1O3RA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
total genus 64
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3rA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3rA01
4HOBA 2KIMA 2KXLA 3ES4A 4YRDA 5D5XB 1D3YA 1R36A 4BNCA 5DV5A 3DKWA 3MCZA 1PMIA 3WTZA 3M8EA 3DV8A 1PM7A 4YSFA 1RNLA 2VOPA 2HKOA 3UKTA 2BNOA 3W6KB 1QNTA 2EAAA 2Z33A 4KWKA 3H1WA 1REPC 5CVUA 2VECA 2HTJA 3TDUC 4KNYA 4L5IA 2P7CB 3ETQA 1BOAA 4EWAA 1NE4A 4Z82A 1U8RA 1XE8A 2FXAA 3AAFA 3IIAA 1DPRA 2ELHA 2DQLA 5KHKA 3V7RA 5EEHA 2OZUA 4I0AA 3HOSA 2P4WA 2XVCA 2WV0A 2STWA 2VBYA 1I27A 1QBJA 1OFNA 1Q5OA 1EV7A 2O61A 4CGZA 2FBIA 3Q5FA 2GXBA 4RB2C 3H3ZA 5E1WA 5I8YA 4I01A 5L3BA 3IRQA 3QRFF 2IP2A 4ESFA 1XE7A 1DZTA 4EJWA 2DK8A 3ECOA 1XMKA 1YLFA 2M5WA 4CYDA 5LRSA 2E1CA 1X8MA 2QENA 2LNBA 2HYGD 4IXAA 4XF1A 2K0GA 3M9AA 3MPBA 3QP6A 1L3LA 5ICCA 4GYIA 1ZRDA 2FE3A 1V70A 4EWDA 4KIFA 3LA3A 2LSOA 2EV0A 5E18F 1ZYRF 2ZBKA 4UUVA 2OD5A 4EJUA 5D8KB 2ZMEB 2L02A 1I5ZA 3JSOA 1QZZA 2XKPA 3LQQA 4LD5A 3K9TA 3O2PE 1FBUA 3SXWA 2A68F 3ZQ7A 2MBFA 3F21A 5D8LB 2EA4A 2QZ8A 2BE5F 5F64A 3TQNA 4LLNA 4D7SA 1EPZA 5HVQC 5D5UB 3TNQA 3HHGA 1CX4A 1FX7A 1XGNA 4MTDA 3ULQB 1ZG5A 4Q0UA 1G3YA 4RD7A 5JSRA 3ACLA 4MUVA 1EH8A 5HS9A 1SMYF 4X6QB 1BM9A 3I0TA 2ZKLA 4GXOA 2ZFWA 1KQ9A 4FBFA 4LFUA 4QX5A 2XASA 5E16A 2YU3A 2CQKA 3GWZA 1IN6A 1OMIA 1ZG1A 1BN5A 1XDUA 4L2NA 3LA7A 1R1UA 3DXJF 3QAHA 4JBAA 2H09A 4MEYF 5FFZA 4XBFA 3WGIA 3GFJA 4RB0A 3D0JA 1Y0UA 2QLZA 4A2UA 1ZN2A 2D5HA 3ZPLA 4BAYA 4R79A 4XFCA 3FF5A 4LLLA 2E7WA 4XF9A 1OYYA 2VBZA 1O7FA 2LF7A 4LUKA 2OU2A 3WTUC 2R7DA 3N4MA 1IN5A 3EQEA 4I09A 1ZZ6A 1WRJA 3IKVA 1T0FA 3H92A 2WWYA 4ENKA 1GQHA 1LDKB 3U2RA 3ZMZA 4M72A 2OQGA 4AVAA 3WTVC 1HSTA 3B73A 4D7TA 4MGKE 5A2QK 1KYZA 3TO6A 2A69F 1FWZA 3BWGA 3O3KA 3MQ0A 5EEGA 1QGPA 2J5PA 4BH9A 3LWCA 2PMUA 3MEXA 4E2GA 2AS5F 1KA8A 2IW5A 3R4KA 1EYBA 3GW2A 4MTEA 1C0WA 3NQOA 1J75A 1LJ9A 4EM0B 1YW7A 5DCFA 1KU3A 3F6VA 3GO5A 1J3QA 1Q43A 3H7JA 4HDUA 3SCHA 2E1NA 1I6XA 4P9FA 2XKOA 3RKWA 3HQXA 2FNPA 1JUHA 1O3RA 4L9JA 1Z7UA 1FP1D 1J5YA 5K5QA 3F8FA 2XV4S 1UD1A 1VR3A 1USSA 1I1GA 3HT1A 2L54A 2O0YA 3BJAA 1USTA 4D0PA 5I93A 5HI0A 5FPXA 2XLAA 2IC1A 4KA4A 4IPAA 2ETHA 3DN7A 4U88A 2JT1A 3HRTA 3PVBB 1EH6A 4YIFA 2IA1A 2CAVA 5BUVA 1J2XA 4GCVA 5A2QZ 3GVAA 4LA3A 4XF0A 2IA2A 3MZHA 1SAXA 2G9WA 1RGSA 2ZJ2A 2FNAA 2VOOA 2GZWA 2XAGA 1IN4A 1XB4A 2HJIA 4Q0QA 1KGSA 1PDNC 5E1ZB 2MC3A 2J5OA 3IBMA 2K86A 3I59A 1CF7A 3KP5A 2XAFA 2X4HA 5DEQA 4Q0PA 1BIAA 3PLQA 3MFKA 1SFNA 3M8FA 3OCPA 1P6RA 2KRFA 1RL3A 3ABTA 3GFMA 2M45A 5I0UA 3M3IA 4IJAA 1YYVA 3RYRA 2IRFG 2UXXA 4UV8A 2D93A 4P9GA 3CEWA 3E5XA 2GQQA 1YG2A 4NQWA 4OIPF 4I98B 5FLIA 4KN7X 4A0YA 4Q0VA 4ENJA 1U5TB 2A07F 1HW5A 1CAXB 3P7NA 5DDGA 3KFWX 1RUNA 2W24A 3RI4A 2BNNA 4S04A 4ORFA 2ZMEA 1ULYA 4EQQA 1BIBA 2MH9A 2IJLA 4HVQA 5I0TA 3DF8A 3UKVA 2A5YB 1DZRA 4HX7A 4G9YA 3OOPA 3IKTA 1QPMA 5D4SA 1YQAA 3V4GA 2VBWA 3CUOA 2V9VA 4ESBA 5JAXA 2YSRA 4L11A 4YYOA 3T1BA 1FYLA 1CAWB 2GAUA 3NVCA 2HQNA 1W4MA 5AONA 3LAPA 1FC3A 3M1EA 1BC8C 1WWXA 4WK8F 4LJZF 4MQVA 1B1BA 2FRHA 4U7DA 1F9NA 4FAGA 1MJAA 1LR5A 2H94A 4PJYA 5ICGA 4U0VA 5BQTA 1OR7A 3O6BB 1UB9A 3FMSA 4KN4X 2PAMA 5JR7B 1TBXA 1PP8F 1U78A 3L00A 2DI3A 1ZG3A 1TQIA 2DPDA 2BBYA 1WA4A 1R23A 1B9NA 3BPZA 1U6GA 1YFYA 1SEFA 1S6LA 3I64A 4E2SA 2FQ3A 4N0BA 4FX0A 4B8XA 1MDMB 1SFEA 2DPUA 4QGLA 4HVRA 2EA2A 1U5TA 2ZXJA 4QMAA 1YWKA 4PIZA 1LEBA 4M74A 4LGWA 2F5FA 1CAUB 2QQ9A 3WGGA 1MDMA 1QXJA 1GXQA 1AOYA 1YS7A 3MYXA 3RKYA 1DDNA 4WCGA 5FDBA 2FU4A 4E70A 4EWEA 2XGXA 6PAXA 3ST7A 1TNTA 1GXPA 2BYVE 2MH2A 4MHGA 4HVOA 1NXMA 3NJZA 5J6XA 1TLHB 4TLFA 1D5VA 4PIXA 3JAMZ 2QUFA 2XROA 4LG0B 5HS7A 4FT8A 3S0MA 1ON1A 2ET1A 1SD4A 3K1PA 4GGGA 5I91A 2H6CA 4L9VA 4KIGA 2QVSB 4XSXF 1YHFA 2O03A 3TGNA 1J3PA 2KJCA 3M70A 2BEOA 2F5EA 1DGWA 1Y3TA 4I0BA 2PFWA 4RGSA 4AIJA 1K7AA 1ZZ9A 2UY8A 2GC1A 3HSEA 3I54A 4MGZE 3QU6A 2ETEA 4UNOA 4IHTA 4HV5A 2QBYA 3WTXC 5H6RA 2JPBA 4I02A 3VODA 1TNSA 1DP7P 2WTEA 4B09A 4CHUA 3HYIA 3H8UA 2DT5A 1L0OC 2W85A 3I7DA 2UWMA 3FJSA 3CF6E 2XRNA 5DD8A 3J81Z 3H50A 5I8TA 2ISYA 4OOIA 5FFXA 2H27A 1ZZBA 5I0SA 4AWXB 2M30A 3DPLC 5HDGA 3C3WA 1ONVA 5BXXA 1ZRCA 1P92A 5LLQA 2EV6A 2FA5A 4BQAA 3O14A 3BU7A 3HHHA 2UYAA 1IN7A 4OIQF 5BV6A 1FI2A 5JI6A 5DUIA 1ZRRA 3GF2A 2I45A 5D6EA 4G94A 3GZ5A 2GC0A 2E7XA 3OF1A 3NW4A 1XN7A 4LB5A 3SMHA 5KHJA 3H3UA 3KMHA 4K8FA 2QCSB 3MDPA 1X82A 1O5UA 3OGJA 4R8HA 5CU1A 1RTVA 1K78A 2L4MA 2FEZA 4EVIA 4OIOF 5LHHA 1ON2A 5CVJA 3IWFA 2XUBA 3CO6C 5LHGA 2B9UA 3HOTA 2RGVA 3DPTA 5CYVA 3F23A 4MNUA 1HKQA 1K78B 4K2EA 4YFXF 3V8JA 3ZMDA 2Z99A 4IEZA 3S7EA 2FOKA 1U2WA 1O3QA 3EUHA 1Z91A 3FXRA 4EROA 1O3SA 4F8AA 2GC3A 3BB6A 5KHHA 4UVAA 4HBLA 4OMYA 3QPTA 1V4RA 1J58A 4JTOA 4CICA 3TNPB 3P9KA 2A61A 1T38A 4A12A 4EJOA 5KHIA 1TW3A 1D8JA 4UXAA 2IXHA 2Q8KA 2PQQA 1OD5A 2IA0A 4LMYA 4L18B 3W6JB 2H6BA 3BDDA 1ZAOA 3G7DA 3R6SA 2CGPA 5FO5A 2IPQX 3R61A 5AIPA 2ZNYA 1XSVA 1P4AA 1ZZ7A 4JVAA 5KHGA 5CVVA 4IEYA 3KETA 2OPKA 2D40A 2XAHA 4LTAA 4OLLA 1GQGA 5K5RA 2JZYA 2PTMA 4P5OA 5FQ0A 2HR3A 2DLLA 4META 1TQ5A 1YLLA 5K8SA 2P8TA 