1O3RA

Protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
200
structure length
200
Chain Sequence
b'DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'
publication title Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 64
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o3rA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o3rA01
3I59A 4IERA 2XKOA 3H1YA 5I8SA 2ESNA 4Z2YA 5FCCA 2ELHA 4HF1A 2CFXA 1ZRRA 1WRJA 2XL7A 1ZX5A 4XETA 4LG0B 4PJYA 1ZZ7A 4LLOA 3K1NA 3C1DA 4DNCA 1SD4A 4I3PA 2O03A 2DK5A 2OA2A 3CO2A 2CSOA 3LA2A 3GYHX 5JFRA 1LDDA 2EA7A 4XFHA 1XCVA 2DK8A 3IWFA 2M30A 1ZNPA 2D1HA 1RZ4A 4L2NA 4XBFA 3F6VA 1R1VA 3MEXA 5CJ9A 3KLNA 2YPRA 2QCSB 2BBYA 2XAFA 4LEJA 2F5FA 3HHHA 3JZVA 3W6KB 4L0YB 4EVIA 3RJPA 1EH8A 1OKRA 4RB3C 1GXQA 1IRFA 3TGNA 4S05A 2ZO4A 2R3SA 3L2CA 3HT2A 4LJZF 4HLTA 2CAVA 4EQQA 2GQQA 1S8NA 4A6EA 2VC0A 2QENA 2Z33A 2V79A 4J1WA 2FBIA 2FBHA 1G3YA 4K8FA 4AIHA 3PVBB 4GYGA 4BIFA 3C18A 1BI1A 4M73A 1H9GA 2IA1A 1W5TA 4P9FA 4MTEA 3EQEA 1XDSA 1IN7A 4O3MA 2DW4A 3U1DA 5FFZA 3IIAA 1R00A 3WU0A 2V9VA 2D1VA 1BI3A 1YFYA 4CDGA 3QP6A 4A5NA 2EJRA 2ACJA 3LQQA 1ZLJA 3ACLA 4XSXF 4IHTA 3H50A 1BJAA 4UNOA 4OMZA 4Q0QA 4AWXB 1IPJA 3IC7A 1RUNA 3RDIA 3FXQA 5F6FA 3EYYA 1O57A 1IRGA 2UYBA 2IPQX 2K0GA 1TQMA 2PAMA 3EO6A 1ZN2A 2K02A 2RVCA 4Q0SA 5D5UB 1MKMA 4KYWA 2Y75A 4YG2F 4ORFA 1XB4A 3MQ0A 2Y48A 1HXDA 1FX7A 3U10A 5FPXA 2VONA 4BHPA 5I93A 4BXUA 2K7LA 1QO0D 3IBMA 5CVRA 4MQVA 2FBKA 1NE6A 2Z2SB 3GWZA 4PIYA 2BEOA 3M7GA 1OI6A 2PMHA 4HVOA 4N9HA 4KFCA 2W24A 5J3UA 5DD4A 1FYMA 5ICCA 2E7WA 1HW2A 5H20A 1YQAA 3SCGA 5LEJA 5HS8A 1OFNA 2XAHA 1FT9A 2MA3A 3GEZA 3QU3A 1ZARA 2HKOA 2VOOA 2V6CA 3DXJF 2JZYA 4OIOF 3K9TA 3HIFA 4AQ6A 2D45A 5BOXA 4KT5C 4MEYF 4YARA 5FLHA 5J7MA 5CU1A 2KJCA 4LLGF 1J1LA 1YFUA 4RGSA 4ZYDA 2VPVA 2IXKA 5TJJA 3QRFF 4KUMA 1NZCA 1TTYA 2RN7A 3CO7C 1BC7C 3CUOA 1DZTA 5CADA 2IP2A 2VODA 3FZ3A 2ZJ2A 2QNKA 1HKTA 3ROUA 4ZH4F 2NNYA 5T3NA 5KHGA 4RGRA 2PI0A 5C6CA 3KP7A 3JW4A 2IW5A 4PDKA 2ISYA 1D3YA 1SFNA 4U0YA 3K1MA 3QPTA 4O9GA 2R7FA 4WK8F 2CGPA 1OYWA 2ZKZA 3R0JA 5AONA 1E17A 4R1HA 3SMHA 1LB2A 2O8QA 1CF7B 4EJWA 1T39A 3NQOA 1ZGJA 3WW3A 1O3SA 1YWKA 1EYBA 2PQQA 1WQ2A 4IF4A 3V8LA 1Z05A 5KHKA 3CF6E 3U0ZA 1BIBA 4HF2A 2YU3A 1ON1A 3V4GA 4GULA 3KP5A 4ZU4A 4ESFA 4IEZA 4K2EA 4PZJA 1QY4A 2VT3A 4ZZLA 1R5HA 2L02A 2HGCA 2X0LA 3HTSB 1NYWA 3C7JA 4AIKA 3H1MA 2FMYA 1WSUA 5D8KB 1P92A 3LAJA 4HX7A 2GH2A 1SD7A 4Y17A 1J59A 4AIJA 2PJPA 1B9NA 2OD5A 5BXXA 2PHLA 5FLIA 2GAUA 3B02A 1UCRA 3WTUC 5FQ0B 4BNCA 4L9JA 2XROA 2QDRA 4Y13A 3WGHA 1ZAOA 1D8KA 3AAFA 2IXLA 3F8NA 4RGXA 1GQHA 1XGMA 4LK0F 4O5VA 3ZQ7A 3GFMA 2IC1A 3GBFA 5H6QA 2PAEA 2P8TA 2OZJA 2EV0A 1QGPA 1NE4A 1P2FA 2VXZA 1FWZA 1PDNC 2GC1A 3H7JA 2HDCA 2E7XA 1XSDA 3MFKA 2O61A 1HKQA 4HQEA 1LR5A 4HX4A 2O6GE 3HT1A 5K1YA 4OLLA 4CO8A 1T0FA 4AVCA 2XV4S 5KHHA 5DCFA 2A68F 5DEQA 1XDUA 4E70A 1QPMA 1J3PA 3O3KA 3DN7A 3M1EA 4HDVA 1J5YA 3KSCA 4AXOA 1ZZCA 2GA2A 4IEQA 4ASNA 3N97A 2HJIA 2GXGA 1YTYA 3GF2A 4HOBA 3L2HA 3JAMZ 2PAKA 3Q9VA 3HUGA 3HSEA 2OA4A 2CQKA 4OFGA 1YLFA 4MGKE 4B09A 5BY5A 1U5TB 2XLGA 3CJNA 2V1DA 3LA3A 3E3VA 2MD5A 4HX8A 4XFAA 2AXLA 3WTYC 4OINF 1QZYA 2BV6A 2F2EA 5K8SA 4ZZDA 2LKPA 1CAVA 1W7PA 3ULQB 3K0LA 3V8KA 1OMIA 3ETQA 2EA2A 4M9SA 4TV7A 3I5UA 4UVCA 3V8JA 2PLYA 5D8LB 1TNTA 5FLXZ 3MYXA 1KYWA 4UUVA 1WA4A 4IESA 3UKNA 1KYZA 2YX7A 2EFWA 3EUHA 2KIFA 3ZMZA 1K79A 1G4DA 1NXMA 4UBHA 1BC8C 4NQWA 5DUKA 2EFQA 4A0XA 4LK1F 3VFZA 2QM3A 2GU9A 4OIPF 4QMAA 4LLNA 1ZZBA 4A5MA 4G7OF 1LNWA 1J0RA 1T98A 1DGWA 4P9GA 4Q48A 2ZNZA 1ZVFA 3KP2A 3PNAA 4O6JA 1FNNA 3F8MA 2EAAA 3R6SA 2L54A 3MCZA 3FX3A 2P17A 1KU3A 3F8BA 2Z9OA 3ZDSA 5HLIA 3QAHA 1X8EA 1RIOH 2D5HA 1W5SA 1U78A 4HSLA 2PTMA 4PGHA 5CYVA 4M9ZA 2KKOA 5KHJA 4U0WA 3IDBB 4MV2A 2GC0A 4RB2C 3HHGA 2EVXA 3R0AA 5LHIA 5BPXA 2DLLA 2E9QA 2P5LC 1U6GA 4CICA 1CAXA 2DI3A 3VHRA 1X82A 5E8IA 2CWEA 1K78B 1FP2A 3HSRA 3CLPA 3MAJA 1CAXB 3JTGA 3P9KA 5FGMA 4Q29A 4OMYA 3RPUA 1SD6A 2NNNA 1R1TA 3NEUA 4JV4A 2GIVA 4HV5A 1JXSA 2QUFA 1J3QA 5E1RA 1Z1DA 4IEOA 3KETA 4HN1A 2XAGA 4KIGA 1SAXA 2BNNA 2Z69A 1IN4A 2PHDA 2H94A 3UKTA 3LSTA 1IUYA 3K1PA 2A5YB 3WODF 1XE7A 4EJTA 2XASA 4L9VA 3TNPB 4RB1A 4KU7A 1T38A 3RTRA 5HLGA 3BALA 1VP6A 4LG0A 1DDNA 1I27A 3I4PA 4Z82A 3LAPA 3CTAA 4HLYA 1CGPA 5I8YA 3HYIA 2FEZA 4ENMA 4LULA 5EEGA 2VECA 4I98B 1EH7A 1TW2A 1ZG1A 4KU8A 3V7CA 1UCXA 5I0TA 2ESHA 1I5ZA 3KGZA 4I7HA 1ZZ8A 4RB0A 5D5VB 3PQKA 4JTOA 2K4BA 2A6HF 1PP7U 1R7JA 3LWCA 1DP7P 2UY8A 1Y9QA 3WW2A 4G9YA 2HQNA 3F3XA 4HAMA 4JTNA 1O7FA 4OIQF 4XEZA 4U0VA 1YS7A 2O0YA 3TQNA 3MZHA 2EK5A 5FB2A 4H0EA 2K4JA 3ZMTA 5BQTA 1XRUA 4AVBA 3BJOA 4FBFA 2OBPA 4OOIA 3HTUA 3H3UA 3H92A 1FOKA 2Q1ZB 4L9TA 2P6TA 4RAZA 2BNMA 3M3IA 2P7CB 1LQ1A 3ABTA 4LTAA 5EZWA 2IVMA 4QGMA 1MJBA 3ZP5A 2DPDA 3KZZA 5EFUA 1DUXC 2QVOA 1QZZA 1YW9A 2DQRA 4KWJA 2QBYB 1EH6A 1Z6TA 1B59A 1WI9A 2GXBA 1KU7A 2COMA 4LA3A 3OV8A 3RNSA 1SFXA 4ENNA 4M6YA 3K69A 2M8EA 1AOYA 2JPCA 4EM1A 1HQCA 4S04A 4M6XA 2CO5A 3IHUA 3IRRA 2QJVA 3CUQC 1VR3A 1ZHFA 2VN2A 1ZRCA 2LF8A 4MNUA 3JSOA 5IT9Z 4RS8A 1FSHA 3ZMSA 4META 3O14A 4N0BA 