1O3RA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
total genus 64
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3rA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3rA01
4M9XA 1EV7A 4UV8A 4RGXA 3RIRA 3VOEA 2VBWA 1D3YA 1HKSA 5IT3A 2PJPA 3RYRA 1RUOA 2A6HF 5HLGA 1FYLA 1DGWA 1H9GA 1O3QA 2VECA 1UHMA 3OV8A 1Q5OA 3WTYC 3UKTA 4FAHA 4N0BA 3HRSA 1FC3A 2KKOA 4MEXF 4AIJA 3LAGA 4CHUA 2YU3A 5E8GA 2IT0A 1TQ5A 1O3RA 1JGSA 2OA4A 4ZU7A 2EV6A 2OAZA 4HX7A 4I3PA 4PIZA 5AONA 1G6NA 1T2KA 5JR7B 4HF0A 2F5EA 4HLTA 2WTEA 5CLSA 2X4HA 4G9YA 4M6YA 4OIQF 1ZG1A 4WVZA 1UIJA 3E6DA 2EFOA 2JPCA 1SMTA 1STZA 3ACLA 2D1VA 1ZHFA 4XFFA 5EZWA 2CSOA 2RVCA 3SCFA 4KN7X 2ZBKA 1DZTA 2FBKA 4EJWA 1LEAA 2HYGD 4ENJA 5K5OA 2LF7A 4S04A 3F23A 3QU3A 1YLLA 2M8EA 2CO5A 4L5IA 4WZCA 3S2WA 3FZ3A 1L0OC 2IW5A 2JZYA 5TJJA 2D2WA 4RAYA 4YFNF 4IHSA 4IEUA 5I8YA 4EWEA 5JCTA 1B1BA 2GU9A 1BC8C 2HOEA 3KETA 3FM3A 1ZLJA 2MHFA 2QZ8A 1XGSA 2O3FA 5TRDA 5C6CA 4UVAA 2E1NA 1DPRA 2RNJA 4MTDA 1OFNA 4WCGA 3EHKA 3GX4X 3ELKA 3FXQA 1Q43A 4EWAA 5BMZA 2ZJ2A 1Z1DA 4KWJA 1CAWA 1R7JA 4U0WA 1RIOH 1CAWB 1W7PD 3EYIA 2Q1ZB 4A2UA 4PJYA 3IL2A 4KIFA 1WGPA 2E1CA 4XFGA 5K5QA 3UKNA 3P9KA 4ZYGA 1B9NA 3H3ZA 2GAUA 2MH9A 1XRUA 1TBXA 4FT8A 1XB4A 1CAVA 2Q0AA 2J5OA 5BPDA 4YNIA 4O9EA 1K6OA 2FRHA 2V1XA 2GQQA 2LF8A 1P4AA 1WI9A 3IRQA 1WWXA 3F6OA 4EQQA 3B02A 1ZAOA 5L3BA 2P5VA 3L7WA 1FXZA 4MH0E 2LDUA 5KVRA 1IPJA 5EFUA 1CF7A 4BXUA 2ZKZA 2UY8A 5JSRA 1W5SA 4L5JA 4ETSA 5CVRA 3FMQA 1UCXA 4I7HA 4ZYDA 1Q1HA 2XV4S 2PQQA 5BY5A 2DW4A 5HDKA 1IRGA 1ZREA 1RZ4A 2F5FA 1XSVA 5BS6A 4YFKF 3I54A 4KNYA 4JK1X 5JVTA 4RB2C 4UHTA 3G73A 3LOIA 5L3GA 4IF4A 3KGZA 2BNOA 1Z6TA 1WRJA 2UXXA 4BAYA 5CVUA 2HEOA 3DPLC 4D7TA 1MD0A 2Z69A 2M1BA 5E18F 2CYYA 4R52A 2Z99A 3D5LA 5FO5A 1WSUA 2DQRA 4U88A 3RYPA 3V8KA 2H6CA 1FP2A 2VC1A 2H0VA 1L3JA 4Q4ZF 3DL3A 2KRFA 4M73A 3KFWX 1P4WA 3RKYA 1PP8F 3T8RA 2ATFA 3QP5A 4FAGA 3NW4A 4UXNA 1Y0UA 1V4RA 4KL1A 4D7SA 3IC7A 1K78A 2GC2A 1E17A 1Z05A 3H9AA 5FDBA 5FLXZ 2TDXA 3OF1A 2YPRA 4JTOA 4PIXA 4KU7A 4LA2A 4UNOA 3GF2A 3EO6A 2J5PA 3VFZA 4YARA 5HS7A 2QYOA 5H6RA 4KMFA 4HV6A 1IW7F 3FE5A 2XVCA 1RTVA 2QQ9A 4DNCA 3SZPA 2V09A 4LB5A 4ON0A 4P9UA 3F3XA 5HDNA 3O3KA 2O03A 3GWZA 4L0YB 1TQMA 4L9NA 5D5XB 3SCHA 5J48A 2IXIA 1KYZA 2WWYA 4A12A 3F8FA 4Y13A 1CGPA 3V8JA 3K1PA 5HOOA 3H92A 3R0AA 3R6SA 3EBRA 4AD9A 5CVVA 2FMYA 2IVMA 3SXWA 3LQQA 4QMAA 1B6AA 4WK8F 1IN4A 5H6QA 4HSJA 4WWCA 4TLFA 2PI0A 5LGTA 2XHKA 2Z33A 3TGNA 4P96A 3KP2A 2NS0A 1X8EA 4ZYHA 2KIUA 5LHGA 1BI1A 4QGMA 2KJCA 2D5HA 2ESHA 3V7CA 2A69F 5LGNA 2F4PA 4EMSA 1R22A 5DEQA 1OPCA 3KSCA 4M6XA 1QWRA 1S8NA 4WX9A 1ZGJA 3DF8A 4AXOA 3SHFA 1XN7A 1T38A 5LLQA 2QQBA 4RB1A 3JZVA 1KU7A 4IXAA 4RAZA 4MGKE 1KGSA 5FPXA 2Y0OA 2H6BA 2EWNA 4MGRA 3D0SA 1QXRA 1YFUA 3BJ6A 2D93A 4LUMA 3E5XA 2OYZA 4ZZDA 4IESA 3SXYA 4IEOA 2HJIA 3EJKA 3GFIA 5ERIA 2IRFG 2W84A 3BU7A 3WTUC 3LWCA 4OINF 1BC7C 4LLOA 2EA4A 2DQLA 5LHHA 2ZMEA 4XLNF 2NNYA 5ILSA 4Q48A 1Z91A 5I0SA 4IEZA 3MDPA 5LGUA 2P8TA 2A6EF 1BN5A 2EB7A 3T5XA 3RPUA 2EFWA 4EVIA 2G9WA 1SMYF 3GEZA 4OOIA 3PQKA 1AWCA 2VC0A 2FEZA 2QBYA 2MD5A 2OA2A 4Q0QA 3KLNA 5DV5A 5DUKA 3IKVA 1W7PA 4BH9A 3UKVA 4CYDA 5K1YA 4E2QA 4G94A 2EA2A 1R1TA 4Y17A 4M9SA 1UPIA 5JAXA 4HLXA 4X6RB 4HQMA 1FYMA 1I5ZA 4G7ZF 3I7DA 3HT2A 2K9ZA 4ASNA 3HSFA 3LA7A 1IPKA 1KYWA 4Q5SF 1YYVA 3GFJA 5ICFA 2ETEA 1OKRA 3TO9A 3JSPA 3BCWA 3CLOA 5E20A 3S7EA 1SD6A 3M9AA 5F64A 5FGMA 1XGMA 1F5TA 3DKWA 1JUHA 1ZRDA 1TQIA 5D5UB 3K9TA 5F6FA 3KMHA 3MWMA 4LUKA 2PFWA 3MQ0A 4M9ZA 2QCSB 1DPUA 2UYAA 5DD4A 3NSTA 2XGXA 4HZFA 2XAQA 1SFEA 3SHRA 3LZZA 3ZDSA 4M74A 2QQAA 1FWZA 2HS5A 3BWGA 3C1DA 3TO6A 1ZRCA 1W5TA 3TQNA 2EFPA 3GYDA 2ISYA 3BJAA 4FX4A 3QAHA 1G3TA 1EH7A 1FBQA 2K0GA 4ENKA 2VBYA 2A5YB 3SQNA 2ZKLA 5LHIA 1LJ9A 4RB3C 2FNPA 4WF2A 5LRRA 1HKTA 3KCCA 3C3WA 3K2ZA 3PNAA 4I2OA 3WTTC 4RGSA 5KHIA 5LEKA 2WV0A 2P7CB 1UFMA 2UXNA 4GGGA 2VE9A 1XGOA 5BPIA 1R23A 3ZP5A 5D1IA 1U78A 1FSEA 1R58A 4A6DA 3U0ZA 4XFCA 2ZMEB 5E1WA 3KP3A 1ZRFA 3WW3A 5I8TA 1UB9A 1U2WA 5FCCA 2Q0OA 3CO2A 2LSOA 2KIFA 1YO5C 3E6BA 1KA8A 4HQEA 2L02A 3RKXA 5KK1A 2D40A 4EM0B 3C3VA 2IC1A 5J8CA 4ESJA 2VBXA 1PM7A 3FFQA 5FLIA 3NQOA 3NL1A 3NVCA 5BV6A 2VN2A 2QLZA 2Z9OA 3HOSA 1O4TA 3BP8A 6PAXA 2Q4SA 1TNTA 2WFPA 5EEHA 2FE3A 1O7FA 2GWRA 1W7PB 4I09A 1W4MA 3P9IA 3F8CA 4XF1A 1MDMA 2XAJA 3WTXC 2BNNA 3JAMZ 1XCBA 4KN4X 3LAPA 3HSEA 4AQ6A 1UIKA 4A0XA 2PFBA 2F5CA 3IHUA 3I59B 2MLKA 3T0YA 5HLHA 3N4MA 2P17A 2B9UA 3TOBA 4AVBA 1LR5A 2C0ZA 3H7JA 4CICA 4PZJA 1D8KA 1REPC 1YUDA 2FBHA 1H1MA 5KHJA 1MJBA 3KEQA 1S7OA 1MJ9A 4KYWA 4NVPA 3U2RA 2FA5A 4KWKA 2XAFA 5F1RA 3CF6E 2W24A 3Q9VA 3CJXA 1EH8A 1YLFA 2G7UA 4JBAA 1VTNC 5JSOA 3FMRA 4RGRA 1U5TC 3FZVA 2GXGA 4I0AA 1T98A 1GHCA 2Z2SB 2IJLA 4RGUA 2PHLA 3R0JA 4HV5A 2HGCA 1FLIA 4CGZA 3J81Z 2CAUA 1J3RA 2ADUA 1TW3A 3RPQA 2FF4A 3WGHA 3J80Z 1YG2A 5I91A 4J1XA 2IXHA 1TTYA 2OZ6A 2A61A 4XEZA 3HIFA 3AAFA 3EQEA 4EJVA 3SFZA 3WTVC 1BI2A 4F8AA 3MEXA 4X6QB 2C6YA 1GXQA 4J1WA 4LA3A 3LA3A 4AIHA 4LG0A 1ZX5A 5IT9K 4O9GA 2DK8A 3ULQB 3IKTA 4LULA 4GXOA 2JPBA 3CUQC 1IZ1A 1J1LA 