA 3N9PA 4YGBA 3N7JA 4YZ4A 3CZ6A 2PLYA 1MEC3 1R7JA 4HFSA 2VUAA 5LHIA 2VJ5A 3T4VA 1W3VA 4QAWA 2HKXA 3CC2I 5DD4A 5TJJA 4A69C 2WTEA 1A8MA 2DQRA 1NA1C 3H8UA 5A7OA 2CL2A 1FIPA 4CP1A 4CDWB 1W6PB 1AR72 3BUCA 3VL8A 2PHXA 2XAHA 2JDAA 3KEYA 4H2AA 1VBB3 1YI7A 1UQXA 4C9YA 2KA3A 4HETA 4U7BA 4Z2AA 1ZZCA 4X6RB 2W1WA 2Q4SA 1Y6IA 3LKJA 4CEWB 1AR63 1W90A 3ZN4A 2R073 2ID3A 2NS8A 4KIGA 5KVRA 5M5XJ 4C1WA 5DV5A 1LEDA 3UYJA 1PIV3 2RMU3 4QPYA 2HYKA 2V79A 5KHHA 4NQWB 3CIHA 3MI8A 1YIPA 2Q8DA 3OSFA 1CF7B 1EUUA 1UHWA 4KBBA 1P9QC 2B9SA 1E2XA 1NLQA 4XJWA 4MFEA 3K48A 4HLXA 3EB7A 1SD7A 3KT4A 3P9KA 2KM2A 4PJ0C 1G59A 4QDQA 3D0JA 1P6RA 2KD7A 2GLOA 1AU7A 2MC3A 1BEV2 1I3AA 4R9DA 4G9SB 5D5WB 2WFF3 2E53A 2VUMJ 3L00A 1HIXA 5FP8A 3VHRA 1Z9CA 1NY71 1FYKA 2R92J 4XCAA 4RS5B 4D7NA 3LFKA 2L3DA 3CDIA 1HRV2 5TISC 1QF3A 3RZOJ 3JR9A 2GALA 4DBQA 3IUOA 2A70A 1KGSA 1H2NA 1OH3A 5L3CA 1AF9A 5D2AA 1AL21 2WZEA 2IGOA 4FOYA 2Z3YA 1OLRA 3U10A 2BXYA 2ZABA 1QDOA 5EZHA 2R5ZA 3ZFGC 3AYEA 4JX5A 1GV9A 1AL0G 1MMNA 1IPSA 5FY1A 5FO9B 2ZNYA 4C3JJ 5CVVA 3EPZA 1URXA 1KQ9A 5FYTA 5FYUA 2Q8KA 2V6CA 5B3SH 2EZLA 4CUCA 1FAYA 3B73A 5LGUA 1K61A 2BW8A 1JYXA 5CVJA 4LBNA 2A69F 3S3MA 2BNOA 3DGTA 3MPBA 3SMHA 4EM1A 3M8EA 5FKBA 2KR2A 2VQTA 3CP2A 3IT8A 4AEDB 1H9PA 2ZKLA 2R062 4BE2A 1NH3A 1W0PA 3VBUC 5LEJA 5IUQA 2BV6A 3P5BA 3U37A 3I59B 2WNUA 2XPVA 2DUQA 4XUNA 3ML6A 4HNVA 3NJVA 2GA1A 3AYDA 3BTCA 1K5JA 4WZCA 3OOPA 4HVRA 5L73A 1S6LA 3BKZA 1NY72 3OBZA 3VHOA 3BIEA 4A6EA 2AEZA 1JZ5A 3OBAA 1JOBA 3GJBA 2X48A 1FOD2 4EYUA 2VLAA 3L2UA 5EG0B 3AMHA 2VZPA 1SPPA 2P5KA 4Q4V2 4CDQC 2G0EA 2P1BA 5DM7F 3D8CA 2B39A 3U78A 4OIOF 1V0AA 3CLPA 3P9CA 1ZBE3 4R1HA 1POQA 4WM8C 2H8RA 1QZYA 1VQ7I 3O3KA 2I5UA 3CJRB 3QCWA 2P3IA 3MCZA 2DMQA 1ZLJA 4LB5A 5IOZA 2WAAA 1T33A 1GNHA 2D44A 1FIAA 1ITYA 4C3IJ 3K4JA 4BISA 2MD5A 4OUEA 1F43A 4RR3A 1NCRC 3CJIB 5E3NA 3ZSJA 3R05A 2O03A 4P55A 1COV1 1IXRC 5K7PA 1S1AA 4YFNF 3TW7A 1J59A 3RJRA 1CQ9A 2LP0A 5C3SA 3VPRA 4QIWN 3BOWA 1YIJI 1LULA 4L2NA 3BR6A 1DGRA 1XDUA 3PDQA 2WSVA 3BT9A 2CTVA 1G7YA 3CQOA 4NE9A 2EFNA 3TOJA 1Y8QB 3OPTA 3JRCA 2Z5WA 2RREA 2UWCA 3KEQA 3JBG2 4CUAA 3KT1A 1D0XA 4DOZA 2WAFA 2L7ZA 3USSA 4UHTA 5J36A 