1O3YA

Crystal structure of mouse arf1 (delta17-q71l), gtp form
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
166
Chain Sequence
GSMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGLDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of membrane recruitment of GGA by ARF in lysosomal protein transport
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords ADP-ribosylation factor 1
total genus 55
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1o3yA00
4CVNA 1U8AA 1DG1G 5JJIA 2D3WA 2NQ2C 4CGZA 4LHZA 3CX8A 1G6OA 2DFKB 4PHFA 4B3GA 2ZE8A 5FL3A 1KZ7B 3MWJA 3UG6A 5HKKA 5EE3A 4LDJA 1KNQA 1OYWA 2JLVA 1FP7A 4HAWA 1AIPA 3U3MA 3REGA 2J5XA 1E2EA 1KDTA 5LD2B 3T5GA 3JVVA 2IYUA 3FMOB 2R6AA 4KV9A 2AD1A 3CRMA 3O8DA 4HB2A 2G0TA 4OI4A 2OILA 1OFHA 3L8YA 2YJTD 2RH5A 4M0LA 4MUBA 3NHAA 2QMOA 3QXJA 3T1QA 4ABYA 2YKGA 2FMXA 4QGGA 4JBXA 1A1VA 2J0QA 3AB3A 2CXXA 4JVMA 1DAHA 5G3YA 1OKKD 2JJ8A 4MH0R 3U7EB 4DIEA 5FTLA 5KPJA 1KI9A 3C5HA 3W34A 1OPXA 2BEJA 1WBDA 2GZAA 3RANA 4L9WA 4DBLC 1NVWQ 3QKSA 4CYMA 3B6EA 4GT1A 2P6UA 1GM5A 1Q3HA 5P21A 4IHQA 2C99A 2JASA 4WIAA 5IT5A 1XTQA 4FXPA 4GPTA 1JPJA 3TQFA 4D80A 1U98A 5KSOA 1IN7A 1PLKA 4L4UA 4E5UA 2KI5A 3AP3A 2GESA 2QAGB 2VF8A 1S1CA 3LRPA 3ZVMA 4FMDF 3MWLA 2BBTA 3AEZA 2GNOA 1BO6A 1KSHA 2PT5A 2Q9AA 2LWIA 4IRUB 1FNMA 4G5SA 4YMSA 3SOPA 2G6BA 4DSNA 3LX5A 2HXYA 2F9MA 5SZHB 1Q1ZA 3PUZA 3PEVA 4WXRA 3GFOA 3QENA 3CNOA 2ZSEA 3E2IA 3FDIA 1E94E 2ZRCA 4P32A 2HLDD 5DI9A 1DARA 5G41A 2GXAA 4I1VA 2ZYWX 4GP7A 2A3RA 2FF7A 2OAQ1 1N3BA 2GCPA 1W5SA 1MR3F 2YWGA 2R62A 4FCVA 4HZUA 4DB4A 4AKIA 4Q1BA 1OIWA 4PO1A 4RZ3A 3A1SA 4ARZB 2Q3FA 8OHMA 1WDTA 4P4TA 1A4RA 3U7GA 2FGJA 5KDLA 1E1QA 3MJHA 1IXRC 2BM1A 2EQBA 4M9XA 3TJZA 1EXMA 3V9PA 1SXJC 1E98A 1QHGA 2C03A 1KO1A 3O47A 4IEEA 4OI0A 4G1UC 5C4GB 2J0UA 4B44A 1NG9A 1DAKA 4EFMA 4Q00A 4QJ5A 3ZVNA 2FNAA 3DL0A 4OJKA 5JFGA 2DWQA 1ZIOA 1P2TA 3CRQA 2EW1A 1D2EA 3LNCA 1N6NA 4E03A 3G82C 2A5FA 4RFSB 2ANCA 1FMJA 1SKQA 3KJHA 3DZ8A 3KTAB 4JSTA 4MGKR 1NN1A 4TL9A 5IF9A 1ZNXA 4WZAE 1XTSA 4DLUA 4G5QA 1W5TA 3P27A 1DAFA 1Y63A 5A4JA 3B1YA 4URUR 1WP9A 3ADKA 3ICEA 4HAYA 5FPSA 2XJ9A 3THWB 2KSQA 1XDBA 3DHWC 2IYLD 5FBQB 4DCTA 4AKHA 4GNKA 2W6JA 4M1WA 4A82A 1SHZA 4NBSA 3C41J 3IPYA 4Q1CA 2WV9A 4EPYA 2IT1A 1G5PA 3EC2A 1LFDB 2FGKA 3B8HA 3AKYA 1Z2AA 1J8YF 1FX0A 4LYAA 2C9YA 3KXLA 5C1BA 4DIDA 1W2GA 3CB4A 1RIFA 2PEZA 4V03A 3TR5A 1OH5A 1RYFA 2ZSBA 3AVXA 2VSFA 2D74A 1XPOA 2OSBA 1UF9A 1OXTA 2FSGA 521PA 1UEJA 2PBRA 2QY9A 3R9XA 2YHSA 2RGXA 3SQXA 4KXFB 1E3MA 1G5TA 3BC1A 2AR7A 4MQBA 4Q1DA 2TMKA 2CNWD 2IYRA 3THYB 3TRFA 1KO4A 3PEWA 1ZM3A 3SEAA 4QXAA 5LB4A 3SR0A 4BFXA 1ZD8A 3L0OA 2FZLA 1IOZA 4NE2A 3UWKA 1XD8A 2OUKA 4C30A 2FX3A 1DELA 3C7KA 1ZP6A 4KFRA 2OO7A 4RZXA 1Z47A 1HQCA 1SULA 2B6HA 3P4XA 1F5NA 1CR0A 1G64A 1T3HA 2IC5A 4YONB 1KSJA 3CBQA 1MOZA 5EXPA 1OIVA 2MMCA 1TQ6A 2ZREA 1BMFA 1KK0A 4FW9A 2FZ4A 2RMKA 4TYWA 2VO1A 3GLIE 4W5WA 5B58C 4HZIA 3GEEA 1HE1C 2OESA 2ZM5A 5J4LA 1OXVA 3RC3A 3RAPR 2D2FA 2GXQA 1L4UA 4V0MA 4FCWA 3IDQA 4PC3A 1P60A 4KYIB 