1I1GA 2ZNYA 3GYHX 1IN8A 1ZG3A 4JTNA 3S7IA 4IJAA 1QPMA 2B5HA 5L3CA 3QPTA 1LB2A 4XSZF 3TNPB 4CDGA 5KHGA 2AXLA 3U10A 3K1NA 2DU9A 2PN6A 1R5HA 3LA2A 2FNAA 3K0LA 5AIQA 3BPVA 3DEUA 1YS7A 1DUXC 2HWVA 1QZYA 4WXCA 4MZUA 2E7XA 1WLTA 2ZCWA 2O8XA 4GYGA 2OBPA 1ODDA 2CWEA 3VB2A 4IERA 4IETA 1HW5A 2O1QA 4WBBA 2E9QA 2DCTA 2D1HA 1YHFA 3T1BA 3F8MA 2Y0MA 2OU2A 4ESFA 2K4JA 3J80K 2GC0A 5CU1A 2HYFA 4O3MA 3FHIB 1B59A 1JHFA 1T39A 1X8MA 5JR3A 2EA7A 1UCRA 1F9NA 4KWLA 1MKMA 2EAAA 3M8FA 2HQNA 3ZN0A 5H20A 3EUHA 1S3JA 1MZBA 4HA8A 2ZNZA 2RV8A 5E8IA 2MBFA 1YTYA 1RGSA 3ECHA 3H50A 5FFXA 3ZMVA 3D0JA 3SZTA 3M3IA 3CLPA 3DV8A 4G7HF 3HSRA 2BGCA 1FBUA 3G7DA 1HBXG 2IA1A 4L9JA 3H3UA 2DK5A 2Z5UA 4EJUA 4L0ZB 1ZVFA 1I6XA 4AWXB 3HTSB 3KZYA 5HS9A 4G7OF 3DPTA 1Y3TA 2XLGA 1E2XA 4EM1A 5D4SA 1P6RA 2R3SA 4MUVA 1YQAA 5DCMA 4OMYA 4IEXA 2GZWA 4NQWA 1RL3A 1CAVB 1J0RA 5FFZA 5D5VB 1OYYA 4LG0B 1S6LA 3ROUA 3ZMSA 3HQXA 1QO0D 1K79A 4PGGA 3QPHA 2FQ3A 5BQTA 5L3EA 1BI3A 2KJBA 3PLQA 1IXRC 3V8LA 3KGLA 1YS6A 5E17F 3HYIA 2PAMA 4KMUX 4QGLA 5HVQC 2CQKA 4G6DA 1V70A 4ONUA 2YX7A 1BI0A 3PFIA 2P5LC 1YWKA 2LNBA 1LNWA 3MAJA 4QWQA 1SFNA 1VP6A 2MC3A 4RB0A 2UWMA 2GH2A 4E2GA 1MJAA 1FNNA 2RQPA 3WU0A 2KIMA 1BIAA 2RDPA 1GQHA 3G3ZA 3O2PE 2HTJA 2K27A 4IRGA 3CL1A 2JTVA 3ZMDA 2DO7A 4QM9A 1GXPA 5FB2A 3K1MA 4LK1F 3WE2A 2L3DA 5A2QK 4EGYA 4XFBA 4UV9A 2PYTA 3E5UA 2Q30A 1ZZ6A 2XL7A 1ZGAA 4G8XA 4MV2A 3WW4A 1O5LA 4IEYA 1FPQA 4LTAA 2N7GA 1XD7A 2IXCA 3FXUA 2AS5F 2P7VB 5IT9Z 3NJZA 2GA2A 4EJTA 2LKPA 4MQ9F 4JQFA 2VXZA 5DYMA 1ZNPA 1R1VA 2H09A 3CO7C 4KFCA 5J3UA 1P2FA 2GC1A 3NRVA 4HF1A 2QVSB 1XMAA 1IRFA 4B29A 3JAMK 2L01A 2DPDA 1DZRA 1HQCA 2YX4A 3DQVC 3O6BB 5ED4A 3U9GA 1HW2A 4IRHA 2JSCA 2PAKA 1FSHA 2PMUA 2ISZA 3U1DA 4R8HA 1LKNA 2B0LA 5I0TA 4HF2A 5DCFA 5A2QZ 3TDUC 4GULA 5ICCA 3OTFA 1QY4A 1YIOA 4MGIE 1P4XA 4R1HA 2PEXA 1HSTA 5E1ZB 2HFHA 2A07F 4LLNA 2VQAA 1HSJA 2W57A 1NHAA 1JXSA 1OI6A 5D4RA 2OZJA 1X3UA 4LB6B 2ELHA 4MEYF 2RKHA 3U11A 4Q0SA 4E2SA 2PHDA 1VJ2A 5EEGA 2VONA 2XRNA 1UW8A 2P6SA 1NZCA 4LGWA 3GO5A 3M1EA 2HZTA 3WW2A 2NYXA 4ZZLA 4BHCA 4DQ2A 3MPBA 5C8WA 5LEJA 2EV0A 3H7YA 1PP7U 3BROA 3WODF 1J5YA 2P5KA 3ZMUA 1J3PA 1ZZ7A 5LRSA 2NRAC 5BXXA 3RYKA 4KICA 4M71A 2EVXA 2A68F 4BHPA 2EFQA 3BDDA 3KP4A 1SAXA 3OGJA 1X7NA 2QJVA 1EP0A 1BBYA 1F1ZA 3F21A 1IXCA 4Q0UA 1ZARA 4XRFA 3ZMZA 1KQ8A 5E1XA 4KA4A 3H1YA 2BE5F 3GUDA 5DUIA 2M30A 3N97A 4P55A 1J3QA 1ZH5A 4L11A 4KU8A 3I4PA 4HYEA 4B8XA 3BOQA 1NE6A 3TOAA 4GCVA 2CFXA 2XLAA 3ECOA 4L9VA 3L00A 2PMHA 4FX0A 1XSXA 2K86A 4ENNA 4LK0F 3L9FA 1BM9A 3COAC 3HOTA 2HDCA 4R79A 1IXSB 4OIRF 2IA2A 1J58A 4HVRA 1DDNA 3HUGA 3RI4A 1TNSA 1JE8A 4Q29A 1IN5A 1YFYA 3L09A 4XETA 3TDZC 1O3TA 5FLHA 3R61A 3E6CC 3I0TA 2PTMA 4S05A 2GXBA 1TQPA 1O7LA 2FSWA 1KU2A 1QBJA 1PUEE 4K8FA 1SFUA 1A04A 4OIPF 4I0BA 2ZFWA 2Y48A 5KHKA 1WKMA 1QXJA 4U0VA 1R00A 3WGGA 5KHHA 2PQ8A 2MA3A 2UY9A 3FX3A 3ELNA 4ZU5A 2BNMA 2Y75A 3QP6A 1B4AA 2MH2A 1R1UA 2DT5A 4XBFA 3VODA 2QDRA 4CO8A 2IXJA 4ZU4A 4P5OA 1XMKA 5I8SA 2M87A 1FZPB 3WTWC 2OPKA 3EQLF 1RNLA 3I58A 2F5DA 3M7GA 1J75A 3I71A 2R7FA 1K7AA 3IBMA 1H0MA 2GA1A 4UBHA 2VT3A 5JSPA 3IWZA 4EJOA 2VODA 4PIYA 5JFRA 5ICEA 3FF5A 3USSA 4XFIA 4E70A 1PMIA 3QRFF 4HX8A 3IWFA 3E97A 2STWA 2XL9A 3DXJF 4HMZA 2QBYB 3GXOA 3ML6A 1WA4A 4U7BA 3V4GA 1O5UA 1BOAA 2CGPA 3E5QA 3NEUA 5J6XA 1YW8A 1USSA 4TV7A 3FWEA 5L3DA 4Y15A 1H1IA 5LBQA 1EH6A 3KP5A 1ZG5A 4EWDA 1YFXA 3GLXA 2HR3A 3CDHA 3REOA 2QVOA 4I01A 4KIGA 2DTRA 1CF7B 1R36A 4HSLA 5FQ0B 4AVCA 3GFMA 3O14A 1J9IA 2X0LA 1Z6RA 4KDPA 2RN7A 2K7LA 2NNNA 5BUVA 5CVIA 1SD5A 2ACJA 2DFIA 3CUOA 4XFHA 1P92A 3FHZA 1CAUA 1WQ2A 3MZYA 1CAUB 3I5UA 3W6KB 1YFHA 5J8FA 4I02A 4META 2EV5A 2XIGA 1GVJA 3HTUA 1G3YA 4QGNA 5BPXA 2OD5A 4H0EA 1ZLKA 4NB5A 3HHHA 1HKQA 1IN7A 4XF3A 1D8JA 2IP2A 3IIAA 3LAJA 4BYYA 1ONVA 2VE8A 3WTZA 3MYXA 4G6QA 3JTGA 2MLGA 3PVBB 4EROA 1K78B 4H7LA 2K02A 2QWWA 4IPAA 3WTSC 3WE3A 4PDKA 5DDGA 3HT1A 4IHTA 2FU4A 1VR3A 2EFNA 4M72A 4WXHA 3KP7A 4HN1A 4LEJA 2WC2A 4MGYE 1SD7A 1T6SA 3RNSA 3I53A 3KP6A 4ORFA 1LRHA 4CXFA 3CUQB 4HX4A 2XKOA 4OIOF 4EGZA 4HN0A 1XSDA 3BPZA 2V9VA 1GQGA 1ZZCA 3QACA 2HQRA 3F8NA 4RS8A 1C0WA 2GC3A 1LDJA 3ABTA 1LDDA 3H1MA 4MNUA 4MTEA 5KBFA 5JI6A 2O61A 1USTA 3C7JA 1Y9QA 3EETA 3JSOA 1IN6A 2Z3YA 3RKWA 1SD4A 1LVAA 3V7RA 1XGNA 3T8TA 2H94A 2V79A 5ICGA 2PLYA 4OLLA 4I98B 4QXKA 3GW2A 3QU6A 2HKXA 3F22A 4HOBA 3M70A 3I59A 4F7ZA 4LFUA 1FY7A 5AVPA 3DFGA 5E16A 3DN7A 1KQ9A 4HW0A 1U5TB 5HS8A 3GFLA 2CAVA 4GYIA 1IF1A 4UUVA 4LD5A 4XSXF 2MPFA 5L3FA 4L9TA 2DI3A 5DCMB 1G4DA 4L18B 2Q8KA 3CJNA 5J7MA 1KU9A 2OZUA 4BNCA 4KT5C 2V6CA 3KEOA 4IEVA 3OOPA 3R60A 3KLOA 3ISPA 2M5WA 4P9FA 3H8UA 2UYBA 4KUMA 3BALA 2DAOA 2HKOA 4HDVA 1KQ0A 1G3WA 3ABUA 1EY2A 1YFWA 1CX4A 1ON2A 4L2NA 3GVAA 1FOKA 2P6TA 3HRUA 1ZN2A 1ZZBA 3NKTA 2FMLA 4HAMA 3LSTA 2FQPA 5I0UA 1Z7UA 1JHHA 4BHBA 1U6GA 4UVCA 2FOKA 3TNQA 3L2HA 2CG4A 2XAHA 3ST7A 1BIBA 4CZZA 3LWFA 1RUNA 4MHGA 4HBNA 4UVBA 2ESNA 5FLJA 1S29A 2QENA 3HRMA 1IUYA 4LLGF 2VOOA 2K4BA 1O57A 2CV6A 2PAEA 1U3EM 1V3FA 2XKPA 4Q0PA 1ZRRA 2VPVA 4YIFA 4N9IA 5D8LB 1YW7A 3EDPA 2O0YA 