2HTJA 5D5XB 5HS7A 4Q0UA 2FMLA 5ILVA 5DYMA 3D82A 3BPVA 1MDMB 5FO5A 4CGZA 5JHUA 1T6SA 4WWCA 5JSPA 2B8MA 1GQGA 4XLPF 4YFXF 4GGGA 4XF0A 2QWWA 1XSXA 4QM8A 3RYKA 2DTRA 4HN0A 3SZTA 2LNBA 5KVRA 1RL3A 2F4PA 1O3TA 1XMKA 4QX5A 3G7DA 4IRGA 1YUDA 4MGYE 1Z6RA 3JSPA 3KFWX 3JTHA 4HSJA 2NYXA 2QQBA 2H27A 2GA1A 1G3TA 2F5EA 3WTVC 3I54A 2XIGA 2D40A 3QP5A 3ZN1A 1J9IA 2HFHA 4IEPA 2QQ9A 1ZG3A 5DDGA 5BV6A 2QZ8A 1AWCA 2F5CA 5HOOA 1ZG5A 1UW8A 1XN7A 4ENJA 1YFHA 2PBIA 4IEWA 2X4HA 1FI2A 3OTFA 3G3ZA 3MWMA 5DV5A 1CX4A 3KP3A 3WTWC 4BH9A 1IAWA 5FD5A 3GX4X 2W57A 4HF0A 3WGIA 2UY9A 4D7TA 3BZ6A 1VTNC 5ICEA 2MH2A 4WZCA 4HBLA 1H9TA 3GZ6A 1OR7A 1FLIA 3BDDA 1WGPA 5L3CA 3JAMK 3TOAA 5K5RA 4HV6A 3E6MA 1O3QA 3WE2A 5K5QA 4A0YA 3EBRA 3RZZA 2L4MA 2H6CA 2W25A 1MGTA 2NRAC 1I1SA 3LAGA 4EWEA 2ZCWA 1QWRA 1L3JA 4G8XA 1JUHA 4IETA 3DV8A 2A69F 3KE2A 2N7GA 3RYPA 4EGZA 4X6RB 5J8CA 3F21A 2J5OA 4G7HF 3R61A 4ENKA 3GFLA 2OAZA 4IEVA 3SCFA 1UHMA 3BPZA 4WXCA 1CF7A 1OYYA 4AVPA 2IT0A 3FM3A 1V3FA 3GFIA 1S7OA 2DT5A 3DL3A 4MUVA 3BROA 3NVCA 5LHGA 2Q0OA 2P4WA 4HQMA 4HW0A 1EY2A 1X3UA 4BAYA 1Y3TA 4I09A 4E2GA 5BUVA 1IN5A 4F8AA 1YFWA 5CVJA 4P96A 2PEXA 3M8FA 1QBJA 1S3JA 4EJOA 5CVIA 4HBNA 4FHTA 2MHFA 1IN8A 4IRHA 2WWYA 3VOEA 4D7SA 3PFIA 1CAWB 5HS9A 4F7ZA 4CXFA 2Z99A 1X7NA 4D0PA 2GC2A 2QYOA 2VBYA 4MGIE 1KA8A 2QVSB 2DU9A 3LOIA 2MLKA 3DP7A 3DPTA 2G7UA 4PIXA 3VODA 1J75A 3TO9A 5E1ZB 4MX3A 1Z9CA 5FQ0A 4A12A 1FC3A 1LEAA 3SFZA 3S7EA 4HYEA 4YSFA 4WX9A 1LKNA 2ISZA 3ST7A 3BWGA 1U8RA 4P9UA 1RUOA 4FX0A 5KK1A 1R58A 1S29A 1CAUB 1RGSA 5E1XA 3TDUC 4G6QA 1LEBA 4IVNA 1IXRC 1W7PD 2ZMEB 3QACA 3WTTC 3WW4A 3SXWA 2M1BA 5LGUA 2MBFA 5E18F 2VE9A 2H09A 3BPXA 3WTSC 3HQXA 1FZPB 3D0JA 4UHTA 1UB9A 4PIZA 5JCTA 3Q5FA 1DGRA 2LF7A 2ZBKA 4A2UA 4L11A 4X6QB 2ETEA 1L0OC 2FU4A 1LDKB 3RKYA 3HSFA 3RKXA 2W85A 3M8EA 2B9UA 4A0ZA 3J81K 1ON2A 3KMHA 5HI0A 1SQ4A 1QNTA 4I0BA 4UVBA 3NRVA 1TLHB 1U5TA 1R36A 2W84A 4EM2A 3R60A 1PM7A 4HLXA 2DCTA 2QLZA 2XRNA 3OOPA 5LGNA 3I58A 5LBQA 4WF2A 4DINB 2L3DA 2XLAA 3GFJA 2UXXA 4Q0VA 4XFGA 2FA5A 3CLOA 1ZLKA 2RNJA 3Q9SA 4XFFA 3HOSA 3N4MA 1HKSA 1JGSA 2ADUA 4IXAA 3TO6A 1H1IA 2MPFA 4YIIA 4ETSA 5DUIA 1V4RA 3VEPA 3GXOA 1YFXA 3I71A 4G6DA 2Q8KA 2EV6A 5BMZA 5L3EA 1XGOA 4XFCA 3S0MA 1YW7A 2XHKA 2MC3A 5E8GA 4YFKF 3E5UA 5IT3A 2VBXA 1ZZ9A 2DQLA 4Q4ZF 1BI2A 2VT2A 5ICFA 5HDKA 4HVQA 3FJSA 1E2XA 1S7AA 1BBYA 2A61A 4L0ZB 3EDPA 4R8HA 3TDZC 3OCPA 3GVAA 3OD0A 4XF1A 1USSA 1IPKA 1D5VA 2VQAA 1LDJA 2HQRA 1STZA 1P4WA 2WTEA 4QLCU 3DKWA 5J8FA 4IEYA 1L3LA 1O3RA 3WTZA 4IJAA 3P9IA 1Q1HA 1J58A 1KU9A 4A6DA 3IL2A 2E1CA 1ODDA 2ZNYA 3FMSA 1YW8A 2FRHA 4BQAA 2ETHA 4ZYEA 3W6JB 5L3FA 3J80Z 1OD5A 4DQ2A 4YIFA 4MHGA 3COAC 2PMUA 3DEUA 2ZKLA 4MTDA 3FE5A 3EETA 1DPUA 1LRHA 1OYIA 3P7NA 1G3WA 5FD6A 1KQ9A 2D93A 2JT1A 2CV6A 4ZYGA 1REPC 2OQGA 2GWRA 4GO1A 2QQAA 3F23A 3GYDA 2VE8A 4XFBA 3SHRA 3T1BA 4OIRF 1K78A 4YNIA 3QOPA 1FYLA 1G3SA 1KQ0A 4GYIA 1R1UA 4I01A 1YO5C 4RAYA 2STTA 4LB6B 3O6BB 5DCMA 5I91A 4Q5SF 4UVAA 4M74A 2CW0F 4GXOA 1QQIA 4LFUA 4QM9A 1TW3A 3MZYA 5DCMB 2HYGD 1UD1A 2B0LA 2RGVA 1ZREA 3QPHA 4H7LA 2HWVA 1XGSA 2ET1A 5ILSA 5DD8A 1B4AA 1SMTA 4L5JA 4EJUA 4E2SA 1YG2A 2NAZA 1KQ8A 1F5TA 3V7RA 1J7KA 3F6OA 3E97A 1TQPA 2RV8A 5L3DA 4M72A 3ISPA 1YIOA 3H9AA 1YHFA 5D6EA 3ZMUA 3F72A 2DBBA 2UZKA 2ZFWA 1YYVA 4XF9A 1RI7A 2IXCA 5L3BA 2FXAA 5HDNA 4QXKA 1MJAA 1Y0UA 1XCBA 1UFMA 2P5KA 2FF4A 2Q30A 3NSTA 1ONVA 1R5GA 1TBXA 4MGZE 5E17F 4UXNA 5JVTA 5LHHA 2O3FA 4XSZF 4IHSA 1MZBA 2K86A 3CUQB 1IZ1A 5ED4A 3H8UA 2KIMA 4IEUA 4L9NA 3EJKA 2C0ZA 4XF4A 5KBFA 3WU1B 2YR2A 4LA2A 4EMSA 5JAXA 4KNYA 3NL1A 2PA7A 3BCWA 3I59B 2Y0OA 3MPBA 3GLXA 3F22A 3ELNA 3U2RA 4I0AA 2BNOA 4IEXA 4N9IA 4HZFA 1RC6A 1A04A 4UXAA 4FAHA 1U2WA 3FWEA 4LGWA 1ULYA 5HVQC 3K2ZA 5F1RA 4AD9A 3T8TA 5LEKA 2G9WA 1C0WA 2Q4SA 4AVAA 4QGNA 2PN6A 1BOAA 2QBYA 2HYFA 4FT8A 2A6EF 5LLQA 1VJ2A 6PAXA 2WC2A 4ONUA 1F9NA 2V09A 1HW5A 3D0SA 3RI4A 1IN6A 3CDHA 1EPZA 3ZMVA 3J7AO 1O5UA 1UPIA 5HDGA 2F5DA 4XLNF 1FBSA 1FY7A 3KEOA 5EEHA 4MZUA 5E16A 2Z3YA 1R23A 2MNGA 1SFUA 1FXZA 3ELKA 4JQFA 5BPDA 2L01A 1FPQA 3WE3A 2C6YA 1MDMA 2HOEA 4PCQA 2GC3A 4Y15A 5TRDA 3LWFA 3SQNA 2RDPA 2J5PA 4J1XA 4BHBA 2OU2A 3L7WA 3SHFA 5HLHA 3OGJA 2EA4A 3I0TA 1IW7F 2H6BA 5D4SA 3FZVA 1JE8A 2V1XA 2DFIA 2VC1A 3KP4A 1SFEA 2CG4A 4P55A 4NHJA 5D4RA 4IPAA 3T0YA 3FHIB 4L18B 3BU7A 2GZWA 1GHCA 3RYRA 3NJZA 3I7DA 2IJLA 1W4MA 3GZ5A 3T5XA 3ZPLA 3TOBA 1GVJA 3GW2A 3ES4A 5A2QZ 2XVCA 2LSOA 3H7YA 1G6NA 1P6RA 5ERIA 3UKVA 4EJVA 2M45A 4IRIA 3ABUA 2A07F 3RIRA 5FPZA 2A3SA 4MEXF 1IXCA 1EP0A 4XRFA 3NW4A 2JSCA 4ON0A 2OPKA 2VBZA 4EM0B 2VOPA 3ML6A 2PFWA 3IRQA 4LD5A 3LA7A 4PGGA 1BM9A 4LLLA 4ESBA 2HR3A 4Q0PA 1P4XA 3HRSA 1BIAA 4AQ2A 1IF1A 1HW1A 1TQ5A 5I0RA 3LQRA 3D5LA 1Z7UA 1J2XA 2Q0AA 3L00A 1LVAA 1MD0A 4FX4A 5CVUA 1V70A 2HTSA 3IWZA 4WXDA 2XAQA 2P5VA 2HKXA 4WCGA 2MH9A 3BJAA 1WWXA 4JK1X 1S6LA 3GUDA 1U3EM 3ZMDA 1ZZ6A 1HBXG 2XLFA 4KDPA 2ET7A 3DFGA 3TO7A 2FNAA 3FM5A 1XGNA 2AS5F 3CEWA 3EHKA 2XUBA 3REOA 1ZH5A 4XF3A 3F8FA 3BOQA 3QU6A 2ATFA 3FHZA 1O4TA 2D5FA 3LZZA 1FSEA 1Q43A 1BN5A 5FLXK 3FFQA 2FNPA 4RGUA 2XGXA 4MGRA 