1FBQA 1S7AA 4BHCA 4ESJA 2RKHA 2UZKA 4FAHA 5LBQA 2V1DA 3CJXA 3D0SA 3KP7A 3K69A 1J59A 4EGZA 4DQ2A 2Q4SA 3E5QA 1B9MA 2HS5A 2EA7A 4MH0E 3I58A 2NS0A 1O7LA 3T8RA 3FZVA 3LSTA 2CWEA 4KDPA 2P17A 2P5VA 5FGMA 1FZPB 1G3SA 1ZX5A 4HF0A 5D6FA 3FE5A 3CO2A 2DAOA 3J80Z 1O3TA 5BPDA 1IN8A 1KQ0A 4M73A 4MV2A 4M9XA 2W84A 1W7PA 3ZP5A 4A6EA 1VTNC 2L01A 1HW1A 4HQMA 3FX3A 2MLGA 4M71A 3RJPA 3GFLA 3IDCB 4J1WA 3HIFA 2Q30A 5E17F 5C8WA 2DCTA 3ZN0A 3CL1A 3D82A 5L3GA 3FM5A 4ZU5A 2NAZA 1F4KA 4P9UA 3HT2A 5J7MA 3CUQC 1RUOA 4KFCA 1WSUA 4U0WA 4P55A 1XSDA 3LWFA 4IEUA 4OFGA 1F1ZA 1BI1A 4GULA 2OYZA 1TTYA 4BIFA 1WQ2A 4LG0A 4ZU7A 3J7AO 2WFPA 1QWRA 5FLJA 4JQFA 4O9EA 5AVPA 1SD7A 3F8MA 3RPQA 4LLGF 1CAVB 1AWCA 1CAVA 2HEOA 2E9QA 5FPZA 2Z9OA 3C3VA 3KP4A 4N9HA 4DNCA 4MGIE 3SHFA 2VE8A 3V7SA 3ROUA 4EM1A 5F6FA 3WTWC 2EJRA 3NEUA 1P4WA 3FFQA 2XLGA 4WZCA 5FLXZ 5L3DA 5BY5A 3EYYA 3DL3A 4HLYA 1H1MA 2OQRA 2VBXA 5L3FA 2GA2A 1MD0A 2KJBA 2QDRA 4HSLA 1FYKA 3LZZA 1R22A 3SZPA 2X0LA 2V6CA 2JSCA 2YR2A 1FOKA 2PBIA 5J8FA 1FPQA 3KLOA 5HLGA 3WTTC 2NNYA 4HF2A 2VQAA 4G7ZF 4IVNA 1IXRC 1UIKA 4G7HF 5HLHA 2V09A 1MGTA 4KICA 4WXCA 3TOBA 2CSOA 1ZLKA 4ZZLA 4EMSA 2P7VB 4WBBA 1U3EM 3JZVA 2DBBA 1FBSA 3FMRA 5K5OA 5ERIA 2OZ6A 4YNIA 2DU9A 4AVBA 4EGYA 1XGSA 2LDUA 4HX4A 4XF4A 1Z6TA 4XETA 3TO9A 5CVRA 2M8EA 3WE3A 2QYOA 2H0VA 5JFRA 2GA1A 1IRFA 1HKTA 1ZGJA 2XIGA 1IXSB 3WW3A 2GXGA 4WVZA 5JVTA 4BXUA 5ICEA 2PMHA 2PQ8A 1HKSA 1MKMA 3WGHA 2O8QA 1IXCA 2BGCA 2GWRA 1D8KA 1PUEE 3HUGA 1JE8A 5D4RA 2EFWA 3WTYC 2CYYA 4AIHA 1J3RA 3CLPA 2FBKA 3QU3A 5L3CA 3SCGA 1LVAA 1XGOA 1YW9A 5E20A 3GYHX 3HTSB 3BY6A 2D45A 2Z69A 2IXLA 1P2FA 2EWNA 1IF1A 1IW7F 1P4XA 5BS6A 1CAWA 4HSJA 2XAJA 5DYMA 5T3NA 1Y9QA 3FM3A 4LULA 3RYPA 4XF3A 4FHTA 3HRUA 2RN7A 1PP7U 4KWJA 3EDPA 4L9NA 2NRAC 2DW4A 1BC7C 3BJOA 2R3SA 1NE6A 4QLCU 4IEXA 3MWMA 2GH2A 2QM3A 3KEOA 1O5LA 1LDJA 4JV4A 3I53A 3ISPA 1E17A 1CGPA 4NVPA 3FMQA 2JTVA 1LDDA 1ZARA 4Y13A 3VB2A 3L2HA 1FNNA 5FLXK 1R5HA 2ESHA 4HF1A 3LQRA 2PAEA 1X7NA 3L09A 4BHBA 1GVJA 4ENNA 1E2XA 5ILUA 1G4DA 3LA2A 2F5DA 2RVCA 2Y48A 4QXKA 1IUYA 1ZZ8A 4GYGA 4PZJA 1UIJA 1TQPA 4HLXA 5FB2A 1WLTA 2MPFA 4EM2A 1J1LA 1VP6A 2FSWA 2O1QA 2Q1ZB 3QACA 4ONUA 1T98A 2QWWA 3E6BA 4HX8A 3R0JA 1YTYA 3IC7A 2N7GA 3JTGA 3BPXA 4QWQA 3ZN1A 5LRRA 1KQ8A 2IXKA 3KEQA 1LRHA 3KGLA 4UXNA 3EHKA 4FX4A 3S7IA 4CZZA 2F4PA 2UY9A 1OPCA 5LEJA 1FP2A 3RDIA 2BNMA 4HBNA 1L3JA 5BMZA 4YFNF 1STZA 1MZBA 4MEXF 3RZZA 2R7FA 1ZGAA 4IRHA 3T8TA 1DUXC 4IHSA 5BOXA 4XFHA 1XMAA 4G6DA 4Q0SA 2W25A 4Q47A 4XLNF 2V1UA 3KZYA 2VT2A 5FCCA 1DPUA 3D5LA 4WF2A 4HN0A 4O9GA 1HQCA 2PAKA 5KK1A 2PYTA 1WGPA 5I0RA 3FZ3A 4WXDA 2ZO4A 1H1IA 2HFHA 1Z9CA 2FQPA 3CUQA 1XDSA 5DCMB 5ILSA 2Q0OA 4YARA 2HZTA 4UHTA 2Y0OA 1VJ2A 3P9IA 4XFGA 1WI9A 4EJTA 2CW0F 1FLIA 1YFUA 5EZWA 3VFZA 3GLXA 2JPCA 2HGCA 1SMTA 1MJBA 5TRDA 2PJPA 2QQAA 2KIUA 4Q29A 3WODF 1JHHA 3M7GA 3QP5A 4EJVA 2FBHA 3LOIA 4MQ9F 2LKPA 4I3PA 1B59A 4Z2YA 2Z2SB 3HTUA 4R1HA 4ZYHA 4XRFA 3PNAA 1W5SA 3K1NA 1Z6RA 4QGMA 1O4TA 2EFNA 2IT0A 1XRUA 3H7YA 4AVPA 1YFXA 4Y15A 1UFMA 2P6SA 4LLOA 2EFOA 2CV6A 3CO7C 5CADA 1QQIA 4EV0A 1NYWA 2VPVA 2V79A 4LA2A 4AQ6A 5D5VB 2ADUA 2PHDA 1NHAA 4MGYE 1SD6A 3VEPA 4S05A 3NKTA 2GIVA 3BALA 2G7HA 3GYDA 4ZYDA 3F3XA 1JGSA 2XAQA 1CAUA 2L4AA 2G7UA 2PHLA 4G6QA 1DGRA 2ESNA 3L7WA 3WW4A 3ECHA 5TJJA 3U10A 4XLPF 3MAJA 3EYIA 3H9AA 2EV5A 5IT9K 3EQLF 3IDBB 4NHJA 1XCVA 3T0YA 4IEQA 1YS6A 3GXOA 3Q9VA 4E2QA 2OA4A 4ZZDA 2FMYA 2K02A 2PI0A 3V8KA 4XFAA 1HW2A 2MA3A 1H0MA 5DCMA 4CDGA 4F7ZA 2D1HA 2VC1A 4LK0F 5JR3A 4H0EA 1W7PD 4RAZA 2Z3YA 1EP0A 5EFUA 3ELKA 2STTA 4M9SA 2YX7A 1X3UA 1ZZCA 2RQPA 3ELNA 3NRVA 3CJNA 4JTNA 3PFIA 5FD5A 2UXNA 2VC0A 1G3TA 5KVRA 4IESA 4DINB 4IEPA 2B8MA 5I8SA 2Y75A 1J9IA 4WXHA 4HAMA 2K4JA 2F2EA 3GBFA 1LQ1A 3LAJA 4HA8A 1HSJA 2JRTA 4U0YA 3IL2A 2NYXA 3C1DA 3ZMUA 3SXYA 1FYMA 5CVIA 1S7OA 4IEOA 3I59B 2V1XA 3J81K 4WX9A 1RIOH 1YUDA 4LK1F 2DQRA 2QVOA 2ACJA 4HV6A 4ETSA 3WG9A 1BBYA 4OMZA 3KP2A 4P96A 3JTHA 2Y0MA 4Y17A 4WWCA 2O3FA 1MJ9A 3RIRA 3SZTA 4MGRA 4ZH4F 1X8EA 5HLIA 5FD6A 3NL1A 3SHRA 3FHZA 1UHMA 2P5LC 3BROA 3R60A 1YFHA 3BJ6A 1A04A 1J0RA 4IETA 2MNGA 4M6XA 3BP8A 3KSCA 4B29A 1CF7B 2QBYB 4CO8A 1GHCA 4KYWA 1FSHA 5DD4A 4LEJA 3WW2A 1OKRA 4JK1X 3ERED 3CDHA 5LEKA 3SFZA 1YO5C 4KU7A 2Q0AA 4L0ZB 5J3UA 1OYIA 1JXSA 1B6AA 2PA7A 2VN2A 4OIRF 3UKNA 5K1YA 3KCCA 4M6YA 1KU9A 2CAUA 5J48A 1KU2A 4UVCA 5H6QA 4ENMA 4KL1A 2O6GE 5AIQA 1U12A 4NB5A 4CXFA 3EBRA 3RNSA 1T6SA 3RTRA 1QXRA 2Q2EA 5CLSA 4HLTA 3ES1A 1TQMA 3TO7A 3B02A 5E8GA 5HDKA 4HYEA 2XLFA 3S2WA 2P5KA 1FY7A 1Q1HA 1SD5A 1XSXA 2P6TA 2FMLA 5KBFA 3IWZA 2L3DA 2LF8A 3JSPA 3LFKA 2CO5A 2F5CA 4QGNA 1O57A 4HQEA 3DP7A 1SFUA 1ODDA 2CG4A 3F8NA 2PLYA 3WW1A 3GUDA 1FXZA 2HDCA 4O3MA 1TW2A 3I5UA 4A0XA 3REOA 3GZ6A 2RNJA 3FHIB 5ICFA 3HSFA 4IRGA 1EH7A 2D1VA 1ZNPA 2EB7A 3Q9SA 1ZLJA 1F5TA 1OYWA 3I4PA 2EK5A 3WU1B 3G73A 1RZ4A 1G6NA 4HW0A 5J8CA 3L9FA 5HS8A 3BOQA 1SFXA 1W7PB 3JW4A 4TV7A 1BI3A 1FT9A 3HSRA 3FXQA 4RAYA 1IZ1A 3U0ZA 2ATFA 5JSOA 4UVBA 1KU7A 4GO1A 5H20A 2RC4A 3F8BA 3E5UA 4KMUX 2K9ZA 3OTFA 2IXJA 1ZRFA 1CAXA 3GFIA 