4DHEA 3M1IA 1E1RD 4YMVA 4CEHB 4ESHA 1XX6A 2FFHA 4UNNA 1VG0B 3PUVA 4PSKA 5TV2A 4A92A 2NGRA 2ZJ2A 2XOKA 1HTWA 1GSIA 2JDID 3KB2A 3QKRB 2RGEA 4PZYA 4MA4A 4BZXA 1GUAA 4BZPA 1KI8A 2AKAB 2I4IA 2PMKA 3BWDD 3CKLA 1IY2A 3A1TA 4MKIA 5HZHA 2WJJA 4BFWA 4D4MA 4JLAA 2IUSA 3QKSB 1OT3A 5M04A 3QXCA 1KDPA 5KDOA 5DHAA 5HE9A 5FFMA 4QBHA 1R8QA 1X6VA 1XWIA 1NY6A 2DR3A 1FMLA 2AXNA 5SZKB 3U2QA 5JECA 2ZRIA 2ZTSA 1F60A 1KI6B 1R5NA 4XD7A 3SS8A 4DDTA 2L0XA 4B47A 1N6IA 1OLOA 4DKXA 5AJWA 3A1WA 1OSNA 3W3AA 4ACAA 3WNCA 1G9XA 4EKDA 3QKRA 4PZLA 1P9WA 4A0HA 1VMAA 4JLMA 2CBZA 3EWAA 3LX8A 2R2AA 1Q21A 2C9OA 1EFTA 4N3NA 3NC0C 5EZ5A 3K70D 2VSOA 1QVRA 2B8WA 4BFTA 2ZS7A 4HAXA 1DADA 2CLSA 2B8TA 4D4JA 4Q1EA 5FTJA 1EX6A 4AYXA 2CE2X 3PEYA 4JLOA 2F55A 4PR0A 4ZO4A 2WVJA 5JEDA 2HEIA 3VHLB 3IGFA 3SHFA 2ZE6A 1UAAA 4A8JC 2BC9A 3W6NA 1BOFA 3TQCA 4E22A 1KJYA 3QKUA 1KSFX 2ZJYA 4P0TA 5L3SA 5LBIA 1LVGA 2EFDB 1M8PA 2IYSA 3PENA 3N2IA 4ZDIA 1D9ZA 1JI0A 3DKVA 2XXAA 1IQPA 2QI9C 5JS8A 2H92A 4MRPA 2W0SA 1G18A 3QXXA 2JLWA 5G53C 2W6IA 5FPKA 2Y8EA 1IY0A 2ZI3A 3CH5A 2OXCA 4DJTA 2V1UA 2F3TA 1U0JA 2QQ0A 3GJ3A 4EQ6A 4M22A 2YINC 3M4YA 3GLHA 3OFND 1GAJA 1W49A 3DM5A 2PZEA 1X1SA 4EIWA 3C5CA 3PFIA 3NBXX 2RHMA 4PFSA 4Q47A 4ASUD 3SJCA 4JYCA 4HUTA 1E9DA 3Q85A 1OYYA 4JL6A 2HCBA 1KTVA 1N5LA 2V6IA 3WNBA 4B3BA 4AYTA 1NIJA 1JEEA 2WBLC 4L9SA 1E0SA 5KSYA 1Q57A 1KK3A 5FR2A 4GP6A 1UM8A 2FH5B 2WJYA 1XMIA 3QIAA 4S2EA 4Q4JB 4X8LA 1GKUB 3BE4A 1S0UA 5DN6A 1SXJE 4YXWA 1YJ5A 2ODNA 5FPYA 2OAP1 1AM4D 1F2UB 1Z6GA 4TLCA 3THOA 2IA5A 4HSEA 4F93B 3TUJC 2EFGA 4WZBE 3QJYA 4CEIB 1XXHB 4G0NA 2FWRA 5DLQC 5HE8A 2KJQA 1VG9B 2CVFA 3A1UA 2GKSA 4KU4A 1G291 4F92B 4HAZA 1CU1A 2F1RA 3IBGA 4CDGA 2ATVA 2QTVB 3Q5DA 2UKDA 2FN4A 4LBYA 4POAA 4TWZA 4AKEA 2PLFA 1JAHA 4F91B 4ZKDA 1EWRA 1UKVY 4OHXA 3NKVA 2NO6A 2JLUA 4KI0A 4KVAA 1GVNB 2QPTA 3LAWA 4X8OA 4XSGA 1EFRD 2VL7A 1CKEA 3AGQA 1G20E 3X1ZA 3U3JA 2C2HA 2ZETA 2GK6A 1WXQA 2MSEB 5AK0A 1FTSA 1NY5A 3TK1A 4D4KA 4BLRA 1F6BA 5FR1A 1T3SA 2QPAA 1L2TA 1E9RA 3F0TA 2Z83A 3DOFA 2PEYA 4R2IA 4LBZA 2IS2A 2FDCA 4TN1A 3TAHA 4OJQA 3OEHD 2ZAOA 4RD6A 1CTQA 2ERXA 2FFQA 1L7VC 2YWEA 2QE7D 3MAAC 3FFBA 1MV5A 3IBYA 3VX4A 3MG9A 4U7DA 4BLTA 5IDVA 1E2HA 1UBGA 2XNSA 2NO9A 3L0PA 4MRRA 5TY0A 2OCPA 1E2NA 5BXQC 2AFHE 3O8BA 4LRWA 4C0AC 3RRYA 2QBYB 2GRJA 3HP1A 3K53A 4O0MA 4DEYA 2FJUA 2XTNA 2GF0A 4D25A 5JMTA 1A7JA 1Q3TA 1QHYA 4V0OA 3WP1B 3FKSD 2A5YB 2IBMA 3C15C 3FHOA 4U02A 1GRNA 4I99A 4XH9B 1ZC3A 2J3EA 1JR3E 2NZJA 4IXNA 1LS6A 2AK2A 2G88A 4QC2A 2NMVA 3WBJA 4BFSA 3AF2A 4Q1FA 3QVUA 2QAGC 2X2FA 1ZM7A 2IEZA 4W7SA 1YRBA 3PG5A 4TL7A 1TF2A 4I4LA 5CB6A 2QAJA 1HH4A 4M8NE 3OIUA 2W83A 2FFAA 2IEYA 4P31A 1MO4A 3RLFA 4RFSA 1S3SA 1E96A 3GEHA 2EYUA 1XEXA 2VP2A 2CL6X 3RHFA 5K8IA 3GPLA 1E2IA 4JJZA 1CJUC 4M1KA 4PTLA 4XVUA 1COWD 2ZVQX 3PJRA 3TBKA 4EPWA 1KK2A 1PV4A 1NSFA 4TQAA 1FUUA 2ZE7A 4NDZA 4BFVA 2Z43A 2WKRA 4DCNA 1CULC 2QP4A 2VF7A 4JYBA 1MO3A 4XSHA 1M1YE 5TARA 3VQTA 2DB3A 3LW7A 3OIVA 3L0IB 1LNZA 1NVVQ 1CF4A 4BLPA 3U3RA 1HE8B 4OQMA 3GLGB 1GRQA 2IYQA 1VG8A 4HUQB 