3D82A 4JV4A 4MGZE 1QNTA 4AIKA 2DLLA 4XF4A 3MCZA 3ZPLA 2UZKA 1PDNC 4Q0VA 1D5VA 4Z07A 4YIIA 1XDSA 2Q2EA 3ZQ7A 4HVQA 4IEWA 1H9TA 2ETHA 5FPZA 3QOPA 4U0YA 5CVJA 1TW2A 5HDGA 4UXAA 3BB6A 2W25A 1IAWA 2RGVA 4NHJA 2H27A 2IA0A 5CYVA 4DINB 5FD6A 2VT2A 1DGRA 4IRIA 1G3SA 3HRTA 4OU0A 3FM5A 3KE2A 2DBBA 1ZYRF 4UBGA 1FBSA 4XF9A 3SCGA 3WG9A 1XDUA 2JRTA 3Q5FA 5CJ9A 1RC6A 3P9CA 2L4AA 4LJZF 3JTHA 3GZ6A 1Z9CA 1J2XA 2YSRA 1UHWA 2QM3A 1J7KA 2MNGA 3CO6C 3J81K 2BV6A 1NXMA 2YR2A 2STTA 4IVNA 2KXLA 2FXAA 1X82A 3J7AO 2IXKA 2CW0F 4A0YA 4B09A 5JHUA 3WGIA 4YYOA 2DPUA 2R7DA 1LQ1A 4BIFA 4P9GA 5T3NA 4Z2YA 3WW1A 3E3VA 2BYVE 5ILUA 1S7AA 3F6VA 2L4MA 2HTSA 1OR7A 2NAZA 4PGHA 1Q3EA 3GBFA 1ZZ8A 2PG4A 1UD1A 4ESBA 2I45A 2VBZA 4OMZA 4MX3A 4Z82A 1RI7A 1F4KA 3TKYA 3TO7A 1AOYA 1OYIA 1ULYA 3W6JB 5HI0A 4YG2F 4WXDA 4IEPA 5BOXA 2V1DA 4LLLA 4FHTA 3ES1A 1QZZA 1XE7A 4A0ZA 3VHRA 5D6FA 3CTAA 2PA7A 3WU1B 4YFXF 3M8EA 4QM8A 2QUFA 1LDKB 3LQRA 3RDIA 2BEOA 3MFKA 4BQAA 3ZMTA 3C18A 3F8BA 2D5FA 1SQ4A 3KZZA 3OD0A 3E6MA 4O5VA 1NYWA 5K5RA 1FI2A 4Q47A 4LMYA 3VEPA 3IDCB 2ZO4A 4ENMA 2V1UA 1XE8A 1L3LA 3LFKA 2PBIA 1FT9A 4HDUA 4ZH4F 4KIBA 3GZ5A 1J59A 2L54A 3H1WA 4RD7A 2A3SA 2RC4A 3FMSA 2VOPA 4D0PA 1CAXB 1I27A 1CAXA 1OMIA 3RZZA 3FJSA 4AQ2A 2ET7A 5FD5A 1I1SA 1TLHB 1KU3A 4HVOA 4XFAA 4A5MA 3CUQA 3OCPA 2E7WA 5HLIA 2D45A 1QQIA 2XROA 2OQRA 2EK5A 5D6EA 3F72A 4PCQA 1HW1A 2O8QA 2XASA 1EPZA 3BZ6A 5D8KB 4HBLA 1FP1D 4EM2A 4K2EA 1NE4A 1FX7A 5K8SA 3I64A 2EJRA 4YRDA 3JW4A 2OQGA 1OD5A 1EYBA 2GIVA 4U7DA 1QGPA 2F2EA 2XAGA 4A6EA 4HLYA 1MDMB 2B8MA 4FBFA 4XF0A 2M45A 3HHGA 1YW9A 3SMHA 1XCVA 3IRRA 3ERED 3DP7A 2IXLA 4GO1A 3BPXA 1ON1A 3L2CA 3BY6A 1R5GA 1U5TA 4O6JA 2FBIA 3S0MA 3BJOA 5D5WB 2QNKA 3FXRA 2XUBA 5I93A 2ET1A 3RJPA 4MQVA 3Q9SA 5FLXK 3RTRA 1HXDA 2P4WA 5I0RA 1FYKA 2XLFA 5E1RA 4OFGA 2IPQX 3R4KA 1ZZ9A 1BJAA 2ZXJA 4YSFA 1OYWA 4XLPF 4AVAA 1MGTA 4ZYEA 1O3SA 3ETQA 3EYYA 2W85A 2JT1A 3B73A 3IDBB 5DD8A 3K69A 4AVPA 1DP7P 3ZN1A 4QX5A 2BBYA 3MZHA 1U12A 4IEQA 5AIPA 3CEWA 4A5NA 4EV0A 1SFXA 3V7SA 2COMA 3ES4A 3P7NA 5ILVA 4N9HA 1LEBA 1SEFA 5CADA 1B9MA 1T0FA 5FQ0A 2O6GE 1U8RA 4QLCU 4JVAA 2G7HA 3PQJA
chains in the Genus database with same CATH superfamily
2FX0A 2CS3A 3ZO0B 3JB4C 3KPHA 3RYRA 3S1QJ 2Q8DA 4AOCA 2LREA 1RUJ1 4SLIA 3K48A 2VECA 1S0FA 2HOSA 1Q5OA 1TE1B 1AR73 5IP6A 1SFOJ 4AIJA 1K42A 2NOGA 2WNUA 1JGSA 2ZHKA 1HJGA 2I2SA 1UX7A 1Y8QB 3AP4A 1WVRA 2VVDA 4C0HA 2XRLA 4LBNA 2WTEA 4A69C 2NVQJ 4GDFA 3D3AA 4C3IJ 3HZJA 3MFCA 3VD3A 3RZMA 2JPCA 5EWSA 2W92A 5T5LA 4HANA 4A3BJ 2D1VA 1ZHFA 1TEIA 5J37A 4GALA 2H0BA 2SBAA 2X6XA 4QQPA 4EJWA 1LEAA 1RUE3 2RE9A 4F3JA 1YLLA 4PBOA 3CD6I 3EXUA 2JZYA 4YW3A 2D2WA 2JDUA 2EILH 5DUWA 4EWEA 1BBT2 2QUOA 2HOEA 1VB2A 3KETA 2QZ8A 3U78A 2O3FA 5TRDA 3ZFEC 2PLV2 1ENXA 2VBPA 4MTDA 1OFNA 4WCGA 3ELKA 3T2TA 1X4PA 3Q9OA 4EWAA 2ZJ2A 4BACA 2RM22 3UGGA 4D6RA 1PK6A 4MIMA 3FHNA 3K4KA 1AL0G 1YRNA 2V7FA 2VL4A 2ZXIA 3MUZ1 2Q1ZB 2CYFA 1PK6C 4CCNA 5B5EC 1X9TA 4XICA 4A45A 5B66C 4JHZA 1LOEA 3IPVA 3CMAI 3P9KA 4W6YA 2RS13 3H3ZA 2GAUA 1IKPA 2KDZA 1UX6A 4COWA 4BWOA 4YNIA 2EIJH 5FZOB 4O9EA 4HK9A 3ZXKA 2GQQA 1AYN1 2F4MB 1A34A 1IV6A 1JUPA 1SVLA 1WI9A 2EIEA 2YPDA 3ECQA 4C91A 2QEXI 4UB8C 1XE0A 3WQ7A 4EQQA 4B7KA 3JD72 1FNZA 5CYYA 3BCAA 2W91A 5FZAA 4Q4Y3 3WXPA 2M2EA 1OR7C 2WO2A 3I2IA 4PDWC 2ZJCA 1BW5A 4MHUA 2GDFA 2DFHA 4AGRA 1H4HA 2LH9A 5JSRA 1RHI3 5FR3A 3SFIA 1UCXA 4ZYDA 2N8GA 1VMJA 2PQSA 2J1TA 5HDKA 1UXXX 4YZ2A 5FZBA 5KCMA 1XSVA 3AL5A 3HOBA 4JK1X 2X29A 5DDJ2 1SLTA 4BMEA 2BNOA 3VSLA 2YC2A 1Z6TA 4BAYA 5CVUA 4WM7A 1GDTA 2HEOA 2E1OA 1MD0A 2M1BA 3D5LA 5FO5A 1JHJA 1V6LA 4FPJA 4U88A 1W6OB 3X29B 4Y4RA 2H6CA 5FMCA 3VZLA 4M4PA 1JZ7A 1HOMA 4Q4ZF 3CZ6A 3H8OA 2KRFA 1GT0C 3ILNA 2ZA9A 4NRPA 3ATGA 3OJBA 4KJZA 4IGQA 3GTGJ 1MQTA 3OEAA 4RHV3 4LQRA 4AHWA 3T8RA 1RUD2 3QP5A 4QHBA 2V9PA 4MXWA 1K78A 2Q1FA 1NG7A 3OF1A 3CC7I 4JTOA 1NH3A 3WP6A 4A7KA 1QJX2 1PVC3 3GF2A 2J5PA 3PJRA 4YARA 2ZX4A 3BU0A 2B7EA 4O65A 4DOZA 3QH7A 2QSFX 4HV6A 5IFPA 3FE5A 1RTVA 1VRBA 3AMNA 1H0BA 2X1CA 5HDNA 4L0YB 2R042 3E1F1 1TQMA 1JOBA 1UNBA 1FV2A 4NC7A 1CZTA 2CUEA 1YNAA 1AHDP 3V8JA 1FATA 3K1PA 5FRMA 2OKXA 1AR81 3EBRA 3SXWA 2WT0A 1K83J 3LQQA 4KG0A 4DZGA 3O1MA 1VBE1 1SEUA 4DXZA 4WK8F 2J7MA 1IN4A 3BR5A 2JUCA 2DYRH 3L2RA 1RITA 3TWIA 2PI0A 4GMP1 1NT0A 5LGTA 2XHKA 1N3QA 2JG9A 2BY3A 1XJAA 4JGZA 3C7HA 4XZPA 4XK4A 4QTRA 5EP9A 2FUG2 2PHWA 2GP3A 3GNEA 3G6JB 4Y1VA 3K70D 1RPWA 2DVAA 2KIUA 2KJCA 3LSRA 1SLAA 2AEYA 2JWPA 4EMSA 4GWJA 1W2TA 4HKWA 2WO7A 2NYYA 1S8NA 4JX0A 3ZXSA 3N9MA 4ARYA 1XN7A 2IEKA 3JZVA 3P3PA 4IXAA 2ZJPF 4QSHA 1ALYA 5FPXA 3K75B 1PO21 1SZBA 2BP6A 1QXRA 2HQAA 1YFUA 3BJ6A 5JHFA 1KJLA 1YJLA 5K0UA 1BA5A 2OYZA 4ZZDA 3VKFC 5C3RA 4IEOA 4CDUB 2J1VA 2ZGTA 2QQKA 5FMDA 3WTUC 4LBQB 3VBFB 4LLOA 2EA4A 2DQLA 2XMLA 2EIBA 1SDWA 2A6EF 4F91B 2KIQA 3WX5A 4D5FA 1Z7S3 2LD5A 2FD8A 3ZGKA 2BGPA 1ODMA 2W47A 3PQKA 3M8LA 3OYJA 4Q0QA 3KLNA 5DUKA 1P8JA 2XJTA 4XLEA 4E2QA 4G94A 1R1TA 3W5NA 3SH5A 5GLWA 2ZXHA 2WV1A 1FYMA 1I5ZA 1BHGA 3I7DA 2AC1A 3HSFA 1IPKA 3J7NA 3SH4A 4Q5SF 4Q1RA 2VUDA 2WWJA 