3SCHA 2YX4A 5E1WA 4JBAA 3IKTA 3DPLC 4MQ9F 3E6DA 1D8JA 4JVAA 2BE5F 1UIKA 4KICA 3KLOA 3B73A 4EROA 2V1UA 2JRTA 4YYOA 2UXNA 3E6BA 1KU2A 1NHAA 4HDUA 5D1IA 4B8XA 2M5WA 1O7LA 4ZYHA 5FDBA 1CAWA 1YS6A 3G73A 4LB5A 1H1MA 3TNQA 5F64A 4FAGA 4EWDA 4EGYA 4KN4X 3CL1A 1BI0A 2IA2A 3BB6A 4L5IA 4ZU7A 2IXIA 1HSTA 2L4AA 5AIQA 4YFNF 5AIPA 4YRDA 4XFIA 1QXRA 3FXRA 3J80K 5H6RA 1ZRFA 5L3GA 3KZYA 4UBGA 4KN7X 3GO5A 1O5LA 3ECOA 1CAUA 5FFXA 3KP6A 3I53A 3T8RA 1B6AA 1XSVA 3HRMA 2STWA 4EWAA 2KRFA 4KIFA 5FLJA 2ZMEA 2MLGA 5CLSA 2RQPA 1SD5A 1SEFA 3KEQA 1Q3EA 3OF1A 4QGLA 1T2KA 2PYTA 4B29A 2FSWA 2BGCA 2YSRA 4KMFA 3V7SA 3BP8A 3E6CC 3H1WA 1H0MA 5I0SA 3LFKA 3USSA 3ES1A 4HVRA 1JHHA 1DZRA 1PP8F 2IRFG 3M9AA 4E2QA 1KGSA 4NB5A 2Y0MA 5JSOA 3BY6A 4U88A 2VBWA 2JPBA 3EYIA 4Z07A 2DPUA 3O2PE 3BJ6A 1QXJA 2CYYA 2OZUA 2XL9A 2P7VB 5I8TA 4P5OA 1GXPA 1RTVA 2RKHA 3NKTA 5J6XA 4GCVA 4CZZA 1EV7A 1K6OA 3ECHA 3EQLF 2FOKA 3SZPA 3H3ZA 3CO6C 3S2WA 2EFNA 2OQRA 3CJXA 5J48A 2WFPA 4WBBA 2LDUA 1MJ9A 1XMAA 2Z5UA 1FBQA 4EV0A 2PQ8A 1DPRA 2OZ6A 3HRUA 3FF5A 4O9EA 4UV8A 5E20A 3F8CA 1SMYF 4LUKA 1I6XA 2XKPA 2K9ZA 2ZXJA 3IDCB 3PLQA 3DQVC 2OYZA 1HSJA 5LRSA 2HZTA 2H0VA 2UYAA 1B1BA 2EWNA 1UIJA 3U11A 1XD7A 5JR7B 3WGGA 1J3RA 4G7ZF 1TQIA 2M87A 5K5OA 4ZU5A 2WV0A 1OPCA 1IXSB 3S7IA 3ERED 4WXHA 2IA0A 1F1ZA 4U7DA 4QWQA 3MDPA 3FMRA 2KJBA 1PMIA 3HRTA 4UV9A 5D6FA 4KWLA 2B5HA 1JHFA 1CAVB 3P9CA 5KHIA 1W7PB 5BS6A 2KXLA 3RPQA 4R79A 1PUEE 3WTXC 3FXUA 4KL1A 2FQ3A 2PG4A 4HA8A 4TLFA 4LUMA 1ZRDA 5ILUA 2UWMA 3PQJA 2DAOA 4WVZA 1Z91A 1RNLA 3KGLA 4HMZA 4CYDA 4KIBA 1U12A 3FMQA 2Q2EA 1UHWA 2NS0A 2DO7A 5BPIA 3WG9A 2FE3A 3WW1A 2EFOA 2R7DA 4R52A 2KIUA 5LGTA 3R4KA 1P4AA 3TKYA 3DF8A 4M71A 1K7AA 3ZN0A 4BHCA 4G94A 2O8XA 5AVPA 3C3VA 1ZYRF 2G7HA 3E5QA 3KCCA 1U5TC 2E1NA 1F4KA 1I1GA 5IT9K 1LJ9A 3M70A 4NVPA 3SXYA 3E5XA 1YLLA 4MH0E 2IXJA 3RKWA 4LMYA 1TNSA 4RD7A 2P6SA 4KA4A 4KWKA 5D5WB 1FYKA 2HEOA 5JR3A 2HS5A 1WLTA 5C8WA 1XE8A 5CVVA 5LRRA 2CAUA 1FBUA 1USTA 5JSRA 1R22A 4I02A 1X8MA 2TDXA 2I45A 2JTVA 2RC4A 3L09A 2EV5A 4I2OA 5ICGA 2K27A 5A2QK 1WKMA 2PFBA 3U9GA 4BYYA 4CHUA 3I64A 4KMUX 5I0UA 2IXHA 3IKVA 5JI6A 1Q5OA 3L9FA 2EFPA 1B9MA 3C3WA 2FQPA 3J81Z 4M9XA 3VB2A 3CUQA 1ZGAA 2EB7A 4U7BA 2D2WA 1FP1D 2BYVE 4Q47A 2XAJA 4OU0A 3HOTA 4ESJA 2O1QA
chains in the Genus database with same CATH superfamily
1QQP1 1QJX2 2XKOA 2HWB1 2JE9A 3HOBA 2ESNA 1U5ZA 2QQJA 1I3AA 3B6AA 1ZRRA 1WRJA 2XL7A 3IN9A 4PJYA 3AP7A 4XDQA 4LLOA 4X6AJ 2HWF2 4M6VA 2WYSA 3CJTB 4GKYA 1MEC3 3CO2A 2CSOA 1UXXX 5JFRA 5FZEA 3VYRB 1RZ4A 2NS7A 3U07A 3ZDVA 3W9AA 2XAFA 4LEJA 3HHHA 4L0YB 1HN1A 3BPSA 3ZYRA 4EVIA 1N25A 3RJPA 5HPOA 2OUHA 1OKRA 5GM0A 1G86A 4YG6A 3VBSC 1IRFA 1OKOA 2IWGB 1OLRA 4S05A 4LKSA 4B43A 5FY5A 3QODA 2F4IA 2XRLA 3HT2A 1V6JA 2MG4A 5CFCB 4Q8KA 1W6MA 2Z33A 4J1WA 3HG9A 2CY6A 3OS0A 3AMQA 4IZZA 4AIHA 4FTHA 3H8XA 3FDYA 1K61A 2DW4A 5FFZA 5F04A 1BI3A 4G4FA 4BU2A 2ACJA 3S3MA 5FYIA 4IHTA 1HDKA 2EZIA 2KISA 4OMZA 1E5HA 3GALA 2M4KA 1SDWA 5F6FA 2VQUA 3NV2A 2K0GA 4C91A 2BZDA 2QSGX 3F95A 4AFAA 4XLFA 2YY1A 4FOVA 1HDPA 1HB1A 1MKMA 5JZGA 4LO4B 1XB4A 3POYA 4CU6A 1R091 1LOEA 2J1EA 4GXLA 2Y48A 3A01A 5C44J 3U10A 2VONA 2WT0A 2K7LA 2JXAA 4E7JA 4M0HA 3IBMA 1S1AA 2NVYJ 2FBKA 2WO1A 2YMZA 2Z2SB 5C3EJ 1ULDA 3M7GA 3OIQA 4KFCA 2A05A 5J3UA 4OMDA 4F55A 1YQAA 1QJY3 2R7RA 2L9LA 2YBSA 4ITCA 1FT9A 3GEZA 4LQRA 1X4PA 3OB8A 1ZARA 3CP2A 2PMWB 3WUCA 1ULOA 4B1RA 2V6CA 3DXJF 5FY1A 5LA1A 3HIFA 4AF9A 4AQ6A 3KQRA 5BOXA 1CIWA 2CFOA 2WRAA 3D4KA 1ACIA 3AMNA 2NS8A 1UNBA 3I3EA 4ZYDA 2XWBB 1ST8A 1JTYA 3CO7C 1UZWA 1DZTA 1CESA 4A6SA 4XUNA 2ORZA 1ULFA 1PVC3 2A3XA 1PZ8A 1VQ7I 4AHXA 1Z21A 2DOAA 4A4AA 3DGTA 1RUC2 1OJLA 4DXRA 3ROUA 4ZH4F 1DLCA 5T3NA 2PELA 1PMJX 1H8VA 2KRHA 1MZ6A 2VUAA 3IH3A 1VFCA 2W1SA 4PDKA 3NV3A 1SFNA 4U0YA 1QJFA 1PGSA 5CKNA 2FCVA 2XMLA 2CGPA 2OF7A 5F8PA 4M3EA 2BXZA 1LB2A 4JDOA 1CF7B 4ZONA 1BMV1 2K46A 2VQGA 1T39A 3FXMA 3NQOA 4W97A 1F43A 3HOWJ 2WAAA 3WW3A 2HXOA 2DDAA 4L99A 1FOD1 5CEHA 3ME2A 2DCKA 4PQQA 1LTEA 4F3QA 4N4OB 1ENXA 2JDNA 1YX3A 1FTTA 3V4GA 2G1MA 2KA3A 2VU9A 1NAEA 4K2EA 2O5RA 4PZJA 1QY4A 1WBFA 1NYWA 3C7JA 4SBVA 2WAEA 2PLV1 3BQYA 1JJ6C 1XNAA 1J59A 2HVSA 1DQ4A 1K83J 4AIJA 3S30A 5LA0A 5BXXA 2GAUA 4CP9A 4FPJA 4YM3A 2M2EA 1UCRA 3OYFA 4QX8A 4BMBA 5A1FA 1Y43B 4FISA 3K70D 4L9JA 2XROA 5JXJA 3WGHA 1ZAOA 1R71A 1ULGA 4RGXA 5FLVA 1X1AA 3JRIA 2IC1A 2E2IJ 1S2KA 5H6QA 2P8TA 4CXYA 1HCRA 3LQCA 1A3KA 1QGPA 2ORXA 2VXZA 2E7XA 4XRSA 4RR3A 2E31A 2DDUA 3HT1A 2JWPA 5DS9A 3ZMOA 5DAVA 1SDDB 3KVBA 4QX7A 2WZR3 1FJLA 4QDSA 2A68F 5DEQA 4GD4A 1TME3 3O0VA 4UT5A 1QPMA 4XORA 1J3PA 3O3KA 3S8PA 4GH4A 3M1EA 4HDVA 1MEC2 2R92J 2X48A 2WA3A 4YEJA 2RS12 3F2ZA 3N97A 2DA1A 1T08B 1DG6A 4URTA 5GAHJ 3RZMA 1YTYA 1HQWA 2XF7A 2PAKA 1LHNA 3HUGA 3W3CA 1A31A 1AR81 3HSEA 3J7MA 2LMDA 3APBA 4OFGA 1YLFA 5F08A 3BG3A 1DF0A 4MGKE 5BY5A 5FYYA 4C90A 3E3VA 5GADJ 1TWHJ 2Y9YA 4XFAA 2WNVC 5A3TA 3WTYC 4OINF 4LHSA 1NT0A 2BV6A 2F2EA 2KHMA 2YPDA 2QBXA 3IPVA 3K0LA 1OMIA 4F93B 2EA2A 3LSGA 2VJIA 5D8LB 1IG7A 2ADDA 2DMNA 3IH2A 3UKNA 1DHKB 3VUOA 2X51A 4QX1A 2EFWA 3UL2A 2JQ7A 