2WWGA 3SC3A 2ZQ5A 3QBTA 3MGCA 3EA0A 1EFHA 2AD5A 3Q7QA 5LPNA 4CEJA 2LCFA 1W48A 4TZ0A 2WZQA 5KO2A 2CK3D 3W8RA 3PUYA 4ARZA 1ZUIA 4C2TA 1JECA 1HURA 3O8CA 3PCRB 2DBYA 4LPSA 2J41A 2P0EA 3CX6A 2D06A 4X8MA 4UXJA 4QJ3A 1E4YA 3AKCA 3ICQB 2MMGA 2VH5R 2ZROA 4LY6A 4EPXA 5H1YA 5A5GA 5CB8A 3LXRA 1FTNA 1XJCA 1NRJB 1OXSC 1G41A 1CR1A 2BWJA 2Q9BA 4MITA 1E0AA 5BQ5A 2JA1A 4WZ6A 1N0WA 1G7RA 5E7IA 4ON9A 2IHYA 4QBGB 5FUWA 3ADBA 3GLGA 1A2BA 3P4YA 1RFLA 1B0UA 1ZUHA 3K09C 2HYIC 2WIAA 3U6BA 4ZDWA 1OW3B 5EP2A 3U7FB 1ZJ6A 1WF3A 1WA5A 1M6NA 1Y3AA 3TSOA 2J0VA 2OHFA 3GLHE 5CJ2A 3QKTA 3UMRA 1R10A 2QNRA 1QHIA 3K8YA 4DWJA 2YWHA 5FOWA 3X1XA 1J99A 2N1BA 2JJ2A 2REXB 4RKFA 3BD9A 1KKLA 1NMXA 2R6FA 2IYYA 4QGAA 3WXMA 4URYR 3QQ5A 4IW3B 1RRCA 3ZD7A 1JPNA 1JQJC 4DLVA 1IXZA 4MDFA 4H1VA 5F98A 4G5OA 4Q4LA 4MRNA 1O3YA 1ZM4A 2XSZD 4EAQA 3B60A 1E0KA 3REFA 5FTKA 4TYNA 4B6EA 5GJBA 2GZHA 3RS3A 1XEWX 2EVWX 4GZLA 4PC2A 4CEIA 2QSZA 1GDDA 4TZ6A 1MT0A 3SYLA 2Q9CA 1P9RA 2IW3A 1QHNA 3VU9A 3EZ2A 4AYWA 1P3JA 1IXSB 1TQDA 1G3RA 2FSFA 2CCGA 4MGYR 2EU8A 1IONA 2GBLC 2BEKA 4KLZA 1AQYA 3IQWA 1XB2A 4PPFA 4GOXA 3K0AA 4NYMQ 1X3SA 1FP6A 4B6FA 3M6AA 4DLSA 5CYPA 2FEOA 2PX3A 4C0BA 1UADA 3G0HA 3M0EA 1MO6A 1ZC4A 3KX2A 2XAUA 4G3XA 5CK5A 1M74A 3PIRA 3BERA 2ZYUX 3AGPA 2PJZA 2AK3A 1Z29A 1KI4A 4II7A 4JJKA 1EK0A 1W4RA 2P3SA 3T06B 2HLDA 2ERYA 3CF6R 1P62B 4BGDA 5G40A 1SQ5A 2H17A 2WJGA 4JLDA 4TL6A 3ADDA 5CM8B 1CR2A 3UMSA 2O8CB 2WWYA 2PT7A 3TE6A 1ZM9A 4AK9A 4MRSA 2GDJA 2GJ9A 5CDFE 3UWOA 1RJ9A 1JR6A 4Z8XA 1ZCAA 1JXOA 5SZJA 2KB0A 3U6KA 3FWYA 2H1LA 3N70A 4CF7A 1W36D 1KAOA 4AIIA 3VU9B 2F9LA 1FOEB 1RRGA 2CHQA 3NHBA 4HI0E 4TMTA 5C4MA 5L3SB 1VHTA 4QHTA 1K8RA 1MABA 4QKQA 3TSWA 3OESA 1N6OA 3DPUA 3N2EA 3U7HB 4JLVA 1U99A 1E99A 4DUGD 1XXHA 4IDHA 1GKYA 2IYTA 2ZSDA 1JQLB 4PAQA 1ESNA 1OH8A 1CRQA 5KSPA 4BUJA 4PC7A 1J70A 1G3IA 4AWXA 1P2VA 5CM9C 1XCMA 3IQXA 3I3SR 3FMPB 4LJ7A 4D2IA 221PA 4P4UA 1GL6A 4DLTA 1NBMD 2ZRHA 1Z0JA 3UG7A 5HKKD 2GEDA 3QNUA 1D6JA 4TMZA 5JCZA 1Z08A 2YZ2A 4XTCS 2WM9B 4MYHA 2XZLA 3ZVRA 3R9IA 1WCV1 4NH0A 2Q3MA 2NIPA 4TLDA 5JHHB 5HCIA 1OE0A 4URZR 3FMFA 4CT4B 2BV3A 5LD2C 5F3WB 1EFUA 2GCOA 1RRPA 3X1WA 2E1RA 1XMJA 3LW8A 5CK4A 3SFVA 5KU1A 1U8YA 4B75A 1TPZA 2W0MA 1RE0A 1X8JA 4NTZA 2WWXA 4V02A 3AUYA 5KHOC 1VECA 3AP1A 4OBEA 5CLLA 5AWFC 3WBKA 1OH7A 4RY2A 2R44A 2WWFA 1W0KA 1HUQA 1X8LA 1UDXA 2G77B 2WOOA 4W5JA 5KSZA 2IS6A 1DO0A 2ZRPA 5AUNB 1FPMA 3BOSA 1CRPA 4Q9KA 5JLJA 3QEJA 1DAGA 2RGGA 2CEAA 4KSCA 2ZS9A 1T8UA 4NONA 5DIFA 2IWHA 2ZRGA 1SXJA 2OLKA 3IIKA 3LY5A 1YZNA 2AKYA 1W36C 1ZBDA 2ZI5A 2Q6TA 2AWOA 4PHHA 2BHRA 2XOKD 2GTPA 3AP2A 1LW7A 4DDVA 4ZCLA 3TR0A 1NP6A 5DN6D 1XD2A 2BVNA 1G4UR 2B7CA 3BIFA 3R8CA 1GITA 3B1ZA 1KSGA 4N0EA 4CZ2A 1CXZA 2YVUA 3PUXA 1CLUA 1NI3A 2OBLA 3AVYA 5KOYA 3GLIA 1T91A 2VYFA 5C46F 1SVKA 4RVCA 1SVIA 3OAAA 1ZNZA 1TAGA 1AGRA 2QU8A 4BEJA 3CRRA 3EARA 2BBSA 1G17A 1SVSA 2IXGA 1E6CA 2W00A 1HY3A 3CX7A 4PHGA 1ZM2A 1N6PA 2ZSAA 3K0FB 2BBWA 4Q1AA 2ORVA 4MGZR 2BCGY 2J0UB 4NKRA 1XZQA 1E9FA 4L5BA 1YHNA 2BMJA 3KKPA 3AVOA 2C98A 3K9NA 1T8TA 