1O3YA

Crystal structure of mouse arf1 (delta17-q71l), gtp form
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
166
Chain Sequence
GSMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGLDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title Molecular mechanism of membrane recruitment of GGA by ARF in lysosomal protein transport
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 55
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1o3yA00
2OAP1 2AXNA 1G3UA 1UM8A 5JI3E 4BQSA 2GJSA 1U2RA 4NZYA 1GKUB 3C41J 3P32A 3T35A 5DI3A 3RABA 2O8DA 4QGAA 4UQOA 3TE6A 1ELOA 1YQTA 3UG7A 4Z54A 2ZRCA 1NVVR 1YRBA 4MGIR 4LI0A 4NPHA 2PL3A 4NMMA 4IW3B 3LY5A 1Q0UA 1S9DA 1CEEA 2WM9B 3CH5A 3QG5A 1KSGA 2KI5A 1N5KA 2FE4A 4TMTA 3WNCA 4KFRA 5FL7A 3P4YA 2GJ9A 5DE3A 1TU3A 4PSVA 1JJ7A 1E2MA 2DHRA 5IT5A 3Q3JB 2V3CC 3BRWD 3MWLA 2WJIA 2QGNA 4M1OA 2PT5A 4K46A 1XXHB 4NU0A 3DL0A 3FHCB 3QF7A 1EESA 2I1QA 2ZRPA 1G3IA 2WPDD 3TJZA 2CHVA 3GJ0A 2O5VA 2ERXA 4AD8A 2F1RA 4URYR 4URXR 3VQTA 4ASUA 4A1FA 3EPHA 3K9LA 4BZQA 1N6KA 5FR1A 3RAPR 5JCZA 1Z47A 4B47A 1W48A 4ARZA 1K8RA 1DPFA 4KU4A 1TF5A 3GFPA 2ZPTX 4Q01A 5DYGA 3GLGB 1N0VC 1IOZA 3KKQA 2Q3HA 2ZI7A 2XNDA 4WZAE 3Q9LA 1GG2A 5GJCA 1S3SA 3HU3A 4KCGA 4QBFA 4IDQA 4OQFA 1AA9A 3PXGA 2WIBA 1Q3HA 1G16A 4R7ZA 3KDSE 4BRUA 4Q19A 2FFQA 1VG8A 1G7CA 5J4YA 2Z43A 2ZJOA 1NN1A 5AJWA 1FQJA 2AN9A 5EP2A 3C16C 2FPMA 4XH9B 5CJ2A 2PJRA 4PC7A 5JJLA 1T0HB 1WBBA 1ZM3A 3VAAA 1G3RA 5FFMA 5BN4A 3DO6A 4NHOA 2C2HA 3CW2A 2QGZA 1QDEA 1CR4A 1G19A 2QSZA 2WJHA 4IOLA 5KHOC 4C7OA 2IYRA 3QXJA 4RCYA 2WIAA 1UF9A 1ZJ6A 2AX4A 3JVUA 4OYHA 4DLXA 1OIVA 3W8NA 1XP8A 2J0UA 2JJ8A 5AR1A 4XOIA 1XB2A 3A4MA 3BIFA 1GFIA 1E9EA 4QM7A 2QROA 5D3QA 4A0FA 1NMXA 4OBEA 5P21A 3C5CA 4MRPA 2YNMA 721PA 5EE9A 1NIPA 4JLJA 1OV4A 1XMSA 2XAUA 5TY0A 4UJ5A 2OXRA 4HB2A 2IWHA 3PUZA 1R5BA 5SZIA 4CEIB 2IUUA 3SN6A 2QP4A 1NMYA 4NYIR 4XD7D 1KI9A 3ZZUA 2FX3A 2V8OA 1E99A 3MMPA 4PHHA 1OJLA 3EA5A 1NBMD 8OHMA 1D2NA 5H1YA 4CDGA 2JDIA 4MYHA 3IHWA 2F6RA 3LVQE 4CT5A 5J4HA 2KBEA 2OBNA 5JS8A 1OKKD 1TU4A 2GDJA 2R6AA 4QHTA 1P7CA 2VEDA 1CF4A 1YRAA 1P72A 3OEED 2BDTA 1AN0A 1B0UA 4NH0A 3BFKA 1GIAA 3MSXA 2VP6A 4KFSA 1KNQA 2KJQA 3QSYA 2P5TB 3EA0A 3OAAA 2PX3A 3OF5A 1E94E 5JEEA 3RVBA 3T1QA 3ICEA 2BMFA 1KOFA 1G18A 4OI4A 2R6CA 1CR0A 3SDZA 2OG2A 1RPZA 5CM8B 2I3BA 3OIVA 1F6BA 1KDOA 3SYKA 4B6EA 4A0HA 5FPSA 4TN1A 4AYTA 4NL4H 5C2JB 5FBVB 1OW3B 1SKQA 2FU5C 3ZZ0A 4NDZA 2ODEA 2AK3A 1U81A 3AF4A 2LWIA 4BLOA 1QHGA 2GVZC 2VH5R 4EPWA 2HEIA 1N6NA 3CPHA 1RRGA 1QHYA 3NDPA 2JLZA 1UKYA 2C99A 2QENA 1JECA 2DR3A 2ZJAA 3GFOA 1GKYA 3NC0C 2Z4SA 3ZVLA 4JBXA 3LV8A 3WRXC 2VHCA 4L15A 1ZUIA 3T61A 3KXIA 3GLHB 2YWHA 3B82A 4ABYA 1EX6A 3TAUA 4NCHA 1Q44A 1IBRA 5SZKB 1G17A 1Z83A 2VP2A 4BFZA 2LKCA 5CB6A 1Z8FA 1KGDA 5IDVA 1FTNA 1LY1A 4P32A 1E2EA 1YVDA 1IY1A 2BKEA 2DWOA 2IEZA 2JLQA 4Q48A 1G3QA 1SHZA 3IEUA 5EE5B 5KYKA 3OE7D 1D2MA 4EPTA 2RGCA 4BWYA 3FOZA 1QHHB 2XOKA 3C5HA 3KXKA 4URWR 3SFZA 3U7EB 4RD6A 1AKYA 2XJ9A 5J5CA 5B58C 3KTAB 3CRW1 3FE2A 5FUYA 1Z28A 5JJIA 1ZBDA 4FMCF 4NP6A 4TLCA 3NBXX 2ZS8A 3BERA 4V0ME 1MOZA 2ATVA 2Q9BA 4EDHA 3CRMA 3ZD7A 1J70A 1PLLA 1KHTA 1ONBA 2QBYB 3AV0B 3O8BA 3FFAA 5SZHB 2IL1A 3QPVA 2OBMA 4HDOB 4D4KA 1XMVA 5EZ6B 1RE0A 2VF8A 4TZ6A 1WXQA 2C03A 4PANA 5AUPB 4B76A 2V54A 1KDTA 3BH6A 1GRQA 5AJYA 4DLSA 2Q9AA 3VMFA 3IBYA 4M8NE 2YV5A 4Q7KA 1QG2A 4P0TA 2QMUA 2XZPA 4CRWB 4R9UC 1WBDA 3PEVA 4ZPXA 5FL7D 3THWB 2IYUA 3U5ZB 5TVKA 1E9SA 5DISB 4C30A 2GA8A 3QKRA 3DOEA 3N70A 2AD1A 5JHHB 3AKCA 1I2MA 3V4FA 3EZ6A 4UKDA 3CO5A 1TX4B 4DLVA 3W3AA 4L16A 3ZLJA 1KKLA 2ZROA 3F8TA 4ASUD 2OESA 3RSLA 1Y63A 1GWNA 4P31A 3KKNA 4LBZA 1T3SA 1XXHA 2MMGA 2KB0A 2QQ0A 2WSSA 1OFHA 4LUCA 4A2WA 5FBQB 3E2IA 1FMLA 4PHTA 3A1UA 5CYPA 1Z5ZA 2XNDD 3TUJC 3VX4A 1JAHA 5FH9A 4WXRA 1M7BA 5C18A 3ZVRA 2WKQA 1ETUA 1UDWA 3EWSA 4DLTA 3W8RA 2ZJ8A 3WYGA 3AVVA 3D6TB 2XZLA 1TEVA 4ZDKA 3U7FB 1XX6A 2NPFA 3ZVNA 4BFTA 2REBA 4C4PA 1G1MA 3KJHA 4Q66C 4YDHB 1KY3A 5B57C 3RSOA 3EXAA 1WP9A 4Q9IA 1P3JA 2GESA 2QM7A 3NHBA 3GLFA 1CJMA 1W5SA 4DLRA 2XEXA 4KLZA 1P2VA 2PMKA 4HEJA 1D2EA 2OCYC 1BO6A 1M7HA 4HYYA 3HR8A 4G5SA 4FWIB 3TMKA 5EP4A 3O8CA 4AIIA 3TR0A 3AH8A 3EC1A 1XF9A 2ZR0A 3HWSA 4B44A 4N0EA 1NI3A 5SZJA 2CEAA 1G9XA 4WW0A 1R4AA 5KSYA 3FVQA 5KPDA 4LYJA 1T9HA 3CPJB 4JVLA 4HAUA 1JR3A 2WOJA 1R6BX 1EG7A 2GK7A 3Q85A 2CK3A 3VNUA 5B2ZA 1EWQA 3ZIAA 1RRCA 1E6CA 2A5YB 4AURA 4US0R 1XEXB 1E4VA 3BOSA 3ZVMA 2GAAA 3WNDA 1DAIA 4DLYA 2OAQ1 2GEVA 4FW9A 2J41A 2IC5A 4C0QC 2ORVA 1XJQA 2QORA 4D4LA 4NE2A 4LV8B 2ORWA 3LVRE 4WVFA 2Z4RA 3HDTA 5KSPA 3VR1A 4KXFB 1VHTA 4CEIA 4JT4A 1CBUA 2BC9A 1NJFA 2JDID 2XITA 3GEIA 3KUCA 4DJTA 3U2QA 2ZRHA 4A4DA 4M4SA 1DG3A 1TQ2A 4POAA 4PO9A 3QKSA 2GCNA 2TMKA 3ND9A 3SZRA 2C95A 1CU1A 5FPYA 4RY2A 3U7HB 4H1VA 2OFOA 3QIAA 2OSBA 4FINA 3FB4A 5D3MA 2WJYA 1W47A 2RMKA 4MGYR 4TLDA 1H8EA 4BPBA 2QRZA 2O8DB 3OAAD 3DKPA 1AS2A 1D9ZA 4J0QA 5L3QB 1KJYA 4EPRA 1MO6A 2X2EA 3C4JA 3QEOA 1T5LA 3MJRA 4LBVA 4P4UA 1NN3A 3R8CA 2VHQA 4FXPA 2V7QD 1GNRA 4JLOA 1ZMXA 1JR3E 1LB1B 3A8TA 5C1BA 2ZU6A 3DKVA 4B3BA 2X1VA 3ZQJA 3X1WA 2NGRA 