3E6DA 2XHKA 2Z5UA 2BV6A 2B0LA 2MD5A 1JHFA 4ZYGA 3KGZA 1K79A 2ISZA 1UPIA 1ZVFA 1BI0A 3P9CA 2VE9A 4KU8A 3CTAA 3BCWA 2VT3A 4RB1A 5C6CA 4HDVA 2PEXA 2K7LA 3KE2A 4PGHA 4O6JA 3NSTA 2GC2A 1UCRA 1KYWA 4IF4A 3FWEA 3ZMVA 2EFQA 5JHUA 3WTSC 1BJAA 2PFBA 3ML6A 3USSA 3E6MA 3ZMTA 3G3ZA 1UW8A 3GX4X 1R5GA 4XEZA 1UCXA 4KWLA 4RS8A 4A5NA 3RPUA 4XFIA 5LGNA 3IHUA 1YIOA 3DFGA 4KT5C 1H9GA 3DQVC 2EVXA 1RC6A 4ZU4A 1HBXG 4BYYA 1FSEA 3H1YA 1K6OA 2YX4A 3SQNA 4BHPA 4HN1A 3KP3A 2C6YA 3CUQB 2OBPA 3EO6A 4A6DA 2K27A 2RDPA 4QM9A 2RV8A 2O8XA 3F22A 1V3FA 4O5VA 2QQBA 1T2KA 4ASNA 5FLHA 4A5MA 2A6HF 4MX3A 4AVCA 1XGMA 4Q48A 3RYKA 2HWVA 5FQ0B 4PIYA 1LEAA 1R1VA 4M9ZA 2CFXA 4OINF 4KMFA 2VODA 2AXLA 2HTSA 4QM8A 2ZNZA 3SCFA 2EFPA 4UV9A 1XD7A 5ILVA 3MZYA 4PCQA 4ZYEA 4AQ2A 2HKXA 4AXOA 2HQRA 3V7CA 3QOPA 3R0AA 2DK5A 4A0ZA 2W57A 1IAWA 4KIBA 2ZCWA 3PQJA 5L3EA 3WE2A 1LNWA 1J7KA 1UHWA 4AIKA 2IXCA 1T39A 2MHFA 2COMA 4HMZA 5JCTA 1QZYA 3F6OA 3HRSA 2D2WA 2YPRA 5ED4A 1HXDA 3J80K 3I71A 4J1XA 1H9TA 1OI6A 4I2OA 4R52A 1Z1DA 4G8XA 2K4BA 2M87A 3KLNA 5IT9Z 2PG4A 2TDXA 3EETA 1R58A 2A3SA 3DEUA 5HOOA 1RI7A 1NZCA 3PQKA 3K2ZA 3TOAA 4U7BA 5E1RA 3C18A 1QO0D 2QJVA 3IRRA 4Z07A 5HDNA 2OAZA 3H1MA 3OD0A 1IPJA 3V8LA 1IPKA 3EJKA 3F8CA 4YG2F 2HYFA 1I1SA 2UYBA 2FF4A 2IXIA 2PN6A 1S29A 1R1TA 5LGUA 4RGXA 4YFKF 2XL7A 5D5WB 2OZJA 4IEWA 2KIFA 2KKOA 4ON0A 4L5JA 3VOEA 2C0ZA 4RGUA 3ABUA 2D5FA 1ZH5A 4I7HA 1Z05A 3CLOA 1EY2A 5BPIA 5E1XA 3K0LA 4IERA 1BI2A 5DUKA 2HOEA 1QY4A 1IRGA 2QNKA 4HZFA 1LKNA 1YFWA 3ZDSA 2A6EF 4MZUA 4X6RB 1S3JA 3GEZA 1WKMA 1LB2A 3C7JA 4XFBA 4N9IA 3KP6A 4RGRA 4IEVA 4IRIA 5LGTA 5JSPA 3U1DA 4OU0A 4UBHA 3HRMA 4KUMA 5D1IA 4PDKA 3U9GA 2DO7A 1YW8A 1S8NA 1XCBA 3ZMSA 3E97A 3COAC 3N97A 3RKXA 2IVMA 1W5TA 4Q5SF 3TDZC 4RB3C 3L2CA 3FXUA 4PGGA 3KZZA 1R00A 4G7OF 4L0YB 2OA2A 5BPXA 4LUMA 2DFIA 1ZHFA 5IT3A 3T5XA 2VONA 1SQ4A 2XL9A 2MLKA 4UBGA 4XFFA 1B4AA 3TKYA 3BZ6A 4AD9A 3U11A 1G3WA 5CJ9A 2ET7A 1R7JA 2DTRA 2GU9A 2NNNA 3JAMK 4H7LA 3F72A 1ZREA 2M1BA 3K1MA 5E8IA 2VXZA 1U5TC 5LHIA 3E6CC 2ZKZA 2WC2A 5F1RA 3BPVA 4Q4ZF 2B5HA 3LAGA 1Q3EA 4L9TA 3QPHA 3VHRA 3WU0A 3E3VA 3OV8A 4YIIA 4XSZF 4LB6B
chains in the Genus database with same CATH superfamily
1P9QC 2EXHA 4HOBA 4PQQA 1D3YA 4CP2A 5DV5A 4UW6A 3LOBA 3TWIA 3M8EA 1U9OA 4GKXA 2VOPA 2HKOA 2BNOA 4KWKA 2O8OA 2XG3A 3MIHA 1REPC 1VBA1 3BG7A 5CVUA 4BJ0A 1XG1A 3ECQA 1MMDA 3B00A 1YI9A 3KYCB 3ETQA 4EWAA 4Z82A 2LC2A 3OYBA 3AAFA 3IIAA 5BNQA 5F5AA 4CA0A 5B66C 3ZSEA 3KCXA 1BYHA 3AZYA 1QBJA 3TYJA 4CP9A 3PMEA 2O61A 1SDDB 4CGZA 1VB2A 3AG2H 4N53C 4RB2C 2DFHA 3H3ZA 3J4UH 3AM2A 1BK1A 3QRFF 2R7WA 1NCQB 1XE7A 3MW2A 1MBKA 3BG5A 2O5RA 2M5WA 4CYDA 1X8MA 3FN9A 3G4SI 3H9GA 2K0GA 1AKHA 1L3LA 3POGA 2F48A 3ZGKA 4AYBN 2Y6JA 1PO12 4EWDA 3LA3A 5E18F 2BVMA 1VALA 4Y20B 4HKLA 4YM0A 3WHBA 2VVEA 5FPBA 1GNYA 1RUJ2 1T6GC 2YDEA 5DZGA 3R4UA 3B69A 3WF4A 3GCXA 5IUQA 1QKQA 3O2PE 1QJZA 1TMF1 3WHTA 2MBFA 1Q1VA 3HBKA 4OQ8A 2QZ8A 2BE5F 1T6BX 4OI2A 1OT5A 5HVQC 4P9JA 3S32A 3C7GA 5EQUA 1FX7A 2XF5A 4MTDA 4RD7A 2JA2A 5JSRA 1QDCA 2P3YA 5F7UA 1N3QA 4X6QB 3GHMA 2W00A 2ZKLA 1HQNA 4GXOA 2ZFWA 4XE9A 3MFCA 3IPVA 1LHOA 1X2MA 4M01A 1RUC2 2XASA 5FZKA 1OMIA 1XDUA 3LA7A 2WA4A 3EYPA 3SZGA 2EIEA 2ZS6B 3QAHA 4JBAA 2H09A 4NC6A 1H30A 5FFZA 4XBFA 4AYBA 1LOCA 3H5RA 4D6RA 1ZN2A 4N4OB 4BAYA 4B43A 4XFCA 4M6VA 2Y33A 5JLVA 3GTPJ 5J47A 3CKHA 4JCKA 4DUXA 3JD72 2E7WA 5F5QA 4P9WA 1O7FA 2LF7A 1UY2A 4NR1A 2OCCH 1WLCA 2ZXQA 1H8TB 1NT0A 3OY8A 4FTSA 2WT2A 3H92A 1GQHA 3R4DB 4ES9A 4AVAA 2N8GA 3WTVC 3BTIA 1HSTA 2XQRA 4D7TA 5A2QK 2Y6FA 4G12A 4XJWA 1LFBA 3L2VA 1DHKB 1OQ1A 1KDMA 3D6EA 2BVVA 3MQ0A 2DU0A 4AAXA 5EEGA 5FKNA 1QGPA 4HXCA 3N05A 3FLTA 4DBQA 3H8OA 4C3IJ 2AS5F 4MSVA 1WCUA 4YRVA 1F31A 3V56A 3OR1C 3QBQA 4A3IJ 3GW2A 2ILMA 3NQOA 1YX5A 1YW7A 1KU3A 1LEDA 4KI5M 2FDIA 3H7JA 2RS53 4HPKB 4Y26A 4P9FA 3RKWA 3HQXA 2FNPA 1JUHA 2MGQA 5CKNA 3VBRC 2ZXIA 2M7AA 2W5FA 3J8F3 5K5QA 2XV4S 1A35A 1UD1A 2NP0A 2VZTA 2X5IA 5FY0A 3H8XA 4DS0A 2UUZA 3RZMA 3KCYA 4XOTA 3JBG2 1BMV1 3BI3A 2ETHA 4XMYA 3I3MA 2JT1A 3HRTA 4R9BA 1NCQA 4CCLA 1SDWA 3GVAA 2WZ8A 4XF0A 2BPA2 5BNNB 2G9WA 2VUJA 3VD4A 2GXAA 4AQTA 3OYIA 2ZJ2A 4LR4A 2VOOA 2ZGNA 2GZWA 1MQTA 1XB4A 1H2LA 3W2VA 3A03A 3PL0A 3ZX7A 5IFTA 2KZGA 2H8RA 4CRQA 3ZR6A 3I59A 5GZEA 2OQ7A 4ZYAA 3POSA 1DGLA 2GNDA 4A7YA 5ACA1 5DPNA 1SFNA 3WG4A 1XX5A 1E57A 3WG2A 4YW6A 5I0UA 3ZN6A 3M3IA 4PJNA 3AC0A 2D93A 3CEWA 3FHAA 3J8F1 2YZ4A 1U5TB 2BVBA 2A07F 4QKNA 1HA8A 4QQ2A 4RL7A 4CEYC 1JZ2A 3O8GA 3H3VK 2A5YB 4A7KA 4HETA 4HX7A 4BDZA 5F3IA 3OOPA 3S16J 2DA6A 3V4GA 2E1MC 2D43A 5C71A 1W9WA 1D7PM 5JAXA 5FK7A 4L11A 3S8PA 3T1BA 4M0HA 3ZM8A 2GAUA 1EJ9A 4LORA 3VZNA 1FC3A 1OLRA 5BNOB 2X1EA 4WK8F 3AKTA 4H4KC 2WA0A 4LJZF 3VBFB 2G19A 3B93A 4GA9A 2QQIA 1AL21 4U7DA 1F9NA 1WMXA 2VQTA 3BIEA 1LR5A 5ICGA 5FZLA 1AYN1 4XTPA 4Q5OA 2M8GX 3KV9A 4JX4A 5GPAA 1UB9A 2RR11 1WJFA 1ULEA 4XZUG 2BBYA 1WA4A 5FZFA 1R23A 3CC4I 2VNRA 1V6KA 2V4AA 3BPZA 1BJZA 2P0WA 4NE9A 3RFRA 1KEXA 2JVHA 4FX0A 4B8XA 4V19K 2I74A 1MDMB 2ZEXA 2Z1DA 5FR3A 1TME2 3MIEA 1APNA 5BNPA 3KF3A 4QGLA 4HVRA 