1OB2A 2P5TB 2P67A 1MKYA 2A7QA 4LUCA 2VA8A 1R0YA 4IDOA 1DBSA 4KCGA 3CPEA 4DCUA 1NJGA 2UVQA 4BQSA 3U4QA 3WMGA 3RC8A 5B2ZA 4FINA 2BDTA 1NLFA 4GL2A 1YZLA 5JHGB 1AA9A 3RS4A 3P1JA 3K0EA 3BH7A 4XJXA 3RNLA 4ZDJA 3ZH9B 3TUZC 3U60B 1EG7A 4LCBA 1U2RA 2R9VA 1XTRA 3C14C 3B5JA 1NSTA 4FIDA 5E4FA 2QZ4A 2WJIA 1R5OA 3K70B 2XZPA 2VP9A 3WYGA 4KLNA 2OBMA 4M1SA 2OG2A 1KY3A 2X1VA 2ZJBA 5BYKA 2C5LA 1QVAA 1KOFA 1LY1A 1JALA 2XZOA 2EFHB 4OQFA 3TKLA 1TU3A 3NEJA 4D81A 3TVTA 4HEJA 1YRAA 1NF3A 2IYVA 4UJ5A 3Q7PA 4KAXA 4ILEA 3PITA 3D8BA 2C04A 2WJHA 3SJZA 1NN0A 4AKGA 4BEBA 1FL9A 1F2TB 5FOTA 2JLSA 2X77A 3VR4A 2UZ3A 1R6BX 2I3BA 2J9RA 4YLGA 4B2PA 3V4FA 2VP4A 4PO9A 3CNLA 4BPBA 1XD2B 2J45A 4UNQA 4LV6A 3W5JA 3OE7D 1W4AA 5EJEA 1W7AA 4BFZA 2WTUA 1Q0UA 5CITA 4OQXA 4RZ2A 3U61B 3PXGA 1BYUA 2OEPA 2QA5A 2D62A 5JBQA 2J7PD 1KDOA 3A6PC 2ZUBA 2O0HA 4GZMA 2NO0A 3OEED 3VFDA 4Q02A 2O52A 4F7WA 1P2SA 3OF5A 3T1OA 2CE7A 1BS1A 2CHGA 5ELXA 3L8ZA 3CW2A 4LJYA 4NL4H 1ZAKA 2G9NA 1DG3A 4YMWA 4IOKA 2D2EA 4QG7A 2MSDB 3HPQA 3R7WA 3UIEA 2H7VA 2N42A 1W44A 1E32A 2ZJOA 1VIYA 4O2LA 1AS0A 2YC2C 4L15A 1SVWA 3B13B 2HJVA 3SN6A 3TGPA 1F2UA 4WBSA 2FPLA 2IF2A 4Q4HA 3BORA 2O8EB 1U0LA 3GFPA 4D4LA 2JLQA 1MRNA 1S9HA 1AS3A 2B21A 4AURA 4LX0A 4B73A 3LBIA 3BFXA 2HF9A 1CS4C 2Q21A 1TTTA 1SGWA 2GCOB 1GOTA 2GJKA 2QT1A 2ZJAA 4URWR 5FUYA 4HLCA 4N0DA 1G21E 2OBNA 3OIYA 3SDZA 2YC4C 1Z6YA 4Q21A 3AVUA 1FUKA 4WW0A 4B3XA 2GF9A 2D7CA 2FG5A 3B7GA 5FOVA 1KO5A 5HZKA 5KPDA 1KGDA 3LXXA 3T1TA 4HZUB 4HLDA 2F7SA 5F2EA 2EWVA 1XEFA 3QUSA 4Q7JB 3CLVA 4TQUS 4US0R 3ZIAA 1D2MA 4O25A 4TQ9A 3HDTA 3ZD6A 1VDZA 5ANRB 4OHYA 3B82A 4R71A 3EPJA 3GJ0A 2PL3A 2A78A 5A0FA 3HPRA 2CNWA 3ECCA 3W3ZB 2LKCA 2DHRA 1U9IA 1TUEA 4IEIA 3KQUA 3QI2A 4BFUA 1ZVQA 3GD7A 2W6JD 1KI6A 3SNHA 4M2LA 4E09A 1KJWA 1BKDR 4NYMR 1KJZA 1NN5A 3T15A 3K0SA 3KUCA 3K9LA 2R6DA 4G5RA 2ZRKA 5TB5A 5JI3E 4ZI2A 4ESVA 1RW4A 2ZSFA 3I92A 2EFEB 1XP8A 1V43A 2DCUA 2V7QA 3QPVA 3ZLJA 2EFCB 4NZYA 2V55B 4BASA 2BKEA 2OCYC 3RWMB 5JRZA 5FTMA 3UXMA 2O0KA 3LA6A 1XTIA 1KMHB 1YQTA 3EIQA 3SJAA 4Q03A 1E2KA 5JSZA 4QRHA 4IVRA 1M7BA 3LVQE 1T0HB 1XBTA 2A30A 2WJVA 4LJ6A 4PZZA 3ASYA 4JZKA 1XD9A 4LK2A 4DSTA 3VHXA 3SU8A 4BWYA 3VNUA 4XWKA 4OI2A 3KB1A 3ZZTA 3WP0A 3QY0A 2XB2A 3P32A 3A4LA 3W8NA 1XU4A 3VTKA 4ZCMA 3LD9A 1KDRA 1PLJA 4PQYA 2WICA 4DLYA 2EYQA 4XVQA 5K8UA 2HYDA 2AFIE 2V7QD 2V8OA 3FVQA 1NN3A 3E1SA 1ZNWA 3ZQ6A 1VHLA 3I5YA 1R2QA 3MJRA 3EWSA 1Z2CA 2O8DA 2DFTA 5J4VA 2GA8A 5E3HA 2ECKA 2J7KA 1DTSA 3CM0A 4HLUA 2QEQA 2FFBA 3BH0A 2I1VB 1KI3A 4QNRA 3IIMA 5CDFA 2ZRNA 4A0FA 4D0GA 3BAFA 3RVBA 1J7KA 5SZIA 2VPPA 3BJIC 5B57C 3WHKA 4DSOA 3A36A 4BRUA 1PLLA 1VTKA 4R2HA 1L8QA 1P61B 1Q12A 3GJ5A 3ZDQA 2ZU6A 4Z1MA 3FPAA 4FCTA 5FBLB 3SFZA 1VG1A 5JSZB 4C9BA 5FL7D 3PEUA 3ZS9A 2A9KA 4OHWA 1NMYA 1E9SA 3CO5A 4ZDKA 1TNDA 1KO8A 4O2RA 5AJZA 4OK6A 1TMKA 2WPDD 2WSMA 1G8HA 1YR6A 1JR3A 1KI2A 2GJAA 3KJGA 2BM0A 4I1SA 4K46A 5DHFA 4URVR 2O0JA 4JBYA 1TADA 1H8EA 1P6XA 2IHBA 3AF1A 1P73A 3BS4A 1ZU4A 4DCSA 621PA 2XJ4A 1VYTA 1W46A 4NMMA 5L3RA 1GNQA 1M2OB 3EASA 1OH6A 4A36A 