2HWE3 5KXBA 1C3HA 4UVAA 1TWCJ 2R5YB 1V54H 1ENXA 5A6XA 4I99C 4CDWC 1NT0A 4I0BA 3A22A 3HL2A 3LQCA 3K4DA 2XOMA 3DYMA 4CRQA 1NZIA 3FBMA 1RUC1 2DTYA 2L4AA 2VZQA 4BXSV 1W39A 4W6WA 2VNVA 2BTVC 1VLNA 2MH9A 4LLFA 3BROA 3FMRA 1YFYA 3CCVI 3ES1A 4YFZA 1RVF3 1OVSA 5T5OA 5IAXA 2B42B 5BV6A 1LODA 4B8XA 4AD9A 1RITA 4DYRA 1TZOA 1VBE2 4LE4A 1LNWA 1QRYA 3O8HA 2VBBA 2OKXA 3RVHA 3WW4A 2OTJI 4PBPA 3DPUA 4IEXA 1V9U3 3GZ6A 3H9JA 3N9OA 3OYHA 2YBKA 5JXJA 4LFUA 4RGSA 3TNQA 3HQUA 5F6LB 3VBOA 5EEAA 5H9SA 3D5SC 3KP4A 4A5MA 2WAEA 3H3LA 2QBYB 1ZVFA 4OFGA 4YG0A 3WDXA 2ARAA 2W92A 1COV2 2MYSA 5JMOA 1Y0UA 2ZHLA 3D1NI 1J3RA 5JZGB 4A0XA 3WTZA 1XMXA 1HKSA 3ECQA 3WNPA 1CPMA 4NPRA 2DV9A 3E5UA 3I56I 1XYNA 1RJ7A 4XUQA 3IPVA 4PFPA 2QUFA 2RR13 2PLV3 5DAXA 1WBFA 5FY8A 5FP4A 4MGIE 3NSTA 3ETQA 4FPYA 2EK5A 3O1UA 1V9U1 3QPTA 2QQMA 2FNPA 2HJIA 2JRTA 1NXD1 2ECCA 1W6PA 2BW3A 1R1ZA 1NE4A 3HJRA 4XUTA 2E1MB 5HOOA 1H1MA 3L2VA 3DEEA 3KEOA 5IVYA 2ETEA 2VQGA 1SFPA 2RM23 5FXZA 4IHYA 2EIKH 2MABA 1D5VA 5CKMA 3CJQB 3ZVXA 1H8TA 2PQQA 2GH8A 1T0FC 3CP8A 4P14A 1HQNA 1CZSA 3KX2A 1I27A 4BQQA 2IXLA 3WQ7A 1W1WE 3X2QH 3VYUB 4YZ5A 1ZQ3P 1U9NA 2H6BA 1IGNA 1Z7S3 4X8NA 1VBC3 5E6HA 1SLLA 3S2HJ 3KZZA 4NMIA 2COMA 5EYRA 4M9XA 3KLSA 1SCRA 2J5PA 3OF1A 2OZJA 3B69A 1FSEA 3BIWE 5ANQA 3SCFA 5AONA 3LD8A 3DWLE 3WF1A 3AZVA 3QH6A 4J6GA 4XF3A 1TLHB 3A02A 4A42A 1YWKA 4XNFA 2EXKA 3QOPA 4Y3OA 1SFXA 3EYPA 3PURA 1YHQI 1GLNA 2JJ7A 3WODF 1VQ8I 2PA7A 4N4NB 2MLGA 4RS5A 4LULA 1NLRA 4B09A 2OX0A 3JAMK 2VZSA 2FXAA 5CG9A 1IG0A 4OHVA 1W36D 2KIMA 2BOJA 5DAPA 3LIGA 1B72B 1WKYA 1MS9A 1OF3A 4GWNA 3WOGA 3B6CA 1L7LA 4EJUA 2CWSA 4OZOA 3WGGA 1U8RA 3G7DA 4XMAA 4DFSA 5FO8B 1HLCA 1PMJX 1PUFB 2V1NA 3DFGA 2BY1A 3NAPA 1FTTA 3C2UA 4DIQA 1VQ5I 2MA3A 1BBT2 2WZ8A 3ACLA 2JD9A 5FUPA 1JJ6C 2ZAAA 3DEMA 4YWAA 2D97A 3T2OA 1U9OA 4UOJA 2CDOA 1K3IA 4QB6A 2K9NA 4KIFA 2WY7Q 1R1TA 3EJKA 4IQ4A 2VCBA 5A3OA 2VC1A 1YXWA 1PO12 2VZTA 5IVBA 1ACCA 2VW0A 5FYZA 5FLJA 1DUXC 5J96B 3DBHB 2PTMA 2M0MA 1A36A 4L9VA 1RUJ2 5IT3A 2LY2A 5FPXA 2X05A 4GCVA 3VHPA 3H5AA 1UAIA 1DDLA 4J01A 1K12A 2DDUA 4YGDA 1W5TA 3U9GA 1MH4A 1YFXA 2Q8CA 5A80A 2G9ZA 1MR5A 2E32A 4TV7A 1JU3A 3SNMA 4KT6A 