421PA 3THXB 2ZJYA 1IN8A 3SJCA 1DS6A 2NPIA 1XPUA 2VHTA 4B74A 5JECA 4UJ3A 3D7MA 3BH7A 1FX0A 1XTIA 1SHKA 1KO1A 4MGZR 3E5HA 5FOTA 3NH9A 4B35A 4TSFD 1A82A 1E2FA 2HLDA 3K53A 2VRWA 4PSKA 1KI2A 3HU2A 3MUFA 4GRAA 2G1KA 2PX0A 3CUEF 2DWQA 4BFUA 2ZAMA 1NLZA 2EQBA 3DM9B 1T3HA 3SOPA 2REOA 1OYYA 3QEJA 3SNHA 3WMFA 1LS1A 5IK2A 2O8FA 1SVKA 3AVPA 2FSFA 3NC1C 4D0NA 2YOHA 3K70D 4B33A 1E3MA 3AB3A 2GXUA 4Q18A 4Q4JA 3UMSA 1UBFA 1C9KA 4NTZA 1Z0JA 4LYAA 1Q3TA 4NONA 5TXGA 3KB2A 5F98A 5JWRA 4JS0A 4LJYA 4E03A 4F4JA 2GZAA 5C4GB 4C2TA 1UBGA 4LX0A 3GLHA 4FMCB 1G8PA 3GPLA 1XD2A 1MRNA 2F1IA 3P1JA 1XZQA 3LXRA 2O0JA 3GJ3A 4DUGA 4YMUA 3QQ5A 3NEYA 1OXUA 3PCRB 3T1VA 5IRCD 2B8TA 4TMVA 4HAZA 1UKVY 5AJZA 1NF3A 2G77B 4TYPA 3A36A 4DDVA 1OH7A 3A58B 3AVUA 4KHZA 4IOKA 1PJRA 4Z1MD 4BUJA 3P27A 4OKSA 3LBIA 5TV2A 2WAYA 1OXVA 5LDDC 2EWVA 3PIRA 5EJEA 3L0OA 2ATXA 3AP2A 5BYJA 3KTAA 1UEJA 4FIDA 5JCPA 3KQKA 5KSZA 1E32A 2CLSA 3GJ7A 5DSZA 3RWOA 1D6JA 4HUQA 4RCZA 3B13B 1EFTA 3FMPB 2AWNA 4PZYA 3UK6A 1E0AA 2OM2A 3KQNA 2ZREA 2QBYA 1ESMA 4DCUA 4BLSA 3RS7A 1F2UB 2QTHA 2ZVPX 4JYBA 5KUTA 2W2VA 3BE4A 3ADDA 1OB5A 4MA4A 4OHWA 1WMSA 2G1JA 3BS4A 4MKHA 2IBMA 2GBLC 2W6ID 4QGGA 5DGXA 1KZ7B 3KL4A 3SYLA 1SVIA 2JGNA 1DAMA 4HATA 2C8VA 1S1CA 2AKYA 4RD3A 3CWZA 1IJEA 4V0LA 1E2JA 1TQ4A 3CRRA 4KYIB 2GRJA 1ESNA 1E1RA 1CR2A 3PV0A 3JZAA 3O47A 2DFTA 2N1BA 4US1R 4URUR 2WAXA 3SR0A 1ZNXA 3OEHA 5JBQA 5ELXA 4LGMA 3THWA 1DVRA 3WY9A 4AI6A 4QOSA 5EP1A 3LWNA 4QBGB 1ZCAA 3MFYA 3A1WA 2WWIA 2H16A 1RRPA 3F5FA 2WSSD 4PFSA 1Z6TA 3P4XA 4HZIA 4TQUS 4OK6A 1W0KD 4RD2A 4DCNA 1XPRA 2CVHA 2IHYA 4XVRA 5FL3A 4WZ6A 4MYUA 1LV7A 2WOOA 1U99A 2XGJA 1EXMA 2GCOB 1CXZA 2OCPA 3AVQA 4GP7A 3EZ7A 4DSUA 3CR7A 2VSOA 1R8QA 3AVXA 1E2GA 2ZJ2A 2ZE6A 4RD1A 5DIFA 5KDOA 3GEHA 2ZVQX 4D4JA 4F38A 4B3GA 4PXAA 3B1YA 5H8WA 5AUNB 3L82B 3FKQA 4MQBA 2WWGA 2N46A 1HQYE 2AR7A 4FCWA 3VR5A 5AUQA 1LF0A 1VMAA 3IKJA 2WHXA 3W3ZB 4IVQA 3W5JA 1CS4C 2GWHA 3X1DA 1LW7A 2AD5A 2HCJB 1P2SA 3IEVA 4P4TA 1TTTA 2FH5B 4TQAA 2ZRFA 3AP1A 2WKRA 4HZUB 3C8UA 1E9AA 1UADA 3SHFA 1COWA 2ZANA 2JA1A 3K70B 3BWDD 1AZTA 2BCJQ 2GJ8A 2QG6A 1VG1A 2WV9A 3CH4B 3UPUA 1P73A 1OIWA 2XTNA 2ZI6A 4JVMA 2QAGA 2Q9CA 3QENA 3L0IB 3LDAA 2W58A 3R9XA 1DAEA 2KE5A 2QPAA 4R2HA 2ZR7A 3ZIAD 1W2GA 4UXHA 5LBIA 5A5GA 3AQ4A 2FGJA 5FOVA 4D2IA 2FNAA 2ZI9A 1N25A 4LV6A 3IO3A 2GZDA 1ZIOA 3DEFA 1SXJC 4YQFA 1N3BA 3FMOB 3H4MA 2FDCA 4X8OA 3H1TA 3PUXA 1VCNA 1TUEA 2YINC 2FFBA 1XDBA 2DY1A 1GL7A 2D7CA 3MCAA 3HJNA 1G3MA 2HXYA 1G64A 1HQCA 4LHVA 3CNLA 2ZRAA 2FV8A 5AK0A 1E9DA 1H8ED 4HLCA 4ZI3A 4Q03A 2ZSFA 2ZRJA 3V9PA 3T06B 1X86B 3CNNA 5TDHA 4D0LB 2OV2A 4Q7LA 3U3KA 3HPQA 1Z63A 4BGDA 2XB4A 3W9YA 1QRAA 4AWXA 1P2TA 2DFKB 4Q4HB 2NZJA 4KO8A 4LK2A 1HH4A 4JLMA 1GOTA 4B3XA 2VSFA 5L3QA 1X1RA 2JJ1A 5FOXA 2H5EA 3BAFA 1QHXA 4GP6A 3B8HA 3QKRB 2JATA 2FEOA 2FPKA 1E0KA 4QBHA 3UG6A 4A36A 1BYUA 2G9NA 2W0SA 2OFWA 4P33A 1JEDA 1S1MA 1XTQA 3QY0A 1ZM7A 2HLDD 2H8KA 4GBMA 4LC1A 3EWAA 3THXA 3NXSA 1Z6AA 4PTLA 5EE0A 1VCIA 2AHOA 2CMKA 2R62A 2BBWA 1E2KA 4RKFA 2PEZA 3D3QA 4QG7A 3WP1B 3EZFA 2Z83A 5IK2D 4RVCA 3LLMA 1CKEA 4ZDJA 1T0JB 3VFDA 4DCTA 2V1UA 4KBFA 3OFNA 1J99A 2QT0A 4F4CA 2H92A 1NSFA 2QMHA 3QPUA 4LOAA 1E9BA 3TRFA 1BS1A 2FGKA 4CT4B 4EAQA 2A7QA 1S2MA 1WQ1R 1ZNZA 4AKEA 3D31A 4LHXA 4TLAA 1WRBA 1SXJA 3B2EA 2ASEA 4JVSB 5EP3A 2NO0A 3T1OA 1RC8A 4DUGD 4GSYA 1SVOA 2FN4A 3M1IA 4CW7A 5HPYB 1VDZA 3CM0A 2RGXA 3LD9A 4PZLA 1G8GA 1I4TD 3EPJA 4G3XA 3T5DA 2PT7A 1FNMA 1FTSA 3CX7A 2G3YA 1GL9B 4C0AC 3GLFB 3DMDA 1V5WA 3OIWA 5BN3A 1TADA 4A6XA 2SHKA 1KK0A 3DOFA 3FDIA 1W44A 2RGDA 3T15A 3I5YA 5DHAA 1S9HA 4DEXA 5FOWA 2XTMA 4A92A 3AGPA 4IKEA 4TT3D 2GILA 5HZHA 1LVGA 3B9PA 2EYUA 2J59A 5JWHA 3FMFA 3IIKA 3X1YA 4CIDA 5JHGB 2P6UA 2IK8A 3FYHA 2CL0X 2NOAA 4IDHA 1MO3A 1T4GA 2J87A 1QG4A 3IILA 4HDCA 2V6JA 1KY2A 2VSXA 4FMDF 4TLEA 2JJ2A 4M1WA 2F9MA 4ZKEA 1SXJE 2GKSA 1RYFA 2NIPA 4JT2A 2RHDA 4DT1A 2GJKA 3KQHA 4CYMA 1AZSC 1F2UA 3NKVA 1S4QA 3L8ZA 1PLJA 2YZ2A 1UFQA 1NVXQ 3F3YA 1PUIA 2DPXA 1N5JA 3N2IA 5L3RA 1T8UA 2IYWA 2GEUA 4V0OA 3CRVA 2GAOA 2D74A 2AWOA 2GJAA 3MWJA 1QF9A 4JKYA 1P9RA 1YR7A 2ZSEA 1N0WA 2BMEA 1TEXA 3UKDA 1KO4A 1XD9A 3QKSB 1JAIA 3WRYC 1T91A 1F5NA 1LNZA 1OXTA 3I62A 2OLKA 4QGHA 2QMEA 3ECCA 3WBJA 5D3MB 4Q9KA 4O25A 1U0HC 3TBKA 4CEJB 3DVLA 3RRMA 2F55A 3NVAA 5HKKA 3REFA 2QPOA 1GNQA 2UZ3A 3OIYA 3TUZC 1VPLA 1G21E 4I1UA 4QNRA 3VKHA 4QFMA 1PLKA 4AYWA 4C9BA 3G0HA 5G3ZA 4WAUA 3SS8A 3EPLA 1HA3A 1HEIA 4LBYA 4LHWA 2OO7A 2AK2A 5G41A 1SVLA 4PC3A 5FTMA 2MSCB 2R2AA 4BASA 1ZC4A 821PA 1FX0B 1XJ0A 2QTVB 5G3YA 1R0WA 3R7WB 1NSTA 1HY3A 2GCOA 2DB3A 2FFAA 1R2QA 2IX3A 1OH6A 1N6OA 4FMBB 2GHIA 3A1VA 3LX8A 1AK2A 1J2JA 1JEEA 1P2UA 3AVYA 1N6HA 4OQXA 2RGGA 5TB5A 3I1FA 2VTKA 5K8IA 1IM2A 1BKDR 1CJVC 2QA5A 3QG1A 4WOPA 4UNPA 4BLPA 5HR5A 1G7SA 2IF0A 3EPKA 4V0MA 3HU1A 1ZD9A 1M34E 3RANA 2C9OA 3X1ZA 3GCGA 2P2LA 4Q4LA 1NNEA 2O8FB 1K5DA 2EFHB 1COWD 4M9XA 3SJZA 2J1LA 3ND8A 4Q4JB 2D3WA 3AF0A 1VTKA 2QY9A 1OFUX 5EXTA 4ZDWA 2D2FA 2OCBA 3I4LA 4NBSA 4EJSC 4GOJA 4ZIRA 4LV5B 3S1AB 2ZYTX 2XJ4A 3FPAA 2ZUDA 2PCLA 3GP8A 4JLVA 4M1KA 3W5IA 3L2OB 3ZS9A 4HZUA 