2HCJB 1N5JA 1NVVR 4C7OB 3MMPA 1T0JB 2WIBA 5FOUA 5L3QA 3GJ4A 4Q5IA 3B85A 3QSYA 2V3CC 2X2EA 1MH1A 2VRWA 1E9EA 2ZEJA 3QOFA 1GNRA 5J4KA 1WE2A 4B2IA 4WXPA 1IN8A 3A8TA 3QBVA 4RJLA 5FOSA 2XNDA 3P20A 2XSZA 1B23P 2QT0A 3MLEA 2IUUA 3SZRA 1OFIA 4LV5B 2WKQA 4ZIRA 3OZXA 2GK7A 5EP1A 4A15A 2X19A 2LKDA 3K0CC 1S96A 4M9ZA 3ZQJA 1OF1A 1UKEA 3NG1A 3BFKA 3Q3JB 3B1WA 1Z0DA 1M34E 1UBCA 3NH9A 5J4HA 1IHUA 2NO1A 2GEVA 3AVVA 1Q1BA 1N6LA 4FWIB 4MRVA 3VKWA 3AVTA 5GADl 3CWZA 4Q18A 4XVRA 1BYIA 2GAAA 4QBIA 2JATA 3QXHA 3ETLA 3A37A 4LHXA 3TAUA 1KI7A 1G3UA 4A1FA 4Q19A 4XOIA 2Z0MA 4S35A 3EW9A 4A0RA 4Q9JA 2ZIAA 1Z6TA 1ZNYA 4JLKA 1CIPA 1NKSA 2YOFA 2CMKA 4B43A 3VR5A 4IOLA 4G01B 1X1RA 1SVLA 5JZVA 3FMIA 5DSZA 4PANA 1WRBA 2KE5A 1JJVA 3CZPA 4LBVA 4O3MA 3JZMA 1ODFA 2E9SA 4PC6A 4QOSA 5JWOA 2ZITA 4RD4A 2IL1A 3UK6A 5JWHA 4YC7A 5FI0B 4DC9A 2F3RA 4GFDA 4M1OA 2J0SA 3RS2A 3RSOA 5KUTA 2QTHA 2ZI9A 4M1TA 1ZD9A 2C96A 2JJ2D 1II9A 3K9HA 1LS1A 2QROA 4P3YA 1IN5A 5LDDC 2HDNB 4B2LA 2DFNA 2WSSD 2VHQA 1TF7A 4LI0A 2B7BA 3OEHA 2A2ZA 5FL7A 1G8GA 2JIZD 2ZR0A 4HAUA 5L3VA 4GBMA 4XWOA 2VP6A 2KWIA 3RS5A 4R7ZA 4KYUA 2F43A 2IXFA 1M7HA 5DE3A 2VBCA 5IK2A 421PA 2CVHA 4GDFA 1TL7C 2P5SA 1HQYE 1TQ4A 3HWSA 2G0NA 3WRXC 4EPRA 4LYHA 3HR7A 1U94A 3BBPA 2FSHA 3GJ6A 5KTYA 2ZI6A 2GXUA 4GOKA 4IDPA 2FPMA 1JXMA 5DISB 2VP0A 2OM2A 2QENA 1AQUA 1SKYE 3R20A 4IJMA 2ZU0C 3VR3A 4XIGS 1EWQA 1Z06A 3W5IA 1JJ7A 3FKQA 4OK5A 4R9UC 4EFLA 2IS4A 5EXSA 5KNDA 4XD7D 1I4TD 2XITA 2R65A 2VP5A 1TQ2A 3OEEA 2QG6A 3SBDA 3I8XA 2ZR9A 3P26A 4NCKA 1II0A 2JGNA 1SHKA 3CZQA 5C18A 1J90A 4KO8A 2O8DB 3T1VA 4B48A 3LBNA 2ORWA 3CH4B 1XPUA 1XFAA 3EC1A 4ZCIA 3EZ7A 3ZYCA 1UBEA 3K0CA 1R0XA 2WAXA 2QQEA 1E9BA 3BB1A 3GQBA 1RYHA 4JT4A 3MUFA 1GP2A 4I81A 4KVGA 4CT5A 5GVSA 3G5UA 1AS2A 4LBWA 3DDCA 3CF2A 4QGFA 4K81B 2GEUA 2F43B 2IX3A 2NTYC 4TTQA 4KFTA 2PX0A 3ZJYA 1PVOA 1GWNA 1OJLA 2IYWA 4FWTA 4PPGA 4RSGA 3HU2A 1W0KD 4JVLA 2BKUA 5BWMA 3J81k 4U5XA 3I4LA 3Q72A 2ZRJA 4BLQA 3AKDA 4G5GA 1ZCBA 2ZVPX 3I73A 4I1UA 4JLJA 4DEXA 2H18A 2ODBA 1RZ3A 2GJ8A 2JLRA 3A58B 1DO2A 4B32A 4OKSA 2PZFA 1KMQA 4Y0AA 1G1MA 1T4GA 1W0JA 2XTZA 2WMNB 1DE0A 1X8KA 3IO5A 4UJ3A 4NYJR 1Z8FA 1FFHA 1AK2A 1CR4A 4LHVA 2BBOA 4TYQA 4TL8A 4MYUA 3HYTA 3BB3A 3RSLA 4HB0A 5J40A 121PA 5JCPA 3WY9A 5G3ZA 5FBVB 3U3OA 5KNBA 2JCSA 1E2MA 1QDEA 2EWWA 5J4YA 3AKEA 2VHCA 4EFNA 2F1IA 3THWA 2R6GA 1OHHD 1Z0KA 3CRW1 2OXRA 4OQLA 5GJWC 4F38A 5CIWA 4JLNA 3GLGE 2QBYA 1VKJA 2QORA 4M4SA 2GAOA 4QJ4A 4YMTA 1Z6AA 2DYKA 2WSSA 4HDOB 3EPLA 1W4CA 2RB4A 3LQQA 4MUAA 4NPHA 3L82B 4NYIR 3MWYW 1AN0A 1NMZA 5C2JB 1OIXA 1KYIA 3T12A 5E7JA 1QZXA 4TSFA 2Q0HA 2ZRMA 3QG1A 5GVRA 4YDSA 1T9HA 1SKYB 2OZEA 3CR8A 5TXGA 4DVGA 1TEVA 2RGAA 4JT2A 5FBRB 3NWJA 1A82A 1QG2A 1P7CA 1AGPA 1G4AE 2RGNA 3H1TA 1HT2E 4IDNA 1WQ1R 3EZ6A 1KZGB 1QHHB 3MWKA 4P4SA 1OFUX 1KNXA 4IOJA 3V00A 4AC9A 2ONKA 1E79A 3HU3A 3OHMA 3RS7A 4QFMA 1FZQA 1P72A 4C2UA 4D0NA 2FA9A 1YR9A 5KNCA 3I32A 4DDWA 1ZYUA 4LC0A 2IK8A 4M1MA 4DLRA 2DPXA 3L0SA 1NJFA 5BN3A 2VIIA 1E0JA 2IS1A 5AR1A 4BLOA 1CEEA 2IXEA 4KHZA 4DT1A 4EPTA 