1EV12 1R9TJ 2GC3A 1AXZA 1GVJA 4WXCA 3WNOA 3IH4A 3AZZA 3CJTB 3L2HA 2ZKZA 4QHBA 2C5DA 2EFWA 3FISA 2L54A 2GZWA 3KLNA 2JDYA 2GIVA 2XLGA 1YQCA 4IEPA 1J58A 1BOAA 1NAEA 4XF0A 4QM8A 5ILSA 1D1CA 2QQLA 2Q0OA 2XHNA 5C8CA 1H2MA 5JLWA 1ACIA 3WCRA 1PO22 2PELA 2PMWB 5FPLA 5FY0A 1ETXA 2MHFA 1D3YA 2IT0A 1OLQA 3ZIXA 2EF6A 3PNVA 5F64A 2V1XA 3WDUA 4H55A 2A75A 2BFUL 1ULGA 1USSA 5DD8A 4FCYA 4LHNA 1GKBA 3FZVA 1BKZA 1ZZ6A 4EEFG 2PQ8A 4C2MJ 5L3BA 3ABKH 1T2XA 2XAUA 5C71A 4JTOA 4FX0A 1AYN1 4RHV2 3HHGA 4KITB 2ERFA 3DPRC 1ETKA 5GADJ 4A3KJ 4MIMA 1FNZA 3S5AA 4LLOA 3MBWA 4DS0A 4AAPA 2NPIA 5EXOA 2WC2A 5IPAA 1VR3A 2K9MA 2RVAA 5K0UA 3EETA 3MN2A 4YEJA 4KA4A 5K5OA 3DTEA 1LOGA 5GZCA 3CF6E 5B1AH 3NNLA 2FD5A 4E7HA 2ADEA 5FZFA 2ZGSA 4KNYA 1OCTC 1ZX5A 1W6QB 2ZB9A 4UFKA 4YW2A 4M9ZA 1H1AA 4UV9A 5C44J 2VCMA 1D0GA 1IGOA 3ILRA 4UY8I 2B63J 4B44A 4BEHB 4G9YA 1QQP1 5C3EJ 4D5FA 2VXRA 2R5YA 1GICA 3ECOA 2EA4A 2M1BA 4Q4X2 5HS7A 1VIWB 2XWJB 3GLLA 2JWPA 1JZ3A 4OUMA 5DAWA 1VRH1 3ZSMA 3NAUA 1NCQB 2E1MC 2VIXA 4BOWA 5IK7A 3AYCA 4XFBA 2HXOA 4R4ZA 1H89C 3Q5FA 2QCSB 1FJLA 4Q8KA 2COBA 3K2ZA 1VFCA 4ISQA 3Q3SA 3CCLI 4J1XA 1CZVA 1RIRA 2YC0A 5FLXK 1X36A 3FKIJ 4EN0A 5A1FA 4E7KA 4LIUA 3WDVA 1PM4A 4XTMA 1XSXA 3OCPA 3JRGA 2WKKA 3VSKA 1JGGA 5KXEA 1J75A 3I2KA 2FDHA 3ZMNA 3JW4A 2ZX0A 2AO9A 3G4SI 4XFIA 1S7OA 3I3LA 2IUWA 3AG4H 5A3UA 2GIZA 1Q1HA 3WTTC 4NVPA 2E33A 1G3SA 4Q5SF 4UB6C 1GNZA 1TQIA 2VBXA 1ZELA 4BQ2A 3BG5A 3D5LA 4B4RA 4QDRA 1N3OA 5JIAA 4FP2A 3CF2A 5BNPA 4EWEA 1AR73 4M3EA 2GAUA 5FY5A 4Q1PA 4OAYA 3RI9A 2K02A 3SCGA 1I3HA 3L7WA 3TKYA 2JPCA 2VODA 3KCCA 4XQDA 2WT0A 3DBLB 1YUDA 3O1MA 2W3JA 2FBIA 1B59A 4GZ9A 3VBRA 4CA0A 4CDGA 3JSPA 4ENNA 1D8JA 3BU7A 1R49A 4HSLA 3MIDA 5K4LA 4AI2A 2F5CA 1JHFA 1DYPA 4D7TA 1YRNB 4XBLA 5C4WA 1GP5A 4QKBA 4ZDOA 3FF5A 2R7TA 3MZHA 1XMKA 4NDLA 3HPHA 1D2SA 1FBUA 4CUBA 3DBRB 5LFAA 1H2KA 1W8TA 5L36A 1NE6A 1DQUA 3M07A 3IL2A 4FE4A 1EP0A 2EA2A 4M74A 4I2OA 4PDWA 4IOAF 1U6GA 4BDVB 4EJTA 1V6IA 1K79A 5DCMA 4WX9A 5FPAA 5ICFA 6PAXA 5FZOB 4RGUA 5A33B 3CBNA 3MLJA 4IKFA 1J3PA 4LKSA 1BEV3 4OI2A 1K42A 5HVQC 5EPAA 2HTJA 1OVPA 4U0VA 1NHAA 4MG2A 3B01A 4U0YA 4LOTA 5LA9A 3HQRA 1Y0NA 4AYBN 2P34A 