1BC8C 1BL0A 1NCRC 4D5CA 2EF6A 2G19A 1ODNA 2QM3A 2HDWA 4QMAA 4II2A 1ZZBA 4GWJA 1FPN1 1E3OC 1ZBA3 2C5DA 1T98A 4IV1C 4AI3A 1PO23 1W9TA 1RUF2 3ZYGA 1O59A 5C9AB 1ZVFA 4QX3A 5F2WA 4O6JA 1FNNA 2W87A 3F8MA 3R6SA 4DIQA 4RQPC 1W8UA 4CCKA 4FPCA 4GA9A 3WNPA 3OYGA 3VBUB 3ZDSA 4U2AA 3T0BA 2VZRA 2XH6A 2W00A 1R083 3VZLA 2Y2ZA 1JYTA 4HSLA 4OI1A 4Y3OA 5FMOS 1Y7BA 4M9ZA 3FUQA 3VPRA 4NIIA 3FFZA 2EZKA 2ME0A 2RJLA 3HHGA 3VZOA 2DJIA 2KD7A 3BR5A 1WJCA 5JVGF 1OF3A 2R7ZJ 3W2WA 3U75A 4N53A 4PJLA 2YU9J 2CWEA 1K78B 3RVHA 1FP2A 2DCYA 4FI9A 3HSRA 1CAXB 5FGMA 3J7LA 1MIJA 1KJLA 2NNNA 4HKLA 1EV12 1R1TA 1C57A 1UN1A 1XNDA 2QUFA 3D8CA 3UK9A 1KONA 2VZTA 4UFLA 3MGUA 4IEOA 1SAXA 3USUB 2DU1A 5FZLA 4XBQA 3UKTA 3K1PA 3HPHA 3L2VA 3FK7A 4M3BA 4LBOA 5M3MJ 5A6ZA 4FCAA 3TNPB 2ZPXA 3A4UA 2HQAA 4UWDA 2XJSA 3BALA 1VP6A 3ZO0B 2G9ZA 1R1ZA 1MNDA 3LAPA 2A5WA 5FTTC 1CGPA 1MR5A 1NQJA 4Q4X3 1PJRA 1G9CA 1ZG1A 4UY8I 1IQDC 1NCQB 4IE0A 2ESHA 2CWMA 2BY1A 4I7HA 1ZZ8A 5D5VB 2R0FA 1KGYA 4KQ7A 4AZZA 1PP7U 1R7JA 1LCLA 2UY8A 1CJPA 5T5JA 3C7OA 2HQNA 1UOJA 2WS93 1DQ0A 4JTNA 2QF7A 2O0YA 2EK5A 5FB2A 3I3BA 2HU9A 1AR61 4AVBA 4B7EA 1VQOI 2J1RA 4L9TA 3CC4I 4JAAA 5HLTA 1LQ1A 2VZVA 3JBG3 5EFUA 3ZGKA 2AGSA 4RA2A 1DUXC 2QVOA 1QZZA 3WQBA 2QBYB 4JX5A 1JZ2A 1B59A 1AJKA 4S0HB 2XR4A 3MKLA 1KU7A 1PIV1 1QEXA 4BB3A 4JDNA 4AG4A 3RNSA 2J1TA 3QYFA 2SBAA 3FLRA 2JPCA 1HQCA 3K4LA 4E7ZA 2CO5A 3PVOA 4QKBA 3CUQC 1PO13 1V5GA 1N1YA 1VR3A 2A6XA 2E32A 1ZHFA 2W92A 2XF6A 3ZMSA 1W2OA 2VCAA 5EXOA 5HS7A 1N75A 5DYMA 1LFPA 1T6SA 5B4XA 1VBB2 4XJ8A 4XLPF 4HETA 3FIWA 1DFQA 2WO7A 3VZJA 1Q8QA 1HOMA 3ETPA 4N8MA 1MBKA 4FQGA 2ARXA 1LGCA 4QM8A 3MFAA 2VZUA 1K4SA 1WFXA 1ND3A 1DCSA 4F91B 5KVRA 1O3TA 4A6OA 1AR93 1XMKA 1HRI2 4IRGA 2I2SA 2WNUB 2K40A 2RR13 1YUDA 4MGYE 3SISA 1HLCA 3JSPA 1TME2 1SFKA 3FBMA 1G3TA 3ZYPA 1JU3A 3QP5A 3B01A 3WR0A 2HWC3 2HFHA 3BI3A 3NKGA 4FPFA 5H2FC 1AWCA 2ZJQF 1YIJI 1HJFA 1PVXA 1XN7A 1TMF3 3QPSA 3ZR8X 3OTFA 1YJWI 3ACFA 1LOBA 4XCAA 3WTWC 1RUE2 3JD72 3OUIA 4BH9A 3G1MA 4EN8B 1ZR4A 1OFSA 3JRDA 1GV9A 4D7TA 4WM8A 2D6KA 5C4WA 3CMAI 4WZCA 1D2QA 3M7AA 1OR7A 1QJU1 1WGPA 4AL9A 2ZJRF 4HEA2 3TOAA 5K5RA 1MQTC 3E6MA 2VG9A 1O3QA 3EBRA 5K5QA 4KGGA 3PTYA 2X5IA 5AC91 2NRAC 2ZSHB 2ZCWA 1QWRA 4N4NB 3WG3A 1L3JA 1JUHA 2ADEA 4JGZC 2DVGA 3KE2A 4AFMA 2WLQA 1HB4A 2DCZA 1FMD2 5J8CA 3HJRA 2WAQN 1URXA 1QJEA 4HRIA 3MLJA 3POEA 4WVWA 3SCFA 2VW1A 1H8TB 3NRUA 1JH5A 2JB8A 4NRMA 3ZIXA 3CMEI 1V3FA 1RUD3 1S7OA 2DT5A 2P6CA 3RSNA 3CCSI 4MUVA 3NVCA 5LHGA 1W0NA 5B1AH 2JG9A 1R082 2XVKA 1AYM2 1S55A 3MI8A 5BUVA 2PHXA 4ZKTB 5KC6A 3M4FA 1G9BA 5CVJA 1K42A 1NTCA 2E7QA 2GOMA 1R1A2 2LREA 4JP0A 1QBJA 1S0JA 2OIIA 4MHUA 1VQMI 2PMZA 1IN8A 5IP7J 2CHHA 4NIHA 4IRHA 2CQQA 3UNGC 3VOEA 4D7SA 4P5YA 2Y6JA 2RJ2A 1CAWB 5HS9A 2WJSA 2KLOA 4D0PA 1RKTA 2VBYA 2A1XA 1KA8A 4ATEA 3K10A 1OLTA 4B1LA 4D6QA 2DA6A 2MLKA 3QYEA 3DP7A 3DPTA 4OWRB 4PIXA 1J75A 3Q0VA 9ANTA 4Q4W3 2LG4A 5CFDA 3SFZA 4HYEA 4DUXA 1LKNA 2ISZA 5F37A 3BWGA 1GDTA 4FX0A 1R58A 2N8GA 4YM1A 3CCRI 1RGSA 5E1XA 3TDUC 4G6QA 3LOCA 4XN0A 4GMP3 4L8QA 3VSLA 4IVNA 1IXRC 1W7PD 3VDXA 2ZMEB 3QACA 4YZ5A 5FZ4A 2ZS6B 4A93J 4DXSA 3W20A 2C26A 1NG6A 2HLEA 2ZGUA 3WTSC 3ZYBA 2P34A 1DGRA 1WCDJ 3H1CA 2ZBKA 3ZQCA 1W36C 3D1NI 1CJDA 2ETEA 4OHVA 1QDCA 3M8EA 4PQ9A 2DDBA 2QQVA 3NNFA 1ON2A 2E33A 1SQ4A 2CS3A 3H9JA 3BC8A 2OUJA 1U5TA 2EIDA 3WQ1A 1UJ8A 3OOPA 2WS92 1BW6A 4WF2A 1XC5A 1W6QB 2VJXA 4B7KA 3HB9A 4XFGA 1UO9A 4Q0VA 2Y6KA 3CLOA 4YW1A 3BG5A 3N4MA 1JGSA 1VE0A 2J1AA 2ADUA 4ET7A 2I07B 4IXAA 3TO6A 5FZ7A 4Z2AA 1ASJ1 1IRZA 3MF6A 4NAOA 1V4RA 3RZLA 4XFCA 5E3LA 2XHKA 2TUNA 1GQPA 5FYUA 5FZDA 1W05A 5IT3A 1X19A 4AYBN 2RDSA 3PJQA 5GZGA 5CB7A 1X9TA 1J83A 1MMNA 3LEKA 3NNJA 5GLTA 1SVLA 2VT2A 5ICFA 1S7AA 2V73A 3EDPA 4CDWC 3OCPA 1MS9A 2AYHA 4FOWA 3G1LA 1PO12 1IPKA 1D5VA 1YITI 2EZLA 2VQAA 2HQRA 4I3GA 1FOYA 3CBNA 4QLCU 4IEYA 4K20A 1L3LA 5FLMJ 1O3RA 4IJAA 1Q1HA 1AYN3 3DUIA 5HXMA 2A6TA 3IL2A 4QIWN 1UYYA 1SPPB 2FRHA 2ETHA 1TVGA 2HPMA 5L3FA 4DQ2A 4YIFA 2FDFA 3COAC 2R7OA 2PMUA 4COZA 4MTDA 2OTLI 2MEV2 1V6KA 2WR9A 1S7EA 3NAPC 3BCBA 3H0OA 2WFF3 4Y1YA 4FETA 5CPRB 4ZYGA 1REPC 1AR92 2GWRA 2BWAA 2B7EA 2FX0A 3I97A 5EYRA 3Q8FA 3F23A 4JRLA 1FIAA 4XFBA 3T1BA 2Y26A 1ZK8A 1FYLA 1KQ0A 1HDDC 4HL0A 2A73B 4URAA 1LHUA 5DCMA 3VBHB 3NJXA 2CW0F 4LFUA 3LSRA 1TW3A 2MC4A 1UD1A 2HYGD 4AEDC 2ZEYA 5CKMA 5KCMA 3K75B 1YCIA 3LOBA 3QPHA 3ZSJA 4LT5A 1COV3 5IAVA 4YG3A 1VBA2 1T95A 5IVBA 4ZZ8A 3U78A 2NAZA 3TBDA 1M4WA 2JA6J 3E97A 3U1XA 5L3DA 1YIOA 2NVUB 3OMYA 3QH7A 3MEPA 5EPAA 3WDVA 3Q0UA 3ZMUA 4XHXA 1GWKA 3AYEA 1GV2A 3A7QA 2DBBA 3BQZA 4XF9A 5L3BA 1DZQA 2GALA 4P14A 1MJAA 4XMAA 3A23A 1UFMA 1HA8A 1SCSA 4GWIA 4XKCA 1C5HA 2DA5A 4UXNA 4IHSA 2O3FA 4QD2A 1JKPC 1MZBA 1IZ1A 4QQLA 3ZN6A 4KI5M 3I2GA 4M3DA 4XF4A 3G71I 4LA2A 2OV7A 4EMSA 4KNYA 4XKWA 1B72A 1EKEA 2NYYA 1IGNA 2FZ1A 3GLXA 2R7TA 3U2RA 5DM6F 1RUD2 4PHZA 2YB7A 2BNOA 4UFJA 4HZFA 1U2WA 1W9YA 5EZHA 1AHSA 1H8AC 2KPMA 1US2A 3INAA 3HOYJ 5FBJA 1NX9A 4AD9A 3T8TA 5J1UA 4IGQA 4FOYA 3VHPA 3S14J 3ZN4A 2Q4SA 5LD2C 1OPMA 2A6EF 3CDZB 3HOZJ 4XONA 2I10A 4KBZA 5C8CA 4NN0A 