3AVTA 3BFVA 5TARA 1WDTA 3WHLA 1XD2B 1KK3A 4QRHA 4MRRA 3WHKA 1C1YA 2BBTA 5HE8A 4AYXA 4M2LA 2FF7A 2IYVA 3IIJA 5A4JA 2JASA 5EXSA 3N2EA 2XXAB 1U8YA 4PO1A 1KYIA 2D06A 2W6JD 4ZV4A 1NVWQ 3FWYA 2JLWA 4M9ZA 3U44A 3I32A 2ZI3A 4AKIA 1EK0A 1I4LD 1H65A 3NEJA 4DDTA 3VHLB 1NIJA 3A6PC 2R44A 2J7PA 4AY2A 3T1TA 4H9GA 4IHQA 2VL7A 2IYQA 5EE1A 1G41A 4B3FX 2Z5FA 3QBVA 1KJZA 1ANKA 4HUQB 2GZHA 1E98A 1W46A 5G40A 1KI1A 2Q3FA 4NYMQ 5M04A 5LD2C 1ZD1A 1JXMA 2UKDA 1T3LA 5E3HA 3GJ4A 4HLUC 3BGWA 4ZO4A 1IONA 3FFBA 4FD2A 1O3YA 2BBOA 4BZPA 4P3YA 1IN6A 4DCSA 2ZEJA 3IQWA 1GM5A 4GFDA 2O8BB 1RW4A 1XU4A 1W7AA 2IA5A 3TIFA 1W36C 4LJ5A 1II8B 2JJ1D 1E9CA 2ZRIA 3FKSA 4GL2A 1OHHA 4TL7A 4G0NA 2YOFA 3P20A 2GNOA 4MUBA 3I5XA 1G8HA 3WP0A 4HLDA 4Q4AB 2QM8A 4V0NA 5FOSA 3RS4A 2BIFA 2OBLA 4GI7A 4Q4HA 3AKYA 1G6OA 2X19A 4G5RA 2W83A 1ZINA 1G8FA 4CZ2A 1XTJA 4RZXA 1L2TA 4OJKA 4GOKA 1XFAA 4GDFA 4OHZA 2WJGA 2ZUCA 1GILA 4S2EA 2ERYA 4JMPA 4M9QA 5DN6A 1OB2A 3W6NA 1Z2CA 4TL6A 2MSDB 5KO2A 1CP2A 3AKDA 3TAHA 3LQQA 3OFND 2CHQA 2KWIA 3OZXA 1P60A 4MYTA 5E95A 1OF1A 1EFRA 1DELA 3KUDA 3KFVA 3TH5A 4CVNA 2QTFA 3KKOA 2JLSA 1Z0AA 1US8A 2FG5A 3VX3A 1CTQA 3TGPA 5BXQC 2JLRA 4PHFA 2QI9C 3PITA 2AFHE 4NYJR 3PQCA 1HURA 1W1WA 2P5SA 3H86A 1FPMA 4JLNA 4MGKR 1AIPA 4JLBA 4RFVA 5F9HA 5LPNA 1IHUA 1Z6XA 2R6GA 2ZTSA 1P61B 4C3ZA 3I92A 2PBRA 4MUAA 3RDPA 3JZMA 3ZQ6A 4PR0A 4MH0R 2IYTA 3KXLA 4IVPA 5KOYA 1GAJA 5FPKA 1BH2A 1SVSA 1TUIA 5FOUA 4DSTA 5J4VA 1T6NA 3KJGA 3NIBA 4DEYA 2A5DA 4HLUA 4KSCA 1PV4A 4FMDB 4M1SA 1YZGA 4JKIA 4ON9A 2IYSA 2P67A 2ZSAA 4PX9A 2RGNC 1IJFA 4JLKA 4F92B 1II0A 1ZYUA 2QAGB 2QAJA 2WWHA 2RKOA 4A0GA 4KJZA 1Z08A 3RS2A 1NG1A 1KDRA 1JJVA 3QKTA 3TW4A 2JJ2D 1S3GA 3K0CC 2UVQA 3I73A 4B48A 2HT1A 2JLVA 2JCSA 1Q1ZA 1HV8A 1MO4A 1BOFA 2CJWA 1Q22A 4EUNA 2YWFA 5FI0B 1DADA 4IFEA 5K8UA 4Q1CA 4DSNA 2NO1A 5F2EA 4TMKA 2O8EA 4G5OA 1L8QA 2D62A 3GJ8A 4C0SA 4PC1A 3EG5A 3NBYC 2QN6A 4FN5A 5CK4A 4E5UA 3NG1A 2Q6TA 3BFXA 4E22A 2UZIR 4BEBA 3BB3A 2VHUA 3GLIE 2ZJZA 4Q1EA 1MV5A 1P5ZB 5LB2A 1NVVQ 5JZVA 3IIMA 5DNYB 1SZPA 2IS6A 1WA5A 1TMKA 4XVQA 3V00A 1G291 2ZYUX 4E09A 2BOVA 5KNBA 1Q12A 1XMJA 4Q21A 2LCFA 3NBFA 4OK3A 4B2PA 3MWKA 1YR6A 3B9QA 4RSGA 4MDFA 1Z0DA 1LS6A 3HR7A 3QNUA 3VHXA 4JVNA 1ZIPA 2QPTA 3RS0A 5EQTA 3UXMA 3GLGE 2R6FA 1AQYA 1ZAKA 3QXSA 5J4KA 5LB4A 3IGFA 5E4FA 2ODWA 4CEJA 3TW8B 1OE0A 2VP4A 1YZTA 2BVNA 3RYTC 1Z29A 3U6BA 4K8OA 1XEFA 3KJEA 2OFXA 2Z6VA 5J4LA 4XTCS 2F1HA 3B7GA 2V55B 3QJYA 2BMJA 2YJTD 4ZI2A 2ZUBA 2YOGA 1M6NA 3A4NA 5CLLA 1KAGA 4B3DA 4EFLA 5L8VA 1SVWA 2O8CB 2ODNA 3CZQA 2HUPA 3R7WA 5CM9C 1JPNA 1YKSA 2IYXA 2B92A 2J5XA 2WJVA 1KMQA 3FHOA 3K9HA 4OK5A 4U5XA 5KNCA 3UATA 3O8RA 3R9IA 5GJBA 1TL7C 3QBTA 3QPWA 1IXSB 4PSAA 4DKXA 2BM1A 3PEYA 3MD0A 6Q21A 2CE7A 1E1QA 3IUYA 4DB2A 3GJXC 4DB4A 3M4YA 3P26A 4PO8A 1XD8A 1KMHA 5IHPA 2ZRBA 1SXJB 1W0JA 4BZXA 4I99A 1ZVQA 4OL0A 2HXSA 2YVUA 3S1AA 3LH5A 2IT1A 1S96A 2WMOB 3NHAA 4G5GA 4BE7B 2DYKA 5JSZA 1W49A 4HLQB 1XEWX 4IJMA 2VHJA 3U4QB 2V4ZA 4DLWA 1E2IA 4OHYA 4N3NA 1P9WA 2RHMA 2XOKD 4XWKA 2ZRKA 2WPDA 3KFXA 1P75A 2IXFA 2J0QA 3HP1A 1AS0A 2BHRA 1VG0B 2J7PD 3LQRA 4Q1DA 3B85A 4R98A 2E1RA 4PPQA 3QXCA 2IUTA 2XXAA 4DDWA 4BLRA 2ZRDA 1Q21A 3MJHA 3MRSA 5E7MA 2B7BA 2CDNA 4BLTA 4ACBA 1E2HA 4PQFA 4NYIQ 1BMFA 5DH9A 1AQUA 2NO9A 1YZNA 1WF3A 1P4SA 2QRNA 1DAGA 2HV8A 2GETA 1XBTA 2EFDB 2GF9A 3QXHA 3K0AA 3B78A 3EZ9A 4DT1B 2IS2A 1R0YA 3G82C 1VIAA 1J7KA 3BC1A 2JEOA 3L43A 1OHHD 2Q21A 3EAQA 5GVRA 2NMVA 3J81k 4Q9JA 3K0SA 4W5JA 2ZE7A 3SYNA 3AF3A 4TTQA 4EPVA 3B1ZA 4YMVA 3VTKA 2O8BA 1KI4A 2OCAA 2WVJA 2B7CA 5AJVB 2QL6A 3GFTA 4NCJA 3K09C 3WMGA 4LZZA 1DARA 1II8A 1KO8A 3CPEA 4QL3A 3B60A 3TQFA 4OQMA 5JS7A 1E79A 1XZPA 2IYLD 3VR6A 1AS3A 3VKWA 4BFWA 3W90A 4PAOA 1OSNA 1NMZA 5DN6D 4Q4AA 2HT6A 1KK1A 1IAQA 1M74A 1XNJA 1C4OA 1FP6A 2VO1A 2CHGA 4Q9LA 3GJ5A 4ZCIA 1NL3A 1E96A 4LPKA 5BWMA 3SJAA 2DBYA 1EFRD 4G5QA 1E2PA 3NTUA 4JLAA 4D25A 2ZM5A 4M1MA 1HUQA 4HAYA 3TSZA 3BBPA 5UKDA 1SVMA 2ZE8A 4N0DA 4X8MA 3GD7A 1XTSA 5JI2E 1H8HA 3CNOA 1FUUA 3W6OA 1JBKA 5JFGA 1ZC3A 4NYMR 4QHSA 1AKEA 4MYCA 2WICA 2CE2X 3C7KA 2PZFA 4QKQA 4JZKA 4XD7A 1Y3AA 1FQKA 1Z0FA 2G83A 2PZEA 5CYOA 4EFNA 4QJ4A 1GL6A 3AF1A 1GUAA 3KJIA 5K8LA 2MMCA 3Q7QA 3TKLA 5HZKA 4LBWA 3ZH9B 1CIPA 4TQ9A 2B8WA 3R8FA 1F2TA 2QUZA 2XX3A 4GMDA 1NLYA 1E2DA 2VP9A 1XMIA 4D81A 2YHSA 1KO5A 1U9IC 2WKPA 3OIUA 4DIDA 4PC6A 3BD9A 4ZIRB 1FOEB 3AUXA 1Z2AA 1IN4A 2BEJA 2DWPA 3PUVA 1YZLA 2WBLC 2VP0A 4KBGA 1M2OB 4TYYA 4AKHA 2V9PA 3QUSA 3ONWA 3SQWA 5JMTA 4A2QA 4U7DA 4GNKA 4YLGA 3U3JA 1OT3A 2FSIA 1W4CA 4BFVA 2ZITA 2GBLA 1E69A 1FMJA 1X3SA 2NO7A 1XRJA 4YMWA 3KQUA 4DVGA 1JR3D 2GXAA 2D7DA 4L5BA 3CBQA 3VU9B 4EQ6B 1G5TA 1A4RA 4TMWA 1W4BA 1XWIA 3TNFA 4LJ4A 1PUJA 4DXAA 2CK3D 1R7RA 4C0BA 2BCGY 4LJ7A 4WZBE 3LX5A 1IN5A 1FP7A 1TPZA 2Y8EA 3U44B 4B75A 4BFXA 1ZRHA 5CIWA 2P3SA 4XVUA 3UMFA 4XTRA 4F93B 1G4UR 2J9RA 3MGCA 1U8AA 3Q8XB 1NY5A 3RC3A 4M22A 3DZ8A 1OFTA 4LY6A 2I1VB 5A0FA 1OPXA 2ONKA 3ASZA 4QBIA 2QNRA 4DIEA 1N5IA 1QHNA 3AEZA 3BK7A 1F60A 2L0XA 1W2HA 4ZKDA 1G7RA 2FMXA 5FTJA 3M0EA 4IDPA 1TF7A 4YDSA 4YC7A 1D5CA 1N2CE 4KFTA 2PEYA 5GVSA 3CX8A 