4FQ4A 4M01A 4PIZA 1JUHA 1AJKA 1HRI1 2FDGA 3PVOA 4YVWB 4Y5Z0 1YI2I 2ID4A 3GGLA 1OCRH 1DQ5A 4A45A 4E8CA 1PVEA 4F91B 2NVTJ 3SITA 3VZJA 3K1NA 1H9WA 2JIGA 3OGJA 4ARYA 1R093 4RA2A 4IQPA 4TYSA 4CCOA 3PL0A 2QCOA 3AKQA 2H1LA 5LGTA 1DLCA 1XNDA 5A7WB 2W87A 2XVGA 4E2SA 5HV4A 4YPJA 3RGBA 3CHXA 1BQPA 4KL1A 1IAWA 2IXIA 5LATA 3VYRB 5LBFA 2LLKA 4CDXA 3VDDC 3BTXA 1EH6A 2K3PA 1BVVA 2WADA 4B4PA 5ABJB 5F7UA 1TQ5A 4QPWA 1D4M3 1YHFA 3IKVA 1X4OA 5IP9J 1LE8A 3ZXSA 3HC7A 1B09A 2O8OA 4Q27A 1JTZX 4PDKA 4R8HA 1AZDA 1PGL2 3MFCA 4MFDA 2HEVF 3ILFA 5FZ7A 3C7JA 4ZYHA 3U1KA 1R091 5LASA 1WJCA 1IN5A 3RRDA 1VQKI 3A2KA 1VQ6I 3NV2A 3CCSI 2FU4A 5CIRA 3LSKA 2PMHA 5KWRA 2G19A 1JTXA 2EZKA 3LF7A 2R063 1OA2A 2LRDA 3L1PA 3W6KB 1SMTA 4Y4YA 3SC7X 1FLIA 3GTOJ 2K9SA 2C9AA 3MEXA 1JE8A 1X7NA 2QUOA 2XV4S 4AFBA 2RKHA 5FROA 1K6OA 4A6SA 1H30A 1Y9QA 1VBA2 5ICGA 2MNGA 2QQBA 2UWBA 1XGOA 3K4CA 4XN0A 2W4SA 1T56A 2A5YB 4MHRA 2XG3A 3ATGA 5F08A 5EQUA 1LOCA 1ZR2A 4ZJZA 1HB1A 1MBJA 1UU6A 4PLNA 2WR9A 4ET7A 1G9CA 1R64A 4BQ3A 2F6BA 1X4PA 1HRI2 1YJNI 2CAUA 5EV7A 1FOD3 1T6SA 3J81K 2P7CB 1UX7A 3N9NA 3KV9A 1W7PA 4Q4V3 3GFLA 4P9XA 2XGXA 2YYOA 3NWSA 4J19A 1TME1 1UOGA 3JD73 3JRIA 3VOEA 3N9QA 1OQ1A 2QVSB 3A23A 2FMYA 2Z69A 5F3IA 4IF4A 5CQEA 2DVAA 2EFQA 3WSOA 5K9YA 3WHBA 2F17A 4CE8A 1RUI2 4NHYA 4CU6A 4CPBA 1VQMI 4HDUA 2ADDA 3H3UA 2QENA 2HBUA 1NCQC 3LMMA 4Z07A 3WNXA 4FOVA 2PHUA 2V9KA 4QXBA 4XLNF 4GYIA 2WFPA 4TN7A 5ERLA 2WZR1 2A3YA 3I4PA 2LBFA 2DYRH 3HNBM 3FXLA 3BN6A 3JD71 3FC0A 1W8OA 3BTAA 3FJSA 3GJAA 2ZX1A 3KYLA 1P2FA 4L8QA 5BQTA 3S2WA 2KIFA 4UI9L 2RQPA 2XIGA 1W03A 1Q8PA 3D5RC 3ZQGA 1PM7A 2EXJA 3OBRA 4Q0QA 3NEUA 5DN2A 5J09A 1YJ9I 2VBWA 2YFUA 1TMF1 2C0ZA 5IP6A 1Z21A 3ZYHA 1LVKA 3G6EI 2GC2A 3GBFA 2XL7A 4LO6B 1K78B 1UHSA 1X1DA 4F93B 2QA4I 4M3CB 3ZP5A 1OC1A 1JODA 1KDMA 4IEUA 2QQJA 5IK5A 2EH3A 3K3OA 2F6CA 4RR3C 1KGYA 2VR4A 4JRLA 5DMYA 1ZAOA 4XRFA 3ZYRA 4LQRA 2X0LA 1MD0A 4PI0A 2RAEA 2HTSA 4W50A 3BR0A 1TWGJ 3BTIA 1AYM1 1WH5A 3ZYJB 1GOFA 4A3EJ 1TME2 5F6KA 1VBE3 2OA4A 4HX8A 3OSGA 2ZXQA 3ROUA 3EMRA 3ZSKA 4LOSA 1OPCA 2TBVA 4CP9B 5FRMA 2E35A 3MIFA 1PNGA 2BERA 2K27A 3TEZA 4N53B 5IOYA 2ZFWA 5HDGA 2LY9A 2VKHA 2DCTA 