2HQ5A 3TBIA 2E34A 1JZ7A 2F5DA 1JN2P 4XLHA 1FBSA 3MIGA 4H4KC 3CC7I 2VZ3A 2WZPP 2LKXA 2D6OX 2MNGA 2W0XA 3E7LA 2R042 2ENRA 1FXZA 3ELKA 1ZKGA 3D5RC 5BPDA 2C6YA 1W3VA 1MDMA 3LWFA 1V6LA 3CESA 3KB5A 2IBDA 2J5PA 2WIIB 4BHBA 4XKBA 3SHFA 4PJNA 2RM22 2DBIA 1IKQA 3FZVA 3AG2H 2V1XA 2DFIA 3PNVA 3AXEA 1SFEA 1GLNA 1RJ7A 2QQIA 1Q8OA 2A3WA 3HBKA 3ZYJB 2E1MC 3FHIB 5E3OA 2XB5A 4L18B 2HBTA 2AQEA 3BU7A 1DU0A 1VAMA 3DEEA 3RYRA 3OPZA 3GZ5A 5DUXA 1ETYA 1AL21 3ZR5A 4DO0A 1I5PA 4AGRA 1BBT2 3DBLB 1HRV3 3RRDA 5C70A 1P6RA 5ERIA 1YRZA 2F6CA 4OUEA 1RUC1 3WF2A 3TP0A 3ABUA 1I9RA 5FPZA 4RMNA 1S0EA 2HH9A 2RMU2 3T2TA 1Z77A 2K5CA 4ARXA 1DYPA 4XW3A 1UL9A 3LD8A 2O9LA 4M3CE 3A01B 2JSCA 5J47A 2VBZA 3NV4A 4AFCA 4OHZA 5C4XJ 4OUMA 4S2HA 1JGGA 3R4DB 4PGGA 5FPUA 1BKZA 4EN9B 1R49A 4ESBA 1XJAA 4NRPA 1X2MA 1N78A 4CDQA 3J7NA 1QHHD 1SVOA 1VRH2 3DWLE 4LE3A 3IMNA 1J2XA 3L00A 3BVCA 1U8BA 1OPOA 5IJRA 3CCLI 1HB2A 2M0CA 4WXDA 2P5VA 4Y1ZA 4EJRA 5DM7F 3BJAA 4YRVA 3U14A 1CQTA 4JK1X 3OYBA 3UJQA 3I3MA 3K77A 1U3EM 1HBXG 4NC7A 2ET7A 3TO7A 2ZGLA 2OVUA 4DUWA 2AEYA 2AS5F 1ETWA 5JXIA 1AL0G 3PJYA 1QOSA 4CA0A 5FIXA 2ATFA 3FHZA 1MS0A 3FFQA 2FNPA 4QAWA 2KZVA 1AYN2 2YX4A 5E1WA 3IKTA 3TAYA 1D8JA 3ZYFA 3WQ7A 1TEIA 2V1UA 2BVLA 5EYYA 3L2UA 1WLWA 4KG8A 1UXZA 4XXPA 5FP7A 4ZYHA 1W8WA 5LASA 5FDBA 4AQTA 1PNGA 5FPBA 3GXUA 4EWDA 3IDAA 1RITA 3W59A 3LSIA 4EGYA 1F5FA 3GGLA 3CL1A 4AAPA 2IA2A 2DTWA 3BTXA 2VULA 3FXOA 4M4PA 2YUSA 2IXIA 4R9BA 2P37A 3L2RA 2L4AA 5JLXA 4YFNF 3QD6A 3NV1A 2ZXQA 5AIPA 4HSRA 4B44A 3CCUI 1MEC1 3OPTA 1WGXA 4A3DJ 3J80K 2RS11 4XUQA 3KZYA 3ESWB 2CUZA 4AHZA 2V6EA 5FFXA 2WNVB 3H5RA 5DDJ2 5BNOC 2XUMA 2JWTA 2KRFA 4I99C 4KIFA 2Y0SA 1H9WA 3VDBA 2ME6A 4COYA 3VDAA 4FXKB 5GALA 5A7WA 3IP4B 2QKDA 2E51A 2RJKA 2PYTA 4B29A 4FP3A 2VW0A 4KMFA 1WJEA 4FPHA 2HYXA 1QZEA 4GB33 1TT0A 3F9KA 1H0MA 4F83A 2DTZA 4CP9B 3FHAA 4PJJA 3USSA 1SLBA 4HVRA 1PP8F 1HB3A 2HPIA 4B3NA 3MN2A 5JSOA 1U0AA 4YPJA 5IYYA 1ORKA 3EYIA 2DUQA 5J09A 3O2PE 1E57A 4AI0A 5K0UA 2VCBA 2P7VB 4JGYA 4LO8A 3KHBA 2WA4A 1RTVA 4IV3A 3MFCA 4RQPB 4RR3B 3ECHA 3LGRA 3LL7A 1YIFA 3S2WA 2EFNA 2UURA 3QBQA 1XU1A 4DEVA 2BZTA 3UV9A 5J98B 2LDUA 3HDDA 1MJ9A 1XMAA 4OI0A 3P3NA 2PQ8A 1DPRA 4G12A 3HRUA 1AX2A 4O9EA 4DUVA 1SMYF 2HNHA 4XUPA 1QDOA 1JKQC 3IM0A 2K9ZA 1TG7A 4FQZA 3DQVC 1VBE3 2ZGQA 2BPA2 3CMMA 3RZHA 1B1BA 1UIJA 3U11A 4QPGC 1XD7A 4COVA 1LOGA 1AF9A 1QOOA 4AI1A 2WV0A 1NK2P 1KQRA 4PDWA 1C3HA 4AFDA 1IXSB 2OTJI 5FZ0A 2QQLA 4IO9F 1F1ZA 2LM3A 4QWQA 3MDPA 1XS9A 3OIOA 3FKJA 3HRTA 5LK7B 1UAIA 2CUJA 3IPVB 1WWYA 5IAXA 2KXLA 1S4CA 4R79A 1JTZX 5LBFA 3FN9A 2PG4A 5J36A 3SH5A 4UW4A 1QJY1 1SFOJ 2R1BA 2JG8B 3IKWA 2DAOA 1Z91A 1X1BA 4HMZA 2JMWA 4CYDA 1PX3A 1OLQA 5KXCA 4W50A 1OURA 1ETXA 5EV7A 2DO7A 2X29A 4DJAA 4QQPA 4QB1A 2R7DA 4Y5TA 3LPGA 2TRTA 3R4KA 1P4AA 5EF6A 4GH4C 4M71A 4ZY9A 1OOPC 2JDKA 3LDKA 4Y1XA 4XQWA 1ZYRF 1G59A 1GUUA 2LW8A 4QPWA 2E1NA 1DQUA 1HRV2 2E26A 4LO7A 1V9U2 2VKEA 3E5XA 1QF3A 3RKWA 5E3MA 5DTDA 3WP5A 1IO2A 1H6XA 4HK8A 4KWKA 4BJ6C 5KHDA 3GJBA 1DIWA 2AQFA 4M01A 2HS5A 2ZJPF 1U9OA 3OR1C 4BQWA 2CUEA 1MW7A 3K4NA 2D3RA 5C8WA 1XE8A 5CVVA 4WM7A 4ATFA 1DGWX 2VBDA 2VAUA 5GKAC 4OHXA 3ERMA 2TDXA 3Q8CA 4QXHA 1SMVA 3OS1A 1LULA 3I56I 5ICGA 4N53B 3K4DA 5A2QK 1D0GA 1WKMA 5IK5A 5A33A 4B4CA 5IATA 2VMHA 3GCXA 3LFUA 4RAFA 3RZKA 1FMVA 3POJA 4NHKA 1W6NA 1LJ7A 4AE2A 1U5YA 4BLJA 2B7YA 4NO4A 4AQSA 5LB6A 5FWEA 4U7BA 1YRNA 3G4SI 2VUDA 3MKZA 3JQWA 4XQDA 3OYMA 5LK5A 3DEMA 4HF1A 2CFXA 4DS0A 1W6OA 4J00A 2Y33A 4XETA 5J4VA 1IG3A 4X0GA 2JKXA 3WHBA 1SD4A 3JRCA 3ZYHA 2W48A 2O03A 5JOYA 2OA2A 2BVBA 1DYOA 3GYHX 4Q4Y2 2EA7A 1ETOA 1XCVA 5FMDA 1PYVA 3IWFA 1ZNPA 5FP4A 1MS1A 3F6VA 1N77A 3CU7A 1NG7A 1C5IA 2XGEA 3L2WA 3G1OA 1GP6A 3JZVA 3OOXA 5GP9A 3FC0A 4BDZA 4F52A 5APAA 3GHNA 5CFCA 3TGNA 1TME1 4EQVA 4DOUA 5ISLA 2JX9A 2CAVA 4E8DA 1S8NA 2YUEA 1RETA 2V79A 4K8FA 2KMUA 1XYNA 1IRXA 1SFPA 4NE9A 1FNZA 4DNYA 2XJUA 2Q8EA 3C18A 1BI1A 1QU0A 4A41A 4P9FA 4MTEA 4NPMA 5A6YA 1CX1A 2L9RA 1UZYA 4XJWA 5FREA 2WQZC 3EQEA 4PT6A 2YFUA 1XDSA 4BQOA 1RC9A 2Z42A 4A3XA 3U1DA 3IIAA 5BNGA 1RRJA 3WU0A 2V9VA 3W2AA 2R49A 2UUZA 2JD4A 1OA4A 1YFYA 4CDGA 2WA0A 4A5NA 5B4NA 1VQ9I 3NMBA 4D6SA 2DJNA 2W52A 2DOFA 3WG7H 3JD71 2B63J 4XSXF 3H50A 1QNYA 4UNOA 3POWA 4Q0QA 1MSEC 2QZ3A 4AWXB 2QFEA 2I74A 3RDIA 4BQ1A 1D0YA 3EXUA 2UYBA 2IPQX 2RQQA 3PUIA 3J7AY 3QYBA 2A75A 2K02A 2WL1A 3BR6A 2WKKA 2QTWB 1D4VB 2Y75A 4YG2F 3MQ0A 1ZBA1 2P81A 4A3CJ 1S72I 1FX7A 3CZJA 5FPXA 3BGAA 4BHPA 3GTGJ 1PO21 4XBLA 5I93A 1ND3B 1QO0D 4RS5C 3CD6I 3ZQQA 2VJ4A 5CVRA 1HC8A 5A80A 2W94A 2X05A 2YC0A 2PMHA 2DYCA 4N9HA 1FOXA 2W24A 4YVWA 1K6YA 5DD4A 1W36D 2E7WA 3RZDJ 1HW2A 5H20A 3SCGA 1R081 1S0FA 5FZHA 2XAHA 1TWFJ 2MA3A 3K2OA 3IAS2 2JRMA 5FKLA 1T6GC 4DXZA 4AVSA 2R062 1XYPA 4OIOF 2JZYA 4JOMA 4RGGA 3MUZ1 4XJAA 5J7MA 2KJCA 1YFUA 3AKQA 2HYJA 3AM2A 2LVSA 2K9NA 4D9JA 2Q8OA 1B8IA 3KQ4B 4KUMA 5FKCA 3OPWA 4RGAA 4C2UA 4AHYA 2XBO3 5FZKA 4CSWA 1GP4A 4WM8B 5C4WB 1AR72 3JUUA 2Q1FA 3KF3A 1XBFA 4C1XA 1AX0A 3FZ3A 5GJ6A 2QNKA 4XC9A 1X1CA 4N43A 1HKTA 5LY2A 2X5IB 4A7KA 3WNOA 5KHGA 4RGRA 2PI0A 1T2XA 