2ASEA 5DGXA 1PUIA 2KBEA 4L8GA 4DZZA 4YQFA 1DS6A 4YXWD 3QG5A 4ITRC 1T6NA 2XNDD 2OFXA 3VAAA 1YR7A 1G6HA 1XTJA 1NNEA 3EPHA 4TTPA 1Q1QA 4C0QC 5AUOB 2WMOB 1NLYA 2KBFA 3TVDA 3LDAA 1EGAA 2OFWA 1IN6A 1H65A 2QAGA 2G83A 5EUQB 3VNVA 1R0ZA 4TMWA 4E07A 5JS7A 2NPFA 2X8AA 4BLSA 1ETUA 3LWNA 1GRRA 2BOVA 2WHXA 4RD3A 3TUIC 1FW6A 3IIJA 2HUPA 4JVNA 2WWIA 3GJ7A 1Z6XA 4QHYA 3VKGA 1KK1A 4CEHA 2RHDA 3QPWA 4FMBB 3KKNA 4ZKEA 3KQNA 5K8LA 2FE4A 2GZDA 2F1JA 3WHLA 3NXSA 2BMEA 3FE2A 1G5RA 4PPNA 3K0AB 1RVDA 4B35A 2H57A 1G8FA 1R4AA 2R6CA 4OYHA 4AI6A 3R9WA 2VLIA 4QNMA 4PHTA 4ERNA 1N5KA 2R8RA 1FX0B 3AH8A 2Z4SA 4JMPA 3O8RA 3Q8XB 3LVRE 1KAGA 1GG2A 3Q5EA 4TLBA 4TSFD 4DUGA 5TVKA 1SXJD 1US8A 4IKEA 4HATA 1M7GA 4FMCF 5DH9A 2O8CA 4FMDB 1UKYA 4V0KA 4DCVA 4W9MC 1F3OA 1YZKA 2QMUA 1VCNA 1PZNA 2QPOA 3GLFB 2ZR7A 1KMHA 4A2WA 3Q9LA 3NIBA 4HLUC 2REBA 1QBKC 2WKPA 5CLQA 5EZ6B 5FBWB 4BFYA 3GP8A 1Q22A 4KSBA 1HYQA 6Q21A 1FNNA 1S1MA 3IPXA 2OCAA 3FKSA 4Q9IA 4AG5A 2NO7A 2ODWA 4TMVA 3KQHA 1IN4A 2BMDA 5TDHA 2C9CA 2FEMA 3C4JA 3ZS8A 5D3MB 2H8KA 1II8A 1A2KC 1RKBA 1BH2A 1E2JA 3I72A 3GMTA 1ZUNB 2Q3HA 1KI1A 2QGZA 2ZRBA 4LJ5A 3FTQA 4KITB 1G3MA 5KYKA 4TYPA 1D5CA 2FSIA 1R7RA 4Q48A 1E4VA 4KFUA 2AWNA 1YR8A 1G8PA 1E79D 2RGDA 1R0WA 3NC1C 3EZ9A 2HT1A 4Q9HA 1E9AA 2CJWB 2FPKA 3E70C 3VX3A 5L8VA 3GLFA 4V0NA 1D2NA 3LLUA 1T3LA 4IFEA 3GEIA 4JBWA 3NDPA 4LWZA 3T61A 3R7WB 3BB4A 1G7TA 2O8FA 5DI3B 3EX7C 4A0GA 3E5HA 1S4QA 2OE2A 3TW8B 1IM2A 3EZFA 4C3ZA 3T5DA 4Z54A 4NCIA 2QUZA 3D3QA 2P65A 3LV8A 4EJSB 1I2MA 2WWHA 4M1YA 1H8HD 2ZUDA 4JL5A 3EIEA 5GJVC 3DO6A 4KJZA 2GETA 2BCJQ 3LQRA 1W4BA 5H8WA 3H86A 2OCBA 2D4HA 2J1LA 3W90A 5KDDA 3KJEA 2ZUCA 4I1OA 5D3QA 1RJ9B 3IO3A 3TLXA 4LV8B 1Z3IX 4TLEA 5EE5B 3K9GA 3U3KA 3K1JA 4LYFA 4GMXA 1U9IC 2Z4RA 1DAEA 3KFVA 3X2SA 4PQRA 2ZPTX 1W2HA 4H1UA 1DAIA 2JAQA 2FOLA 1CBUA 3PV0A 1C4OA 2G3YA 2PMDA 2PJRA 4R98A 1SZPA 3RRZA 1S9DA 1TUIA 5FUXA 1CJVC 1KY2A 4NU0A 5AJVB 3CUEF 2DY1A 1EFRA 1AZTA 2GVZC 3RRMA 1MRSA 1YKSA 2GXSA 1IY1A 1GKIA 2C77A 2QRNA 3FHCB 2W58A 4M53A 4KODA 4U00A 5FOXA 2VHUA 1CJTC 4WOPA 4ZIRB 1RPZA 2XB4A 4Q9LA 3KDSE 4NCNA 4CIDA 3CPHA 3BXZA 2IYXA 3HR8A 3KQKA 1OXUA 2QTFA 3NH6A 1OHHA 5EE1A 3D7MA 4A9AA 4JKYA 4LZZA 1YU9A 5J47A 3DVLA 4JVSB 2A5DA 4GRAA 3RYTC 1PJRA 2F6RA 2IWRA 2AN9A 1Z28A 2QMHA 1G7CA 2H5EA 3X1YA 4M9QA 3GJ8A 3HU1A 1NIPA 2OT3B 3MSXA 5HPYB 2CL0X 2OLJA 3EG5A 2O8BA 1VIAA 1COWA 1G7SA 4KBGA 1JNYA 2A5JA 4LHWA 4NCJA 3TSZA 4ZI3A 4PC1A 2QM7A 4IDQA 2OFOA 1NLZA 3OE7A 2JEOA 1UJ2A 1H8ED 5DYIA 3TW4A 2VQSA 2FU5C 5AJYA 1XEWY 4DLXA 3GLIB 3WYAA 2CDNA 5H68A 3QE0A 2JLXA 4QM6A 4A6XA 1OXXK 4A2QA 3KJIA 4TTRA 4RZUA 1H8HA 2HV8A 3KKQA 1NVXQ 1U0HC 3PR1A 2OV2A 3RDPA 1O87A 3H84A 4RCYA 3AM1A 2RGNC 2ZE5A 3DOEA 4HYYA 1TEXA 3SHWA 4TYYA 4HB4A 1I4LD 1ZIPA 1W1WA 4DXAA 5JEEA 3BH6A 3UMFA 1HV8A 5EUMA 1UEIA 5E95A 2ZYTX 4EPVA 1WMSA 2ATXA 4HUQA 3U4QB 3TIFA 1KKMA 1N6HA 3IUYA 1C1YA 1JEDA 3KUDA 2K5UA 5CIQA 3VR1A 4Q4AB 3MCAA 4OQNA 4MYCA 3B1VA 1DOAA 4BE7B 3QF4A 3FHTA 3KKOA 2V1XA 3AQ4A 3I61A 1OKKA 1N0VC 1XMVA 3A1VA 3BFVA 2GWHA 1HEIA 2DFLA 3C8UA 