3ULQB 3M8LA 3CCMI 2HWC1 2IXKA 5HLHA 4E7JA 2XXZA 1M06G 1E3PA 3K1PA 4ENKA 2V5YA 4PGHA 1GWMA 2BP6A 2VVFA 2H8WA 1LEMA 2BBAA 1W05A 1WJ5A 2HVSA 1ND3C 3T0AA 4I6ZA 3RFRA 3MKLA 2BZDA 2J1TA 3LB9A 5J3UA 4PK4A 3P1IA 2M2EA 1LU2A 3X29B 1POV3 1HKTA 3MW2A 1G2HA 1JS9A 2DBIA 1XGMA 2R4GA 4M3CF 3TEXA 2VQAA 5EYXA 3OB8A 2RJ2A 4ENMA 2HQ5A 4AU7A 5LBEA 1GYKA 3CESA 4RBOA 1ODDA 2JB8A 4AGVA 2R3SA 2W47A 2DA6A 3MKZA 1HDKA 1I5PA 3QP6A 4K20A 1ST8A 3ELKA 5J8CA 4MEXF 2XC7A 1RXFA 3RPUD 3T3YA 5EYYA 1A8DA 1RUF2 2K86A 5GLVA 2R0HA 1W2NA 2VJXA 4RLFA 3B02A 1GVDA 4HONA 4LR4A 4BDYA 2A3WA 2ZEZA 2ZX4A 1IRZA 4XHBA 5BNOA 1GOGA 3REOA 1ENHA 4LJHA 3KETA 4B4CA 1CX4A 3ZLIA 3I3DA 4KH9A 2EB7A 5C9AA 4A7ZA 2EQRA 3JRHA 4R4XA 5T55A 4CZCA 4BHCA 1XMAA 1NK3P 1ZZ8A 3CMGA 1LAJA 2NOGA 5F6FA 4LO4B 3TBDA 4IEYA 2UURA 5DXDA 4LO8A 2LF8A 5FBJA 1IV6A 1GP6A 3HT1A 3I4NJ 3KYDB 2R7VA 2FQ4A 3TYJA 1RUG1 3EUHC 4P9WA 1RB8G 1VTNC 1BMV2 4A3MJ 1LRHA 2X1DA 2CGOA 4P02B 2XRLA 3UK9A 3J81Z 1FOXA 2XJQA 2Z1DA 3AP5A 2GNTA 3EXUA 5JAXA 3WU1B 3KQ4B 4B3XA 3UV9A 3FXMA 3PNTA 4L92A 4NRQA 4KJZA 3G73A 2RS12 4YG3A 3PFIA 1PX3A 1W9SA 5J37A 4B47A 2DCJA 1WPKA 3VD5A 4UF0A 1JXNA 1DPUA 5CQGA 1IXSB 3W2AA 5A3PA 4AI8A 4OIPF 1KJRA 4JKLA 5M0TA 4L5IA 1LHOA 3K69A 3F8FA 5A7WA 1JZ4A 1TWFJ 2K85A 2WAQA 3W21A 2YX7A 3I8TA 1BBT3 3F3XA 3I5UA 1D0HA 1VB4A 1JKPC 2O8KA 5HPOA 2B9UA 5LCWL 4D7SA 2VMDA 3WU0A 1N1TA 3LSPA 2XUBA 3QU3A 2ZGUA 5GZEA 3GBWA 1LHUA 4DJAA 1Q8OA 3IV5A 2DFIA 3FHQA 3VBHB 3O1RA 1NXMA 4HSRA 3INAA 2WV0A 2QQUA 1MJ9A 4HW0A 1Z3YA 2R7RA 2RJKA 2R7UA 1O4TA 3AX4A 2W2IA 5FRNA 5FPBA 1PO13 3VBFA 1XYOA 4ITCA 1GUUA 3JRFA 4OMYA 3ZRGA 4CCJA 3VL9A 4I7HA 1RUJ3 3LA7A 1WZXA 3TOAA 2JENA 2LKPA 1MDMB 1ULDA 2UWAA 4B4QA 4YSFA 5GLZA 3SEQA 1OURA 3WQ1A 5LWBA 4U7DA 1PUEE 3M1EA 1QDCA 1IKQA 5KCMA 4XUPA 3ZQIA 2FHRA 4CEYB 1Y8RB 4D7MA 2Y6GA 1F4KA 1EV13 1BR4A 1IQAA 4C3HJ 1MQTB 1FYUA 4N43C 4JGYA 2OU2A 2CSOA 5DG1A 4JCKA 1IZ3A 5CVIA 4M3DA 2E1CA 3RI8A 3O1PA 2FSWA 1LOFC 3OSDA 3OYBA 3NMBA 1WJAA 4Y1YA 1MBKA 1PO23 2EIGA 1HB4A 2LMDA 2VBYA 1KFXL 4GH4B 1IPJA 3S1MJ 4K7JA 1QOSA 3U1XA 1H1IA 5D6EA 4RAYA 1BXHA 5IWFA 1R082 1IS4A 4LK7A 5APAA 4D8MA 2MEV1 5KNLA 2NYXA 3ZOBA 4NBQA 4E9KA 2IXSA 