2JLYA 1D9XA 3U3RA 3OE7A 3EW9A 2CXXA 2HJVA 3U3OA 3M6AA 2FZLA 3MG9A 3THYA 2MSEB 4JJKA 4PPGA 4II7A 4Q7JB 1TNDA 2PLRA 4TYNA 2VA8A 3A4LA 4D80A 1RJ9A 4I1OA 2OXCA 5KNDA 1YR9A 2FFHA 4GPTA 1EWRA 1ZM9A 3LW7A 4EJSB 1X8JA 3I8SA 5GJWC 4IVRA 3IHLA 4QHYA 5E7IA 1AJEA 4A6PA 2VLIA 1MO5A 1J90A 1ZU5A 2ZU0C 2W2XA 1F3OA 3ZZTA 3U6KA 2DFNA 3BXZA 5C46F 5BYKA 4Z51A 2O8CA 1KNXA 2ZRLA 4TLBA 5JWOA 2J0SA 1O87A 1E1QD 3AKEA 4DC9A 1US8B 1UKZA 3EASA 1ZNYA 4Q02A 4I1VA 4C0HA 3K0FA 2FWRA 2XSZA 3SBEA 1RYHA 3UIEA 5KTYA 1L4UA 1W0JD 4UNSA 3FTQA 3EX7C 2KBFA 5CLQA 3X2SA 2WWWA 3PEWA 1K5GA 3PG5A 4QJ5A 1Z6YA 2C9YA 2ORIA 2XB2A 3Q72A 1NJGA 4WXPA 4PAMA 3IPYA 4IFBA 3GLIB 1XJCA 4M9SA 3CLVA 4MKIA 2QU8A 1G5RA 1ZD8A 1SKYE 5LD2B 4TTPA 1X8LA 2FSHA 1QZXA 4C2UA 1AGRA 1JB1A 4KAXA 3U4QA 4HSEA 1TAGA 2EFGA 2HDNB 4RJLA 2J0VA 4UXJA 3RC8A 1CLUA 1Q1EA 3BB1A 3ZS8A 1BMFD 2DFLA 1HT1E 4D4MA 3R9WA 3PVSA 1W36B 1FFHA 1KK2A 4JYCA 3LW8A 1U0JA 4EPYA 3QE0A 4M1YA 5J40A 2AL7A 4Q47A 4JL5A 2ODBA 4I1SA 2CJWB 1NKSA 3TQCA 4O3MA 1VYUA 4A8JC 5JJKA 1IN7A 3NWJA 4HI0E 4G1UC 2O8EB 4RFSB 2WWXA 4PQYA 1IXRC 2H57A 2EFCB 3SHWA 1E4YA 2RB4A 3DPUA 3VKGA 3PUWA 3SQXA 4JL6A 1E79D 1VHLA 1YE8A 2QP3A 3DDCA 1YR8A 4GZMA 3EIHA 5FTNA 5B64A 1I4DD 5CITA 1DO2A 3BORA 3VR2A 1E1RD 2G88A 1GKIA 1KIMA 2A5GA 3OEHD 4XWOA 2VIIA 4QJ3A 5J47A 3TSWA 2CL7X 5L3SB 2C78A 3KZ1E 4YXWA 1Z22A 4E07A 3EIQA 4MITA 2RH5A 2G0NA 4IXMA 5CB8A 4HAVA 4NKRA 2WTUA 2CLDX 3OHMA 3VNVA 4LSGA 2ONJA 1KTVA 4TL8A 4DHEA 4UNQA 3U3MA 3K70C 2VQSA 1H8HD 1G4AE 1JQLB 1HT2E 2P65A 2ANBA 1NLFA 2VPPA 4LHZA 1OXSC 3CF0A 1Z0KA 2F43B 1M8PA 1RFLA 2H7VA 4OHVA 1ZW6A 2C96A 1B23P 4CF7A 2Z0MA 4MKGA 1RZ3A 4YONB 3SFVA 4UNNA 3ZD6A 3IBGA 4D6PA 2CNWA 5H68A 5KU1A 3VR4A 4TYQA 3RS5A 4B73A 1G8YA 4DCVA 2C98A 5FR2A 2LKDA 5AUOB 5JRZA 2YWEA 3BJIC 2IW3A 1S8FA 2CCGA 4LHYA 1NG9A 4W7SA 1T8TA 2X8AA 2F9LA 5JEDA 5FI1B 1MABB 1QBKC 1K6MA 5EXPA 1MKYA 521PA 1L7VC 2N42A 2Q0HA 1GVNB 1D8TA 1DO0A 2QE7A 2QMOA 2QQEA 3MAAC 4QNMA 4B3CA 4IRUB 2A3RA 4TWZA 3ZJYA 4KI0A 4TMZA 1KMHB 4DZZA 3KKMA 2O0HA 4A8JA 2P6RA 2C04A 4L8GA 5CJPA 2YYZA 4IEIA 2P0EA 2V7QA 3SE0A 1NN0A 2FZ4A 5FTLA 1VECA 3K1JA 2QEQA 4ESHA 1ZCBA 2H18A 1VCOA 3WYFA 4W9MC 1RVDA 1JXOA 5JSZB 4TTRA 3SJBA 4RD0A 2F1JA 2H17A 1KI3A 1CULC 2PJZA 4ACAA 4QM6A 4BEJA 3T34A 2CVFA 3TUIC 3ICQB 3IDQA 4TSFA 1KSFX 3DM5A 2ZRGA 3BH0A 3UWOA 4ZDIA 1EFUA 2IYZA 5DLQC 4CEHB 3VU9A 2HF8A 3CF2A 3K0EA 4EQ6A 1UPTA 2VP5A 4OI2A 4F91B 2B21A 5GJVC 4N1AA 1OIXA 4NCNA 1EX7A 3N5CA 1Q57A 4WBSA 1A1VA 4P4SA 2IUSA 4LWZA 3TR5A 5IF9A 1Z6GA 4GOXA 2W00A 3BB4A 4DLZA 1TF2A 4UXIA 3Q7PA 4Q1BA 5JRJA 5KPJA 5EE3A 5F9FA 2ZR9A 1RKBA 5CIQA 3AUYA 1SGWA 4NCKA 2HYIC 2CCJA 3K0AB 3NDBB 2ANCA 1KZGB 2VF7A 2NZ8A 3I72A 4BRWA 5FTKA 4BECA 2EW1A 3QF4A 4DRZA 3HYTA 2BJWA 3B1XA 1V43A 3AP3A 3CIOA 3MWYW 1KI8A 4LYHA 5BN5A 3CRQA 4AK9A 3JVVA 2ZJ5A 3AVWA 3AVOA 3IPXA 1E0SA 1U90A 4URZR 5FUWA 2JLXA 5BQ5A 2RGEA 1HYQA 5HCNA 3I8XA 4Z1MA 1UBEA 3QI2A 1MRSA 3B6EA 4LPSA 1Z07A 5CDFA 3U60B 1VYVA 3C15C 1E2LA 4Q00A 4JBWA 1L4YA 4DWJA 4D26A 1YJ5A 3A37A 1N6LA 4UNRA 2QZ4A 3PUYA 1KSHA 2HYDA 4EFMA 1FZQA 3CKLA 1JNYA 2EVWX 4ERNA 5CK5A 1Z0IA 1CR1A 3RHFA 2GVDC 1BIFA 2GF0A 4OHXA 3WXMA 4ESVA 4KVGA 1ZUNB 4D82A 4EJSA 3DHWC 4V0KA 1N5LA 3WNBA 1HE8B 3RRNA 3E70C 4OI0A 2XSZD 2V6IA 4OQNA 3L0SA 5FPHA 2GTPA 5C4MA 4FCTA 2EFEB 1MH1A 2BM0A 4L4UA 1ODFA 4LJAA 1E2QA 2JAQA 3D8BA 3EC2A 2VBCA 2W6IA 2OEPA 3DZDA 4Z8XA 1LF5A 3KKPA 1SXJD 4JLPA 1DAFA 2ZI5A 4FI3C 1P9NA 1X6VA 4M0LA 1UJ2A 1A2KC 1G20E 4DSOA 1OYWA 2CL6X 4CGZA 4BFYA 1GDDA 2G6BA 5DO9A 1R5OA 2WJJA 3H0KA 4PPFA 1F48A 2J3EA 4MDEA 2C5LA 4IDNA 5CDFE 1F2TB 2GXSA 1WB9A 2D4HA 1UAAA 2YC2C 2V1XA 3C14C 3GLIA 3TSOA 4GT1A 1U98A 4C0KA 1HE1C 4WIAA 1G7TA 1II9A 4EIWA 2IS4A 2IXGA 2PLFA 4C0LA 1W0KA 4L9SA 2O52A 1GP2A 2QSYA 1OFIA 2OE2A 4Q7MB 3T5GA 1UEIA 2RCNA 4I4LA 4QC2A 5B30A 4LJ8A 2PZGA 4KSBA 3W34A 1FUKA 2CLCX 5AWFC 1CJTC 3ETLA 1SULA 5FUVA 3TVDA 4PAQA 4F7WA 3GLGA 3RLFA 3L8YA 3LNCA 1G5PA 3OESA 4HUTA 2ZS7A 1PZNA 1XCMA 1I2DA 621PA 2OILA 3AGQA 5FBRB 3Q5EA 3PEUA 3HPRA 1J8YF 3W6PA 4AKGA 1SQ5A 4LDJA 4HDQB 2XTZA 2A2ZA 4H1UA 4XIGS 2WWFA 2A9KA 4HB3A 2D2EA 221PA 2CCKA 2PCJA 4XJXA 3LLUA 3PR1A 3NH6A 4RFSA 1QHIA 1S0UA 4I81A 3WBKA 3WMEA 4S35A 1OH8A 3THOA 2JIZA 4MRSA 3IO5A 4YMSA 1KKMA 2BV3A 2NTYC 1XXHE 2HJGA 1Q1QA 4PQRA 1W5TA 3FGNA 4TL9A 4B32A 4ZCLA 3PJRA 4YXWD 1R5NA 1VKJA 5EXXA 1DBSA 3TVTA 3GEEA 1OLOA 2OT3B 2RAPA 4FWTA 2F7SA 1KI6B 4RZUA 2IWRA 4Z8YA 4ITRC 4MKFA 3ZGXA 4JJZA 3NBZC 1FNNA 4R71A 2J46A 5HKKD 2ZAOA 2EYQA 3B5JA 3KB1A 3CONA 1R0ZA 5L3SA 1KDPA 2BJVA 2BMDA 3CF6R 2PH1A 2RGBA 4PHGA 2CBZA 4X8LA 3Q5DA 1XTKA 1Z3IX 1E9FA 2O0KA 4HB0A 1KSJA 3K9GA 1ZM4A 3LBNA 3CX6A 3THYB 1IY0A 4U00A 1MR3F 3H2YA 1P62B 1AM4D 4M53A 3LO5A 1RJ9B 5HE9A 3U61B 3SBDA 3UMRA 4KYUA 1SKYB 2CNWD 3QVVA 4Y0AA 3GLFE 2F43A 5KDLA 2NQ2C 3RS3A 3X1XA 3CR8A 3IQXA 5DI9A 1X8KA 4A15A 1XEWY 1NKTA 3SEAA 2X77A 3SI7A 4V03A 2IHBA 1U0LA 3EIEA 2A30A 3QKUA 4DDUA 2XNSA 5DI3B 2QE7D 1HTWA 1XCGB 2A78A 1KJWA 2RGNA 2VYFA 3K0FB 3SU8A 5AJXA 2OZEA 4IXNA 4B71A 3GMTA 1GZSA 4GZLA 1N0UA 1MABA 1IY2A 3F0TA 4Y0VA 3K0CA 4B6FA 4JSTA 4O0MA 3QVUA 