4QMAA 2FX0A 4I76A 1FOD1 1SLAA 3ZFGA 5LATA 3QH6A 4UW3A 2ELJA 3N7MA 1GXQA 1AOYA 1ZBA3 3HOBA 3RKYA 3BVCA 2VQGA 4E70A 2E19A 2A70A 4EWEA 3T0DA 1RIRA 1YIFA 1TNTA 3KZIC 3B6AA 4HVOA 1QJY3 5FO9B 4AFAA 2VTFA 3NJZA 3LDBA 3CDIA 1D5VA 4PIXA 3JAMZ 2XROA 4FQGA 5HS7A 4FT8A 3QCWA 3S0MA 4X1EA 1HX6A 1SD4A 2VMIA 1VQ7I 3HBZA 4L9VA 1UHSA 3Q8BA 2O03A 3TOJA 4XUQA 2HWD3 2DA2A 5EJZB 2PFWA 2JD4A 2HNHA 1ZZ9A 1CONA 4MGZE 1S2KA 3QU6A 1HB3A 2ETEA 4FXGB 3WTXC 4RN5A 5H6RA 4TLGA 3PSIA 4DOUA 4MO3M 4YM1A 3H8UA 2W85A 1QPIA 2VQLA 5F5CA 1IV6A 2ORXA 2XRNA 3VDXA 1YHQI 3ABKH 1LHWA 2QBXA 3H50A 5GLTA 3S3NA 1ZZBA 4D5FA 2A75A 3A1YA 3UK9A 1IZ3A 5HDGA 1FIPA 3C3WA 3T1MA 3N9QA 4IE4A 1D4VB 1DCSA 4WVVA 2FA5A 4B4RA 4CU9A 4AI2A 3O14A 1C8NA 2R5YA 3BU7A 5FPAA 1IN7A 3WY6A 5CB7A 5JI6A 3KV4A 4Y5Z0 1G9CA 5FBZA 2I45A 3O1TA 3UJQA 2JE9A 2GC0A 2KPMA 4DMIA 2CTVA 1JOJA 3SMHA 5KHJA 1GOGA 3MDPA 3ZXAC 1X82A 1O5UA 5FKOA 5IP9J 4EN6B 2L4MA 2FEZA 1Q56A 1GLNA 4BDYA 1YQ6A 5LBFA 3BCBA 4V1PA 2JDAA 5CVJA 1DF0A 3IWFA 2HWC2 1EA3A 5IPAA 1N1TA 4XOPA 2RGVA 5BNGA 1S2BA 3TRSB 5L36A 2BOJA 3V8JA 3HPGA 3S7EA 3MLJA 3UNPA 1O3QA 1GNHA 2OUHA 3MIDA 1Z91A 3WNOA 2PLV1 1BMV2 5KWRA 4PJMA 2GC3A 5KHHA 4UVAA 4PF1A 3HB9A 4QQPA 2A6VA 4PK4A 2ZJCA 2WZEA 1YRNB 3P9KA 2A61A 4A12A 4XAAA 1VBE1 4XABA 4NDLA 2PQQA 4QQOA 3ZFFC 2C26A 4K7JA 2J1AA 3ZN4A 1LJ7A 4AFCA 4ATFA 2CRGA 3ASNH 4W6WA 2CGPA 5G04L 3JU9A 5LK5A 1IG3A 1Y56A 2IPQX 5AIPA 4AG4A 1KJRA 3ABMH 5KHGA 1MNDA 4OLLA 2JZYA 2PTMA 3NV3A 4KWUA 4K40A 4CDWB 4NIHA 4META 3D5SC 1TQ5A 5K8SA 1S7AA 3FLRA 4AEJA 2ZEWA 2RE9A 1CR7A 1H8VA 4I6ZA 3IMMA 2V4VA 2Q4SA 3ZXGA 2HS5A 1ULCA 4MH0E 3ZKUA 1O7LA 3LSTA 2E34A 4M00A 2CWEA 4KDPA 1PYVA 3AYEA 3D3AA 1FZPB 1G3SA 4ZONA 3DBHB 1TT5B 3HOVJ 3FE5A 2DAOA 1V54H 5BPDA 1S0DA 1ZRIA 4MV2A 5F32A 2W84A 1W7PA 2WA3A 1VTNC 1MACA 2CMPA 3TP3A 1LHUA 2MLGA 4XORA 3VZLA 3GFLA 4UFJA 1AXYA 1VBB3 1ZKGA 5M3FJ 3OS1A 4BBSJ 5A70A 2VTXA 4Y22B 3BPSA 3NAPB 4OYUA 2KM2A 4AHXA 4BXFA 3BKZA 4P55A 1XSDA 1QOOA 1R092 2KMUA 1F1ZA 2OYZA 4XICA 2HI3A 2XB6C 3J7AO 4PLOA 4QDQA 5AVPA 4UUSB 2DVGA 4LLGF 1CIWA 2HEOA 5FPZA 2Z9OA 4DNCA 3OBRA 4LOCA 3CMGA 2IVIB 2VE8A 1YQCA 2A6ZA 1W0OA 4RGKA 5TISC 1R49A 3WTWC 5FJ8J 3NEUA 4BS9A 1U8BA 4AGVA 4QDSA 4WZCA 4A4AA 1NY71 4LG3A 3OG2A 1SCRA 3MI8A 5FY4A 4HLYA 2E7QA 2OQRA 2VBXA 5EG0B 5CG9A 3HD8B 1R22A 5JOWA 4D69A 3RZGA 5JZGC 5ABJC 3CDZB 4U87A 1FOKA 3D5OA 4OUMA 1FPQA 5JOYA 3W9AA 1PNGA 1BLZA 3WCSA 1BZWA 4C0HA 4AHWA 1UIKA 2W52A 4LHKA 2V09A 5FKBA 1MGTA 4KICA 4IQPA 2WBMA 2ZHLA 3M07A 3POWA 2ZGKA 1DU0A 4H7MA 2PHUA 3JZVA 3WF2A 4KQ7A 3FMRA 1JODA 2L9SA 1IRXA 2DU9A 4EGYA 5JVGF 3I2IA 5FMOS 3IAS2 4XF4A 3CQZJ 2CFOA 2M8EA 3CMMA 2QYOA 3OYDA 5E3OA 2ERFA 1D1AA 1HKTA 3IZOA 1ZGJA 2IXSA 2FHRA 4BE3A 2CYFA 1UU6A 2KR2A 3HQRA 5JVTA 4F83A 2H1LA 1JUIA 2JB4A 5ICEA 3DEEA 1W8UA 1LTEA 1G7YA 3CCYA 1D8KA 3C2BA 2VL8A 2JN6A 3CCJI 2EFWA 3TMOA 4MHRA 3W2AA 4FPJA 1J3RA 1BVP1 3FKIJ 5A6QA 3QU3A 4UOJA 5LFAA 3DXUA 3ASOH 2D6OX 1XGOA 4FPKA 4LNVA 2FDFA 1DP0A 3HTSB 3BY6A 2HWE1 2Z69A 5FZ9A 3PTYA 4ES8A 2FMDA 3VSLA 2A5WA 4ASMB 4LPLA 2EWNA 1IF1A 1ZBA2 1DDLA 1LU1A 1PGL2 3ZQHA 2GSYA 4CE8A 4XKBA 1UU5A 2YROA 3FM3A 5CAZA 2OC6A 4AVZA 2E2HJ 3VBFA 3VD9A 2DW4A 3BJOA 1O6UA 1NE6A 3TW6A 3S5AA 2GH2A 3KD4A 4YG6A 2QM3A 2XAUA 2YC2A 1O5LA 2WAOA 2ZACA 3I53A 3ISPA 4JV4A 2ZGSA 3LPFA 3LMMA 1EF4A 1NH3A 1OQYA 2HWF2 3L2HA 2E33A 1JGGA 2PAEA 4EN8B 3L09A 3WF0A 1G4DA 5IVCA 5DAWA 2E31A 2R0FA 1WJEA 5A6YA 3UL2A 5C3PA 1IUYA 2W1SA 4BXXJ 3HNYM 1S1AA 2ARXA 3DLLF 4YW2A 4GYGA 1TQPA 3J8F2 2MPFA 1VP6A 3LQCA 2Q1ZB 4ONUA 4WM7B 2VZQA 1YC61 3Q0UA 3LEGA 1E3OC 2JG8A 2NN8A 1YTYA 1GV5A 3JTGA 3BPXA 2B39A 5F9TA 5LRRA 1KQ8A 2CUJA 2IXKA 4YVWC 2Y38A 1GV9A 1LRHA 4UB8C 3FFZA 1OPCA 2JX9A 5L7OA 2BNMA 1L3JA 5BMZA 4YFNF 4OAZA 2X6WA 3Q8CA 1MZFA 1ZGAA 4C0BA 4IRHA 4GB31 5FLVA 4IV1B 1FJLA 4MADA 1S2EA 1GOFA 3QD6A 4EN7B 1XMAA 1AR63 3KZYA 1H88C 3VKMA 4WF2A 5L9RA 1HQCA 2PAKA 1MS1A 3THCA 3AL0C 5EEAA 4BCUA 3WQ0A 4JGZB 2JB8A 2VH9A 3KPHA 4K3UA 5JXGA 4LOSA 3S6PA 2ZO4A 1H1IA 1AR91 3O5SA 5FO7B 2WQZC 5KAIC 4UHTA 3AJYA 4XFGA 2CW0F 5EYRA 1YFUA 4XKCA 2ADDA 3BR5A 1AHDP 3X2QH 4G3YC 1US3A 5TRDA 1C1FA 3VZMA 1JHHA 1D0GA 4EJVA 3CCSI 3KIOA 3LOIA 4I3PA 2A7AA 2CWSA 1KONA 1UAAA 4BU2A 1VB4A 2QQLA 3VBSB 5F1JA 3N9PA 3K1NA 2V5YA 1Z6RA 3K10A 3N35A 4QGMA 2AQEA 1O4TA 2EFNA 1POV0 3S2DJ 2W87A 1XRUA 3H7YA 4AVPA 1VIWB 5A6ZA 2X85A 4PJ0C 2EFOA 1PGSA 2CV6A 1FMD2 1SVMA 2V79A 4LA2A 5FO8B 2EIKH 1OVPA 1KS4A 1R1A1 2PHDA 3MD2A 1W9TA 4IEJA 2KLOA 3K4KA 2WIIB 4MGYE 1ETVA 2LG4A 2OXBA 3NKTA 3OGGA 5FPLA 3GYDA 2XPJA 1VQ8I 4UFLA 1DGRA 3ECHA 4MXVA 1S0CA 3ACGA 4FISA 1NG0A 2JG9A 4Z2AA 3MAJA 1RITA 1VQOI 1NA1A 4Q1PA 3QODA 1DLLA 4NHJA 3BC8A 2DOFA 2OUMA 1JZ8A 1YNAA 5EIYB 2HH9A 5C4WC 4RM2A 4BEHB 4E2QA 2JKXA 3M2MA 1ETKA 2EICA 3BG6A 4ASKA 3SFIA 4BQ2A 4XJUA 3NV2A 1DQ5A 5DCMA 2WB1N 1JOPA 3MKZA 2KDZA 1VFCA 2VUDA 1NK3P 4F7ZA 2QQPA 4LK0F 5JR3A 2WINB 4RAZA 1EP0A 5EFUA 5DM7F 5HCHA 4M9SA 1X3UA 1ZZCA 1LFUP 2W91A 4R4XA 1R083 1JUMA 3CJNA 4IX7A 5FD5A 3BOPA 2OQ6A 2VC0A 1UMIA 4XVHA 5A6XA 4XK4A 5KVRA 2C4XA 2CGOA 4DINB 