4FPCA 1OKRA 3UV9A 3BCWA 3CLOA 5E20A 1WI3A 2J22A 1JODA 5FGMA 1F5TA 3ZFEA 3DKWA 1JUHA 3K9TA 4XJZA 3FXOA 1DPUA 2UYAA 3OBZA 4NQWB 3JRGA 3BR1A 1JGGA 5IVFA 3GTKJ 1ASJ3 1WWYA 1K12A 4RM2A 3VDDA 3QAHA 1NOVA 3K6GA 3OSGA 1MZEA 1EH7A 4ENKA 3ZYJB 3SQNA 4YVSB 5LHIA 2VJJA 1YQCA 3IDAA 2OQ7A 5LRRA 2HPMA 4CUAA 5FUIA 4F83A 3C3WA 4I2OA 4OI4A 3WTTC 2NS8A 2WB1N 2P7CB 4FI9A 2XUMA 3CMMA 4GGGA 4UUSA 1XGOA 1F9KA 3HG9A 2WSUA 1FMWA 1R23A 3ZP5A 4ZS3A 1FSEA 1R58A 4A6DA 2ZMEB 3KP3A 4GJYA 5L9VA 2D6KA 3SKVA 2Z42A 2Q0OA 2ZHNA 4KT6A 1YO5C 1ND3C 3SC7X 4UW4A 2IVIB 2EAKA 1D4M3 3C7OA 4IKFA 5K7HA 3FISA 3RKXA 1XB9A 5GP9A 2VNVA 5KK1A 5A7OA 4CA9A 2M3AA 4EM0B 3C3VA 4UWDA 4UAPA 4ESJA 4BE1A 2VBXA 3NQOA 3NL1A 3NVCA 5GLVA 1ULFA 5HV4A 5BV6A 3CJIB 5FMOS 2Z9OA 1C1LA 3BP8A 6PAXA 2Q4SA 3OWTA 2WFPA 4IV1B 3AB0A 1GP4A 2FE3A 5CFCB 1O7FA 4AF9A 1BL0A 5CFCA 3P9IA 1W6MA 1MDMA 2XAJA 3WTXC 2X53S 1XCBA 1LKXA 4IOAF 2D6LX 4W8JA 4N4NB 2K85A 3NV4A 4BQOA 4URAA 1HF0A 3EYPA 2MLKA 1WFXA 5IVVA 1RUF3 3AL0B 3PVOA 5K0UC 3I2DA 3TOBA 3KCXA 4C0BA 4QPIB 3H7JA 1REPC 1POGA 1LEDA 1MSFC 5HV0A 3KEQA 1MJ9A 3ZFGC 4NVPA 3U2RA 1D0GA 1AXKA 2D7FA 3NMBA 1FOD3 2W24A 1YLFA 2G7UA 1GP6A 1VTNC 5IJRA 1AU7A 2K46A 1PX4A 3DF0A 2G4IA 3FMRA 3VZJA 2PHRA 5IFTA 2C24A 5GLUA 1T6GC 5JUVA 4PBPA 2YC0A 1YI2I 1YCIA 4FXKB 3HPNA 2FF4A 5APAA 2VI6A 1IUFA 2VPLA 3WV6A 2JQ7A 2VB6A 2WAQN 2OZ6A 1S0IA 2YU9J 3N7MA 3S1RJ 3MEXA 2VKHA 3CKHA 4YPJA 2LFBA 3ZYFA 4X6QB 4AHYA 1GXQA 3VBOC 3NAPA 2E6VA 2ZGLA 3A02A 1RUJ2 1OA3A 4LULA 1QOSA 2EICA 3TB0A 5LBEA 3WOGA 3WQ1A 1MNDA 4JTNA 4XKWA 5L3CA 3K4NA 3PFYA 3URFA 1LB2A 5KHGA 1V9U1 2VOTA 4NR1A 3DYPA 3IP4B 5SV5A 3VLBB 2DU9A 2PN6A 5B4NA 4ZXEA 2ZAAA 2JDMA 4PJJA 1W6NB 1VFCA 4ZJZA 2X10A 1HV0A 1YS7A 2QSHX 1DUXC 1ODNA 2HWVA 4XMAA 3MKWB 3V0AB 1W2OA 1WLTA 3HB9A 2OBPA 2DDAA 3HN1A 4IETA 3WZ1A 2DCTA 3VBHB 1X1BA 4LXLA 4YGCA 2R043 3VZNA 4NC8A 2R5ZA 2J1RA 4X0GA 3T1BA 3HUGB 2K4JA 1AF9A 1R081 3OUIA 3Q3SA 1B59A 1J83A 4EYUA 4RA0A 2GMEA 1X8MA 5JR3A 1MKMA 2IGKA 5H20A 3I4IA 4K40A 2BVLA 3P5JA 4FO9A 1MZBA 4TTGA 4DUXA 5E8IA 3W6VA 1OA2A 4AEDB 1Z0HA 1AR83 3B93A 1RGSA 4YFWA 4CDXC 1UZYA 1ACCA 5J98B 5C8CA 3DV8A 4G7HF 2RV9A 3A01B 4YWAA 2HVSA 3H3UA 3G4SI 4L0ZB 1OFCX 5A3PA 3KZYA 1VAKA 2JN6A 5HS9A 2HWD1 1JXNA 3ZXEA 3MLJA 1QHDA 1ETOA 2L9LA 2GXAA 4Y22B 3OYHA 2KP6A 3HPHA 1E2XA 4EM1A 4L8QA 2WQZC 5J4VA 1XU1A 1RXGA 1RL3A 1CAVB 3Q8AA 5E3OA 2O5RA 1OYYA 3HQXA 3ROUA 4DRVA 1K79A 1Q8VA 2F6BA 3JCIA 4BU2A 1QNYA 5FKCA 1WW6A 5BYNA 3JRHA 4Q4W2 2XGCA 3HYIA 2PAMA 1JUIA 2NOJB 2HWE2 1WH5A 1ONAA 4D9JA 4AVVA 1BI0A 1NCRC 2LNBA 3MAJA 1WJ5A 4QWQA 4AVSA 3NNGA 4LJHA 3OYEA 3QBQA 3UETA 2F4IA 1VP6A 1NCRB 2LALA 2PMZN 2L2OA 2PX9A 3BTLA 3ZMNA 2DBIA 4E2GA 1Y1VJ 2RQPA 3V64A 2DT7B 2NMNA 4O61A 4FPFA 4QQHA 4OHYA 5FLMJ 1FPN3 3ZMDA 4UW3A 1IQDC 1VLNA 3WE2A 3A0NA 2L3DA 1POQA 2ID4A 3HOUJ 1MS1A 3A4UA 3TBDA 3CHXA 3CMGA 5DZEA 1YXWA 2XL7A 1RXFA 4BBSJ 1WD4A 5LZ6A 3DBRB 4LTAA 4RAGA 3AZYA 2VZTA 2P7VB 1BMV1 3SH3A 3CDIA 1M06G 2TRTA 3AYCA 2VBDA 1U9NA 3FUQA 4W4ZA 5DYMA 1YX3A 1R1VA 3ZSJA 2EXHA 5J3UA 2M9HA 2GC1A 1R082 4RFRB 3Q8FA 2DA2A 2VU9A 3VBSB 2WZEA 3OY8A 5JLVA 1O4XA 1DZRA 3ZOIA 3DQVC 4XUOA 4DQAA 1BBT3 3U9GA 5J1RA 2JSCA 2PAKA 1ETKA 3DEWA 2PMUA 1Y39A 4HF2A 2BVVA 4GULA 5ICCA 3LOBA 3NKGA 1YIOA 4MGIE 3D6EA 1P4XA 5T5OA 1ETYA 2DF7A 3KD4A 5E1ZB 4P9YA 4LBKA 3FIWA 4LLNA 4CDWC 4FSJA 1JXSA 4HNUA 4E7JA 5IVJA 3G1LA 3QOEA 3PMEA 4MEYF 1S1AA 4ATFA 4DEQA 4IQPA 2AUYA 4E2SA 5EEGA 2XUEA 2CW7A 4MVTA 2VONA 2XRNA 3RJRA 2X8KA 4A3LJ 3AZWA 5SV8A 1UW8A 4AEMA 5FZMA 3BR2A 4WV8A 1OCPA 2HZTA 2NYXA 5EYYA 4ZZLA 1F31A 1PUFA 3RZOJ 4NMIA 3MPBA 2EV0A 2W68A 2WQ4A 3BROA 5CKQA 2DA3A 1E57A 4F3QA 3A0HC 1P9QC 4KICA 2EVXA 4BHPA 3MIDA 3GZAA 1D2SA 4XIOA 2ZJRF 1BEV2 3FBMA 1ACIA 1X7NA 1BBYA 3F21A 2RS53 1GZWA 4XRFA 1BZWA 4K21A 5JIUA 5E1XA 1JKQC 3QPLA 3NNMA 4BGDA 1ND3B 2AQFA 2ORZA 5TSWA 4P55A 5FY7A 5D8AC 3WLUA 3ZSMA 1ZH5A 1DQ5A 4L11A 3UGHA 2HPIA 3GJBA 3BOQA 3AG3H 1XOYA 3TOAA 4GCVA 1E5HA 2RS51 2XLAA 3H9JA 1GOFA 4Z92B 4L9VA 2PMHA 1XSXA 2K86A 2X6WA 1JZ2A 3QD6A 2WFF3 5A6ZA 1VE0A 3OGGA 4V1PA 5FPLA 2IA2A 1J58A 1DDNA 2LK2A 4XIKA 1SPPB 5KNLA 2A7AA 1YFYA 3THDA 1O3TA 5FLHA 4Q4V2 3I0TA 2PTMA 2GXBA 2Z1DA 3BN6A 1BQPA 2WFF1 5M5XJ 1PUEE 4YGDA 1SFUA 1A04A 5FUPA 1OPMA 5DUUA 1UJ8A 3UK9A 5FWJA 1QXJA 4GMP0 5GAGJ 1LVKA 3S2HJ 1PGSA 4DEVA 2MA3A 2UY9A 5BNOA 1YITI 4CZCA 1UXZA 5ABJC 2R0HA 2R5YA 4XBFA 4ZU4A 3MN2A 2C26A 2DVGA 3N7KA 2M87A 3WTWC 1TWFJ 1BLZA 4BQ4A 3I58A 2F5DA 2WA4A 4LT5A 1J75A 5DQ0A 3S93A 3CF2A 4Z2WA 1XYNA 1H0MA 1QJU2 2VT3A 5CQEA 4EJOA 3MKYB 1DP0A 5HNFA 2LYCA 1LECA 4ZS2A 4MO3M 1MNEA 2WZPP 2STWA 2XL9A 1AR63 4B47A 2WIIB 4P9LA 3AK0A 4FXGB 2ELJA 1UOBA 3V4GA 4NHLA 1O5UA 2CGPA 3E5QA 1LOFC 3AKRA 2ADEA 2ZMEC 3RZGA 5C9AB 4NAMA 4ITVA 1USSA 4TV7A 4N8MA 4Y24A 3PIJA 4AI9A 2A05A 1SDDB 1VAVA 4AEJA 3JRFA 5EYXA 4BQWA 1YFXA 5DN2A 2L9SA 1ZBA2 1QJU3 3CDHA 3DTIA 2JE8A 2FDHA 4HSLA 3JRDA 1UQXA 2IS4A 1J9IA 3U21A 4CDQB 4KDPA 2RN7A 2K7LA 2NNNA 1XC6A 2VCBA 5BUVA 3LFIA 4IE7A 2JECA 3PUIA 1QOOA 5CVIA 2ACJA 1CZVA 5GZDA 2DFIA 3CUOA 2XSDC 4AYBA 1P92A 