1DE0A 1LTQA 3WYAA 2FA9A 1JALA 4GMXA 2REXB 1GRRA 1T5IA 2QT1A 5FUXA 4R2IA 2ZJBA 3RRZA 4OQLA 2OHFA 4JLDA 2IYYA 3KX2A 1M7GA 3PENA 4V02A 1Q20A 2BWJA 4MRNA 1DG1G 3EZ2A 2KSQA 1CRQA 1DAHA 2JLUA 5G53C 4O2RA 2E9SA 1NP6A 4A82A 4LJ9A 3FMIA 1OXXK 2ZETA 2OUKA 5E7JA 2YKGA 2IF2A 2Q3MA 4ARZB 4KLNA 1JR6A 4CEHA 4BLQA 4US2R 3LFUA 1GNPA 1NY6A 4EKDA 1A7JA 2AKAB 2F3TA 2WZQA 1NRJB 2ZIAA 2GCPA 3PFIA 3I61A 2J7KA 3SC3A 2IXEA 1N6RA 3V4RA 4JSYA 5DYIA 1ZUHA 1ZU4A 4IDOA 2ZE5A 1Z06A 4IEEA 2HF9A 1EFHA 1EFCA 2C77A 1GITA 2R9VA 4QGFA 3RWMB 1N6PA 4ZCMA 1PVOA 1XPOA 1X1SA 3AM1A 5KSOA 1WE2A 2IEYA 3FKSD 5L3VA 4RD4A 1QHSA 1R0XA 2ZRMA 2C9CA 3H84A 3I3SR 3K8YA 4IOMA 4FCVA 2K5UA 1QHHA 2WWYA 4W5WA 4D0GA 4C7OB 3QXXA 3ZYCA 3ZDQA 3U7GA 1R8SA 1VYTA 4TT3A 1CJKC 2J0UB 4C0JA 1CRPA 1WCV1 1XCPA 1QVAA 3G5UA 1YZQA 2A5JA 1E0JA 4QXAA 3DMNA 1TQDA 3TK1A 3CZPA 1ZM2A 4Q1FA 1U94A 3GJ6A 4A2PA 4KODA 1EGAA 1VG9B 2QP9X 4Q1AA 3GLHE 2QAGC 5EUQB 1FL9A 2ZYVX 3B1WA 3LBHA 1BYIA 2P6NA 1XTRA 4JBYA 2X2FA 5ANRB 2B6HA 2ZXUA 1W4AA 4LYFA 5H70A 5K8TA 2HCBA 3EARA 4NCIA 3FHTA 3KQLA 4TYWA 3K9NA 2EWWA 1IQPA 5BW8A 1J8MF 2ZSDA 2NO6A 3T12A 4DBLC 2R65A 3VR3A 2FOLA 4LJ6A 1DOAA 2YWGA 5EUMA 5EZ5A 1KI7A 3AF2A 4YMTA 5KDDA 1UBCA 1NBMA 1CJUC 2GK6A 4O2LA 1DAKA 2AXPA 4HAXA 4LC0A 2WSMA 1OKKA 4A9AA 1U8ZA 1TQ6A 1VCMA 2YC4C 4A8JB 5HTKA 5F3WB 1RRFA 4AG5A 3HYRA 3OEEA 4JIMA 2ZQ5A 4IOJA 4M1TA 4M21A 5DHFA 4B34A 1JPJA 4B43A 4LCBA 4EPXA 1YU9A 1YZUA 4MRVA 1W36D 1VIYA 2XZOA 2BBSA 3ASYA 4PPNA 1NVUQ 3E1SA 2ZRNA 2PMDA 3CWQA 4TMXA 1RIFA 1W4RA 3CB4A 1YZKA 2R8RA 2EU8A 5FBWB 3K09A 1MT0A 3UWKA 2H1LA 1KO7A 4LRWA 2F3RA 4PC2A 4XSGA 2FEMA 4L9WA 2WMNB 4KITB 4F4IA 3O8DA 4XSHA 1JQJC 1GSIA 2JIZD 4B2LA 1N6IA 4P4SB 1GRNA 4KVAA 3UANA 2GEDA 1NBME 1YHNA 4Q9HA 3R20A 3TLXA 5JLJA 5FBLB 4BFSA 1UKEA 2FJUA 2J45A 2NG1A 2BEKA 4B2IA 4A0RA 2FSGA 1LFDB 4URVR 1A5TA 4ILEA 2R6DA 4KFUA 2BKUA 1G6HA 3ADKA 3LXXA 2RGAA 3QOFA 4W5HA 4X8HA 3B1VA 4G01B 2IS1A 3QF4B 2A5FA 1E2NA 3ADCA 2DCUA 4PZZA 2W2TA 2W0MA 1KAOA 2OLJA 1KI6A 1GTVA 1UDXA 3L0PA 2ZSBA 4OI1A 2FPLA 2G0TA 4XWAA 2GXQA 2ZI4A 1IXZA 1M1YE 2E87A 3RRYA 1R10A 3A1TA 3LAWA 3RNLA 4RKEA 4KV9A 4K81B 3MLEA 4AG6A 1E9RA 1P6XA 2W6JA 4WA7A 1XEXA 3LA6A 1A2BA 3LRPA 1ZP6A 2ZYWX 4TZ0A 2ECKA 1Q1BA 3REGA 2ZS9A 2AFIE 5HCIA 4JL8A 4Q5IA 1NN5A 1AGPA 4HAWA 5FPTA 4DLUA 4U02A 4RZ3A 2I4IA 121PA 1U9IA 1ZNWA 4NYJQ 4RZ2A 5GADl 3ADBA 4HB4A 3GQBA 4OJQA 5TMPA 1JI0A 1DEKA 1QVRA 1DTSA 1FW6A 4AC9A 3A1SA 1OH5A
chains in the Genus database with same CATH superfamily
4ZO6A 1NHGA 1G3UA 1UM8A 1CY6A 3NKFA 3ENZA 1DRKA 3E82A 3AINA 1GKUB 4F0JA 3C41J 4ITVA 5KVQA 1G8JA 1JNXX 3ZY2A 4BMYA 3DW1X 4C88A 3H1AA 4UQOA 4EUKA 2O8DA 4REMA 3URMA 4WASA 2C2ZA 1U0OC 5DVZA 1QGUB 4EJ0A 4Z54A 1SM4A 2ZRCA 1YRBA 4DF3A 3PWZA 2E5WA 1L5WA 1XQXA 2PL3A 3KU1A 4IW3B 1Q0UA 3JR3A 4B3IA 3RODA 2P3OA 2BTQA 1QJCA 3CH5A 1KSGA 2GZ1A 3QYJA 1FLAA 3Q11A 3VZBA 1CP3A 4DBLE 3VNAA 3VJMA 3WNCA 2Z3ZA 5CAEA 5J2UA 1Z5GA 2RHTA 1XQ9A 2E4ZA 2EQAA 1TU3A 4IJWA 2X58A 4H77A 2DHRA 2CXOA 3Q3JB 3BRWD 3FNRA 3M6IA 3MWLA 4R2XA 4KR9A 3DL0A 4RM3A 3F2VA 4XB6B 1EESA 2ZRPA 1V45E 1A2OA 2Q5IA 2WPDD 3U3ZA 1DXYA 3L02A 3MGAA 3N59A 3TJZA 3WOHA 3PCXA 3ZW9A 1QBGA 3L9XA 4BVJA 4AD8A 2VJPA 3G8YA 3OCYA 4URYR 4GI1A 4ASUA 1EVEA 5IG2A 1KJ9A 3M33A 4BGIA 2BRUC 4HDMA 1Z47A 4HQLA 4B47A 5A3QA 5CVUA 3WLFA 1T6YA 1U7DA 2WT9A 3OP4A 4QT4A 1CUFA 1NF8A 1R74A 2XMSA 4ARZA 3DZHA 1DPFA 4IPTA 3TD6A 5G0WA 3QOXA 2JFOA 5MF6A 2CDCA 1N0VC 4IJVA 1IOZA 2FE1A 2QY6A 3EXIA 5CCDA 2Q6OA 3VC2A 5JJBA 3WB1A 2ZI7A 4IHKA 1YB7A 1Z5NA 2DWCA 3M1YA 4H16A 3U31A 1R9MA 4Y3UA 1GTG1 3PQ7A 4N0PA 1QTQA 5H02A 4KCGA 1H93A 1Z2PX 4HG2A 4QBFA 4CM4B 4G0MA 5BVGA 4UARA 2G72A 1G16A 2XYGA 3TR6A 2P9CA 5J2TF 5BWCA 5L9AA 3OPYI 1VG8A 1UMCA 1QXSA 2BISA 2C7GA 2I7TA 5J4YA 5NLLA 2YZNA 3O94A 1FVHA 1NN1A 1TO2E 2Q3LA 1FQJA 5TRTA 3U9LA 2PZAA 4E6PA 4HYTA 1RJGA 5EP2A 1CZRA 1XPJA 3ZWDA 3KPVA 3C16C 3PQDA 4TUYF 3GK3A 3C3KA 1TJ4A 1JQAA 1BFDA 4PC7A 5JJLA 2XDWA 1YZ3A 1J0DA 3T8YA 5EVJA 3EIWA 1T0HB 2R1VA 5FFMA 4QECA 4F3NA 2F17A 2I4OA 2J30A 3VJLA 3AEQA 2XUKA 1ONOA 5BN4A 1QQ6A 3GQVA 5ITVA 2QGZA 4JJ8A 1MIHA 5I9IA 1CR4A 1S01A 5GV7A 5KHOC 1J7JA 4G4IA 2I3GA 3QXJA 2WIAA 3R0QA 4RCYA 5E6SB 2WLTA 3HYLA 3KWLA 2QNIA 4D9IA 4LRYA 1ML3A 2X6QA 4MA5A 1XB2A 1Y3FE 2YJ3A 3A4MA 3G7UA 4XOIA 1GFIA 3MT0A 4DTCA 2V7XA 4QM7A 1I3NA 3WHPA 1PYOA 2OQRA 3BGVA 4HN9A 3GVIA 4A0FA 4WGGA 1CF9A 2QR2A 1R6TA 3D6HA 4YRSA 4G5HA 4UAVA 4ZVSA 2IV7A 1JG6A 1A9SA 1OV4A 3HB4X 5TY0A 4ZU3A 2DTEA 5JZMA 2VYND 4RESA 2PUGA 3ZZNA 1DCKA 2IUUA 1RXYA 2QP4A 4KEAA 5DFAA 3O38A 2HY7A 4CMGA 5KNBH 2BSQA 3VR3D 4LOLA 4XD7D 2GSDA 4AO7A 2GKOA 1OI4A 4M49A 1PWYE 2C4KA 3GIWA 1F38A 1VRCA 3A6GA 4G4SO 3RRJA 1D2NA 3LKDA 2H54A 1KYVA 4CDGA 4YHHB 1YS1X 10MHA 3IHWA 3OJWA 4RKYA 2OBNA 3O0DA 1POXA 5EA2A 4GM1A 4WEOA 2VEDA 3BE6A 3GPIA 2AOTA 1AN0A 1B0UA 1GGKA 5JAIA 3BFKA 4RGQA 4ZFNA 1GIAA 4WQMA 2H3HA 1F3LA 2VP6A 3EGEA 5AOCA 1LNQA 2KJQA 2VTEA 4G36A 3RJ5A 1XLTA 2FAXA 2NVUA 1QH9A 1YCGA 3AB8A 1BFUA 3EA0A 3KYIB 2ZK7A 3OAAA 2VRCA 3TQSA 2CD9A 3ZOZA 1K7CA 5CH5A 5DYTA 3RVBA 3T1QA 1BJKA 1GARA 1DLJA 1U1CA 3JQPA 