5HXMA 5DABA 4N4NB 2EBIA 2Y75A 4WXHA 4DRVA 3DCQA 3ZXLA 1RUF2 2MYSA 4HA8A 4U0YA 1TG7A 4CUGA 4ZPIA 1Q8QA 2HBUA 2Y9YA 2ZTNA 3BTJA 3I59B 3J81K 5K7PA 1RB8G 2DQRA 2QVOA 2QZ3A 2ACJA 3RCOA 4IZZA 2VUMJ 4E8DA 1ZGWA 3DGTA 3WG9A 2KISA 4OMZA 5LD2C 3KP2A 2W1WA 2YHJA 4YLZA 2ZJRF 1MJ9A 1PO11 1HDPA 1OCOH 1PK6B 2FQ4A 3FUQA 2BY2A 3BROA 1YFHA 3JREA 1A04A 1LOFC 1Q8VA 5D21A 3SEPA 2MNGA 2WADA 4LKSA 1H0BA 4X8NA 4Y7NJ 2ZX3A 1N47A 1X19A 4K21A 5KXCA 3V42A 1FPN3 2VJXA 1KD7A 1XS9A 3OPTA 1FOYA 5LWBA 3AZZA 2Q8EA 1OD3A 3JCUC 1R081 3SFZA 1AYN3 2KZVA 4LBQA 4A3ZA 5A3LA 4L0ZB 2DFBA 4P9IA 1R6RA 3KCCA 5DQ0A 4M6YA 4CTEA 4URAA 4HPKA 2MSYA 2X1DA 4P9XA 4NB5A 1MEC3 5FOJB 2HQAA 5C8CA 3TEWA 2JDMA 3RTRA 3VBFC 2Q2EA 2JDZA 2ARAA 3ES1A 4Q4X1 2E71A 2R7ZJ 1ITYA 2ECBA 4A6SA 3B02A 2MEV1 1LOGA 2LS6A 3OEAA 2OS2A 4TTGA 3AP9A 4NROA 5GAEJ 2P5KA 3BZKA 1F5JA 1XMXA 3GCWA 3QH7A 1ACIA 4QX2A 5B1AH 1T2XA 2E32A 1HN1A 1W5CC 2IS2A 3WNMA 4HQEA 1ODDA 2CG4A 2PLYA 1J84A 1A8DA 4Q27A 2PX9A 2EIDA 1JKQC 4O7XA 1TW2A 3FKJA 2RNJA 3ZOBA 2QQWA 1VQLI 3VKOA 1EH7A 1MVEA 3MIBA 1ZNPA 3Q9SA 2WNUC 1ZLJA 3OY8B 1H8TA 3E1F1 3K51A 5ACA2 3I97A 3HOUJ 5C5TA 3N9MA 1NA1B 3BOQA 1W7PB 3JW4A 4B3AA 4AK3A 4EJRA 3WQ1A 2ATFA 4GO1A 2BUKA 3L1PA 1RVF1 4KMUX 1JU3A 3LGRA 2HOSA 3UKGA 2EIMH 2Z5UA 2VBDA 2B0LA 1UQXA 1JHFA 3KGZA 1K79A 4FPFA 4ET7A 4A42A 3PIJA 1BI0A 2MEV3 2ZPXA 3T0BA 2C6SA 2PEXA 2W2IA 4O6JA 1PUFA 4LHSA 1UCRA 1KYWA 1UN1A 3FWEA 1OC1A 1YI7A 2EXIA 5JHUA 4CZCA 3E6MA 1UW8A 4GZ9A 4CEWC 1UCXA 3KV5A 1MEC2 1YJWI 1ENQA 2P3KA 1F8VA 2CQQA 3WQ7A 1AR92 3TB0A 4TZDA 2EVXA 3QOEA 3A7QA 1W6OB 1QHHD 5EHDA 4BYYA 3LSJA 4I99C 1AYN2 2VBBA 4HN1A 2WB1A 5LBBA 1K83J 4CDWA 3ZRGA 1HKDA 4A6DA 1OUXA 3H5AA 3PHMA 5IFPA 3F22A 4Q4W1 2FDJA 4ASNA 4IXLA 2A6HF 3OIPA 3ZQGA 3PUQA 4MX3A 4AVCA 1PIV1 1JI6A 1GOHA 2OJED 2HWVA 1C5IA 4RR3B 1R1VA 4M9ZA 2ZFUA 4GWMA 4XDPA 3IH3A 2VODA 3SLIA 1HDKA 2FUG2 1XU1A 3MZYA 2JE7A 3K4AA 2HKXA 4WM7A 1VQMI 2HQRA 4AXOA 4DFSA 3OGRA 3CCQI 3CMEI 4A0ZA 3OSGA 1IGOA 5APAA 4KIBA 1SPPB 4PBPA 2YUEA 2B7YA 5L3EA 3WE2A 3IV5A 1G9AA 3KVAA 1LFPA 1P7JA 4HMZA 2YPJA 2D2WA 2JJ7A 2BFUS 1R64A 1Q8SA 4FE4A 4GWIA 3J80K 3JXSA 1H9TA 4R52A 2Z42A 4G8XA 4TYSA 2M87A 4XURA 3KLNA 1J09A 3PQKA 5E1RA 3IRRA 5HDNA 1IPJA 3EJKA 2DTYA 2VE1A 1BBT1 4J00A 5DUWA 2UYBA 2FF4A 4M3GA 4DGWB 1S29A 1R1TA 3HEIA 3WG3A 3WDYA 2AC1A 3B5LB 4P5HA 3QYEA 5D5WB 1UKRA 2OZJA 5JMOA 4BB3A 4S2FA 2R4GA 2KKOA 3WNPA 3I8TA 5EGOB 1VAVA 2C0ZA 5DDJ1 2GOMA 1EAH3 1RMU1 2ZX4A 2DMNA 1H8TC 1Z05A 3CLOA 3K0LA 1M06G 4IERA 3ZXKA 3LCPA 4AI8A 5C9AB 4X6RB 5EYXA 3TEDA 3M4OJ 2DUQA 4RGRA 4IEVA 3MV11 2LD5A 2HVRA 3HRMA 4KUMA 2LR8A 3I49A 1CWPA 4CYCA 3U9GA 1NXD1 1ASJ1 2DA1A 4CUCA 3A01B 2X51A 3N97A 2YGLA 1WZ2A 4JRAA 4AUXA 2YB7A 2X1CA 4XPVA 2W48A 3AKQA 3L2CA 3FXUA 4PGGA 4DYQA 3VKNA 1R00A 1W1WE 2HWF1 2ZEZA 2XGDA 1DQ4A 1IO2A 3T5XA 1SQ4A 2OV7A 1QQP1 3Q9OA 1PO22 4YZ2A 3DTIA 4D0QA 3BG9A 3B9CA 1R9TJ 1B4AA 3U11A 3BZ6A 2VZ3A 3AZVA 5A32B 1G3WA 2DTRA 1ZREA 3LFUA 3NQHA 3UR3C 1Z7S2 4M3CB 4A7ZA 4B8EA 2YBKA 2VD7A 2D44A 3LFMA 4IV3C 2B5HA 5HBAA 5EP9A 1RUH1 2FBEA 3E3VA 1LPQA 2QEXI 4NIDA 4CH7A 2KIMA 2KXLA 3V0BB 4BNCA 5FRAA 1PM7A 3OWTA 3W6KB 1MEC1 2YMZA 3H1WA 3KQ4B 1MMGA 1W2OA 1WA6X 2VECA 1GWKA 1XNTA 2RNGA 1VQ6I 2AREA 3VPRA 1FIAA 2P7CB 1UKGA 1BOAA 3S1RJ 3MHZA 3V0AB 3OBZA 1S0BA 2FXAA 1AJKA 2ICWG 2VXDA 4E7KA 5FTTC 2OZUA 4I0AA 2R1BA 2CL2A 2P4WA 5EZHA 3NWSA 4AAPA 2EQRA 1I27A 4XZPA 3FBMA 1OFNA 4CCNA 3CJIC 1VRBA 3OYWB 3Q5FA 1QVUA 2PN5A 5E1WA 1JI8A 5I8YA 1PVXA 1RC9A 5CFCB 5L3BA 2IP2A 1R4MB 1A78A 1BR2A 1AUYA 4URTA 1XMKA 3BN6A 1YLFA 1OPOA 2E1CA 2LNBA 2HYGD 2WS92 3H5NA 4XF1A 2XONA 3M9AA 3MPBA 5D8AB 2WNOA 5ICCA 4GYIA 2ZC2A 2FE3A 5GLWA 3K4LA 5K0UA 2BU9A 3FISA 4KIFA 4WV8A 2DVDA 2M9HA 1YXWA 3S14J 1ZYRF 4ZTJA 4SBVA 3LQQA 1VMHA 4B3NA 2C9KA 4BA6A 1XYPA 3F9KA 3RMYA 1MNEA 3IAQA 4D7SA 1EPZA 2CUEA 2UWBA 4D7YA 5D5UB 3U21A 4FOQA 3R05A 3ULQB 4Q0UA 1TWGJ 1G3YA 3KWVA 1W8OA 4YGBA 4K1ZA 2IS4A 1EH8A 4MHUA 3I0TA 1LAJA 2OX0A 1AYM2 4FBFA 1X1AA 3T30A 4LO5B 2VPLA 2BHZA 4QX5A 3GGLA 1QJY1 3GWZA 1IN6A 1SLTA 4AFDA 5H9PA 1BN5A 2NS8A 1NCQC 1MS8A 4UF0A 3BODA 3WGIA 1Y0UA 2G9GA 2QLZA 4A2UA 1OA4A 2D5HA 4COWA 3RVHA 3FF5A 3OEBA 4UUSA 3OS0A 3CJIB 1D0YA 4DZGA 3DWLE 5C4WA 1OYYA 3VBHC 1RUG3 4E7SA 1IN5A 2C1FA 3DPRC 4I09A 2FZ2A 4IQJA 1T0FA 4ENKA 2WWYA 1LDKB 3ZMZA 2R7UA 2XJRA 2TEPA 4FFHA 2OQGA 1XPWA 2ME0A 1FV2A 2WO2A 3MKWB 3CZUA 2A69F 5CKMA 1Y43B 3BWGA 3O3KA 2AYHA 4YZ4A 2KP6A 2HWC1 2Y31A 3PU8A 2WKKA 1K42A 2RS51 1OF3A 4CEYB 4E2GA 2RJLA 2IW5A 1D1BA 3ZYJB 1EYBA 2OCEA 2XVKA 1J75A 1G59A 2MD0A 4EM0B 4BK4A 5A3PA 3M3YJ 1R1A2 2VMHA 1W6MB 1UX6A 4HDUA 3SCHA 3K4MA 2ZSHB 1QJY2 5JXIA 2E1NA 1I6XA 5LK7B 1RMU2 1AYM1 1O3RA 3O1MA 1Z7UA 4BJTA 2NOGA 1FP1D 4NAMA 1J5YA 3J7YJ 3M8LA 1F5FA 2R041 3J9SA 1VRH3 3HT1A 3BJAA 2RS12 1W0UA 2XLAA 2L0KA 1MBEA 3I55I 2IC1A 1S72I 2AQFA 2VJJA 4IPAA 1RXFA 1ULGA 1EV12 1RUC1 2E63A 2YC4A 2G9FA 1A8MA 2IA1A 2PHRA 1IGNA 5FZ6A 3THPA 1W9SA 4Q8LA 5CKQA 5BUVA 2BZTA 4GCVA 4CPBD 1PVC3 3MZHA 3N36A 3WT3A 5J3LA 2FNAA 2AO9A 1GP6A 1W06A 2XAGA 4B44A 2R063 4AOCA 1SBFA 