1FEXA 2RREA 2L9NA 1WQ2A 3MZYA 1H4GA 2EV5A 1HRI2 3GCXA 4QGNA 1OKQA 2DT6A 1FMD2 2OD5A 3GTMJ 3ZQCA 1ZLKA 3RWKX 3BZCA 1HKQA 2ZX1A 3HOVJ 1D8JA 3VZKA 3THPA 1ONVA 2BHYA 3WTZA 3G1OA 3MYXA 2V26A 3WNOA 1YJWI 4KI5M 2VMHA 4LBJA 4H7LA 2QWWA 2R041 4A41A 4B4RA 1N47A 3WEZA 2AENA 1W6NA 3OR2C 3AKQA 4OI1A 4IHTA 2H8WA 1IDYA 2FU4A 1U5ZA 4IEJA 4WXHA 1QJEA 1LGBA 2VXRA 1A6IA 1T6SA 1NG6A 3KB5A 2VNRA 4XTMA 1RIRA 1LRHA 2Q8CA 4EGZA 4LMFA 3PTYA 3ZVXA 2X6YA 4QPYA 2A3YA 3ABTA 4MNUA 3LDKA 1FOWA 5JI6A 2O61A 5FLVA 3JR9A 2Z3YA 3RKWA 1DHKB 2LRDA 2WNVC 1LVAA 2DYCA 3K70C 2M7BA 1S0CA 3T8TA 4OUMA 2Y31A 2BW3A 4E7IA 4E4DX 4I98B 1MW7A 1N3PA 2F5VA 2HKXA 3ZDVA 3F22A 4P02B 4CDXB 3M70A 1R49A 3PUBA 2UURA 4LFUA 1FY7A 3QLQA 5ISLA 4LBMA 3DN7A 2V5DA 3TW6A 4RQPA 1FTTA 1B35B 2P37A 2BXYA 1N1VA 5EPAA 4UUVA 2R7WA 5FMBA 5B1BH 2MPFA 4C2TA 3VV1A 1PNFA 2W2IA 4OUSA 3BUCA 4XVHA 3PNVA 5F6KA 2OZUA 3ZYIB 1ZBE2 1JMUB 2HWD3 3OOPA 3R60A 5FPBA 2WT2A 2ZS6B 3MKLA 4HG2A 4FTHA 5LWBA 4IV3A 4PFPA 3ABUA 2QSGX 1EY2A 1EV12 3I2KA 2VOVA 4PSWA 1FOKA 4RR3C 4C8DA 3KT7A 1W8TA 3BC8A 3NKTA 3T1LA 1JHNA 3WHUA 4D6SA 5GJ6A 4RR3A 2R7SA 5GKAC 1JHHA 1U6GA 4UVCA 3VBFA 1RUF1 2E2JJ 1QH6A 1VBA1 5IW0A 1QQP1 3ST7A 1DQUA 3PUSA 3DBHB 3W3CA 4QHZA 3QODA 1BIBA 3LWFA 3T0BA 1TMF3 1W5CC 4UVBA 1S29A 2QENA 4L0PA 4Q5OA 2LR8A 1W0PA 2XKPA 4Q0PA 1Q8OA 1EAH3 1JYWA 3A0KA 5DUXA 3K51A 1ZTRA 2O0YA 3D82A 1QNTA 1WJFA 5IOZA 3MW4A 5IYYA 3AXEA 3HXLA 3MCZA 2BQPA 2ZEYA 1PDNC 3LPFA 1VQKI 1D5VA 1Y8RB 1E5SA 4YIIA 2Q2EA 1EA3A 3ZQ7A 2GIZA 5ACA1 5F5AA 2HWD2 4OQ8A 3VBRA 1TW2A 4UXAA 3BB6A 1SCSA 1R64A 5DDJ3 4FOVA 3VBRB 4XORA 2JDNA 5F5QA 2RGVA 2H27A 4R9CA 5FD6A 1IS5A 3AFGA 3HC7A 3VBUC 3A1YA 3FC0A 3ACFA 4ZYAA 3KE2A 2DBBA 3M8JA 4ABZA 3WG9A 4D7MA 1DGWX 2JRTA 3C2BA 3P9CA 2L4AA 4OULA 3H5AA 4Q4W3 4CU9A 3GZ6A 1J2XA 2YSRA 3PJYA 3O1RA 4FPKA 2G9FA 2DURA 2MNGA 2BV6A 2ZGNA 2C9AA 1IGNA 2YR2A 1JJ6C 1XSQA 4V2WA 3O8GA 2STTA 2L7KA 2RDRA 3VHOA 2ZFUA 2IXKA 4A0YA 2ARXA 3AMPA 3LEIA 2DPUA 2P6HA 1LENA 4P9GA 4TWTA 4GH4A 3FUOA 3F6VA 2AACA 4J25A 1OR7A 4PGHA 1F15A 3GBFA 1ZZ8A 3F9KA 3JRAA 5C3PA 3W20A 4HK8A 3TO7A 1BOBA 2A73B 1OYIA 1ULYA 4PT6A 3NWTA 2P3IA 5F04A 4YG2F 3ENRA 2P34A 1GUUA 5GTIC 1XNCA 4IEPA 3ZFGA 5FZ9A 5BOXA 1PVEA 2WA3A 3MV01 5A7WA 1GKBA 4A0ZA 2MD0A 5D6FA 5EGOA 3ORJA 2PA7A 3LFUA 2ICWG 1LDKB 1MBGA 3MFKA 3J8F1 1VB4A 1VMHA 3KZZA 1NYWA 4Q47A 2VZ3A 1NTCA 4B3AA 4A42A 1W3VA 2Y6GA 3VEPA 2ZO4A 1XE8A 3H1WA 4HDUA 1J59A 2L54A 3AMQA 4XAEA 3RMXA 3HBZA 3ZOBA 1LOFA 1D7PM 2RQQA 1GV9A 4AQ2A 2UUZA 4NPLA 3GJAA 3VKMA 3VBHA 3PU3A 4XFAA 5M0TA 4A5MA 1GV5A 1VQLI 1S7EA 3EPZA 3OCPA 4LHLA 4AU7A 2D45A 2OQRA 5D6EA 3F72A 1SC7A 1EPZA 3WDWA 5EIYB 2DCYA 1FX7A 1MS9A 3CJIA 3JRIA 1ENHA 2PHXA 4Q4X3 3ABMH 2GIVA 4P5YA 5J36A 3HKZN 1MDMB 2B8MA 2DUOA 4MO7A 4K9SA 2K9SA 3RS6A 3QYEA 1HB2A 4A3DJ 2HH9A 4XPVA 1JOJA 3IRRA 5E88A 4LLFA 1OF3A 2R5YB 2IXLA 2VQUA 4PJNA 1W36D 3S32A 3DKQA 5LBFA 1ASJ1 2D6MA 4WVVA 2RMU2 5J1YA 1R5GA 1RYYA 4QKFA 2FBIA 1UG2A 2ZMKA 3LD8A 4D0QA 2VW2A 3KZIC 3S0MA 3BJOA 2DXIA 5D5WB 3PL8A 1UL9A 1DP3A 1BEV1 4WM8C 2ET1A 1ETQA 1AJOA 3MEPA 3S5QA 3U07A 5FZKA 2XLFA 5F3GA 5ACA3 1UMQA 1K6YA 4I0WB 4YG0A 2ZXJA 4DZPA 2JRMA 3OMYA 4ZYEA 1ULDA 5C9AA 5F0HA 1CIYA 1R5ID 1EUUA 3IDBB 2XPJA 3OGSA 1DP7P 3MZHA 4OWRB 1X4OA 4EV0A 3ERMA 3JBG1 5A6QA 4XJUA 1SHWB 3P7NA 1DYKA 3PIPF 1RUF2 3INAA 4YG3A 2PHTA 2CQNA 2ZGUA 2B63J 2YROA 3VOEA 2JVGA 2XJQA 5CISA 5IT3A 1XBFA 2PJPA 1RUOA 1DIWA 1WW7A 3MW3A 2TNFA 1FYLA 1AXYA 3GTPJ 1UHMA 4QPGC 3KLSA 4O7XA 3HRSA 1FC3A 5B3SH 3P3NA 2HDWA 1D0ZA 2YS9A 1U5YA 5E8GA 3DU5A 2OA4A 5IVEA 5C3EJ 2X9DA 2OAZA 4HX7A 4I3PA 1D4M2 1T2KA 5JR7B 3MZ8A 2F5EA 5CLSA 2X4HA 4DYRA 2Y6HA 3GXUA 4OIQF 3TN92 2AQEA 3OYNA 2E34A 2R92J 3E6DA 1SMTA 2D3RA 1STZA 2E60A 3MIHA 1PVXA 4G4FA 1MBHA 2CSOA 1TWAJ 2RVCA 2TBVA 2FBKA 4OQ9A 2HYGD 2QQLA 3W5MA 3FKIJ 2XPVA 4CXYA 1F5JA 1ND2B 3FZ3A 4RQPC 4DMIA 4IHSA 5KXCA 1B1BA 1WMXA 1ZLJA 1DLCA 5FZ3A 4WVWA 4UVAA 4UFLA 2VNOA 1QA6A 1DPRA 2RNJA 5FBZA 3TRSB 4K1YA 3J7HA 2KR2A 3M3QA 3MICA 3ZKUA 2QQOA 9ANTA 1IC8A 2YUSA 2VZRA 3K4ZA 3GCWA 1R7JA 2ZB9A 2ARCA 4P5HA 4BQ1A 1CAWB 1U9OA 1REFA 1NLSA 2DU1A 4AFCA 4JGYB 2E1CA 5K5QA 3UKNA 4XLCA 4ZYGA 4IHWA 2V4JC 3U37A 2O14A 4ZPIA 2VCMA 3OUJA 4FT8A 1XB4A 1CAVA 2UWAA 2CGOA 2Q0AA 2J5OA 3KX2A 4JRAA 2V1XA 2LF8A 2HXIA 3BOPA 1OVSA 2V1NA 4D1QA 3IRQA 2DFFA 2CNAA 5LA9A 4FASD 3M4OJ 5TISC 5FK7A 3KZ4C 4V2VA 5DXDA 4AG4A 5A1FA 4TLGA 3SJMA 5FTTC 3N9NA 2P5VA 4HPQA 1YX5A 1YJNI 4MH0E 3CESA 1XNKA 3JBG3 1R71A 1JS9A 4LBQA 2Z79A 3I56I 3FMQA 2GNDA 2PQQA 2KM2A 2A71A 5BY5A 4G9SB 5J4YA 1IRGA 3MW2A 2F5FA 2ECBA 4KNYA 2R7UA 3K10A 4Y5TA 3G73A 3RCOA 4JKMA 1PM4A 3LOIA 1WRJA 4D7TA 4FISA 2Z69A 2YG0A 3U75A 3RQ0A 2CYYA 4BISA 2VQHA 1WSUA 2VAUA 3V8KA 2RJ2A 1OPOA 2LRPA 3R4UA 1ZR2A 1BEV3 1ETVA 1S5LC 4DIQA 1QJU1 2H0VA 3VBUA 3S3NA 3D1NI 2VUJA 1P4WA 1PP8F 2X5IC 4FAGA 3I49A 4MLOA 1FNYA 3IC7A 1Z05A 4XOTA 3H9AA 5FLXZ 2TDXA 3U1KA 2QCOA 2VTXJ 1ST8A 1EJ9A 2XF5A 2RNGA 4KU7A 1V5EA 1R092 2DMUA 1NLQA 2QYOA 4E7LA 2GMMA 4LKDA 5H6RA 4KMFA 1POV1 3BKZA 1QQP2 4DNCA 3SZPA 3WP4A 4JDNA 4D7NA 3F3XA 