4HRVA 1CR0A 3DD5A 2OG2A 3PX7A 1XDDA 3FR7A 3P0HA 3OIVA 2EKLA 1X7DA 1Y9DA 1XR3A 3FFTA 1V7CA 3HDGA 3SYKA 3TW0A 2WU1A 4B6EA 1I6KA 1FNCA 3EIUA 3ORSA 5CVCA 3GGSA 4L8LA 1OW3B 3IERA 2I2WA 5K0LA 3SFTA 2FWMX 1SKQA 3F5SA 3JQQA 3TI9A 1I2CA 2FPPA 3ZBTA 4CNQA 5DX0A 4ZOBA 3Q3VA 3BTOA 2FU5C 5DP2A 1XN4A 2AK3A 2ODEA 5HFNA 1W59A 1ODKA 1AF7A 2VH5R 3ZE2B 1I36A 1E3WB 1N6NA 1OUMA 1ZNQO 4MUJA 4MVJH 5IM5A 3DWFA 1QHYA 2CHUA 2VWHA 3RVOA 4Z4HA 3LHSA 2C99A 2QTWB 1JECA 2DR3A 1NXXA 1UXGA 2GNAA 1LU9A 3GFOA 3ONNA 3UK7A 5B4TA 5JS6A 4FUQA 1QAMA 4WCFB 4JBXA 3LV8A 3WRXC 4INPA 3OCJA 4OXYA 4DADA 1ZUIA 1J20A 5K3DA 3TSAA 2B4RO 3T61A 5FUMA 1U0BB 1JX6A 1FTWA 2YWHA 4PZDA 3GGOA 3IBTA 4WPGA 1B4DA 5J5AA 1Q44A 3KP1A 4Q39A 2RKWA 1N7GA 1O96A 3B6JA 2LKCA 3TMAA 2FUG6 2PFKA 2DBZA 1FTNA 2JJQA 1WSBA 4KR0A 1RBZA 5BOSB 1Z2NX 2B30A 1CHDA 2GFHA 3H1FA 2FN3A 3EG9A 4WMLA 1IZ7A 1IY1A 1Y82A 2DWOA 2IEZA 4FNMA 5AVVA 5HTOA 5KYKA 2WD7A 4RADA 5CLHA 5DTEA 4EPTA 2RGCA 3UBTA 4BWYA 2HJSA 3HV0A 2VC2B 2BFDB 3L79A 5J5CA 4ZJUA 3KTAB 1B6SA 4I66A 4QX6A 3LTEA 1M8JA 2Z1NA 1UBOS 2F90A 1KDVA 5EQDA 3FPCA 1ZBDA 2BR3A 5K3AA 3WGMA 5JJIA 3ZD7A 1JILA 1MOZA 1NVEA 2GM3A 5CW1A 4YALA 4ZXPA 1QH1B 3QUBA 3NATA 1DX4A 1TJ3A 4EGFA 3EDYA 4YGYA 2NQTA 3QEMB 2X0EA 1J23A 3SKXA 4JXZA 2HRBA 1GG9A 1T1RA 3ACCA 2WUFA 5BV1A 5DM1A 1F1JA 4DIKA 1TM1E 1B73A 1P4AA 2C4VA 5HG0A 1LFAA 4E15A 2VF8A 3W8FA 1Z4OA 8ATCA 1Y3HA 2VZLA 1XZDA 3UB2A 3N2GA 3OT1A 3R0XA 4BBZA 5CXSA 1CZLA 1GZDA 4WZZA 3IBYA 1L5OA 2W6ZA 2H9AA 3JVIA 2J4DA 3P97A 3SNKA 3ILXA 3ANTA 3OJ0A 4GYYA 3NW9A 3A9VA 4YCDA 5IHXA 4Q7KA 2WYOA 3MIIA 3O4VA 2J9XB 3QFTA 3W9BA 2VJOA 2QMUA 2XZPA 4CRWB 1QKIA 1RBYA 3WGLA 3RYCA 1GZ4A 4RTSA 4ZPXA 3U5ZB 4OAPA 2CUKA 1E9SA 4C30A 5AW6A 2GA8A 3SXPA 1AK9A 2RARA 2I65A 3C8DA 4Y2TA 4TVSA 4R81A 2AD1A 3RUCA 5JHHB 1KZ4A 1T3GA 3OJOA 4MWBA 4UBJA 1L4NA 4CJXA 1PZXA 1YAJA 3CO5A 4K2HA 4OF4A 2Y1XA 5H81A 4BYGA 1IUNA 1IFXA 4MAAA 1USVA 1OLXB 2J5QA 4IICA 4L0DA 1FYVA 2R7AA 3R44A 3F8TA 4JR1A 4MULA 4R0VA 4XCQA 4ASUD 3I53A 1MMFB 4P31A 3KKNA 2D7JA 3AUKA 2KB0A 5IARA 1CQIB 1E5XA 1JS1X 4A2WA 3FETA 4UTRA 4DLKA 4HVLA 4N39A 4BLWA 4F4UA 1QZZA 1M6WA 3WA7A 1G59A 4PHTA 4KR7A 1P1HA 1B6GA 4QUGA 4DLPA 4QYTA 5E4JA 4Z4GA 1E7WA 1RAIA 3W5HA 2AZMA 4KR3A 1M1YB 1T9BA 4KLAA 4OHFA 1RRMA 5TQ2A 1HNZB 1U5AA 3JQGA 3F6CA 3W8RA 2Q46A 4TRJA 3WYGA 1H6BA 3AVVA 4GRDA 4KOAA 4EMBA 4NZZA 3U7FB 2FZWA 2AFIB 3SQLA 3VR0A 4IY1A 2OZLA 2P9FA 1ZD3A 2K4MA 4YEDA 4ESEA 5H16A 2O14A 3B3JA 1QB8A 3PUJA 2XZTA 4YUZA 1NOIA 2NT3A 2PL5A 3C87A 3GLFA 1RNLA 1W5SA 3EH1A 3G49A 3X2EA 3LHFA 1L4KA 3UJ9A 2AYZA 1NU8A 2ODQA 1M7HA 4UVEA 1XL1A 4XARA 3S68A 3W0LB 4BKUA 4CUZA 3JD3A 4CWAA 3AHIA 5IF3A 4MHOA 4ZXFA 2PQ0A 4O4JF 3CH6A 3RYFB 5BV2P 4S1OA 5T7BA 4QWMA 3J7AC 3EC1A 3GRCA 4KAFA 1XF9A 2ZYSA 5CTAA 3WWYA 1RI5A 4B44A 2HHLA 3OQBA 3W6UA 3IT0A 3DR5A 2BYTA 4HFMA 5SZJA 1G9XA 3G2JA 1R4AA 4R69A 1JHZA 5I3CA 2VWGA 2X9LA 5CLFA 2YJZA 4JVLA 5E6SA 2EIHA 1JR3A 3M9XA 3MTIA 4A8TA 2ZYRA 1EG7A 1U7HA 3UNXA 3IA7A 3BUSA 5CB0A 3I9JA 1GR0A 5L6LB 2VTDA 5B2ZA 5DBHX 3ZIAA 5ICSA 1E6CA 2DT5A 4YP9A 1XEXB 5KYVA 1OLUA 4LEIA 2F9FA 2GAAA 1DAIA 3NWOA 2ODTX 2ZBRA 4FW9A 2FN8A 2J41A 2QVZX 4HVAA 2QL9A 1QQAA 3KSDO 3OPXA 1X15A 1TZMA 2QORA 4JA2A 1ZL2A 4LV8B 3S40A 2CNLA 3TEMA 4CIYA 3IKLA 3G9XA 2PGLA 4H35A 1E58A 4YAJA 3VR1A 3K9QO 4JT4A 4I5EA 2BC9A 2VATA 1M75A 4C7VA 4XM0A 3KUCA 2CXTA 2BGTA 3HLTA 3PJEA 4OJNA 4DJTA 1WZNA 4EM6A 1G6KA 4Z4EA 3VZSA 2ZJ1A 4M4SA 4PZUA 4ZEWA 1CK4A 4F2WA 1YI1A 4ZVQA 1J00A 1T25A 5ALVA 1CU1A 3C8MA 3OZCA 4H1VA 3AOGA 3EEYA 2OSBA 2YY7A 1SBTA 1W47A 4KMRA 4MGYR 5JBNA 5LJIA 3OAAD 1QUFA 2R8EA 2VRCD 3GCDA 1A4IA 3NHFA 3PFNA 4Z4CA 2IUFA 1L5NA 3JARA 3IAS6 4EPRA 2X2EA 1T5LA 2OVFA 3MJRA 2FRVA 3PHJA 1RWXA 2I6SA 2PH7A 4FXPA 4JLOA 5H83A 4EO7A 1JR3E 4YMGA 1LB1B 3G59A 3WXBA 2M32A 5C1BA 2I1LA 1A9RA 2XBMA 4ZVVA 1SBCA 2VK2A 3CZMA 1RIIA 2D2XA 2ZJYA 4ZI5A 1IN8A 3H18A 1EH5A 2IX9A 3SJCA 4CR6A 1PTKA 4DR1B 1N8NA 3FPKA 4R9RA 2Y1FA 5JECA 1P0CA 1P5FA 3H17A 3BH7A 3GRRA 1FX0A 2OV8A 2QTVA 1SHKA 2FVXA 2XE7A 3F49S 3GFVA 1RWVA 3PPIA 5FOTA 3NH9A 3DLHA 5LOVF 1Z88A 3DKRA 2R7NA 2B34A 4V38A 3K53A 3CX4A 4D0SA 3LCRA 3DTVD 4G85A 3GEBA 1LPAB 4NXNB 2ZAMA 4XDGA 4QO7A 2C58A 4BBPA 4PRYA 1T3HA 3QYFA 2ZSKA 4JR2A 4KPGA 2PMEA 1T8PA 1UZUA 1T10A 1MZVA 1RPNA 3QEJA 1F8GA 3U3DA 3WMFA 1JE0A 1LS1A 4AWAA 2BKVA 3SX4A 3D6MA 4HPXB 2Y27A 1L1EA 1T0UA 1MHPA 1OTYA 5KI6A 1DFGA 4GU5A 1USUA 4Q4JA 2TMGA 3L18A 3W2FA 2VJYA 3BX1A 4HDKB 2AJCA 4LYAA 2D1FA 1IZ9A 1GL3A 1L7PA 4BLVA 3KB2A 1EBBA 3R3ZA 3KCQA 2XLBA 4E03A 5FQNA 3QKWA 1FA9A 3E9YA 4C78A 4LX0A 1GGEA 1XNGA 3BXPA 1G8PA 3GEGA 3L8MA 1LLUA 4WECA 4DUGA 1MD9A 4YMUA 3X1MA 3GPLA 3GJSA 3OUZA 4G1CA 4HSGA 4O59O 3DJFA 2QTAA 4PWYA 1UBJS 3LO8A 1LSSA 1BX1A 1TAHA 1UKVY 3A2MA 1HOXA 1X70A 2P35A 1P0PA 2F8MA 4FQ8A 2JGAA 3Q0EA 2VCEA 3MLAA 3AI3A 3MZ0A 4D3XA 5BOSA 2LR0A 2K87A 4KACA 4KHZA 4JEHA 3HVKA 1HL7A 2VHXA 3IAEA 3ORRA 4IOKA 3T3MB 3SQOA 1JA0A 4BUJA 5IZ4A 2QTCA 4J91A 4MPJA 5EJAA 5LDDC 4GI2A 1MB0A 2EWVA 4Z3DA 1UL1X 1CB0A 2BFDA 4KYVA 5BYJA 3RKSA 1QFSA 3KTAA 3DFMA 3KQKA 3VC1A 3NDRA 1E32A 1MG0A 1O97C 2FP3A 1AA6A 