4QWNA 3POJA 3AP7A 1H89C 3IBMA 2K86A 4PI0A 1REDA 4FQ4A 1CF7A 3MV01 4CDXA 4COVA 5DEQA 2WDBA 1F4HA 2HU9A 4JKMA 2XMLA 1P6RA 5T5OA 1D2SA 3RJ2X 4IUGA 3CESA 3GFMA 1X3WB 3I9V2 5B4NA 2LUWA 4C3JJ 2VOKA 1PJRA 1RUD1 2IRFG 2UXXA 4CA9A 4D3WA 3IMNA 4Q26A 1PIV2 4NQWA 3H0DA 4A0YA 2EINH 3U07A 4CDQA 3BG3A 5GM0A 4Z2WA 1RUG2 3IN9A 3D1NI 4TSVA 1T8IA 2WNVC 1SVLA 3NWTA 1BIBA 5I0TA 1IRZA 2VAUA 3W2WA 3IKTA 1CQTA 4ZDPA 1YQAA 2A1XA 1I6HJ 5K7HA 2VBWA 3CUOA 2V9VA 2BVLA 4Q4V1 2YSRA 2ZMLA 3N9NA 2QQOA 1COV2 2WO7A 2BHYA 1HRI2 4V2VA 1UXZA 3GALA 1OLMA 4JDOA 2BOLA 5KHDA 3RJRA 1ZA7A 4S2DA 3GZEA 5FUNA 1B1BA 2XF7A 1AR72 2EIBA 5AC92 4DW6A 2VBPA 2CWMA 5FYUA 5J1RA 2VASA 1VBA2 1SFKA 2H94A 5BNOA 3VN4A 1Z0XA 4YEJA 2RDQA 1M1EB 3ZYBA 1PZ9A 3MICA 1OR7A 3O6BB 3FMSA 1SACA 4KN4X 2W47A 1TBXA 1HRV2 3L00A 2DI3A 2NM1A 1TQIA 2TBVA 1FOWA 1PO23 2D3SA 1YFYA 4II2A 4Y52J 5L19A 1ZA4A 2ZAHA 4N0BA 4L9BA 1PVC1 2F4IA 3C7HA 1U5TA 2ZXJA 1DQ0A 1YWKA 1ENHA 3PU3A 3T2PA 1RUE2 4M74A 4XLFA 5GAGJ 2F5FA 1VBB1 1MDMA 3BTXA 3MYXA 4ATEA 3FL7A 4WCGA 2R32A 5FDBA 1YYNA 2WRAA 4XIOA 3KHCA 1Y39A 1GBGA 4MHGA 1E5RA 4Y1VA 4TLFA 1OF4A 4NPMA 4ZS3A 1QJX1 1POV3 2DMUA 1ON1A 1O4XA 3K1PA 4GGGA 3JQWA 3SH3A 4KIGA 5M0TA 1YHFA 3CHXA 2HWB3 4MYEA 1J3PA 3SITA 2KJCA 2F6CA 1BW6A 2BJSA 4AIJA 2E7AA 4ZXEA 1V00A 1ZELA 1UOJA 3K7AJ 3NNLA 1GP5A 2BBAA 3VD3A 3HGGA 2JICA 4GJYA 1XTAA 4UNOA 2BRTA 2QBYA 2I5UA 5EDNA 4UI9L 3VODA 2G1MA 2EPFA 2O7OA 1DP7P 4XM3A 2HYKA 3PJQA 2WTEA 1PUFB 5FZMA 4XLEA 2BOIA 3AMNA 2UWMA 3CF6E 1UOGA 4DY5A 4V2GA 3J81Z 2JK3A 3NNJA 2ISYA 5E3LA 4OOIA 3K75B 2BXYA 2CV0A 2EZHA 3Q8EA 1Y8RB 4GQ7A 2R93J 1JYIA 3GHNA 4AWXB 2M30A 3DPLC 4IE0A 3H36A 5JLWA 1ZRCA 1P92A 4GKYA 4FFGA 1COV1 1PHMA 3HHHA 5EYYA 1FI2A 4A6OA 2C9AA 3WDWA 1XQNA 4RS5B 4CDQC 2E7XA 2JDKA 4LB5A 3TEZA 5K9YA 3POEA 3W3CA 1XSRA 1TC3C 1K78A 2RV9A 1WJAA 5D8AA 5IOYA 4AVTA 4XLHA 2NVXJ 5FUIA 4OUSA 2TCTA 3HUGB 2P5BA 4OAYA 3DPTA 3F23A 1HKQA 1K78B 4K2EA 3JRHA 3ZMDA 3T4HB 3KZ4C 3I3EA 4QDRA 4UW4A 1RPWA 3VZKA 2FOKA 1U2WA 1VRH2 4CXWA 4KBZA 4N7UA 3IKWA 4ARYA 3I56I 2RDRA 3PMSA 2O9LA 5C8CB 4E8CA 2YC0A 3VLBB 2R5ZB 4OMYA 1CPMA 1I3HA 1SCSA 3NARA 2X5IC 3JD71 3AXDA 4CICA 1BVVA 2CU5A 4UXAA 4PJJA 5FUPA 4GIQA 4L97A 4I0WB 3VBUC 3W6JB 2H6BA 3IB3A 1I1EA 3BDDA 1OCTC 4QPOA 3AKPA 1ZAOA 2JQ7A 1X4OA 3R6SA 1XSVA 1P4AA 1QZEA 2FCTA 3MW4A 1I9RA 5CVVA 2WNEA 1K5MC 5CIRA 2D40A 2XAHA 4E6KG 1GQGA 5K5RA 2DURA 4Q4Y1 4D7NA 5C33A 1NCRA 1H6YA 4HEA2 2WAEA 2A71A 1RRJA 3ILNA 4BHCA 1A6CA 1X4PA 2UZKA 5LBQA 3SH4A 2V1DA 4IV3A 1YITI 4IHWA 3D0SA 1J59A 4YVSA 2M3AA 1ZYBA 3C2UA 3E5QA 1B9MA 4IHXA 1IPSA 4ASLA 2EA7A 5JR2A 3I58A 3FZVA 4J6GA 1QVTA 4L5EA 2P5VA 3HWJA 5FGMA 5BNOC 4QB6A 2K85A 2QTWB 2DCKA 1ZX5A 2FDKA 4NWVA 1TZOA 4XKVA 2CQ7A 1O3TA 2A05A 3GZUC 2ELKA 3VB9A 3S57A 4JOMA 1R5ID 5T5PA 2L9RA 1HW1A 5F0CA 1W2NA 3FX3A 1F2NA 5IAXA 3RQ4A 4NRPA 4RHV1 2WZR1 1IG0A 3IDCB 1LE8A 3HIFA 3ITQA 1HN0A 1URXA 3CL1A 1DQ1A 2WLQA 3D82A 4II3A 3A4UA 4P9UA 1TWAJ 1NTCA 4B1MA 2QKLB 4QPQA 2E36A 1RUOA 3HPHA 4U0WA 3K2OA 3SKJE 3LWFA 3M3QA 4IEUA 1GZ9A 2EZLA 1BI1A 3NNGA 1HB1A 1TTYA 2R30A 4YGEA 1B8IB 4GALA 4QB2A 4ITVA 4GWNA 4LG0A 5FLJA 2WFPA 2MFZA 3MIGA 4O9EA 5HLTA 1AR93 1CAVA 1SZBA 1XE0A 3C3VA 3KP4A 4IGOA 1D1CA 5IAVA 2F6BA 2DV9A 2YYOA 1KZHA 2P3IA 3BQZA 4AVVA 4WM8A 3OY9A 4DQAA 3VBUA 2D6KA 1W9YA 3ZO0B 2W92A 2XLGA 1SFOJ 5FLXZ 1JKOC 1T0FC 3EYYA 2IWGB 3L2UA 1N3PA 2KJBA 3IAM2 5B4XA 2GMMA 2QDRA 1H1AA 3PVEA 3LZZA 1V55H 3S3OA 2X0LA 2DMPA 5GALA 4CCJA 2PBIA 1PGW2 4LBQD 3KLOA 3EPZA 5HLGA 2NNYA 3ZSKA 1EAH2 3RWNA 2DWRA 2VOWA 1PX4A 3JRAA 2IUWA 3DKQA 3A02A 1IHMA 3FXOA 2EILH 3TOBA 1POQA 4ZZLA 2JMWA 5F39A 4LXLA 4EMSA 4WBBA 1U3EM 5ACA3 1FBSA 3WF1A 4LJHA 1SAUA 5CNAA 2I2SA 5ERIA 2OZ6A 4YNIA 1OLME 2LY2A 1UZ0A 3A0BC 2P4EA 3PM1A 4NJ4A 3TO9A 1WH7A 1UY1A 3WE3A 1GWLA 1QJX2 2RMU2 2X8KA 2H0VA 3Q0WA 2GA1A 1UELB 1UMHA 4D7MA 1RUF3 1IXSB 5FYSA 3WW3A 2GXGA 2VOVA 4WVZA 2PQ8A 1HKSA 2YXSA 4O61A 4QPWA 2GWRA 3B94A 3PUIA 4A45A 1ZM1A 2BP6A 4HG2A 1N1SA 2XJSA 2ZA9A 4UWDA 3GM8A 5FZ1A 4BJ5C 2DJIA 3SCGA 2J1UA 3PUFA 4DYCA 1ZTRA 3OUJA 4XUNA 5E20A 1ULDA 2W0XA 5T50A 2R49A 5J40A 4BKXA 3S30A 1CZVA 5HXVA 3POYA 1DU6A 1OLTA 4MVTA 3WNXA 3RYPA 5CA6A 4AWDA 1V5FA 3HRUA 2RN7A 3UV9A 4KWJA 1OOPA 3EDPA 4L9NA 3HNMA 4BQ5A 3ZKYA 3RQ0A 3HKZA 4QTRA 1X1DA 5TGTA 2DU1A 3KEOA 3LSHA 1DQ2A 3PUSA 2QQJA 4FPOB 3W59A 2XJVA 2E5ZA 4Y13A 3VB2A 2DT6A 3LQRA 4XYXA 4BHBA 2LFBA 3LA2A 2XB0X 1NOVA 2CDOA 1C8M3 1LU2A 4QXKA 3SDBA 2QQMA 4AEMA 4BPZA 5FZBA 4PZJA 5J1YA 1WLTA 2BGOA 5CPRB 1J1LA 3QACA 3DF0A 2QWWA 3DPUA 2VGDA 3A01A 2DYSH 1WCDJ 3VDDC 4BIOA 1I3QJ 2Z4FA 3LB9A 3JRIA 4CDWC 1K61A 4KITB 2DBIA 3RGBA 3BUCA 3EHKA 4HFSA 5C8CC 1NQDA 5JHFA 2F4PA 1VLNA 1RKWA 2Q1FA 3AB0A 4MEXF 2I10A 1ND2A 2GN7A 3T8TA 4IHSA 2GOXB 1NG7A 4XFHA 1J1TA 3LEIA 1HCRA 4Q47A 4BQNA 2DF7A 1YX3A 2VT2A 4QPGC 4XJAA 1DPUA 3CCEI 3I2FA 4O9GA 1HLCA 3E1SA 4PFOA 2PYTA 3X29B 3Q3SA 1AXKA 2DFFA 2YY1A 4V2WA 1ETWA 3CJQB 1DIWA 3FZ3A 5B5EC 3LSKA 1Y7BA 2R7XA 1RUD3 2B42B 2OUJA 5ILSA 4CSWA 1MBHA 2HZTA 3MUZ1 2JDPA 1JTXA 4QX3A 1FLIA 1OKQA 5EZWA 4NIIA 2Y6LA 3DYOA 