3O1TA 3W2WA 3NJVA 5JZGB 3GWZA 5JXHA 4L9NA 5JZGA 2FCVA 3SCHA 1LFUP 2IXIA 3OD4A 1WZ2A 4A12A 3F8FA 1CGPA 4XRSA 5HOOA 1S0DA 4FTEA 3H92A 1AR71 3LE0A 3IH4A 3KV4A 3RGBA 4K8RB 1MVQA 5ABJA 2XC7A 1W6PB 2ZGPA 3MGUA 5H6QA 1NK2P 1BVP1 4K7JA 1R083 2Z33A 3TGNA 1Z67A 5F32A 2DOEA 2QKMB 1XG1A 1PO12 2NS0A 3T30A 1X8EA 2CMPA 1WLCA 5LHGA 2HWE1 3CCQI 2ESHA 3V7CA 3POEA 2MGQA 4NIAA 3KYCB 1SPPA 1R22A 5DEQA 1OPCA 1EF4A 2XOMA 4M6XA 1QWRA 3KSCA 3TEWA 4WX9A 2PMZA 1RUD3 1NKGA 4RHV2 3DF8A 1A35A 4XJAA 3ZMOA 1ZBA1 1OA4A 5EGOB 1Q8QA 1EV13 4KBZA 4YRVA 1KU7A 1JKOC 5D21A 3AZZA 3E7LA 2H6BA 2EWNA 3K3NA 2D93A 4LUMA 1YO8A 3J4UH 4CH7A 2NQYA 4EATA 2YU2A 2HWF2 3M3OA 1HKDA 4IESA 3SXYA 4CXWA 1HXS3 4JRLA 2M8GX 3BTYA 4YW2A 4OINF 1BC7C 4XLNF 1Z91A 5I0SA 1SFKA 1RUJ3 1A5JA 5LGUA 1MIJA 2P8TA 2EALA 4LORA 4CU8A 3N35A 3T5XA 5LATA 4EVIA 3SEZA 2YBPA 2OCEA 2ZGRA 4OOIA 1AWCA 4XZUG 4M3CB 3FBNB 1MZFA 2CUFA 3RQIA 5DV5A 3IKVA 1W7PA 4BH9A 3UKVA 4CYDA 5DDJ1 4M9SA 1UPIA 4BLIA 1K5MC 3DPUA 4PK4A 4HLXA 3VL9A 1ZKGA 5FYBA 1ZRIA 4G7ZF 4Y1YA 4XOPA 1W90A 3HT2A 1BCXA 3LA7A 1KYWA 1YYVA 5ICFA 2ETEA 3ZPYA 1FOD2 1LEMA 5F64A 4S2GA 4JGZB 5IYBJ 4I76A 5IAVA 5C5UA 3KMHA 4LUKA 4NPRA 3MQ0A 3WHCA 3WP5A 4DOUA 5FY1A 4NNJA 5DD4A 1X1PA 2IGMA 4HZFA 4P08A 5FZOA 3I2JA 1SFEA 4S2DA 2XQRA 2HS5A 3BWGA 2LM3A 3TO6A 1ZRCA 2EFPA 3GYDA 3BQZA 1FMD3 3J8F3 5FRAA 1FBQA 4BQXA 1PHMA 1W8NA 5IOYA 5M5YJ 1OKOA 4RB3C 1RUI3 2FNPA 2RJKA 3MPPG 1X3WB 1HKTA 3KCCA 3K2ZA 1TZOA 2V5YA 4RL7A 5KHIA 2WV0A 2UXNA 5FP3A 4W6WA 1R1ZA 1B8IB 1MMDA 1R1A3 1IOAA 1B8IA 5D1IA 3OYGA 1U78A 2A75A 5E1WA 3JQXA 3RZJA 4EE2A 5FCCA 2KIFA 1JZ6A 1KA8A 4HQEA 2YPJA 4CCDA 2L02A 4C1XA 1V0AA 1ZBA3 3J7LA 1LU2A 2D40A 3MIFA 4UUTA 2GMPA 3J7MA 2C6SA 3FHAA 1PMHX 4GD4A 2QLZA 5C4JJ 3HOSA 3VWBA 2VJ4A 4QKNA 1TNTA 4I09A 1NAEA 3GMEA 4DRRA 3LSPA 4BL0B 2FDGA 1FX5A 4KN4X 4GMP3 4AQ6A 5ERLA 3NNLA 1WHUA 4A0XA 4FPHA 2F5CA 3IHUA 1VBA3 5CBLA 3WF3A 3BPSA 4B48A 3IAPA 3T0YA 5T5PA 4B3NA 5DAQA 5HLHA 2IUWA 1PIV3 2P17A 4OYUA 1UU4A 4CICA 3K2AA 2ZGMA 1H1MA 3RSJA 3VZMA 5KHJA 1MJBA 5FZCA 2GN7A 4Z1VA 2CWSA 1S7OA 4KYWA 1RR7A 1OUXA 4ZC3A 1VQPI 2XAFA 3BIEA 3KT1A 4XUNA 3F95A 3VD7A 4AAXA 1H8TB 1UMIA 3Q9VA 3CJXA 1UHSA 3ZN5A 2BZTA 3LMMA 1IRXA 3H5NA 3ZYHA 2W08A 2Y0SA 2JDZA 1UZWA 3K46A 1GHCA 2BUKA 1W6QB 2PHLA 2MEV3 1W05A 2HGCA 3PM1A 4CGZA 5LW9A 2ADUA 4BE2A 1VBB2 3S57A 1TG7A 3OYWA 1YG2A 1MS8A 2DTYA 2D6PA 4AC0A 4CDUC 3PUHA 5A3LA 3MUY1 2A61A 2HBUA 2XHNA 1SBEA 2W9XA 3SFZA 1BI2A 4Y22A 1GUIA 1H2NA 5J3LA 2XONA 1VQOI 4FPEA 1COV2 2C6YA 1C5IA 2BFUS 3P5BA 2W00A 3N3HA 4XR6A 5AC92 3PO3J 4FE7A 2DK8A 5CKTA 1DQ4A 2JKXA 2JPBA 3CUQC 1GOGA 1A78A 4QPOA 5CFDA 2FOWA 1UG0A 5L19A 1IN8A 2R6QA 2X6OA 3I3QA 5IY5H 3VDXA 2WADA 2IFWA 3O7OA 1QPMA 5DS9A 2B5HA 3QPTA 4NPMA 1V9U3 1FIAA 2KHMA 2IGNA 2ZSIB 4HEA2 3DXUA 1YIFA 2RS52 1OURA 3TW7A 5GADJ 4YZ3A 4UFKA 5AIQA 3OY8B 4WXCA 2O8XA 3VHPA 5FP4A 1ODDA 4BMBA 1WJDA 1T8IA 3MV11 2M0MA 1HW5A 2E9QA 5FZ1A 5HBAA 3A23A 3O8HA 3RMYA 1YHFA 2XB6C 2L5QA 5CU1A 1MMNA 2HYFA 4O3MA 1NUKA 1JHFA 3D5RC 4GWMA 5L9BA 3K3OA 4A3XA 1F9NA 2WWSA 3WF1A 1VBE3 2EAAA 4AYBN 3M8FA 3KF5A 4CCCA 1U5IA 2ZNZA 1AX0A 5JPNB 1YTYA 2KPMA 4OI0A 1T08B 4BK5A 5FFXA 3D0JA 5FJKA 3THCA 3SZTA 2I10A 4EEFG 1WLWA 2E2IJ 1MMSA 1FBUA 5M3FJ 3G7DA 3T2PA 4ARXA 1MMGA 3AMHA 2DK5A 4CA0A 2V6EA 4JYKA 2Z5UA 3ZRGA 3ESWB 1OCRH 3HTSB 2EZHA 1FOD1 1STMA 3H5RA 3CIHA 5T5JA 4Y20B 3SEQA 2L9VA 3OS2A 3QYFA 4CYCB 4ES9A 4MUVA 4B8EA 1YQAA 1JU3A 2GZWA 3WDYA 4NQWA 4R9BA 5KXEA 1J0RA 5FFZA 5ANNA 1S6LA 3ZMSA 4LK6A 3LEMA 4PGGA 2O7OA 1UKGA 2NPIA 4LO8A 3QPHA 2FQ3A 5BQTA 3DUIA 3K7AJ 1BI3A 3VDDB 1YS6A 1KZHA 3IN9A 4XW3A 1AR61 5KWRA 3VYTB 1VQMI 4R4ZA 2CQKA 1OLQA 1GYKA 1V70A 3PFIA 3CZJA 2JJ7A 4A7ZA 5ABJB 2P3YA 2L0KA 2EBIA 1KITA 4RN5A 4PDWB 4CCEA 1BIAA 1GQHA 1M4WA 3O2PE 1B72B 3PMSA 3NJYA 1D4M1 4QM9A 3VYRB 3K4BA 1GXPA 2W3JA 3S30A 4XFBA 4LK1F 5FBJA 3E5UA 4F55A 2JDYA 2Q30A 3NAPC 3LDBA 3TEDA 1PO23 2CQXA 3L2QA 3K4AA 4DUVA 2DVFA 4MV2A 4IEYA 3DPRB 2DMNA 4D8MA 3FXUA 3ZN6B 2AHQA 1I3AA 3CQOA 1W6MB 1N1TA 4CVUA 1RUD1 3R4SA 1KXGA 3J26N 3VDCA 2HI3A 3WVJA 2RDSA 1RETA 1IRFA 1VQ5I 2Y60A 1RVF1 1APLC 2W87A 1D1AA 5FPUA 2CRGA 3GTJJ 3O6BB 3GTOJ 3O0VA 5BNQA 3ASOH 2W1SA 2ISZA 2VZSA 1X58A 1LKNA 4QX0A 5A2QZ 3UESA 3GGLA 2WSVA 3S8PA 3ZR8X 3CZUA 4JQRA 3T4HB 3HPGA 5JXJA 1HSTA 1QH7A 1SVMA 2A07F 3AM2A 4BUPA 3PNTA 1NHAA 5EDNA 2W1OA 4AI3A 2JE7A 2ELHA 1AR82 1HXS2 4C30A 2RKHA 2Z5WA 2PHDA 1TWGJ 1VJ2A 3PL0A 2FQ4A 2GNMA 4YM2A 4V2GA 3RI8A 1YIJI 1GNZA 3WW2A 3K4CA 3HBLA 4DQ2A 5C8WA 3GTLJ 1J5YA 3BTAA 3IPVB 3RRDA 4FFIA 3LSJA 2EPFA 5LRSA 3U1XA 1HDDC 5EF6A 4M71A 2A68F 2CDPA 4Q4X1 4K3UA 3BDDA 4FOQA 2XQXA 1VBC2 4FQZA 1ZR4A 4Q27A 1RC9A 2VL8A 1F1ZA 1EP0A 1L7LA 1ULGA 3HM5A 5GZCA 5J40A 1ZARA 1TNRA 2CDOA 1RUH2 4DZJA 3NO8A 5IK8A 5LY2A 5DUIA 3O1PA 3BG9A 4IE4A 4IV3B 5BNNA 1D2QA 4CEWC 3TEYA 2KQRA 1AR93 4KISA 1GP5A 3MFAA 4KU8A 3I4PA 4MG2A 4HYEA 2OPWA 1NE6A 1UN1A 4HXCA 4JAAA 5C9AC 3CC2I 4E8DA 2R7ZJ 1KRIA 2OF7A 3CP8A 3L00A 4FX0A 3DEMA 1PMJX 2WN2A 3CCSI 2MYSA 1W36C 2NMOA 3B00A 1IXSB 2R7OA 4HVRA 3HUGA 2L9RA 1TNSA 1JE8A 