3I1YA 2FWJA 2KS6A 4HUQA 4X1YA 2PRSA 5D86A 2I99A 3FMPB 2OM2A 1B41A 3AW9A 1O95C 4TLLB 5DT9A 2DPMA 3HJTA 3OTWA 3RS7A 4MQEA 2QTHA 3HN7A 4JYBA 5KUTA 4JUDX 1JKIA 3A28A 1LRKA 1MC1A 1KH1A 3CEMA 1NFFA 2NV0A 4ARSA 5KJFA 1L8XA 3CKYA 3SLKA 3O93A 2W6ID 2QM3A 1FSSA 4MUNA 5LLSA 4IDCA 5CNKA 5DGXA 3KL4A 3QUCA 3SYLA 3A1DA 2C8VA 2GWRA 3DE3X 4YYEA 2QG4A 3D6VA 4V0LA 4E3ZA 1I94B 1UPFA 3OG9A 4KYIB 2OHOA 2HREA 2GRJA 2YVQA 5IJWA 1CR2A 1P4GA 3I2JA 4AKSA 2OFFA 1M0WA 2GPTA 3SR0A 1ZNXA 5ELXA 3OOWA 2H6EA 4MVJI 1SD1A 2HM7A 2BUCA 4CTKA 2V7EA 1G5HA 1QKJA 3L46A 4IUBS 3QMMA 3LWNA 1Y81A 4EGSA 2X0JA 4G5XA 2VK4A 3AF5A 4XCVA 1NR1A 1THMA 2JBWA 1RRPA 5EZQA 3F5FA 4JUBA 1K3UB 2WB2A 1QC5B 5CT9A 1V37A 1V1RB 3CKKA 2AVDA 1XPRA 4E08A 2QMQA 5I9BA 3BDAA 1OLXA 5JNWA 2YHIB 5FL3A 2XCTB 4H6PA 4WZ6A 4R54A 3HKDA 2XXJA 3F7MA 2JI6A 2PGDA 4NU8X 3H05A 3OUTA 1U99A 4G09A 4JQCA 4MO2A 1R8JA 2QLLA 1CXZA 1ZOSA 3E9CA 2RG1A 4D9FA 3PLAE 4X20B 3VRHA 3AVQA 4ZCRA 3PNLA 1E9VA 4KGVA 3CR7A 2VSOA 1R8QA 3H9JA 1QE5A 4CF3A 4IZOA 4XWYA 1NNSA 4F4FA 1M1YA 1VSQA 1U11A 5BRJA 1YA4A 3KR9A 4BX0A 3DBLA 4IZ6A 4EHHA 3EUWA 2XDAA 4MQBA 5E1OA 4KFCA 3M4XA 5AUQA 2AFIA 3GNLA 4RM2A 1V41E 3IKJA 4NATA 4ZN6A 2GWHA 3EXEA 1UBLS 1KVRA 1LW7A 2HCJB 2RHOA 1KWGA 3OD5A 4TQAA 2FKNA 4B85A 3C8UA 3DFZA 1UADA 3SHFA 5AKEA 5EAIA 1WO8A 2ZANA 2BFWA 4BTLA 1PWZA 1NTRA 5AM3A 5JADA 1AZTA 2YWXA 3TI7A 2GJ8A 2Q49A 3BM5A 5A0TA 1HQKA 3JY6A 3BL8A 1OIWA 4MS4B 1V3UA 3QX8A 1ILWA 6AT1A 5KKNB 2BM8A 3RYFA 3R40A 3TQTA 1XA4A 3T7RA 1I14A 1VLLA 3A0UA 5DSXA 3ZHSA 2LP4Y 4R2HA 5E2IA 3N3AC 2IKQA 3QLEA 4MP3A 5LBIA 3LM8A 1O9HA 3ZIAD 4CQLB 1RP1A 2P40A 1E7QA 4GXQA 5JANA 2R7KA 3ROXA 3VDRA 1N25A 1WDKA 4LV6A 4HX5A 3IO3A 2PV7A 4UUOA 1SXJC 1N3BA 4AQ7A 2C97A 1H2FA 2HI0A 3C3CA 4OMUA 3PUXA 1UFKA 5LQDA 2Q2VA 1BHJA 1XDBA 4PWZA 2ACEA 3ZHBA 4EKIA 1Z7WA 2D5CA 2DY1A 1GL7A 2B25A 3KOMA 3OPYA 3UA4A 1BS9A 3L7AA 2D7CA 3NVMB 3O2JA 3MCAA 1JKMA 1BH6A 3QVTA 2I87A 3KAQA 3EDCA 4XOUA 2HXYA 3FPLA 4C3UA 1X7ZB 4C22A 2DUNA 5CDTA 2IOFA 2CXUA 1ZLYA 1HQCA 2WSBA 5DXFA 5I7UA 5GIOE 2CWDA 3UYLA 4BUZA 4EG6A 5AK0A 2EP5A 3TXYA 5C8ZA 4PLGA 2QRGA 1OREA 1XQWA 3AX6A 2GEFA 3M34A 3ROKA 5FORA 3Q98A 5L95A 2DKFA 4TV8A 2PD3A 1HWYA 3V9PA 5TDHA 3ZJTA 1KBOA 1OAKA 2UV8A 4CL0A 1G42A 4JP5A 1KEEA 3CGWA 3E35A 3P71T 4RE5A 2ZIFA 3O1HB 3ZBQA 1E2UA 1V9SA 3F8WA 3W9YA 4BGDA 4OB6A 3STHA 1QRAA 2AN5A 3WZ2A 1R16A 4AWXA 4Q4HB 3BD7A 2NZJA 3W2EA 4JLMA 1NUTA 3EIFA 3X43A 2IZZA 3IMEA 4G26A 4WBNA 1H5NA 1TCVA 3MJTA 5EQJB 5AVRA 1E0KA 2ZB3A 3JYPA 1W29A 1Y4ZA 2FEPA 1BYUA 3IC5A 4NS1A 5D5PA 3RJ9A 2X0RA 4XSVA 3RTAA 3DF7A 1JEDA 4GBMA 4LC1A 4WOBA 2H8KA 3W77A 1SD5A 4B4OA 1P7VA 1A76A 3EIOA 4Z9BA 5C8YA 2DC1A 1VCIA 4MS1B 3LJKA 4Q4DA 1P2BA 2BFBB 3S2SA 4K9KA 2MSKA 1RHRA 1YL6A 1PJTA 3D3QA 1VRWA 4EELA 1P5HA 3EZFA 2C3MA 3GZNB 4Y6OA 3LLMA 3CVUA 4WLFA 4R8VA 4W7HA 1KYWA 1Y1LA 3QPUA 4LOAA 1E9BA 3HXLA 2AMFA 1NVFA 2BHTA 1E3EA 3LZDA 1BS1A 1WCYA 4HP8A 4YVFA 5AW4A 1ZJJA 2XE6A 3KWFA 3W05A 4BGUA 1ZNZA 1WQ1R 4S1TA 1CV2A 1BNCA 4AKEA 3ZLTA 2QWXA 3D31A 4LHXA 1SXJA 4JVSB 1EXWA 1RC8A 4DUGD 5C7OO 1L5SA 1FEZA 4FDLA 5IBPA 3BMQB 5EFZA 4C3VA 3O4GA 1EFLA 1KYTA 4PZLA 1G8GA 1ULAA 3GDHA 3PBKA 4GPBA 3H2BA 4G3XA 1TVEA 3T5DA 2JPDA 2R0QC 2P41A 4I50F 2C00A 1FTSA 1TKBA 2HCRA 2G3YA 3N0WA 3E48A 4C0AC 1ACLA 2G7ZA 1EAMA 1XXLA 2P3LA 1U1EA 4CKZA 2SHKA 4XWWA 1KK0A 3KT0A 3DOFA 1FVXA 2RGDA 4KYTA 5DHAA 1S9HA 4DEXA 2EZ4A 4A92A 3ZWKA 3C6ZA 3DEZA 1EGHA 1FS6A 4TT3D 1PJQA 2GILA 1VMKA 2C57A 4PNHA 1FLVA 3EF3A 5JDIC 4F9TA 1ZR2A 2I0FA 5THKA 3AILA 1ZESA 5ALPA 5JWHA 3X1YA 4CIDA 2W2LA 3PL5A 1GYPA 1AT1A 2CL0X 3KVYA 1M1XB 4WKOA 4HJRA 1T4GA 4TLEA 5KB3A 5JS2A 1V4VA 2NU6A 1MBZA 3DQPA 1SXJE 1PQWA 1RYFA 4E1BA 5K09A 1K7SN 4EYKA 4PGMA 5K99A 1YR3A 3MT7A 3OP1A 4OUDA 3DT6A 4YDRA 3TX6A 5CXQA 5JDCA 1BZYA 1TO1E 2C2YA 1M8KA 2PIAA 1WTCA 3F46A 2X13A 4Q3CA 1XN1A 2GEUA 2ZIUB 1KJNA 2OXFA 1QF7A 2F48A 3P2KA 1NBHA 4HDSB 4PNZA 3MWJA 1JYEA 4QUBA 4G37A 1YR7A 2KPOA 1ZVMA 2O2GA 2R8BA 3UYKA 1XZIA 1QFZA 2BMEA 3OE4A 1XD9A 3OQVA 3R6GA 3KPYA 4K7JA 5AK4A 3WRYC 1T91A 4CHGA 4CCSA 1FQWA 2HWUA 4QGHA 3BHNA 5KWIA 4LKOA 2P6OA 5HM8A 5D3MB 4YJKA 1YL7A 1NVAA 2YH2A 4NBTA 4O25A 3WDKA 1H6CA 1YQXA 4JI5B 2VJBA 4AMZA 5I51A 2F55A 4CEJB 4LE0A 4PRZA 5K0SA 1M2FA 1GNQA 1MIOB 1DEAA 1G21E 2GCIA 4I1UA 1Q7EA 1KETA 1NYRA 4ZVTA 4ZZ1A 3RE1A 2IBTA 1PLKA 3V6LA 4TTTS 3JXEA 4O4HF 1QC5A 3BWCA 1V1RA 1CPYA 2Z8YM 1HA3A 3Q1KA 3EPLA 3E9NA 2EZ9A 1NC3A 2YCLA 2E4XA 4GWKA 4QVGA 3G6KA 3N86A 3ZHCA 4D8XA 1ST2A 1DIAA 4N7JA 3L7YA 1D03A 3NM4A 3PD0A 2A9RA 1IK4A 4BASA 3RBZA 821PA 5FAXA 2Z6QA 1KOGA 1SOWA 2Q1XA 1BVRA 5G3YA 2DB3A 4KBYA 1OH6A 4J29A 2O2DA 2A6PA 4UE6A 1EX1A 4X20A 3FXAA 2NV6A 5AKYA 4DCCA 1PJLA 4QXRA 1AK2A 1P2UA 4MJXA 3AVYA 3R7FA 3HXQA 4J1TA 1CZKA 4B4UA 1YDHA 1SPXA 4D79A 5LLTA 1IBMB 3QITA 5CJJA 1QTRA 3DBHB 4MWDA 3KE9A 3VYVA 2QA5A 4U7GA 5K8IA 3OF3A 5EJMA 3EPKA 5FIUA 4RIGA 2BFOA 1Z9BA 1ZD2P 1ZD9A 3DMTC 3HU1A 4UPDA 4R16A 4V0MA 1SG0A 2P2LA 2E1PA 2EFHB 4JI6B 3BFJA 1SC3A 4Y7CA 3ND8A 2FEWB 3PGMA 3QU7A 4MROA 1VTKA 3V1TC 2XKBA 1GLNA 4QFCA 4EJSC 4ZDWA 2D2FA 4FMPA 2SKEA 3I4LA 4QATA 4GOJA 4JYMA 