3GLXA 2D6LX 1S0EA 4FVVA 1MJBA 1QHDA 4Q29A 3QP5A 1ND3B 2JEMA 2WNUB 2FBHA 4MQ9F 4DUVA 3NWKA 1GV2A 1V6OA 2KHMA 4NMIA 2ZZQA 4XRFA 4OI4A 1W2AX 1W99A 3ZDVA 1YFXA 3AG3H 5DMYA 2EZKA 3A22A 4Y15A 2P6SA 4LLOA 1G8WA 1NCRB 5FZDA 1Z78A 1NYWA 2VPVA 3W20A 2JDUA 3AP6A 4FFFA 4AQ6A 4HPQA 5D5VB 4A3EJ 2OPWA 2V7FA 3WOGA 1NHAA 1ZR4A 5FYHA 2P3JA 1MQTB 3VEPA 4S05A 3K48A 2GIVA 2IFWA 2QUOA 1BA5A 2XAQA 3V65A 3J7LA 4P1WA 2RS52 2PHLA 4C2MJ 3WW4A 4JGZC 1PNFA 3OYLA 2NYYA 3H9AA 1U9NA 4ITCA 2WN3A 4XIKA 5IT9K 4U36A 1X3ZB 5T5LA 1GKBA 4HK8A 1XCVA 4AGRA 4IEQA 5EJ3A 1YS6A 2YBPA 4ZZDA 4QB1A 2FMYA 2PI0A 3V8KA 4F91B 1LE8B 2J1SA 4XFAA 3T2OA 2JXAA 3JBG1 2VO5A 1TEIA 2WR9A 4CDGA 2WAFA 1VBE2 1OXCA 5BYNA 2RQPA 1VBC3 3PFIA 2UXNA 3QYFA 3UGGA 3WQBA 2WFF1 4CUAA 3SEQA 1SBEA 3C7FA 5FLMJ 2K9LA 1WGXA 1LHNA 4MGTA 2XHNA 3GBFA 3LAJA 3IL2A 1HSJA 4AI0A 3C1DA 3ZMUA 3SXYA 2PXJA 1R082 4TN7A 3K4DA 1S7OA 1LGCA 3A0KA 5H2FC 4XJZA 2BW3A 4CYCB 4ETSA 1RUC3 2JRMA 2Y6HA 2VMCA 2M7BA 3JTHA 2Y0MA 4YWAA 2KQRA 2CV2A 2WO1A 2R7VA 5F2WA 1GVDA 2O3FA 3RIRA 4LT5A 4MGRA 3WX5A 1X8EA 2H8WA 3FHZA 2LBFB 4CP1A 1GZCA 2P5LC 3R60A 3BJ6A 4DXSA 2LK2A 3T4VA 2VPRA 5GZDA 1V6NA 4M6XA 3BP8A 2CQXA 3JBG3 1CPNA 2XSJC 1K4SA 3MFAA 2ADEA 5IYYA 2QBYB 1V6MA 3ZN5A 2C24A 3VKFC 1FSHA 5DD4A 2GMPA 2D98A 2AHQA 4QD2A 4XHBA 4JK1X 5LASA 4BEHA 4N53A 4A3BJ 3U4XA 5LEKA 4A44A 2DDBA 2B45X 2M0MA 4KU7A 3PO3J 5JVVA 5J3UA 1OYIA 1JXSA 4B1LA 3TEXA 2VN2A 2GBYA 4DIQA 4OIRF 1RJ8A 2VLAA 3V0BA 2VUCA 3EB7A 5FP7A 2CAUA 1ENXA 5FPUA 1U5YA 1KU2A 1YRNA 2GNMA 2MEV2 4UVCA 1WCSA 1YEWA 3WF3A 4HSTA 2O6GE 5AIQA 2VVFA 5FZIA 3FXMA 4LBOA 2ZGMA 4NC7A 3RNSA 4XRMA 3DKXA 1QXRA 3GTMJ 4GJZA 1CD3G 4HLTA 1SHWB 5GZFA 3NNMA 5E8GA 1P8JA 4FASD 2XLFA 3S2WA 1W3XA 3RSNA 1FY7A 1XSXA 2VMFA 4CUBA 2P6TA 2FMLA 2AXTC 3PUHA 2VJ5A 2L3DA 3JSPA 4MFDA 5ANQA 4QGNA 3HN3A 1O57A 4D94A 3IDAA 2VXJA 3LEKA 1PZ7A 3F8NA 3PDQA 2HWE2 3WW1A 1JN2P 3VBOB 3O1PA 4LO7A 1S7EA 1SVOA 2EALA 1FEXA 3NO8A 2VKHA 5ICFA 1WLDA 4UFIA 3ZYHA 2B46X 1GR3A 1RXGA 3AL0B 1OYWA 2NQYA 3WU1B 2Y34A 4JQTA 4HW0A 2JSPA 2VVDA 3L9FA 2W68A 1RUI1 3O0XA 2CSGA 3OYKA 1BI3A 3OIOA 4RAYA 1DYOA 1MS4A 4UVBA 4TWTA 1D0XA 5H20A 4X0GA 4XDQA 2YBSA 2PHWA 2IXJA 1ZRFA 1CAXA 5FYIA 2JECA 2BV6A 1XYNA 3KB5A 2RQQA 5T55A 4ZYGA 1A5JA 2HWB2 2J7MA 4PHZA 4Y4YA 1CZTA 2ZJPF 5FZ7A 1ZVFA 4BGDA 4KU8A 1OA2A 3BCWA 4OHVA 2VT3A 3OPWA 4RB1A 2VZOA 3J7AY 2RR12 4QPGB 4S2GA 2CS3A 2XPVA 2X48A 3HBLA 2WL1A 1LGNA 2GC2A 2K46A 5L7OB 1TME3 2VNGA 4RBOA 5FYYA 2PFBA 1XB9A 3USSA 1AYM3 4D9JA 5BNPC 3URFA 4XFIA 1QHGA 2R061 1TP4A 2OPTA 4P00B 1RC6A 4ZU4A 5FPVA 1BXHA 3GLLA 4FPGA 1FSEA 4Q4V2 4XUPA 1ZBE3 3GTKJ 3VZOA 4BHPA 4IHVA 5A7NA 2WAQA 3CDLA 3CUQB 3P5BA 2OBPA 4K6BA 4QM9A 4RA2A 3BQYA 3ZSLA 3ZPYA 3HG9A 1V3FA 4O5VA 2R042 4FPYA 4AF9A 3HC7A 5K7FA 2J1TA 1XGMA 4Q48A 2JE8A 4BQ4A 3ZQCA 3RYKA 5FQ0B 5IVBA 2QGUA 3HL2A 1GZWA 5FZ8A 1LEAA 4GAZA 2CFXA 2HDWA 2FCVA 4YFZA 4KMFA 2AXLA 4QM8A 3UYJA 2ZNZA 3ZFEC 3T2TA 5GADJ 3I3BA 2MW8A 4UV9A 1IC8A 3I3QA 4CXYA 4FCAA 1CX1A 1CN1A 2VW2A 4XL9A 4LKEA 1D4M1 4AQ2A 2XQXA 3PSFA 2W3JA 4RQPC 3M8JA 1GUUA 3UGFA 3ZN6B 2ZAAA 2ZCWA 3PQJA 5KR7A 1LNWA 1C28A 4BZ4A 1UHWA 4AIKA 2IXCA 1T39A 3ABZA 2WAQN 3F6OA 3ZXSA 4CU8A 4QXHA 3DTEA 1DYKA 3I71A 1HQLA 3DEMA 4Q4Y2 1OI6A 2R7EB 1I3AA 3CCRI 4I2OA 4BQXA 3VYTB 2PG4A 1W6MA 1JMUB 5CBLA 3TOAA 1H9PA 3DEWA 2HXIA 3H1MA 1WFXA 3KT4A 1D5YA 1YJ9I 4EQVA 1T95A 4YG2F 2HYFA 4N43B 4AFBA 4LMFA 3ZYRA 1APLC 2MG4A 4Y1UA 3DPRA 3HXLA 1VF9A 1WMEA 1BEV3 2KIFA 3Q0VA 1JZ5A 2RREA 1AJOA 4JKKA 4R9CA 3ABUA 2DYCA 1ZH5A 3BT9A 4JRLA 2E1MB 5BPIA 5HV0A 2RDNA 1BI2A 3UETA 2HOEA 4PDWB 1QY4A 2ARBA 2QNKA 1LKNA 4E7HA 1QJU3 2RVAA 4K8RB 3ZDSA 1VPHA 4FQZA 3C7JA 5FAXA 1FNZA 4CCDA 4IRIA 1O4ZA 3CQOA 5LGTA 5JSPA 2DTZA 2GNTA 1Z0HA 5FIXA 4OU0A 5D1IA 3AMQA 2EXJA 3HAGA 5FY8A 4JP0A 1C3HA 4QX8A 4RR3A 1U0JA 1R1ZA 5L9BA 3HJRA 2F4LA 4NWWA 1XCBA 3E97A 2PLV2 4LLFA 3RKXA 2CUFA 4A93J 1ETQA 3OSDA 5ANNA 2QSGX 2NVTJ 4L0YB 5FY7A 2OA2A 2LW8A 1O8SA 3MKYB 4DYRA 3AJZA 3VBHA 3VBRA 1RMU3 2DFIA 2A73B 5F0HA 2VONA 4QPIB 2WSUA 2WWJA 3OUHA 5DUXA 1HRV1 2MLKA 4JX0A 3GXUA 1NK2P 3ACIA 2RM22 3TKYA 4E7LA 3MVPA 1ZK8A 1SLBA 2GU9A 1WMDA 2NNNA 1MS9A 3N7JA 5FY1A 4M3CA 3K1MA 2H0BA 3E6CC 2ZKZA 3ALQA 2ZJQF 2VNOA 1OH4A 3WXPA 4QXBA 4V2FA 1JTZX 4QPYA 3CLQA 4YW4A 5F5IA 5LA9A 2R0HA 2UWAA 4L9TA 2UV1A 4IGPA 1CESA 1L7RA 5GJ6A 4YIIA 1F5TA 4LB6B 4BXSV 2XB5A 5FY5A 1TMF3 3ES4A 2DOAA 5D5XB 1HXS1 1NZIA 3I4IA 3MCZA 4OHXA 3G71I 2ZGQA 3QLQA 3DV8A 1RNLA 3SH5A 3S17J 2LMDA 1MS0A 3UKTA 5E3NA 1J83A 2IBDA 3LF7A 2OW4A 4BY1J 2CHHA 5LB6A 1QQP3 2V5DA 1D0ZA 1XE8A 4KGGA 3O0VA 2ELHA 2DQLA 1TMF2 3V7RA 2F5VA 5CFCA 2XVCA 2VTXJ 4RS5C 1H4HA 2STWA 5FP8A 1Q5OA 1EV7A 5FZGA 4KH9A 2Q1MA 2FBIA 4C30A 2LOOA 4WVWA 4I01A 5AVAA 3T09A 3AYDA 3ZXFA 2HVSA 3AYAA 4UF0B 2ZABA 3WUCA 4ESFA 1UX7A 1DZTA 1O59A 3ECOA 3TEYA 5LRSA 2QENA 5DM6F 2GM4A 1U5IA 1ZRDA 1EV13 1V70A 2LSOA 2EV0A 3WVJA 2ZBKA 4UUVA 1HQWA 4XHXA 4EJUA 2EZIA 4QU1A 1I5ZA 1SC7A 3DECA 1O4YA 1CJDA 3JSOA 2SBAA 1QZZA 3OL4A 2XKPA 4ZY9A 3OGVA 3W5NA 1FBUA 4W1UA 2KIQA 4XRSG 3J7NA 2WV1A 1H8AC 3U4SA 2A68F 