2YWFA 3F5FA 4CW7A 3D6TB 1NKTA 2V6JA 1YZTA 1N25A 3CR7A 2VTKA 2YV5A 5CYOA 5UKDA 5JJLA 5JJKA 1U8ZA 4AG6A 3TMKA 4C0HA 2XX3A 1NBME 2WOJA 4D6PA 3GFTA 5EP3A 3T34A 4DB2A 2F1HA 3PVSA 5EXTA 4HAVA 3PUWA 2QGNA 1XTKA 1Z83A 3F3YA 3CONA 3H0KA 4DLZA 2V54A 2ZI4A 3X1DA 1AZSC 3K70C 2V9PA 3B9PA 4C0SA 2Z5FA 1N5IA 3SBEA 3SJBA 4H9GA 5E7MA 3DKPA 1E69A 4IOMA 1OB5A 1DPFA 2PCJA 1GTVA 1UBFA 1XMSA 2NOAA 1NVUQ 4V0LA 1G16A 3OAAD 3SI7A 4EQ6B 3OIWA 1TU4A 4A4DA 3B2EA 4TMXA 2J7PA 2ZI7A 1IBRA 2P6RA 4CRWB 4CEJB 1J8MF 3U44A 4UQOA 2CJWA 2W2XA 4C0JA 4HDCA 1VCIA 1CJMA 1JB1A 2PCLA 2CLCX 2ZYVX 4LSGA 4JIMA 1IJFA 4N1AA 5DI3A 1QHSA 2BIFA 1QRAA 4FI3C 4HB3A 2JLZA 1I2DA 3AVQA 5BW8A 2RAPA 1F2TA 4F4JA 3PQCA 2V4ZA 821PA 1Z0AA 4F4CA 2RCNA 1E2QA 2ANBA 1E2PA 1E9CA 5F9FA 1TX4B 4F4IA 2AX4A 4PSVA 1G8YA 2CLDX 3I1FA 4JSYA 4OHVA 3AVWA 3IHWA 1A5TA 3B9QA 3T35A 4LJ4A 4RCZA 1XCGB 3K0FA 4LYJA 1Q1EA 4Q4HB 2O8EA 2WAYA 4PXAA 1P75A 2YOGA 3L2OB 1XCPA 1ZMXA 4X8HA 3W6OA 3HJNA 2QMEA 2H16A 1X86B 5HR5A 4NYJQ 1DAMA 2HT6A 3QF4B 3RS0A 3JVUA 1C9KA 1CJKC 3F8TA 3JZAA 3IEUA 5DYGA 4MKHA 4W5HA 1K5GA 1U90A 2C8VA 5FTNA 2XXAB 3BK7A 1SVOA 3ZVLA 1VCOA 4LOAA 4YDHB 5IK2D 2P6NA 2J87A 4V0ME 1I4DD 4Y0VA 2ZJ8A 4OHZA 2NPIA 4US2R 4K8OA 4UXHA 3UATA 2W6ID 2NZ8A 5BN5A 1UFQA 4PPQA 4XTRA 3SYKA 4C4PA 3QXSA 5FI1B 3B78A 2C95A 1YZUA 2GJSA 3NBYC 4GSYA 3WRYC 4DRZA 5AUPB 2RKOA 3HYRA 4Z1MD 4GI7A 4ZPXA 2ZS8A 3GJXC 3W9YA 4D26A 3FYHA 5CJPA 4ZV4A 2UZIR 3D31A 2HXSA 2CCKA 1QHXA 5BYJA 2J59A 3C16C 4WVFA 4FMCB 3MD0A 4NYIQ 2AHOA 4MGIR 2WPDA 2YOHA 4DLWA 1EX7A 1Q44A 1PUJA 2MSCB 4MKFA 1LF0A 4QL3A 4Q4JA 5HTKA 1WBBA 1ESMA 5GJCA 2ZJZA 1E2LA 1GNPA 4JKIA 3VR6A 1UPTA 2QL6A 2A5GA 2REOA 1T5LA 1UDWA 1JBKA 3DMNA 5JI2E 2CCJA 2QN6A 4PAOA 1W36B 2O8BB 3ND8A 1LTQA 4KBFA 2YYZA 1ONBA 2ONJA 1S2MA 1N6KA 2YNMA 3NBFA 2W2TA 1HT1E 3LBHA 3ADCA 3MFYA 2BJWA 1GFIA 2QRZA 2QE7A 1K5DA 2ODEA 2XGJA 3WYFA 4D82A 2AL7A 4D0LB 5JRJA 4JLBA 4PX9A 3IKJA 2FV8A 2JJ1A 2ZRFA 3KQLA 4WAUA 4TT3D 2JDIA 1D8TA 3TNFA 1XPRA 4QHSA 5FH9A 4JLPA 5F9HA 1YE8A 4PQFA 1MABB 3ND9A 4A6PA 4LPKA 4MKGA 3H2YA 3QEOA 4OL0A 2O8FB 3KTAA 4YMUA 1TF5A 4Q7MB 4OI1A 1KIMA 3WMFA 5B64A 2GBLA 2QSYA 3AF4A 3NBZC 3KXKA 4J0QA 3FOZA 2ORIA 4B3CA 3IHLA 3DZDA 4L16A 1ZD1A 1XJ0A 1FQKA 4AD8A 3KZ1E 4Z8YA 3EPKA 4P4SB 2ZRAA 3NTUA 4Q7LA 4RD2A 1NL3A 4US1R 4LJAA 1DEKA 3CIOA 4KFSA 3KFXA 3AUXA 5IHPA 1XZPA 2I1QA 3A4MA 1E1RA 1LV7A 4BZQA 1KO7A 5AJXA 3ONWA 3LFUA 1S8FA 3GLFE 1E1QD 1S3GA 4Q01A 5DO9A 3SQWA 4NHOA 4GOJA 2XEXA 3KL4A 4P33A 3B1XA 2G1KA 1JR3D 4ASUA 1VYUA 2CK3A 4HDQB 3DM9B 3NDBB 1NBMA 2CL7X 1G3QA 1YZQA 2ZJ5A 4JL8A 3U44B 4TMKA 2BMFA 2VEDA 4LJ9A 2G1JA 1Z0FA 3ZZ0A 4BRWA 4NP6A 1XXHE 2JJ1D 3MRSA 4DDUA 5B30A 2PZGA 1FQJA 1E2FA 4RD1A 3K09A 5FPHA 1YVDA 3EXAA 3QVVA 2ZAMA 3N5CA 3NEYA 1SXJB 5AUQA 2VSXA 3BRWD 3ASZA 2VHJA 2ZXUA 4C7OA 2RGCA 4RFVA 2BJVA 4IVQA 5EP4A 3S1AB 1F48A 1RC8A 4IVPA 5EE9A 2DWPA 3ZIAD 2RGBA 1GZSA 1NG1A 5EQTA 2QP9X 2JIZA 5FUVA 4OK3A 1XNJA 3THYA 4ACBA 1AKYA 1IJEA 4EUNA 1P9NA 3CNNA 3DEFA 1Q20A 2HF8A 1ZINA 2N46A 1XEXB 4LC1A 1N2CE 3EIHA 3U5ZB 5BN4A 