4N7UA 1LECA 2RVCA 3RKYA 4YVSB 3EO6A 3WVJA 2VZ1A 2E5ZA 2DWRA 2E6VA 4N53C 1U0AA 1NG7A 3ZIWA 4RHV3 2FA5A 2EIDA 1I6XA 1H4HA 5GAEJ 2DPUA 1UCRA 3CZUA 4F52A 3HGYA 4XF4A 1CIWA 2W39A 3KVAA 5JLVA 3U07A 4LIVA 3PTYA 1UG0A 3MKWB 1PP8F 3HUGB 3DP7A 2JECA 4M71A 4FPEA 2IWGB 2W9XA 4A0ZA 3I64A 1I1EA 1RUD1 3Q0VA 2XH6A 4RB2C 1FX7A 4ESBA 4HV6A 5FZBA 5HXVA 3PIPF 2JDUA 1W6NA 3AXDA 4XURA 1RMU2 1W7PD 2WJSA 2XPWA 3KLOA 5K7FA 2A05A 4LO7A 2WA0A 5LHHA 1QJY1 4Q4X3 1JI6A 1XG1A 3PUQA 5KK1A 2EV5A 1ZHFA 4KQ7A 1HN0A 3S57A 3P7NA 3OYWB 2Z42A 3KF5A 1T08B 4XM3A 2QQAA 1LJ7A 4S2HA 5LHGA 5J6XA 4AGGA 2CUJA 4A3GJ 1W5CC 5KR7A 4MH0E 2X5IA 5KHIA 3M3EA 2XAFA 2BNMA 1S0DA 2P5BA 2KISA 3IN9A 1UN1A 1TT5B 4URTA 2NVYJ 4DZPA 1RUE1 2Y6FA 3H9AA 1V4RA 3BG9A 4Z92B 4CXYA 2B4KA 5CISA 1XDSA 1LDJA 1DF0A 3F21A 2KRCA 1HB2A 1TNSA 3JQXA 5K0UC 4LKDA 2R7OA 4P9JA 5JVTA 1QVTA 1ZNPA 4M6XA 2E7WA 2ES3A 1Z91A 1N1SA 3MD2A 3ZXLA 2YC2A 2XAQA 2DA1A 2M34A 2MEV2 4I3GA 3RZGA 3C2HA 4UWDA 3M1HA 5CVRA 1MBHA 1GFF2 3T5XA 1WWXA 4NUBA 2BV4A 3ASNH 4XACA 4PIXA 1UCXA 4CCEA 2PFWA 3J7HA 2YBPA 4AC0A 1O3QA 3GYHX 4GWIA 1DQ6A 4JX4A 4EWDA 2C26A 3JXSA 4Q2FA 3OYEA 5EZWA 1WFXA 1U5TB 3RWKX 2GNMA 5FP9A 1H88C 4Y22A 1ZR4A 4E4DX 4B1LA 2OQGA 4CH7A 4GXLA 2VOWA 1UZWA 5G04L 3HOWJ 1WCSA 3N9LA 3AL5A 1SAUA 1HW2A 5IVEA 3LEMA 4NIAA 1QXRA 2OT7A 4HK9A 4Z2YA 5L9BA 3G71I 5IP7J 1CJDA 2FCUA 1JYWA 1OHFA 2G7UA 1GLHA 1VMHA 4AVBA 3O12A 1HF0A 4G7ZF 4PJJA 5FBZA 2WBMA 2VMFA 5C5TA 4HL0A 1BK1A 1OISA 5LY2A 1JMUB 1SVLA 2BPA2 2DI3A 1BHGA 2ZSHB 2Q1MA 2HWD1 4GMP3 2Y31A 3S6PA 5CFDC 1QXPA 5E8AA 2FDJA 1HA8A 3KT7A 1SMYF 3GZAA 2GM4A 4AEJA 3TNPB 1MIJA 3FBYA 1FZPB 3U2RA 3LE0A 3HAGA 2ZACA 4CYCB 4XKWA 5I8SA 3C3WA 2WS91 3H92A 3POEA 4HVOA 4K1YA 2HZDA 4CXXA 3VZLA 2JXAA 3ZN6B 1F8VA 4FOWA 2EXIA 2JDNA 3ZPYA 1DIWA 1S5LC 2O3FA 1S7EA 1B8IA 2HVRA 1CIYA 3M9AA 5C8WA 1AX0A 3I9V2 2K9QA 1DGRN 2EBIA 4V19K 1YO8A 3EYIA 5L7OB 4L9TA 2P4EA 4YW7A 4OI0A 5FY7A 3HNYM 3RZJA 4CEYC 1KYZA 5M3MJ 3WF3A 5EGOA 2GA2A 1NG0A 3I54A 2Y38A 2VB6A 4XQFA 3BJAA 9ANTA 1MQTC 5A7QA 2DFEA 1VP6A 1J84A 2WAOA 4HT1T 2R7QA 4UUSB 1YJKA 5FKLA 4XLCA 4KNCA 1E5SA 1JOJA 2V1DA 4CDUB 3SH4A 4M6YA 4B3NA 2O7OA 3TW6A 3S2DJ 4L0ZB 