1QH7A 4MGQA 3BTAA 3RS6A 3CBNA 3OS2A 2V1NA 5G05L 3HOYJ 3AP5A 3BLYA 3CCLI 3PFYA 1PX3A 1JT0A 3TNQA 4QKDA 4UFMA 5J4YA 3BOWA 3W6VA 4MUVA 5HS9A 2LALA 1BM9A 3I2DA 1E5HA 4GXLA 1SG3A 4M3CF 1KQ9A 2BY0A 4LFUA 2ZMEC 4RSUA 2E60A 4FPHA 4MXWA 2YU3A 3FXLA 5C3EJ 1RUH2 1R1UA 1NLQA 3ORJA 4H14A 4RB0A 3D0JA 1Y6IA 2LLKA 2JJ6A 3ZPLA 2A5ZA 4A3XA 3AK0A 3VYSB 1W04A 2DA7A 4LLLA 5CFDB 1RYYA 1GWMA 3OYEA 3GTJJ 2HEVF 4XF9A 4XLAA 2KFDA 2OU2A 4A69C 1AF9A 1UZVA 3N4MA 1MBJA 4A41A 2HYJA 1R71A 2P1BA 3ZVXA 1RUD2 3U2RA 3NV1A 4M72A 2KA3A 4DXTA 2Z16A 4LO4B 1ACCA 3B73A 2KRHA 1KYZA 5DS9A 1H2NA 2IGNA 5T5JA 1SPPA 3WEZA 3PNTA 2WZR2 3S3MA 2J5PA 4HT1T 5FY9A 2XGEA 4Y5TA 3U75A 1QNYA 3LIHA 3LWCA 4BQ3A 2FCUA 3PIGA 3MEXA 4FPCA 3ASIA 3R4KA 5E89A 1C8M1 4MTEA 2X29A 4LHNA 4ZC3A 2P37A 5DCFA 3KT1A 4A3CJ 1YQ2A 3F6VA 3GO5A 3WP6A 1J3QA 1Q43A 3JB8A 1GUIA 1D0HA 2J1RA 2XKOA 1QOSA 4CDUA 2RS11 4LBNA 2GIZA 3SDGA 4XILA 4Q4W2 3AMMA 4ZXKA 1USSA 1JZ7A 1UOFA 5EXOA 2O0YA 3B6CA 1QNWA 4OVEA 4D0PA 3GTOJ 1HV1A 3E0JB 1K5JA 3ZIXA 2P6HA 4E7ZA 3O12A 2ZZJA 4U88A 1NLRA 4RLQA 3B9IA 1AXZA 4R4ZA 4Y1YA 3PVBB 1DLCA 2CAVA 4IL7A 3MF9A 4CXXA 2K3FA 1QJU2 2IA2A 2VIXA 5M3MJ 2D97A 2IGMA 4IV3B 3SEEA 4XW3A 1PO13 3JRBA 1F4AA 1IN4A 2HJIA 4NOTA 4E4DX 5JDBA 1BKZA 1PDNC 3WZ1A 5KNLA 1NKGA 2RR13 4CVUA 1RUI3 1N78A 2XAFA 3JUUA 1BIAA 1VAKA 1OCCH 1KRIA 2KRFA 2QA4I 4QPGA 2M45A 4BK5A 4OMCA 1V9U3 3K4JA 4BLIA 5C5UA 3RYRA 4UV8A 1EUUA 2A3YA 3E5XA 2GQQA 2VULA 4YW7A 1YG2A 2P81A 4KN7X 1FOD3 1CJPA 5DZEA 4ENJA 3PTRB 2XJUA 1MH3A 1HW5A 1CAXB 5DDGA 1Q8OA 3UGHA 1AA7A 4S04A 2FOWA 2ZMEA 1UZWA 1MMSA 3EXUA 1JHJA 4BMBA 2R071 1DZRA 4GH4B 5FRMA 4GFBA 5DUVA 4G9YA 3M1CA 1FATA 3HZJA 4ESBA 4W4ZA 4A3DJ 2XXZA 2LYCA 2RS31 3ESWB 1FYLA 4JQRA 3FXKA 4YPJA 3NVCA 4XQ4A 5JIAA 2HQNA 1W4MA 1X36A 3LAPA 5E88A 3MGUA 3M1EA 1FV3A 2XJTA 1WI3A 1YIPA 4MQVA 5FZOB 1UYXA 3PURA 4PUSA 3JCIA 4RHV3 2RAEA 2WQ8A 4ZDLA 4FAGA 5FFOC 2W1QA 3WDUA 2LY1A 1XU2A 1WD3A 4C9YA 2XUMA 5BQTA 3LDKA 4QX0A 2VB6A 5C7GA 1U78A 5IVJA 1ZG3A 3VBOA 1QMJA 1GP4A 2VG9A 1B9NA 4LKFA 1T33A 1SEFA 5IT6A 1WVRA 2E7TA 4E7IA 1NA1C 1SFEA 3USUA 2BW3B 1RVF2 4PIZA 2XRLA 1LOEA 3U1XA 3HJEA 4DUWA 5GAHJ 3VD7A 1CAUB 1JT6A 1HC8A 2QQ9A 3WGGA 1QXJA 3CCVI 1YS7A 5FRNA 1MNMC 4AM3A 3AFGA 2MC4A 2DVFA 2IAIA 2FU4A 1QDOA 3HMYA 1VBB2 2XGXA 6PAXA 3O1SA 1GXPA 5F3EA 2VZRA 2BYVE 4GH4C 3ZFGB 2MH2A 1NXMA 3EUHC 2WZR3 2QUFA 4LG0B 4QKFA 4Z1VA 4PJLA 4XLCA 2ET1A 2Y6GA 2Y6KA 2PMWB 4XSXF 1HLVA 3TGNA 2WZPP 3HQUA 3M70A 1LVKA 4FOVA 2F5EA 1DGWA 1Y3TA 4I0BA 3LSPA 5C3SA 4RGSA 2VMDA 5M5XJ 1K7AA 1FTZA 5FREA 3G1OA 1PK6C 2JA5J 1F43A 4HV5A 5KXEA 4I02A 1Z7LA 1TNSA 3LNQA 1TNFA 4PF5A 4YVWB 1AL23 1SFYA 3FJSA 1AZDA 1OH3A 2VL4A 5JI9A 5FFXA 4C2UA 4KGQA 4LIUA 2K9SA 2KD7A 2R1DA 2HWE3 3BTCA 4P08A 1POV1 1X9PA 1B09A 3VBSA 4B7EA 2RM21 1ONVA 5LLQA 2ZGUA 4BQAA 4IDZA 2Z79A 5BV6A 2OTJI 1NQJA 5DUIA 3IUOA 1MIJA 2ES3A 2DJNA 3GZ5A 4HOOA 4COUA 2VQHA 1L7LA 5F2SA 3AFKA 3HKZN 3ZSMA 3KHBA 3H3UA 4K8FA 3ETPA 4G6TB 5JXJA 3VBRB 3T0AA 4R8HA 5CU1A 5FYBA 4XOGA 5FZCA 1UYYA 3DBLB 4EVIA 3WNKA 5LHHA 3SISA 1AKHB 2NXNB 5J4VA 1DGWY 1ON2A 1BEV1 5DN2A 3CO6C 5LHGA 2B9UA 4ZKTB 3HOTA 4XMIA 5CYVA 4MNUA 5HCBA 2QZ2A 2Z99A 4IEZA 5CQGA 3CU7A 2R5ZA 2YGMA 5FJKA 4Y20A 1UY0A 1IJWC 3I3LA 4B4QA 3OYAA 2J1VA 2RDSA 1OOPC 3BB6A 1ZR2A 4MOAA 2NVQJ 3QPTA 1J58A 3TNPB 4QHOA 1T38A 1A36A 3ZSJA 1JTYA 1D8JA 5IATA 2Q8KA 1OD5A 2IA0A 4FFIA 1HB4A 4L18B 3VUOA 2VI6A 2M34A 2WNUA 2DDAA 1VNDA 5J98B 2VXRA 3R61A 3WSOA 4AI9A 4UW5A 1QA6A 5A3TA 4IEYA 3KETA 1MZ5A 4LTAA 1GU3A 1KXGA 3A4CA 5FQ0A 2NOJB 5CEHA 2HR3A 4C91A 5F6KA 4C1XA 2P8TA 4ESJA 3G2BA 1K4TA 4OQ9A 3BTYA 4XIDA 4P5YA 3CJXA 3PNVA 3U37A 3KP7A 4CP9B 4DQ2A 3OYGA 4B7KA 4RGGA 1UMQA 3VDBA 1OQDA 4GB32 4HNUA 5A1FA 1OUSA 2L9NA 4LQRA 1BQPA 4HF0A 4FTBA 3DYMA 1YJKA 5D6FA 3CO2A 5JZGB 1DP3A 2WN2A 2F4OB 1IN8A 1KQ0A 4PQ9A 3BR2A 3K4ZA 5IP7J 4TXWA 4R9AA 3ZP5A 2CUZA 2AZ5A 4F3JA 4Z8BA 4HQMA 2GNBA 3LE0A 3J26N 4M71A 4FTEA 4M3CE 5GLVA 4BQYA 2W9XA 2PMZN 2A3XA 2Q30A 1JZ4A 5C8WA 4XN3A 4INDA 1BHGA 5FMCA 5L3GA 2Y9ZA 3M4FA 3FM5A 4ZU5A 4SLIA 2PLV3 3UNGC 3HT2A 4LO6B 5IK5A 5J7MA 5GTHC 4KFCA 2JG9C 3INAA 5GKAC 4OFGA 2IEKA 3ZQFA 4BIFA 1WJDA 4ZU7A 3CC2I 1E0EA 3C7EA 1STMA 1SD7A 3F8MA 3RPQA 5C3OA 1CAVB 2ZHMA 2E9QA 3ZQIA 1W36C 3FMGA 1K6YA 1K12A 3JRDA 4MGIE 3JR9A 1LOFA 3V7SA 3ROUA 4YVSB 5F6FA 5TSWA 3FXJA 1A3KA 5IYBJ 4COZA 1UYPA 4EZ4A 1EKEA 4JX6A 4PLNA 4IL6C 5F3CA 3G6JB 3DL3A 3RSJA 5EGOA 2K3PA 2GA2A 2O8KA 5SV8A 5J1XA 1GZWB 3WP5A 1V5GA 4HSLA 1UMZA 4CPBA 1WJBA 4IO9F 2YUSA 2M2EA 2JSCA 5J8FA 2DCZA 1VQKI 4N8MA 2Y69H 5IVEA 5IVVA 2R7TA 1ENRA 4JAAA 4WXCA 5C3QA 2VMGA 2CSOA 5B1BH 1W8HA 2P7VB 2DBBA 3JD73 4KG8A 4YW5A 1MMAA 4A3LJ 3L2RA 3HDDA 3AL5A 1XGSA 2LDUA 4HX4A 1VE0A 3CF5F 4Y4RA 1Z6TA 4XETA 4FO9A 5CVRA 4CDXB 5DAQA 4BACA 5LY1A 3ON7A 1KITA 4X8PA 5JFRA 1F35A 1ALYA 1IRFA 3A2KA 3WP4A 1HXS3 3BIWE 3G1LA 4BXUA 2PMHA 4N43C 1MKMA 1S0GA 3WGHA 3L2QA 1IXCA 2BGCA 3LKJA 4QSHA 1PUEE 4FE7A 3MMYB 3HUGA 1JE8A 3CP2A 5D4RA 2Q8DA 3WTYC 1MZ6A 4XQDA 5T54A 3CLPA 1MS3A 4FPLA 5L3CA 1V9U2 2WAAA 3NAPA 2D3RA 1YW9A 1WW5A 3DUIA