3I2IA 3KP7A 4F3JA 3JW4A 3UGHA 2ISYA 1D3YA 2DUOA 4ZTJA 3K1MA 1VF9A 4O9GA 5JR2A 2R7FA 2ZKZA 3R0JA 3N9LA 3RI8A 3BG9A 3K4AA 1UY2A 1Z0XA 1E17A 3A0HC 3K3OA 3PMEA 3VD9A 1O3SA 1F4AA 4KJZA 2ZGRA 4NPRA 2BQPA 5FZ3A 3WCSA 5H9PA 1HXS2 1UG0A 1BZWA 2KRCA 2GNMA 2YU3A 3PO2J 3CJIC 4QQOA 3JXSA 3GTKJ 3HJEA 4QPIA 3MKWB 5T52A 3H1MA 2WS91 2FMYA 4XRMA 1FNYA 4BDYA 1W06A 2DT6A 4NROA 1P92A 3LAJA 4DW6A 1GU3A 2ZGMA 2VW2A 2ZGOA 3ZR6A 2R7VA 4W65A 4XUTA 3BCAA 3HD8B 4ZDOA 3B02A 1WVRA 4XPVA 3WTUC 3JBG1 3DTKA 4BNCA 2L7FP 5CFDB 2DMQA 1SCRA 2PJRA 5FY0A 4UB6C 1D8KA 3VBRC 2DMUA 3AAFA 2IXLA 1GQHA 1LEDA 3OGRA 1XGMA 4O5VA 1POV3 2VBPA 3GFMA 2NOJB 3GBFA 2ZTNA 5LA2A 4PLOA 2OZJA 1NE4A 4CA9A 3PVNA 4UYBA 2HDCA 1HKQA 2O6GE 5K1YA 4OLLA 1ONAA 1PO11 3NJYA 3ZXGA 4MGTA 4Q4V2 1T0FA 2XV4S 1KRIA 5KHHA 1PGL2 1W6PA 3S1RJ 3AB0A 1OCRH 1BJZA 3DN7A 5A3LA 5D8AA 3KSCA 4IEQA 2GA2A 4M3CB 1AXKA 5FKNA 3OIPA 1PK6C 2KFDA 4HOBA 1LU1A 3JAMZ 3Q9VA 1LU2A 4XXAA 3NAPB 1A6IA 5GZFA 1W39A 1U5TB 1BK1A 2V1DA 2MD5A 5LFAA 4HX8A 3IMMA 4P9WA 1S0CA 1H4GA 2DU0A 3X29B 3I3QA 3BODA 1QZYA 2OCCH 3CQZJ 1AR91 5K8SA 2RR11 3ULQB 4P00B 4M9SA 3I5UA 2PLYA 1TNTA 1MS5A 2HOAA 1KYWA 1WW7A 4G9SB 3LE0A 2A6YA 2YX7A 3NAUA 3EUHA 2TEPA 5DPNA 2DFCA 1G4DA 1OUSA 2HWC1 5FY4A 4MADA 1F5JA 1LOFC 4A0XA 3VFZA 2IZWA 1DQ1A 1RR7A 4LLNA 5CA6A 1TMF1 1J0RA 2E2HJ 4GKXA 2L7KA 5FXXA 2QUOA 3KIOA 1DGWA 3L1PA 1JYWA 2ZNZA 2W3JA 2WB1A 3VGIA 1R4MB 4PK4A 2P2KA 3V56A 1IS4A 3WT3A 3MCZA 3F8BA 2Z9OA 4CPBD 4NJ4A 4FTBA 3GCWA 1OF4A 3HPGA 2JIJA 1IOAA 1XTAA 4U0WA 4MV2A 4TLGA 4RB2C 4PJ0C 1UOBA 1OCZH 2EZHA 5BPXA 4CXWA 2DLLA 1PZ9A 3GCMA 3EMRA 1GVDA 2P5LC 1VPHA 1CAXA 2DI3A 3S1NJ 3H9GA 1X82A 1NK3P 1RUD1 5E8IA 4MO7A 4LBNA 1OC1A 2FCTA 1VAVA 3RPUA 3HL2A 1SD6A 3O7OA 3NEUA 4JV4A 3VBFA 2GIVA 4QQ2A 3ILRA 1JXSA 3S93A 1W2AX 2XAGA 1QHDA 2MSYA 1T56A 1FV3A 2AEZA 3TWIA 1BR4A 2JA5J 2PHDA 3O1RA 1WW5A 3AG3H 3LSTA 2ZX0A 2A5YB 1XE7A 2AH2A 4PJMA 2XASA 4L9VA 2I5UA 4KU7A 1T38A 1V00A 1W0TA 1WW4A 3THPA 2D6NA 4Q4W1 4Z82A 2ECBA 2OT7A 1NCQA 4GRIA 4LBLA 5I8YA 1MZEA 2FEZA 3BR2A 2VECA 1YQ8A 4UW3A 4K1YA 3WSOA 2RS52 1Y1WJ 3MBWA 3DBHB 4PF5A 4KU8A 2EXJA 3Q8EA 4GMP1 3CCEI 1LECA 1GR3A 3EYPA 3D5SC 2BUKA 2RM21 4YVSC 4RB0A 2K4BA 3MV11 4LMFA 2RDRA 4YGCA 1DP7P 5F6KA 4DGWB 4Q1PA 4HAMA 4YGBA 1D0XA 1B72B 1QU3A 1GZTA 4U0VA 3GTQJ 3MZHA 3POGA 1P7JA 3KV4A 5FP3A 4KBBA 3BJOA 4FBFA 3ZKUA 2OBPA 3OBTA 3H3UA 2P5BA 3OYNA 4AWDA 3H92A 3HZJA 1FOKA 1RUH2 4D3WA 3AL0B 2P6TA 1BBT1 3BTAA 4RAZA 5HNHA 2XPUA 4ZYAA 3CJRB 2IVMA 1IPSA 4LTAA 4QGMA 3KZZA 3PU3A 4NOTA 5BNNC 4KWJA 1Z6TA 4CDXA 4G6TB 3WINE 1GSLA 4B3XA 2Q8DA 3ITQA 2GXBA 3H8OA 2COMA 2B46X 4LA3A 3OV8A 5C8CB 3OYDA 2RE9A 1SFXA 4ENNA 3K69A 2M8EA 1X9PA 3R05A 3IRRA 3T08A 2QJVA 3RCOA 3BYWA 1O4XA 4Q26A 2VN2A 2LF8A 4MNUA 1IGOA 2VASA 1DQ2A 4NHMA 5IK8A 4C9YA 1LPQA 5EJZB 5FRAA 4XN3A 5BNPC 5D5XB 4Q0UA 2FMLA 4CCLA 5DZFA 4ASMB 3IAM2 5LW9A 4RFRB 1N47A 1RHI2 3BPVA 1MDMB 5FO5A 1BQPA 5JHUA 5JSPA 2R6QA 3VDDC 1ODMA 1J09A 4Q1RA 1ZA4A 2PHRA 4UFKA 4BCUA 2QWWA 1XSXA 2ID3A 2DTRA 1A6CA 1TZLA 4HN0A 2LNBA 3BTLA 4RM2A 5GZDA 1QA6A 3ECQA 2VOXA 3KFWX 3C2UA 3JTHA 1AYN1 2VMEA 2H27A 2GA1A 2WY8Q 1HQNA 2A6WA 2D40A 4XVHA 5JIUA 3J7YJ 3M2MA 1KEXA 4HANA 4GDFA 1JKRC 5J1RA 1VMHA 4IEPA 2QQ9A 2VC9A 2EIGA 3OJBA 5FUNA 2F5CA 1UW8A 3K46A 2WFF1 4XCBA 4M3FA 4DYRA 2PBIA 4IEWA 3G3ZA 4Q8LA 1E5SA 5DV5A 2X8KA 3WUDA 4K40A 3TEXA 4FE4A 3BIEA 3M4OJ 3S3OA 1IAWA 2ZA9A 1FAYA 2VKHA 5FD5A 3GX4X 2W57A 5EZGA 1UMHA 3LKJA 4DXTA 4SLIA 1ENHA 1YQ2A 1UU6A 1GT0C 5ICEA 4CDQB 3BDDA 1RMU3 2JUGA 4HV6A 1Y1VJ 4A0YA 3RZZA 3S1MJ 3OOUA 3LAGA 4JX4A 4G8XA 2HZDA 3CDLA 2EQRA 1COV1 4CH7A 3AYDA 2N7GA 3LIHA 4Z1VA 5DDJ1 4EGZA 4C3HJ 1XXNA 1H8TA 4U87A 1GNHA 3F21A 1QJX3 4GWNA 5L9BA 5ACA2 4ENKA 3GFLA 2IXSA 4K8RB 1UHMA 2UWBA 3VYTB 5HBAA 1VBC2 1W2TA 4WXCA 2FUG2 2Y30A 4X1EA 4LE4A 2HWF3 2QEXI 4I30A 4RA0A 2P4WA 4IUGA 3QQAA 1EY2A 3ZFEA 2BW3A 1ND2C 1JOBA 2VVEA 1JJ8C 1IN5A 4F8AA 3ZOIA 1JYNA 1QPIA 5FYSA 4AOCA 4ASLA 3ASOH 3M8FA 5ABJC 1S3JA 4EJOA 4HBNA 3OYLA 4S2DA 2MHFA 5FZFA 2XJTA 5C5UA 1E0EA 4YLZA 1P9QC 3PFIA 4HNTA 3TN92 4F7ZA 2VZOA 4CXFA 2W1QA 1PGW2 2B45X 1X7NA 4XYXA 1FV2A 3KZ4C 2GC2A 2JDUA 3AZWA 4WV8A 1OD3A 2QVSB 1JI8A 2L5QA 2CU5A 3TO9A 3HN3A 5FQ0A 2DVFA 3K7AJ 2X53S 1H2MA 5FK7A 3S7EA 3I55I 4WX9A 4UOJA 2KQRA 1S29A 1D4M2 3O5SA 1MS4A 1B35C 1GP5A 3D6EA 1R9TJ 4ES9A 2XC7A 3CCVI 1LENA 4A42A 1AHDP 3ZFGA 3ASNH 3WW4A 3JR9A 3WU2C 2M1BA 5LGUA 5H9QA 1GLHA 3BZKA 5GTHC 3MVPA 4UHTA 3OYJA 1BEV2 3I3DA 1OA2A 3KYDB 1JODA 1L0OC 2FU4A 3RKXA 4D94A 1R4NB 4BQQA 1HN0A 3LB9A 2WN3A 2MABA 5HI0A 4BMEA 2DXIA 3M07A 1QNTA 5FKBA 1F2NA 1MZFA 2ZXIA 5CG9A 3N05A 1TLHB 2W47A 1BJQA 1OOPB 4MXWA 5K0UB 2DCTA 2PHUA 2IS2A 4ZPIA 4JGYB 4TN7A 5L7OC 4IV3B 3SEZA 2GNTA 2ZGPA 1Y8QB 3QLQA 4DINB 1UOFA 5FXWA 1LNSA 5FYVA 3LEMA 3BTZA 3Q9SA 3HOSA 2YBKA 2FDJA 1HKSA 1H1IA 1HRV1 1C8M2 1V9U1 2OQ6A 4AI8A 3ZN5A 1YFXA 2Q8KA 4G6DA 2LY2A 1Z7S2 3CKHA 2UU8A 2EV6A 5BMZA 1QKQA 2OS2A 1XGOA 2UV1A 3S0MA 1YW7A 1QVUA 2LTPA 1BHGA 4D7YA 2YU2A 4W8JA 2Y34A 1H9PA 5FP8A 3I2OA 1EUUA 1MMAA 1BI2A 5B66C 4HVQA 1W9FA 3FJSA 4PDWB 1E2XA 3SDGA 1BBYA 