5CZKA 1H6YA 1UWWA 3L09A 2VNGA 1IG0A 5L73A 1TC3C 1A6CA 4II3A 4S05A 1PZ7A 2FSWA 1KU2A 4Y33A 1UKRA 1VQ9I 2YFZA 1MBFA 4K8FA 1NG0A 2QE3A 1LJ7A 4I0BA 4NBQA 2Y34A 4GXLA 2LY1A 1M1EB 1R00A 3WGGA 2K9NA 2PQ8A 3MF6A 3OG2A 3ELNA 4RYDA 4AHXA 2Y75A 3JBG2 2JG8A 1B4AA 1R1UA 2DT5A 3OYIA 3CCRI 1G9AA 2IXJA 3AL6A 1YHQI 2ARBA 3RKQA 1H2KA 2H1KA 2OPKA 1H9PA 4Y5SA 4PI0A 4IE5A 4D94A 1K7AA 4I99C 3IBMA 4CDWB 3ZX7A 4UBHA 2QQUA 3OSFA 2VODA 1V6MA 3BODA 3C7EA 4PIYA 3USSA 3K4JA 4XFIA 4E70A 4GKXA 1UYPA 1PMIA 4CCKA 3ZQGA 3B6AA 1OISA 3E97A 5EJ1B 1GFF2 1EUTA 2ZEZA 3TL4X 3NAUA 2G19A 1PVC1 1WA4A 2Y38A 3NEUA 5M5WJ 1TME3 5E8AA 1OLRA 5J6XA 4KG8A 3KYDB 2EIGA 4ZTFA 4HONA 4FVVA 3UL2A 3FWEA 5L3DA 2XJUA 5GM0A 1CPMA 4XL9A 1XNBA 3LIHA 5DAXA 5LBQA 1UU5A 1EH6A 1YYNA 4NRQA 4XDQA 2XR4A 2QDNA 3ETPA 4I01A 2VQLA 5A7NA 4KIGA 4XLHA 2ID3A 1UU6A 5KXBA 1YQ5A 4IV3C 3O14A 3CP2A 4YVWC 2X0LA 2DA4A 1Z6RA 4W50A 1PNGA 4ZZ5A 4GWNA 4Q26A 5H9SA 2JVHA 2D43A 4NHXA 1QJZA 1DDLA 1XC5A 1JZ8A 1CAUB 3H35A 1BK0A 1GZWB 4META 5JI7A 1ND2C 2XIGA 2VMFA 3N9LA 1DFQA 1GVJA 3SQOA 4GZ9A 4M0NA 5JOYA 1AR62 1ZK8A 1IS3A 4NIGA 5BPXA 5FXVA 3OYKA 1A8MA 3LIGA 4L5EA 3HHHA 1PX3A 4AFBA 4BA6A 5HODA 1IN7A 4OUEA 4XF3A 5K0UB 4BYYA 5D8AA 4G6QA 2MLGA 1WLDA 2K02A 4YZ4A 1LTEA 3WTSC 1JH5A 5DDGA 3RJ2X 4NHKA 2MSYA 4ZDOA 2V4VA 1VRH1 1J09A 1VR3A 4QDSA 3IAQA 3W2AA 5BNPC 2P5BA 2IS1A 4HN1A 4LEJA 3C8XA 5GZEA 1W8HA 1A36A 3RNSA 3I53A 3KP6A 3WNNA 4AVTA 2XKOA 1XSDA 1JTXA 1C4RA 1P7JA 1C0WA 3OYLA 1LDDA 3H1MA 1DU0A 2F4LA 5DUVA 5KBFA 4LKFA 1LHWA 1Y9QA 4M3CA 3EETA 3JSOA 1SVOA 1SD4A 3EUAA 3VBUB 3V7RA 3LSGA 3U4SA 2V79A 5ICGA 1Y6IA 1PIV1 4OLLA 5BNOB 3WUDA 4QXKA 3KVAA 1FOXA 3QU6A 5FYSA 1N75A 3B9IA 2ZXWH 2E53A 3OBAA 4CEWB 1D1BA 4CEWA 3DFGA 2CHHA 1UY4A 4AEDC 2KD7A 5E16A 1JYCA 5J96B 1AX1A 3M2MA 2WZR1 2MC4A 1LODA 5HS8A 5LBCA 2P2KA 3MIBA 2VOKA 1COV1 3G6EI 4CYCA 5L3FA 2ZGOA 5DCMB 3NAPB 2QBXA 3ZFGB 4H55A 5FXZA 1KDKA 1JYTA 1MEC1 4IEVA 1KS5A 3HOZJ 3KLOA 4W65A 3H8UA 2UYBA 2NM1A 3BALA 1G3WA 1KQ0A 3DGTA 2ZTNA 1YFWA 2IGOA 4I6ZA 4GH4C 4BPZA 5KC6A 5KC5A 1ENQA 1RUC1 1ZZBA 2W5FA 4B3XA 1OSGA 1D5YA 4X8PA 5FKOA 1Z7UA 4BHBA 3V0AA 5HCBA 2C4XA 3ILRA 3TNQA 3KQ4B 3L2HA 4BIOA 2VJ5A 2IAIA 2JK3A 4QWNA 4Q4X2 2GN3A 3LSKA 3GDBA 4CZZA 1RUNA 1G59A 4E7ZA 5FLJA 1IUYA 2WRAA 2K4BA 5CG8A 1QPIA 3ZFFB 2CV6A 4FFFA 1U3EM 1HIXA 1V3FA 2OW4A 1ZRRA 3MD2A 4XBNA 2VPVA 4YIFA 1K61A 4N9IA 3NJXA 4NWWA 1UMZA 3KWVA 4YW6A 1YW7A 2WS93 3EDPA 1XTAA 4MGZE 2W1WA 1GMMA 3POBA 3POFA 1JT0A 2M0CA 4H2AA 3LDRA 3ZPLA 4Q0VA 3B3QE 3M7AA 1XDSA 3HR9A 3FFZA 1ERDA 4HVQA 3N05A 1H9TA 4IEWA 3QH6A 2RAEA 2XPWA 2XF7A 1RR8C 4MYEA 1GWKA 3FL7A 5CVJA 1AKHB 5HDGA 4JDOA 5A33A 4LHKA 5EQUA 1UY0A 5FZ0A 2K40A 2WINB 5A33B 1VBD1 2VT2A 2WNVB 1IKQA 1KD7A 3L2UA 4AYUA 1HQNA 3AJYA 1ZYRF 4UBGA 3SCGA 1WMDA 2CL2A 5BNPB 1XDUA 4S2HA 1JTZX 5CJ9A 1AXZA 5IVBA 2JWTA 1W06A 2XG3A 2P3KA 4FFGA 2Y6JA 1UHWA 4HT1T 1NXMA 4XUPA 1SLCA 2HBTA 2ILMA 4IVNA 3JQWA 2I5UA 1FPN2 2CW0F 2R063 5DTDA 1GQPA 4D7YA 1CD3G 4XTPA 1HB4A 4BIFA 4N4OB 5F0CA 3FXLA 4Z2YA 2XJRA 3E3VA 2BYVE 2K9QA 5ILUA 2WKKA 4XJ9A 2L4MA 2HTSA 2RR11 2NAZA 2ZACA 2PG4A 5E89A 4ESBA 5FYIA 4XDOA 2DV9A 2VBZA 4OMZA 4MX3A 4Z82A 1F4KA 3TKYA 2VR4A 3MKZA 5HI0A 4LNVA 5LCWL 1Z3YA 1POV0 2DCKA 2BOIA 2IXSA 3AP6A 4LKSA 2LC2A 3H1CA 3S15J 4RLFA 3FDYA 3UR3C 4DBRA 3VHRA 2W48A 4YFXF 3M8EA 1ULOA 4E4ZA 2JMWA 4BQAA 2W46A 4Q2FA 3F8BA 1YEWA 2JICA 1NQJA 3KIOA 4A7YA 4XMIA 3O0XA 5HXVA 4PQ9A 3KQRA 3IDCB 3OEBA 4ENMA 4YVSC 3LFKA 4ZH4F 4KIBA 2NVTJ 3T1MA 3FMSA 2VOPA 4DPNA 1RVF2 4AQSA 3VBSA 2R49A 2Q2EB 5FKNA 4D0PA 3TEXA 4AK3A 1CAXB 2RS12 4QX7A 1C3HA 1CAXA 3AXDA 1OMIA 3FJSA 4LIVA 4JX6A 3SZGA 1G2HA 3HEFA 2GSYA 3QYBA 1GV2A 4HVOA 1H9WA 3SNMA 2ZX0A 4XQWA 1Q1VA 2KA3A 2CQ7A 2E7WA 5C4XJ 4NAOA 1QQIA 2XROA 1CQ9A 2EK5A 1SG3A 4B1RA 1UY3A 4NIDA 1HW1A 4D5CA 2XASA 2WLQA 4HPKA 1NQDA 2LS6A 4HBLA 1FP1D 3RI9A 4YW4A 3ZYGA 1NE4A 4AFAA 5K8SA 3I64A 2Y2ZA 2EJRA 2LKSA 1N77A 3JW4A 1EYBA 1POV3 2XAGA 4A6EA 1QJY3 2E31A 1BK1A 3WG7H 4MOAA 2M45A 3K77A 1XCVA 3ERED 1PGL2 5FZ6A 4XUTA 5FZLA 3CBNA 4W97A 1EAH2 2CY6A 1YJ9I 2WUHA 1H8VA 1RUG2 2OUHA 1W2AX 1AUYA 1U5TA 4O6JA 4GH4B 4IV1C 3GF6A 3PNYA 2FCUA 1HB3A 1SANA 3H8XA 5AFEA 3GALA 3TMOA 4A3ZA 1IG7A 3DLAA 1UPSA 1ZBE3 3RJPA 4MQVA 3Q9SA 5LK5A 3LGRA 2VO5A 5I0RA 4OFGA 2IPQX 2ZEXA 2ZEWA 1TZLA 5FP8A 3I3MA 2M4KA 3B01A 1OYWA 2P81A 3CCJI 4AVAA 1O3SA 2W85A 4AE2A 1MH4A 1B35C 4CUGA 4UY8I 2BBYA 1UF2C 2WNOA 5J1XA 3BTCA 1MACA 1XSRA 3CEWA 1DGRM 4A5NA 4DBQA 4S2FA 2L7ZA 1SFXA 2COMA 5GZGA 2M34A 3ES4A 4BZ4A 4N9HA 1ETWA 1SEFA 4F52A 1T33A 2X09A 5IP9J 4N43A 1K5MA 1WZXA 2QFEA 1DYPA 4ASMB 1FJLA 3AKZA 1TL8A 5FZEA 4UV8A 4RGXA 3RIRA 2VKVA 4KITB 4N53A 2WL1A 1D3YA 1HKSA 3V42A 1UELB 2R4GA 5C70A 3USUA 1O4YA 2A6HF 5HLGA 4LO4B 1RINA 2Y30A 1H9GA 1O3QA 1REDA 5F1JA 2ZHLA 4QPIC 4UFHA 3WTYC 4CTEA 3OBTA 1OC1A 2DA1A 3RQ4A 4N0BA 3LOCA 4OVEA 4E6KG 2KKOA 4MEXF 4E7SA 1D0HA 4CHUA 1QEXA 3WCRA 5F39A 2WNUB 1TQ5A 2IT0A 5FY5A 4A3FJ 4ZU7A 2EV6A 4PIZA 1V9U2 4HF0A 5HNHA 4HLTA 4G9YA 3WG2A 2W7NA 4EZ4A 2MW8A 2D97A 1ZG1A 4WVZA 2ME6A 3POYA 2JIGA 4GA9A 2EFOA 