2HU9A 3LWCA 3UKNA 2R7FA 2QDRA 5J1UA 4IE4A 2ILMA 5FZKA 2BHZA 1W28A 4PHZA 1YTYA 4CCDA 3SQNA 2CU7A 4GH4C 3E3VA 1XPXA 2D6NA 1F9NA 3O0VA 4LORA 3WCSA 3DXJF 1YS6A 2WQ8A 2XASA 1DU6A 3SISA 3TAYA 5EFUA 2JT1A 4YM3A 3P3PA 4IETA 1W0NA 3E6CC 2BRTA 1X8EA 1EJ9A 2DFBA 4D1QA 2AENA 3AP4A 3HXLA 1D7PM 5IY5H 4YVSC 1PGW2 1Q8SA 4Y5TA 4DUVA 4XZPA 5LB6A 1CAUB 3N7LA 5IYCJ 3ORJA 1J3QA 4ATEA 4Y33A 4BQ1A 1ND2A 2WRAA 3U75A 2VMCA 3IZOA 2C24A 3KPHA 3CCEI 4QKNA 1GV5A 4L9NA 2QQWA 1XXNA 4QPQA 2P3KA 3SYTA 3DEWA 4GIQA 4I0WB 2VL8A 4UW3A 3LSEA 1OOPA 1FMD2 5CB7A 1UMIA 1FOKA 2PYTA 4Q4Y1 2TEPA 4MYEA 2XGEA 1X8MA 2XJSA 4OQ9A 4BAYA 2JMWA 4HQEA 1ULOA 4MUVA 3JTGA 1WW6A 3VD4A 4KU8A 3ENRA 2J1SA 3WTVC 1SFKA 4F55A 1VF9A 2FDFA 3CL1A 3UNPA 1JBCA 1RUI3 1YIOA 2STWA 3V0BB 3POSA 3L2QA 3CJNA 1G6NA 2IS6A 2MPFA 4J1WA 5JXGA 1W06A 1H8VA 1TNFA 2M7AA 5EEHA 4ZZLA 4NPMA 1ENSA 3LOIA 4Y1XA 1NUKA 4WM7B 5FWJA 3KZYA 3B00A 3ZYBA 1UX6A 2DOAA 2KZVA 1IHMA 1UL9A 4GYGA 5KC6A 2XSJC 4CICA 3THDA 3MW3A 1REFA 3FXJA 3FZ3A 4XOPA 1FV2A 1GSLA 1WJDA 1R5ID 4U2AA 1RYYA 3V65A 4XSXF 2N8GA 2O1QA 4KMFA 1O57A 2QDNA 1ALYA 1XJAA 3ZSEA 1RUH2 1JZ7A 5LBBA 3ALQA 2F4PA 3ZR8X 1TQPA 2A6HF 5FJKA 1F35A 4HN0A 3Q0UA 5C3QA 1T2KA 1KQRA 3RZLA 5F3CA 4XL9A 4RFT0 2D6OX 2J1UA 5J4YA 3O1TA 2CQ7A 5ISLA 2Y48A 4XKBA 3RYPA 1FP2A 1UMQA 2YROA 3KM5A 2GOMA 5AFBA 3BR3A 1Y1WJ 1CAVA 4Q4W1 1U5TC 5ERIA 4PBOA 3TO7A 3B6AA 1IDZA 2YHJA 4TLGA 2Q8EA 4KT5C 2KHMA 1O3SA 1IO2A 4MV2A 4Y26A 4N7IA 3HJEA 1NZCA 4ZYGA 3SXWA 3K3NA 4JRAA 1S29A 4HBNA 4Y24A 2OJED 4RGRA 5GPCA 3MICA 4GRIA 3BI3A 1WW4A 3AJZA 3H8XA 5K7ZA 2WNVC 5HCBA 4AW7A 4RN5A 4IW3A 4Q1RA 1R36A 3KP2A 2DVBA 2EV0A 5H6RA 4Y15A 5IAVA 3T1LA 4ZYAA 1REDA 4D3WA 3NVCA 4ISRA 3K70C 1QJX1 2BOIA 2FZ1A 4V1PA 3WDWA 2CQKA 2KRFA 4IEVA 3ABTA 4HX4A 4F92B 1WMEA 2ZOEB 3H7YA 3IAQA 3WEZA 1FBQA 4NJ4A 4ZY9A 4B48A 3FFQA 4XK4A 4L5JA 1IG7A 4Z2WA 3RJ2X 1USTA 1K4SA 4IV3A 2MD0A 2JTVA 1C4RA 5A32A 2ZGMA 3T2PA 4FT8A 2LS6A 2VUCA 3FXKA 4WVZA 2XF5A 2JA7J 1DBNA 4AFDA 3D82A 3BJ6A 4BCUA 2X6OA 4EATA 2JE9A 3KV6A 1F9KA 3R0JA 2E2IJ 5BNNA 1D5YA 4ES8A 3VDAA 2L9RA 1ZRFA 3GEZA 3MVPA 3WHUA 3WINE 4P9LA 3USUA 3BJOA 4PCQA 4MGKE 5L7OC 4BJTA 2F4MB 4D9JA 4Z82A 