2A61A 1XX5A 3N7MA 2DT7B 4R8HA 2ZEZA 2LH9A 2WAQA 3ZQIA 3TW6A 4CDUC 2DFHA 1LDJA 1C1FA 1STZA 3ZVXA 4FOQA 2WTEA 3DKWA 4AHWA 1SPPA 3K6GA 1W0UA 1GBGA 1RUC3 3Q3SA 4B48A 5E89A 1G9AA 3DPRC 2F4LA 1YW8A 2K2SA 3W6JB 1A8DA 5DG2A 4NAMA 4H14A 2IGKA 1I3HA 2ZGKA 3DEUA 4AC0A 3K4JA 2UWAA 4P08A 2FDKA 1LRHA 3P7NA 2D93A 2CV6A 3A0NA 5IYBJ 4GO1A 2O14A 4CEWC 3GZTB 2GM4A 5CQEA 2VE8A 3VD3A 4LKEA 4FVVA 4OIRF 4BQ5A 1G3SA 1OLME 4IHXA 2LS6A 4LB6B 3NARA 5I91A 4UVAA 2VZSA 2R7QA 4DYQA 2A70A 1JOPA 4OZOA 2WSUA 4HPKA 3VBSA 1X4OA 1E5RA 4H7LA 2HWVA 4QDRA 1GWMA 4WM7B 1XGSA 5ILSA 5DD8A 3TEZA 1B4AA 1SLCA 4L5JA 1K45A 3N7LA 4BXSV 3V7RA 1J7KA 3POBA 2BRTA 2WT2A 1W03A 3AG1H 5KXBA 3R4SA 4V2GA 4Y1VA 1I1EA 4QKNA 2ZFWA 2E2JJ 5A33B 4F92B 1VRBA 2IXCA 3CNAA 5HDNA 4QXKA 1LGNA 5AFBA 4AVZA 4Q2FA 5F39A 2P5KA 2HDDA 3LSKA 1ONVA 4MGZE 5E17F 2OPWA 5LHHA 3T09A 5F3EA 2PHWA 2P3IA 4XLEA 2K86A 5DAQA 2LFBA 2K9QA 3WNXA 2C0ZA 4M4RA 1YRNB 2YR2A 1W8TA 3DXUA 4LKDA 3MPBA 3F22A 3ELNA 5F0CA 4GB31 3HNYM 4A3BJ 3OR2C 4N9IA 3SEPA 2HOTA 1W6OB 4FAHA 2Y8KA 3LMMA 1ENRA 1OBNA 2RS13 5DZEA 2JK3A 4LGWA 5HVQC 3K2ZA 4LIVA 3JCUC 4DBQA 5F1RA 2X6XA 5HODA 1E3HA 1C0WA 4JHTA 1W90A 1FIPA 2RVAA 1BOAA 4HPQA 4XR6A 4CCMA 2HYFA 3MW3A 4FT8A 4LHNA 1F9NA 4RS5B 3D0SA 1LAJA 3CDHA 1EPZA 1BR1A 1UPIA 4TXWA 4DBRA 4AYBA 2E36A 2W82A 5HDGA 1RUJ3 4QT6A 3JREA 4ZXKA 3S6PA 3C2HA 4XLNF 2CRGA 1V5FA 4A3ZA 1QQP2 3PUHA 2HWB2 5EEHA 4MZUA 3W6VA 1R23A 2EAKA 4LOTA 1ACCA 4JQFA 2L01A 1FPQA 2HOEA 1DLLA 1VBE1 4Y15A 5TRDA 1NA1C 2WO2A 2NN8A 4LG3A 2XGCA 2W1UA 5CIRA 2OU2A 2R061 4GIQA 3B69A 4QHZA 4IX7A 2R072 3I0TA 1S2BA 4XQ4A 1HX6A 1N1TA 2VOKA 2BDRA 4QHBA 3KP4A 1JW6A 1RUF3 1EA3A 4FFHA 1WJDA 4NHJA 4O65A 3T0YA 1ZYBA 1D2SA 2FOWA 1F9KA 2OKXA 3I7DA 3ZPLA 1KITA 1OQYA 1GVJA 1M06G 3ES4A 2LSOA 3BN6A 1SEUA 3WF0A 2XB0X 4IRIA 4FASD 4XAAA 1EPWA 4QWNA 4YW2A 4MEXF 1EP0A 3TEWA 1MVEA 4K6BA 4KWUA 1TWAJ 3I49A 1YIPA 3VDCA 1SFYA 4A3IJ 2BWCA 3KHCA 4EM0B 2YG0A 5FO9B 2GLOA 1WPKA 1VB2A 2PFWA 3IRQA 3LA7A 3H3VK 1BM9A 2WNOA 3IB3A 3DCQA 2HR3A 4Q0PA 3C7FA 1EV13 4YVWB 1TQ5A 3DLLF 2A5ZA 1BCXA 1HXS1 1X1DA 3D5LA 1Z7UA 2VNVA 1D1AA 4FX4A 2VMDA 5F7UA 2H1KA 1QIQA 5FV3A 3AXDA 3CIHA 4DFSA 2ZBJA 2B4KA 2C4XA 1S6LA 4C0BA 2JDPA 1ZZ6A 3HWJA 1MMGA 3FHQA 2LD5A 1R092 3GTPJ 1KDKA 1Z3XA 1B8IB 4PCRA 1BA5A 4O7XA 3KD4A 3REOA 4XF3A 3BOQA 4E4ZA 2YC2A 4N90A 3LZZA 1BN5A 4RGUA 4QDQA 2QDNA 5FYZA 3SCHA 4LKFA 4JBAA 1DYKA 5FYHA 2R30A 4LPLA 3B9CA 1Y9GA 4N43B 2WNEA 5FXZA 4UFMA 3KLOA 3B73A 2JRTA 2BFUL 4R4XA 4YYOA 2UXNA 2ZZJA 2WB1N 3ZQGA 4WVVA 4OUSA 1WI3A 2VQHA 4NIGA 1QXPA 4B8XA 2HEVF 1OQEA 1YS6A 1H1MA 5F64A 4FAGA 3GTMJ 1CIYA 2ZMNA 4KN4X 2D6PA 1BI0A 3UKGA 4Q4V1 3BB6A 4L5IA 4R9AA 1E3PA 2ZABA 2HWE3 2JKBA 1QVTA 4I76A 5AIQA 2CU7A 2GMMA 3S5QA 5H6RA 2WNVA 1ZRFA 1OVSA 2W08A 2JJ7A 1XNCA 3O1PA 2VO5A 3GZUC 4DB5A 3T8RA 2EIJH 5IVFA 1B6AA 2D6MA 4AEMA 1XSVA 4QPIB 2HWD3 1Q8PA 5F3CA 5CLSA 3PU8A 2VKDA 4Y7NJ 2WQ8A 5I0DA 4YW7A 1Q3EA 3ACHA 3ORJA 3A1YA 3OWTA 1GV5A 3OBRA 3THDA 4IQPA 5IW0A 4Z92B 1NCRA 3V7SA 3E6CC 2Q5TA 5FYCA 4UW6A 1BMV2 3ES1A 5EP9A 4IV1A 1V54H 5T55A 2R7WA 3JU9A 2PJRB 3AZYA 1VBB3 2R16A 4U88A 3S17J 2D43A 2C24A 1WH7A 2DPUA 1YI9A 3BJ6A 2OC6A 1QXJA 4BQNA 2TNFA 4RQPA 2QCOA 4CUAA 2VXJA 1MBJA 5I8TA 3BKZA 4OMCA 4P5OA 1YHQI 2BP6A 2RKHA 3OYIA 2V26A 4CZZA 1HRI3 1EV7A 1K6OA 3SZPA 3H0DA 3WF1A 2R5YA 2PLV2 5K9YA 5F0HA 1W6PB 4LOSA 2Z5UA 2OZ6A 4A3JJ 5G04L 2IS4A 4UV8A 4NC8A 2QSFX 5D8AB 2LR8A 3M3OA 1QGLA 4NRQA 5DAPA 1X58A 3HR9A 4PLNA 2W5FA 1ERDA 4W1UA 2ZXJA 3IDCB 5K7HA 2DVBA 3WF4A 1HSJA 2D6LX 2UYAA 4XE9A 4B4RA 1U5XA 5DMYA 5LCWL 3WGGA 2M87A 5K5OA 4ZU5A 3OY9A 1OPCA 2NVQJ 3U1KA 4OZXA 3SC7X 1RUJ2 4L97A 4LJHA 4C0HA 4U7DA 1RUE3 3JD73 3FMRA 4TWTA 2B5HA 2ELJA 1WUVA 1QMJA 5BS6A 5FY9A 4YZ1A 1XNKA 2JG8A 2XJVA 3B3QE 1IS6A 4U36A 1ZRDA 3AVRA 3WNKA 3AK0A 5JIAA 2CV1A 2OJED 3FMQA 3CDIA 4QU1A 4R9CA 2AREA 1J84A 1RUG2 2XPVA 1FMD3 4BL0B 4AEKA 1T0FC 3WG9A 2R1DA 1JXNA 1A5JA 4R52A 2KIUA 2EXHA 3KVAA 1AZDA 1I3QJ 1H1AA 4Y5Z0 1TT5B 3SJMA 2K3FA 4BHCA 3VSKA 2WO3A 5FBZA 1XC6A 4BY1J 2XBO1 3E5QA 2ZKNA 4OQ8A 3V0AA 3BU0A 1F4KA 1AYM3 4UB8C 2ZJCA 3M70A 5E79C 2X6YA 1YLLA 2IXJA 4LMYA 1FTZA 4RD7A 2P6SA 1R1A3 3HPNA 2GH8A 2HYKA 1FYKA 4D6RA 3ZSEA 2KZGA 3GBGA 3LSMA 4IL7A 1WLTA 4FPEA 5LRRA 2CAUA 1SLTA 5CNAA 1FBUA 4IGOA 4YW6A 4J6GA 1L7QA 5EWSA 5JSRA 1R22A 5ANQA 4AI2A 2KIQA 1WMEA 2LLKA 4YM0A 2P1BA 2I45A 1I39A 4GJYA 1LUJB 2XF5A 2E71A 4AI9A 3H42B 3T3YA 4A3MJ 3U9GA 3OYWA 3I64A 3K3NA 4Y4YA 5GLVA 1NG0A 2RDQA 3L9FA 4GZ9A 3C3WA 2F4MB 5C9AC 2FQPA 3VBFB 5FRMA 3HC7A 3J81Z 3VB2A 3AP4A 3HM5A 1V5EA 3CUQA 5B5EC 1ZGAA 5IFPA 3LSJA 3VBUC 2ZGSA 2EB7A 2D2WA 1FP1D 2BYVE 2MGQA 4Q47A 2XAJA 2IVJA 4AU7A 4LORA 2JSPA 2DMPA 4ESJA 3EPZA 2YC4A 3I59A 1MNMC 4IERA 3H1YA 5I8SA 5FCCA 2ELHA 2CJJA 1ZX5A 1DP0A 1UY0A 5FYMA 3SKJE 4CEYC 3K1NA 1FMWA 3C1DA 4DNCA 2E7AA 4W6XA 3CLQA 4I3PA 5GLWA 1VMJA 2DK5A 1QRYA 1W8HA 3N9OA 3LA2A 5C3OA 1R6RA 4YIRX 4XFHA 3MKYB 2DK8A 4H3WA 1POV1 3V64A 2HOSA 4XMIA 4L2NA 1R1VA 3MEXA 4IQJA 2BBYA 1WJFA 2F5FA 3W6KB 3V42A 1HIXA 1EH8A 3VZKA 3M1CA 1GXQA 2HWE2 1UU4A 2BOIA 3RZGA 1UU5A 2ZO4A 