3OS1A 2EZIA 2OQ6A 1DGLA 3ACLA 5F9TA 5E3LA 4XFFA 5EZWA 3PU8A 2E1MB 3SCFA 4KN7X 4N7UA 2O8KA 1W8WA 3AMMA 3J7ZI 3A7QA 5A3WA 3BZKA 4HG6B 4DW6A 2LF7A 3F23A 2DMQA 1LGCA 4Q4Y1 5FYCA 5KAIC 1VQNI 2VZOA 2CO5A 3S2WA 5TJJA 1OH3A 4RAYA 4IEUA 5FRNA 1DZQA 2GU9A 5F5IA 2DFBA 2MHFA 3POSA 4HRIA 5EG0A 2E1NA 2HU9A 3W21A 4P9WA 3GX4X 3FXQA 1R4NB 1Z21A 4XKBA 1VBB3 4LKEA 2A6VA 1Z1DA 1MPXA 5FZIA 3FHQA 1HRV1 4U0WA 1RIOH 4H7MA 3BTXA 1GVDA 3W2VA 1ZA4A 1G9BA 3VYSB 3DPRC 4KIFA 1W8ZA 1W9SA 2EIDA 4DB5A 4TYSA 2GH8A 3WDXA 1CWPA 2MH9A 3FLTA 4PF1A 1XRUA 1OQEA 1QMJA 4ZDLA 4YM0A 1JI8A 3WHBA 2GALA 2FRHA 1P4AA 2BU9A 4EN8B 4HKLA 2RMU1 1YQ8A 1I1EA 1UZZA 2J1SA 1WWXA 1W2NA 4CEYC 3DWLE 1WW4A 3ASIA 5LD2C 3BOWA 4J01A 2VMDA 5I0DA 3B02A 2X1EA 3WT3A 5L3BA 3PO2J 4XYXA 3IMMA 3L7WA 1UZ0A 2LDUA 1IPJA 5EFUA 1CF7A 1FTZA 1W5SA 2B9SA 1PGW1 1WD3A 1Q1HA 4XDPA 1JKRC 3S2DJ 1LAJA 2DW4A 1JN2P 1W8FA 1QRYA 2YHJA 3KV5A 1SBFA 1ZREA 2IVJA 2DCZA 3A21A 5BS6A 4YFKF 3I54A 2WY7Q 4RB2C 3Q8BA 5IVCA 4LO7A 4RGAA 3ACHA 3DPLC 5A80A 4NN0A 2Z99A 2DQRA 4ZY9A 3WNPA 1X1AA 3SLIA 2FMDA 4GAZA 1FP2A 2VC1A 3T08A 1GLHA 1IDZA 4QU2A 3NV2A 3ZN6A 3DL3A 1I50J 4BJ6C 1MQTB 3KFWX 4HNTA 2WBMA 1MZ5A 3NW4A 3VUOA 4UXNA 3A01A 3HOXJ 2GC2A 1E17A 2X51A 4R4XA 2HNHA 1A6QA 2HXOA 4IX7A 4HETA 4LA2A 2DTWA 4UNOA 2B39A 2WZR2 1C8NA 3IAM2 1W04A 4ET7A 5C3SA 1AJKA 1UOFA 2DFCA 1IW7F 4NIHA 1ZYBA 4U36A 2YXSA 2KISA 4LB5A 2IFRA 5DM7F 4C2MJ 3VSKA 1W9FA 4JGZC 2O03A 1OT5A 2JD4A 4AVZA 1WPKA 5D5XB 3LSIA 1K4TA 1QXPA 5J48A 2BVMA 1OOPA 1KYZA 2WWYA 2P1BA 5CB7A 1H2LA 1VPHA 2YZ4A 3R6SA 1Q8SA 3T09A 1YC61 2LMDA 2LG4A 5CVVA 4AD9A 2IVMA 1UYXA 2C5DA 3O5SA 2F6CA 5FYYA 4BLJA 2BJSA 2WJSA 2XWBB 2EXJA 4JP0A 1RMU3 2UWBA 4QX3A 2I8DA 4TLFA 1OHFA 1HQLA 4BXFA 4E7KA 3KF3A 1VBA2 1Y9MA 4P96A 1ZA7A 3B7MA 1UAAA 1VNDA 4LO6B 2R071 4QGMA 2D5HA 2AR6A 5LGNA 2F4PA 2K9MA 5JPMB 4OZOA 3LNQA 1ZGJA 5CG9A 3F0CA 1AL22 1G7YA 4HSRA 3N7LA 4AXOA 1YOVB 3SHFA 2VZPA 4Y3OA 2YV8A 3GHNA 3VB9A 1X36A 1T38A 2Y9YA 1KEXA 2ZX3A 5HCHA 2QQBA 4RAZA 4MGKE 4QT6A 1WJBA 2Y0OA 4MGRA 5A1AA 2ELKA 5A6XA 1C8M1 2QA4I 5FO9B 3E5XA 4PLOA 3S16J 1AVBA 4DS0A 1LHNA 3OYAA 1YJKA 1SACA 2UWCA 4CSWA 2WLPA 3LWCA 4MGQA 1SCRA 5LHHA 5ILSA 4Q48A 4XXPA 1TNFA 4IL7A 3MDPA 4XJ8A 2R7QA 1Y43B 4C1WA 4FPYA 5CPRB 2OPTA 4ZHNA 3ZR6A 3RPUA 2EFWA 2G9WA 1SMYF 4COYA 4WM8A 3ZSKA 3IH2A 2WR9A 5IVYA 2FEZA 2W4SA 1I3HA 3VN4A 3OYCA 2JUGA 4LG3A 2VW0A 2JD9A 5FO8B 4IQJA 5K1YA 2XGEA 4FETA 2VIXA 5FY8A 1WJAA 2LOOA 2PLV1 3CMEI 2ZX2A 2JXAA 3ZXAC 3ZLIA 3FLRA 3AYEA 4URTA 1E3PA 1JUSA 5IUQA 2K9ZA 3DU6A 4ASNA 1W6PA 4V19K 3GFJA 4AI2A 3NWSA 3TO9A 3JSPA 1W1WE 5DMYA 1QDOA 3THTA 2JG8C 1B35A 3FXKA 4ASLA 4JGYA 2ZABA 4UFJA 4LK7A 2Y6KA 3M3EA 2ECCA 1HDKA 1TQIA 5D5UB 1VI0A 5GAEJ 1KFUL 3GBGA 3WDVA 2QCSB 2ZHMA 2M7AA 3NSTA 2XGXA 1IZ3A 5FYVA 3WUCA 3ZDSA 4N7IA 4DXRA 3GZUC 2QQAA 4NHMA 1W5TA 3TQNA 1TMF1 1ND3A 4GQ7A 1G3TA 5E6HA 3DYMA 4WVMB 3WNXA 2K0GA 1S0EA 3K4MA 3I9V2 4JQTA 2ZKLA 4Y1ZA 1QHGA 2LVSA 1WJCA 2W1UA 2F17A 3SITA 2KMUA 4AL9A 3PNAA 1F5FA 5LEKA 1W03A 5BPIA 4XIDA 4BDYA 1FYUA 2J1AA 5GPAA 1I5PA 5B2GB 3OS0A 1UB9A 1K45A 3CO2A 2LSOA 1X9PA 3B94A 2ZBJA 2EZLA 4N53B 2QZ3A 3OPWA 3AZVA 2IC1A 4FOWA 5FLIA 5FZ4A 5CFDB 3OSDA 1JZ5A 3TBIA 3V0BB 2EQRA 2X1DA 5EEHA 4QXCA 1LOGA 1W7PB 1W4MA 1J1TA 3HWJA 1NCQB 4XF1A 4PHZA 2VKDA 2BNNA 3JAMZ 1RUE2 4Q4V1 3FK7A 1PO13 2WAFA 3LAPA 2XVGA 3K2OA 1JYNA 2PFBA 5FY0A 1PYVA 5H9QA 1WBLA 3I59B 2WO3A 3C2GA 3EB7A 2YUEA 3B6CA 1O8PA 4RGKA 1G8WA 1H88C 4YFZA 2B9UA 4QQLA 5FZHA 1AKHA 4AVBA 3BQYA 1TWCJ 3PHMA 2C0ZA 3WP3A 3VDDC 4PQQA 5TGTA 4M3CE 1DU3D 5HCAA 4RAFA 3PUAA 1V6JA 2XJVA 3I4NJ 4KWKA 3N7JA 4FQGA 5A3TA 2VCCA 4PCRA 4JBAA 4YLZA 3JREA 2QGUA 3LFMA 2YDEA 2JIJA 5F6LB 4UYBA 2Z2SB 3N9PA 2IJLA 4RGUA 4HV5A 1FLIA 3J81Z 1VBD2 4OI2A 3WGHA 3J80Z 4BS9A 4LPLA 3GM8A 5I91A 1D0XA 4XRMA 1UAIA 2A1XA 1CIWA 3BG5A 1R093 5B4XA 2IXHA 1TTYA 2K3FA 4XEZA 3UJOA 4CDQA 3HIFA 3EQEA 4A4AA 2A5ZA 1HX6A 4BCUA 2JX9A 5FOBB 4SBVA 4J1WA 4XONA 4FOYA 1BJQA 4P14A 4AIHA 4LG0A 2VQ0A 5IT9K 1H8TC 4O9GA 2PN5A 3IKTA 2JDKA 3AP7A 1IZ1A 4M3BA 2Y0IA 4JKKA 1J1LA 3RG0A 2ZNYA 3GYHX 2DA6A 3BVCA 3UYJA 1ZG3A 2JB4A 2ZXQA 2B9VA 2RR12 2JDHA 4XSZF 2DCJA 3TNPB 3HMYA 4CDGA 3M3CA 4K6BA 3U10A 3K1NA 3I2GA 3LA2A 1GANA 1RHI1 2DJNA 4X8NA 1SLLA 1O8SA 3K0LA 2VY0A 4XACA 1HRV2 4PDWA 1NY71 1QZYA 1OOPC 4AZZA 4QPGA 1H2MA 4GYGA 2CWEA 4IERA 4QPGB 4IHXA 1JT6A 4OMCA 3CCEI 1LOCA 2E26A 3F8MA 3ZYBA 2Y0MA 3H3VK 2OU2A 3J80K 2GC0A 1MS0A 4DGWB 2XB5A 2OJED 1C5HA 2CWMA 2VKEA 1AYN3 1V6IA 4KWLA 1QU3A 2HQNA 5J09A 4XMYA 3ZN4A 4FPGA 2BV4A 2RV8A 2MBFA 2CV0A 4B43A 2OTLI 2AZ5A 3ECHA 3HQRA 1HRI3 1V5GA 3CLPA 3S1MJ 3M3IA 3HSRA 2HWB3 1MQTC 1REEA 4RBOA 2HVQA 3D5SC 4YW1A 4L9JA 3GTQJ 4EZHA 3RZKA 3ZSEA 4E8CA 1FOYA 4AWXB 2XB0X 3OIQA 4ATEA 2BVBA 5ACA2 1IRZA 4BOWA 4G7OF 3DPTA 4FP3A 1Y3TA 2XLGA 1K5JA 3E0JB 5D4SA 1P6RA 2R3SA 4X6AJ 5IK5A 2R7VA 2B46X 3C2HA 3M1CA 5D5VB 3ZXFA 2QQNA 5L3EA 1Z0XA 3JXSA 4XNFA 5A1LA 4LIUA 3PLQA 3AZXA 1QHHD 5E17F 4AFMA 4OCTA 1TT0A 2Y6LA 4G6DA 5HCFA 4RSUA 5IYCJ 4INDA 3GHMA 4C3HJ 2P5LC 3V56A 1JBCA 2K5CA 2WNUC 3W59A 3LKJA