4FAHA 3OYJA 3JCUC 1O5UA 5AC91 2PHFA 4XPVA 4AEKA 1JHHA 4I3PA 1YLFA 1NG6A 2CWMA 1B35A 2ORZA 1LOEA 3I2IA 2OCCH 1NQDA 4HSTA 2G9GA 3J9SA 2K3FA 3ECHA 3V0AA 4AHWA 1IS3A 2RDQA 5A7SA 4QPIB 4FPHA 3PNAA 5JOWA 3OGSA 4TWTA 3AKZA 1HDDC 3ZFEA 1ZREA 2F5EA 3AKTA 1VAVA 1OPOA 4XJ9A 3GX4X 5FJHA 2EFPA 2H0BA 5IT9Z 1H0BA 3FN9A 2WT2A 4BE1A 5FZ6A 3TN91 2A07F 3ITQA 2W82A 4UVCA 4Q4ZF 1UOFA 1QIQA 1BJZA 2ZXJA 5J3LA 4LK6A 3PSFA 1UIJA 1UF2C 2ISYA 3HWJA 2WQZC 1FPN1 4N9HA 3H3ZA 1STMA 1POGA 4IRHA 2ZJQF 2VC0A 4GJYA 2HPMA 4CP0A 3GTKJ 2O14A 4IEQA 4N9IA 2NNYA 5JOZA 4FTHA 2IZWA 1T95A 2CV0A 4IE7A 2E2HJ 5H6QA 2A61A 4EWAA 3ZN6A 5LLQA 4R9CA 2RS13 3TB0A 1NTCA 1F2NA 2N7GA 1QHDA 1Z6TA 2L01A 3PVNA 4JQFA 2IP2A 2XROA 1SLBA 1M4WA 2M30A 4WVMB 3OR2C 3U14A 2HFHA 1PVC2 2WLPA 1OR7A 1IG3A 3N97A 2XPJA 4HKWA 4O6JA 5C9AC 4CA9A 3HN3A 1LENA 4P9FA 1AJOA 4K8RB 2AACA 5FZ8A 4NC8A 3ERED 4I0AA 5FQ0A 1KFUL 3DXTA 3K9TA 4A93J 3A01B 4ESFA 2JG9A 2R32A 2VG9A 4BGDA 1LHVA 2ZXIA 2D5HA 1XE8A 4JOMA 4HPKA 4CDUA 2YB7A 4IE6A 5FIXA 2ZJPF 2BZTA 4YW3A 3UGFA 1YX5A 4ZU4A 4XLPF 1Z77A 2D45A 3CU7A 1W5SA 4G6DA 4AAXA 4AI3A 1D2QA 4CU8A 4G6QA 5FZ1A 3GF2A 2AC1A 3VZNA 5FD6A 4ZH4F 3LPFA 4GB32 4D69A 1Z0XA 4M6VA 5BPDA 3D5OA 4X0GA 3RDIA 1EY2A 3AZYA 3CEWA 3H1WA 4BB3A 3HEFA 2P17A 5FYSA 4D0PA 2M3AA 4AI1A 3AFGA 4ZYEA 1VBD1 4ASKA 4RM2A 4DY5A 4ON0A 2A6XA 1T6BX 2RS32 4OWRB 3WV6A 3HMYA 4V2FA 3M3YJ 1R1VA 2D3RA 2E1OA 1G9FA 3RQIA 3I2HA 5DDJ1 1O4ZA 3MWMA 4NOTA 4HV5A 4MQVA 3G1LA 2R93J 1LNSA 1DGWY 4XUOA 4EM2A 1XNAA 1FYMA 3B7MA 4AQ2A 1Z7UA 2LROA 1WA6X 3OS2A 1TNTA 3MKYB 4XDPA 4GKYA 3WX5A 2Q8OA 3WLUA 4URAA 2KL4A 1ONAA 2HI3A 2VTFA 2NS7A 3HG9A 3S1RJ 1UZ0A 1Y9GA 4E6KG 4YG2F 3PO2J 1QXJA 4II3A 1JT0A 1VQ4I 2CQQA 4XKCA 1U0JA 1H9GA 4WVVA 4HF2A 2M8GX 5A7PA 3HOVJ 1E5IA 2CSGA 3HBLA 3GTLJ 1ETVA 2E71A 5CFCA 4Y20A 3GZEA 2DPDA 2NRAC 2EINH 3S17J 2ICWG 3HSRA 1ZM1A 4EJOA 2BE5F 1IC8A 1OD5A 1DP7P 3SCHA 1HXS1 1GQHA 1VAMA 2Y30A 1JZ2A 1HJFA 3D3AA 4JZRA 2IVJA 1U12A 1APLC 1WW7A 4ZZDA 3DF8A 4I98B 4BL0B 2ZMEA 2G9WA 4B3AA 1SFOJ 1GWKA 1UY1A 5D5UB 3ZFGB 2W57A 2HS5A 4BJ5C 1Q5OA 1IN4A 1TW3A 3LZZA 2DT6A 5TRDA 5HLIA 1RMU3 4XBFA 3HEIA 2JN6A 5T50A 3I0TA 5EF6A 2ET1A 3WQBA </