3UKOA 5DHQA 2ZYTX 3FPAA 4X64B 1UBKS 2R5NA 4BFCA 3DWEX 4WN9A 3HH8A 3OQMA 4FTWA 1GCOA 4E51A 1O7JA 3AVTA 3E5NA 1QLWA 3WHLA 1XD2B 2DHQA 3DEYX 2WWRA 5JYBA 2QK4A 2KM1A 2FWAA 2BBTA 5HE8A 1YRYE 4BKPA 3DCNA 1XZFA 4MS4A 4WXMA 1U8UA 1UOOA 2FF7A 3C3MA 3QWBA 5K0CA 4WKPA 3JSXA 4NU5A 1WB6A 4V39A 1FMTA 4ZC1A 3O9ZA 3ZDXB 2OP0A 1I2BA 1SC9A 1WXHA 2QYSA 2VUIB 3WRYA 2XXAB 4CQLA 1QRUA 4X7PA 5D51S 1NVWQ 2ECPA 3FWYA 1QIMA 3G89A 3VSCA 4XDHA 2AMJA 2XVMA 4ZGBA 3KFLA 2F3SA 3QYAA 4Z86A 1J0CA 4J6FA 3VHLB 3IQEA 1IM8A 1PFKA 1IQ0A 4N8EA 1VHWA 4XGRA 5EE1A 2ADFA 2Z5FA 4ZHQF 1ANKA 2H4HA 2ISSD 3AWIA 2WINI 1B26A 3VPBA 3ZQUA 3OFSA 3UJHA 4PF1A 1HORA 2PL1A 5IAKA 1QM5A 2Z5LA 1JXMA 2H9IA 3DULA 4G5FA 4H0FA 4RE6A 4CG0A 4QUDA 3B48A 2P78A 3BGWA 5DOVA 2O2SA 2FSSA 5LYJA 3UHJA 4AJEA 5IJAA 1O3YA 2EGUA 3I9V1 2P4HX 1QLHA 1YK0A 2P7HA 1IN6A 3ACDA 3HDJA 3NOOA 3IQWA 1QIIA 1GM5A 4F9GA 1W7AA 3WYBA 4BX9A 3TIFA 2C8LA 4F1WA 1XMOB 2OBFA 1RHUA 2AFHA 1II8B 4GEGA 1TK3A 2G7MC 3V1UA 3SKYA 2VXBA 3ZCUA 1ZOLA 5FA5A 3PC3A 1AV6A 1LK7A 3PP8A 4DLAA 1COZA 1I5RA 4HLDA 4MV7A 2QM8A 2AJTA 3M4JA 2R4QA 4NU6A 4GI7A 1M6YA 4Q4HA 4V0NA 3RS4A 1AH2A 4HN2A 3A9RA 4WT7A 2DM6A 1ONNA 1VLJA 4CZ2A 2Q07A 1MN6A 2XMQA 3M3HA 2X4DA 2ZYAA 4FYPA 5AW8A 4HNTA 4GDFA 3IAM1 3S2GA 3RVMA 3GEDA 3GPBA 3EZLA 2ERYA 1X7XB 2YJ6A 1LPNA 1ULHA 4GXTA 4M9QA 1OB2A 3W6NA 3I9FA 4EUHA 3U1BA 2MSDB 2C4NA 3L4JA 1C8VB 2PS3A 3LQQA 2KWIA 4XIFA 3TAHA 2J3JA 4MS1A 4MYTA 5E95A 1D3AA 4C05A 2BFBA 3LGSA 1OF1A 2C4WA 1WXWA 2YDXA 1V0JA 2ORYA 2BH9A 4AT1A 1N77A 3KUDA 1O89A 1EWKA 3PGKA 4CVNA 2HC9A 2QTFA 4CCYA 2JLSA 4Z3KA 5IWCA 1O94C 2G82A 4L5CA 1JDBC 1KBZA 3LFHA 2JFWA 1OX4B 2PDAA 1YFLA 3VX3A 4KE7A 2BEUB 4NLLA 4I5FA 3PC8A 2MYUA 4CIVA 1U2SA 2NU7A 4YASA 4DG8A 8ABPA 3TGPA 4FM9A 2CXQA 4JB3A 2QI9C 4DRXA 1L5QA 3AESB 5DGHA 3PITA 4WL0A 3ZQKA 4M1ZA 2AFHE 2BZGA 4O2BA 3QWIA 3H86A 1W1WA 5EINA 4JMLA 4QAQA 1FPMA 2E21A 4GR5A 4IHJB 5F9HA 1N57A 1RQPA 1W85B 1U2GC 3WK4A 3UFXB 3SPXA 2W2QA 3NWPA 4OHKA 4NDNE 2Z5GA 1MJNA 3VPHA 2QIPA 4PGAA 2M1XA 3RHSA 3I92A 4R8KA 3JZMA 4O1HA 4MH0R 2QIOA 4OYYA 1F14A 3VVLA 1EEXB 4DSTA 5C5IA 5J4VA 1T6NA 2X40A 1UDBA 3NIBA 4MQLA 4DA8A 1QRTA 3T1YB 1BEZA 5FNVA 4ZP1A 2I8AA 1Q16A 3Q9SA 2ZIGA 3FTDA 4NOJA 3D4IA 2H11A 1CERA 4BV8A 3MYRA 2UUBB 2RH4A 3DXZA 4MJ3A 2UZ4A 1YQUA 1GYRA 2RGNC 4DBVO 2XNCA 3HP7A 2Z8ZA 5ES3A 5T4EA 2WUGA 3GOQA 2QAGB 2YS7A 4RK6A 2WWHA 1Z08A 2FJPA 4E13A 1KDRA 5G1NA 1JJVA 5BO5A 2HT1A 1ZA2A 3E22B 3RU3A 5TLSA 4R2KA 1UXOA 1LRJA 1HV8A 4INAA 4EUNA 1KMIY 3W7AA 1TIKA 1P2DA 4NABA 2QHXA 4ER7A 4DMKA 3QPDA 1A9YA 4IFEA 2C4TA 2YNMD 2JHGA 3L8CA 4D43A 4X62B 1C7IA 3O1JC 1Q5PA 4TMKA 1EP1B 1Y8ZA 3GT7A 1WMEA 1EDEA 4FFDA 3NBYC 1EM8B 4B9AA 2Q6TA 4E22A 2UZIR 4B1FA 3BB3A 3UICA 4Q1EA 5A5FA 1MV5A 1O0SA 3H04A 1NVVQ 4NJMB 5DRYA 4H4EA 4C5BA 2M6SA 1WA5A 1TMKA 4CM8A 4LRUA 3SEQA 2IS6A 3RC1A 5BPFA 1BHSA 4JDUA 4NZPA 1CQJB 2Z2JA 4QELA 2BOVA 1RYMA 5JG7A 5LXTF 4WFQA 5KNBA 2IELA 1SCJA 3AONB 4HWTA 2LCFA 3IV9A 2UVPB 3IOBA 1KFBB 2QKYA 3NBFA 1ISPA 2B3TA 2D5LA 3PKIA 3MWKA 4BRSA 4EYEA 4RTKA 4N12A 4UTXA 5FOQA 3RFFA 1FYWA 1YKFA 5AOAA 1R0KA 3L01A 4ZQBA 5DHUA 4RZIA 1U7PA 1Z62A 5ALMA 3SIWA 3U49A 1Z15A 4F97A 1QS0B 3HWX1 5DLYA 3QXSA 4O8CA 4ZVPA 1C9YA 1WKVA 2A4MA 3SOZA 2PD4A 5CU7A 1TQHA 5GONA 4TQGA 4A23A 4CEJA 2VDWA 1H4TA 2CEKA 2BVNA 3LRTA 4JEUA 3HKCA 3EGXB 4K8OA 1XEFA 1I0ZA 1RWBA 3H4IA 4YJHA 1Y6JA 3FDXA 4P4NA 4F46A 3BDIA 5J4LA 1U3GA 2Q5OA 4D9KA 2NP7A 3B7GA 3QJYA 1CCWA 1GD1O 1KS2A 2BMJA 2YJTD 3SF0A 4MHTA 4LY0A 4ZI2A 4ATNA 5CH8A 1MNAA 4F8YA 5EWLB 3ZWWA 2CKMA 1QGOA 2BFNA 2DPHA 1J1ZA 1N5RA 1ND6A 1SVWA 2B4QA 4MUMA 2I7VA 4R41A 1RYBA 2F59A 1FB5A 3ANXA 3AR2A 3CZQA 3LDUA 3P0IA 3QVOA 4UDOA 4AZTA 4Y6QA 2WHEA 1YKSA 3GAAA 3H2ZA 2INGX 4UVGA 2G5PA 3FHOA 3K0KA 3K9HA 4MS3A 3OKAA 4OK5A 4X6LA 5E1MA 3O8RA 4QPJC 5GJBA 1TL7C 3TRKA 4PSAA 4DKXA 2PYDA 3DBHA 3P0EA 4UHKA 4X84A 5ILGA 4JB2A 3V4LA 1AHHA 1W4ZA 3EBPA 3K4QA 4N5HX 2X4LA 1E1QA 2YMQA 4MVJA 5JD3A 2VYVA 5BSKA 4DB4A 3P26A 4N18A 4E5PA 1Y8QA 1Z7EA 2Q1WA 2CXRA 2JB9A 3GVXA 4PO8A 2E2WA 2JGEA 4F7DA 5IHPA 2WUWE 2QXYA 2YYYA 4HR7A 3C8ZA 4AU1A 4QOIA 1W0JA 4Q3AA 1GA1A 1QIHA 3DAPA 4L6CA 4MWSA 1AF4A 3H3JA 2P9ZA 1F7UA 2R68A 3HV2A 4JJFA 1XFDA 4XX0B 5TJHA 3CX3A 3H9QA 3LH5A 1GTZA 2IT1A 4FP9A 2GCEA 3N8GA 1L5KA 3IEPA 4BE7B 3G9ZA 4TS3A 1GCIA 1J56A 1QIEA 3DTNA 3OC6A 1H2ZA 2C7PA 2V4MA 3HBJA 3GIDA 1JHXA 1R5JA 3DHVA 3I2FA 4D4KA 1GU7A 2O7SA 4N3NA 4YCNA 2A7XA 1JEAA 2XOKD 5FI3A 1GPH1 3NJ4A 2PX8A 4Q6WA 3IBFA 3WIBA 3ABQB 4OJMX 3LQRA 3SXUB 2IODA 4W82A 3ET5A 2QLJA 4H27A 3T4XA 3QXCA 2I9KA 4EP1A 4NCAA 4HEA1 2XXAA 1HM5A 2C8KA 2ZRDA 4AJ4A 1NF9A 3MJHA 3QFSA 4K6GA 5E7MA 4DE5A 3AFHA 4EG5A 4F3CA 4MAFA 1NX9A 1E1CB 4Z6KA 5FWXB 3CY6A 1V16B 1Z5WA 4TS1A 3RK0A 2XF2A 4YRAA 1Z5OA 2HV8A 2WTBA 2GETA 1ACMA 1XBTA 4F11A 2IUEA 1M1UA 3HCEA 4GKBA 4IIGA 2OZKA 1Q2UA 3GT4A 1HFJA 2YZMA 2EFDB 4NICA 4CM9A 1MZPA 3K0AA 4E7PA 3Q10A 3MCWA 4KO3S 4DT1B 4DQDA 3ISJA 1R0YA 1Z7YA 3PFBA 2HADA 2LZ0A 2NTVA 3G82C 3EF1A 3L43A 5ITZB 2NMVA 2Q21A 2UYYA 4JJ7A 1ODTC 4U63A 1D09A 4BNUA 5KS2A 2QZSA 2AF3C 3B1ZA 2EEZA 4YMVA 4YP1A 1KI4A 2OCAA 3J80A 1BDMA