5IVJA 3L2CA 4LJZF 2GN3A 1M1EB 4HLTA 4JKLA 4EQQA 4PUSA 2GQQA 3W5MA 2VC0A 2QENA 3FL7A 2FBIA 2FBHA 4NC6A 2FHRA 1AVBA 4DZPA 3PVBB 4GYGA 1SBDA 2Z16A 2P3YA 3MIDA 4C3JJ 3AZVA 1H9GA 3HNBM 5CBLA 2AXTC 2HWD2 4CDXB 4Y4RA 1D5YA 1NY72 3AYCA 2O0OA 1R00A 3ZM8A 1GICA 2D1VA 5JOWA 2AUYA 3IAPA 3ZYIB 1MQTA 3RMYA 3QP6A 5EG0A 2EJRA 3PL0A 3ACLA 5TSWA 2ARBA 2ZEXA 3WDWA 4JGZA 2BOLA 4BQ3A 3PSFA 2R0HA 3IC7A 1RUNA 2W1OA 1AR62 2V72A 5IVVA 1ITYA 3VL8A 1O57A 5DXDA 3WP4A 3VKLA 3ACGA 2PAMA 3KV5A 1GOGA 1ZN2A 2RVCA 4Q0SA 3PIPF 1RESA 2V9PA 5D5UB 2MEV3 4KYWA 4QTRA 3SQOA 4S2GA 5M5WJ 3KCXA 3N36A 2LC2A 3POFA 4A7YA 4L0PA 5ACA1 4XHBA 2VTXJ 2AC1A 1PIV2 2ZHLA 4R4ZA 2XOMA 1CD3G 4MQVA 3VKMA 1NE6A 4XTPA 3GWZA 4PIYA 4J19A 3C7EA 2XB6C 3RGBA 1FYMA 5DZGA 5FXVA 5T5PA 5LEJA 3GDBA 5HS8A 3BTIA 3LEGA 1K5JA 3QU3A 2QQOA 1SAUA 1VBA3 3VBOC 2VOOA 3DEWA 3SEEA 4AVVA 3K9TA 4GQ7A 1BXHA 3AKTA 4YARA 5FZAA 3ZSMA 4LLGF 4RGSA 2VPVA 1PGW1 4FPOB 5TJJA 2IGOA 1UHSA 4BA6A 1NZCA 3OG2A 2M9HA 3CUOA 3IV5A 1IKPA 2VMIA 5EIYB 2BBAA 5CADA 2WLPA 2XG3A 3WF3A 3S32A 2FDHA 5A3OA 4CP1A 2XSJC 2RAEA 1Y8RB 2ZJ2A 4OI4A 3N9PA 2E19A 3MW4A 3PTRB 2WNUC 3O12A 3MF9A 4XIDA 5C6CA 2J42A 1F31A 2L9VA 1VLNA 2IW5A 4C2MJ 1RUI2 4ZDLA 4BE1A 4PBPA 3EUKL 1F8VA 3WLUA 1OHFA 3O1VA 4BK5A 1TWGJ 4R1HA 3SMHA 2DOEA 3PDQA 1TC3C 2OX0A 2B9SA 5T50A 1BEV1 2NP0A 1YWKA 2PQQA 2D3SA 2KT0A 4UUTA 3CC2I 2P3KA 3IAQA 1REDA 3ZFEB 1T6BX 5F3IA 2WDBA 1JTXA 4V1PA 5B3SH 2BW3B 1CR7A 3U0ZA 1N3OA 4HF2A 1ON1A 3T0DA 3A03A 4OI2A 2MYSA 4GULA 5AC92 4ESFA 3KYLA 2VT3A 4ZZLA 5E88A 2HGCA 3HTSB 4NDLA 3OSDA 3OS2A 4ZHNA 4XJZA 2ILMA 1WSUA 2OXBA 1ZBE3 4LITA 1SD7A 2V4JC 2PJPA 1FEXA 1H6YA 4NR1A 2PHLA 5FLIA 1VQNI 2R043 1IQAA 3AFGA 5FQ0B 1Z7S1 3CCQI 1OH4A 4CDWA 5FUPA 1VBD3 1W8FA 3F8NA 1C8NA 2RM23 4FPYA 2GNDA 3ZQ7A 5EJ1B 3SYTA 5F5CA 1G8XA 3V65A 2EV0A 4MG2A 3TYJA 1P2FA 4LBQA 1FWZA 4CDUB 3ZFGB 3MFKA 3RKQA 4HQEA 3QCWA 2J1SA 4NIAA 1LR5A 2NOGA 2XVLA 4CCCA 4YFWA 4CO8A 1XNTA 3UGGA 5DCFA 4M3CA 4P9XA 1XDUA 1BBT3 4XURA 3DTEA 3PUBA 4E70A 4P9LA 4LR4A 2M3AA 2BFUS 1J5YA 3NAPA 3T2PA 4ASNA 3CHXA 2F6BA 2DFEA 2RMU3 1ZA7A 4NHXA 2WABA 3GF2A 4ZC3A 4MFDA 4Y26A 4QPQA 2GMPA 1V6NA 3JB4C 2CQKA 4CYCA 1UF2C 4B09A 4RN5A 5FAXA 5FZ8A 3HQUA 4MXWB 5FZ1A 4B8EA 2VM9A 4HNVA 2IS6A 4E9KA 1CAVA 3SITA 3JB8A 4XABA 5F5AA 3V8KA 4AEDA 5F6LB 3ETQA 1H89C 3LSEA 5GTIC 4UVCA 3V8JA 2ZMEC 4UUVA 1WA4A 2SLIA 2Z5WA 4IESA 1VRH3 3GLLA 3ZMZA 1H2LA 3UETA 1NXMA 4TSVA 2KL4A 2VUMJ 4NQWA 1ZELA 2JDHA 2EFQA 2LRDA 1K4TA 1LVKA 2GU9A 4OIPF 1SZBA 1L7LA 4G7OF 3OYCA 2BV4A 1LNWA 4XNFA 1OXCA 4E7KA 3O0XA 1UOGA 4A44A 2QQNA 4P9GA 2JIGA 2DWRA 3GZAA 1WCUA 1S0IA 2ERFA 2J7MA 4XZUG 1K5MC 1US3A 3FBIB 1YO8A 1MS3A 5DABA 3FX3A 1KU3A 1RMU1 4HXCA 1A36A 3L2QA 3QAHA 1X8EA 2VNOA 2D5HA 2X09A 3ZQFA 5HNFA 1CN1A 4EZ4A 4PGHA 2KKOA 4Y52J 5KHJA 2GC0A 4E8CA 1QJX1 4PSXA 3MUY1 3PL8A 2GMEA 4BLIA 3D5OA 2E9QA 5DUUA 1WD4A 1U6GA 4CICA 3VHRA 1PUFA 2HWF1 2HI3A 2J1VA 5B2GB 5T5OA 2BY2A 3ILFA 1JYIA 3JTGA 3P9KA 3DPUA 2GBYA 1ZRIA 2QQ8A 1MBHA 5DDJ3 3H35A 1Z1DA 3W2VA 4HPKB 3WNMA 3VBSB 2BNNA 5J1XA 3GM8A 3ZCOA 5LBBA 3NNMA 2WSVA 2Z69A 4C1WA 3G6EI 2EBIA 2DN0A 4RB1A 3RTRA 5HLGA 1YJNI 2CGNA 1WMFA 4LG0A 1LKXA 2FDIA 1ENSA 5FJHA 2ZXWH 1I27A 3T1MA 4FFFA 3I4PA 4DRRA 1PHMA 1NA1B 4PFPA 3CTAA 4X8NA 3O1OA 1XSRA 4ENMA 4LULA 1UZVA 1YJLA 3RZJA 5I0TA 3KGZA 2R071 4JTOA 2DFFA 5D2AA 5F3GA 5E3NA 3FBNB 3VBHC 1YEWA 4G9YA 3FXKA 3F3XA 3OL3A 3ALQA 1GNZA 2WQ4A 4H0EA 1U5IA 1UX6A 5BQTA 3KWVA 4LXLA 2VZPA 3I2KA 4PLMA 1IV8A 2D98A 3GF6A 3AL6A 1UKRA 3Q8BA 4HONA 1QNWA 1UPSA 3VD4A 1WH5A 5EGOB 2HVRA 2BNMA 3UGFA 3M3IA 1YJKA 5IP6A 4R9DA 4RM3A 4G3YC 1W3XA 3NQHA 3A0KA 1YW9A 2DQRA 4IE5A 4RFT0 1EH6A 4LK6A 1WI9A 3E0JB 3WQ0A 3MMYB 4BQ4A 3ZFFC 1JZ5A 3M3YJ 3AP6A 3HQRA 5CYYA 4M6YA 1WZXA 1ZBE2 3KLSA 3W58A 4EM1A 4S04A 3F0CA 3CCMI 2BGPA 2WZ8A 1FOWA 3K2AA 1W8NA 3VHOA 2C9KA 5IT9Z 4RS8A 4META 3O14A 2A3YA 2JE8A 4N0BA 2HTJA 3M8LA 3PUFA 3H9QA 2RS32 3VD7A 1REFA 1VBD2 4L92A 2YYOA 1SACA 4A3EJ 4EN0A 4WWCA 4ZZ5A 2B8MA 4J25A 3AJZA 1GQGA 3ZLIA 3PURA 3WZ1A 4P9JA 3HMYA 4YFXF 4BE0A 3FXLA 4XF0A 2CQNA 1HJGA 1OCOH 4LK7A 2O8OA 5IK4A 4MYEA 4QU2A 1OT5A 3SZTA 4K21A 1DGRM 4NHYA 2FDGA 3Q9OA 5A1LA 1V9U3 1GANA 1RVF2 5JMOA 2F5EA 1Q1VA 4CCNA 3WHTA 2CW7A 1GOHA 2AZ5A 4V19K 3ZN1A 1WJ5A 2W39A 5C3QA 3VKNA 1MPXA 1ZG3A 5DDGA 2ID4A 3PMSA 1Y0NA 5BV6A 4BBRJ 2NQYA 2K9SA 3DXTA 5C3PA 2EXKA 5FR3A 1MMSA 4AM3A 4ENJA 1YFHA 2X4HA 1FI2A 2YGLA 3I9V2 4HNUA 1CX4A 4ABZA 3O8GA 3KP3A 2NMOA 4HF0A 3C7GA 3I3LA 2W46A 3PVEA 1TE1B 5EHDA 3I2JA 5BNOA 1IHMA 2MH2A 1H9TA 3B93A 3GZ6A 1FLIA 4IE7A 2G4IA 3KV9A 1AL22 2L4MA 4BE2A 2H6CA 2W25A 1MGTA 3FHNA 1I1SA 4EWEA 2JENA 3K4ZA 4RLQA 3DV8A 2A69F 3SDBA 3IH4A 1EAH2 2ZX4A 3RYPA 4QX0A 4QB2A 4X6RB 3AP9A 4G7HF 3R61A 3CJQB 4IDZA 2OAZA 4IEVA 3SZGA 5JZGC 4AVPA 4D8MA 5JDBA 2IT0A 3BR1A 3GFIA 1XOYA 1WA6X 3E1SA 2Q0OA 1ALYA 4HQMA 4Q4Y3 2NZ9A 2JECA 1X3UA 2DA3A 2JB4A 4BAYA 2F17A 1CQ9A 1Y3TA 4E2GA 3TB0A 1YFWA 2M7AA 4P96A 2NM1A 3ZXAC 5G05L 2PEXA 2CTVA 5CVIA 1UWWA 1KJRA 2GNBA 4XJUA 1WHUA 3SH4A 4D69A 4MO3M 4BM8A 3HNMA 3EUAA 2Z99A 1REEA 5K7FA 5JPMB 3T2OA 3QPLA 2QYOA