3FGNA 3CWQA 4M9SA 1EESA 1R5BA 3ZGXA 2PH1A 1XF9A 5HCNA 2E87A 2ZANA 1IAQA 4LGMA 3BGWA 3KXIA 3GCGA 5TMPA 1D9XA 3LLMA 1QF9A 3AF3A 3SYNA 4BECA 3EAQA 2QM8A 4Q7KA 3EA5A 2W2VA 3GLHB 4RD0A 3AF0A 3THXA 1GILA 1W0JD 1Z0IA 1ANKA 1J2JA 2WWWA 1BIFA 5H70A 5J5CA 4EJSA 4UNRA 4QM7A 4FD2A 3R8FA 1GL7A 4EDHA 4M21A 4NCHA 3CPJB 4Q66C 2AXPA 4AY2A 2GILA 5K8TA 1SVMA 3KKMA 1VCMA 3S1AA 3UPUA 1P4SA 4B33A 3OFNA 2GVDC 1ELOA 4C0KA 4UKDA 1OV4A 3L43A 1AKEA 1US8B 2GCNA 3VKHA 5FPTA 4B71A 3I5XA 3AVPA 4UXIA 3I8SA 1Z07A 2IF0A 4RKEA 3VR2A 3RRNA 721PA 3VMFA 1L4YA 3RABA 1W47A 1BMFD 1XJQA 5IRCD 3LH5A 4QGHA 1U81A 4PO8A 1ZRHA 4A8JB 5DNYB 2DWOA 3DMDA 4GMDA 3SE0A 2J46A 1E2GA 1XRJA 1E2DA 4XWAA 3IEVA 1P2UA 1KHTA 1CP2A 1GL9B 1Z22A 4FN5A 5JWRA 5EE0A 4MYTA 3QPUA 4WA7A 3UANA 4MDEA 2VHTA 4UNSA 1G19A 2IUTA 2QP3A 1LF5A 1P5ZB 1RRFA 1R8SA 2ZRLA 4IXMA 3AV0B 1Z63A 4DSUA 1VYVA 4JS0A 4B3DA 1EFCA 3A4NA 1ZW6A 3ZZUA 1UKZA 1AJEA 4EJSC 4A8JA 1VPLA 2XTMA 2P2LA 2Z6VA 4PAMA 3V4RA 5L3QB 1K6MA 1Z5ZA 3QF7A 3LO5A 4DT1B 4HLQB 4QBFA 4Z51A 2JLYA 4LHYA 3WMEA 3NVAA 2ZRDA 1LB1B 3IILA 1V5WA 1QHHA 1ZU5A 2SHKA 1MO5A 1QG4A 3RWOA 1HA3A 2GHIA 2O5VA 2PLRA 3H4MA 5LB2A 4B3FX 2C78A 2CHVA 4A2PA 3THXB 2HJGA 1WB9A 3CF0A 4UNPA 3FFAA 2NG1A 1T5IA 1DVRA 3UKDA 3I62A 4PSAA 4IFBA 1II8B 3FB4A 4B74A 2B92A 4TT3A 3WNDA 5EXXA 3W6PA 1YZGA 3CRVA 4TLAA 1N6RA 4LJ8A 1GIAA 2D7DA 5D3MA 3TH5A 4B76A 4C0LA 2IYZA 4B34A 4URXR 1N0UA 1JAIA 4Q4AA 1OFTA
chains in the Genus database with same CATH superfamily
4RC9A 1KERA 5CX4A 2D3WA 2ZVJA 1HEYA 2ZYDA 3LUAA 1G21B 4UDOA 1G6OA 2DTXA 4PHFA 1KZ7B 4AZ3B 2HDHA 1Y1RA 5JDIC 2Y1OA 2IXAA 1YKGA 4KQMA 4IZOA 4ZT5A 2FAXA 1U1GA 1OYWA 5EESA 3L0DA 3CUWA 1I6KA 3NTXA 3UKJA 3MW8A 4MDHA 3GT4A 5HIAA 2E1PA 2K4MA 2RH4A 4IY1A 1JLSA 2JVIA 3LYLA 2Q9UA 3M7IA 5CW2A 1JQKA 1YASA 4CMEA 4OEHA 1KL7A 1KDTA 4N8EA 4JB3A 2DBVO 5LD2B 1LJUA 1X8XA 4PIPA 4Z3OA 1DV2A 5D1HA 4D4HA 2R6AA 1VA4A 1PKEA 3ICVA 3O8DA 3CZ5A 3IOCA 3ROKA 1GR1A 5GIPE 2RJ3A 3TIIA 5AFSA 3ZVKA 1G0OA 3L5OA 5F3RA 1M1ZA 2MHCA 1BVRA 2RH5A 3W8DA 1Y5NA 4M0LA 3TVYA 1LDYA 4MUBA 1G6Q1 2J5KA 3MJEA 1FVXA 5HNKA 3AIOA 3RFXA 2HM7A 3DVRX 5AK5A 2ZJ3A 4G5YA 5BUQA 1EU1A 4WOJA 1Y9AA 3RSHA 1X15A 2I6GA 2J0QA 4JVMA 2X9GA 1RZRA 1JSCA 4I36A 4DIEA 4BU0A 1EYZA 2AMFA 3GDOA 1U8UA 3C5HA 2YBEA 2BEJA 2BRUC 4PLGA 4X45A 4AUMA 3SZLA 1WBDA 2GZAA 4RWZA 4L9WA 3CLKA 2RH9B 2C2YA 3HA3A 3NMUF 2W2KA 4HPXB 3TYXA 1KQPA 2OBXA 1TJNA 3B6EA 4TKMA 5CBPA 1U0NA 2D13A 2RGUA 4YRMA 2J3LA 3QPCA 3F1KA 2C99A 1E0DA 2JIPA 1BA2A 3WNQA 5J2TB 1G5QA 2NM0A 2YRXA 3KXDA 1XTQA 5TX7A 3QE3A 3QVMA 4UHFA 3QIVA 3FYUC 5F7OA 4R2XA 3QPAA 1IN7A 3WLFA 3PGMA 3UOGA 2P2NA 3MMSA 1PBNA 2OZKA 5IAOA 2YWBA 1TK2A 4RY9A 3LRPA 4J29A 1NVGA 4DUZB 2V5AA 3MWLA 3WAJA 2BBTA 3TPCA 3R9KA 1EXNA 2RFLA 2GNOA 1RC0A 3SOPA 4G5SA 4P3KA 1IZ8A 2P9TA 4YMSA 1Y1TA 5EAIA 4C0XA 4DSNA 5DTEA 3DUFA 1I32A 4HNHA 3AK4A 3PUZA 4Q9DA 3N0WA 3LBAA 4CUKA 2BFBA 1YUNA 3JQGA 2ZRCA 4HPWA 4P32A 2HLDD 3F1LA 2IHTA 4UCWA 2Y71A 4BV2A 3OQMA 2FOXA 1J5EB 1ACJA 4GP7A 4B17A 5B7QA 3EHEA 4UZEA 2FF7A 1ODLA 2DUWA 3PD7A 2IU6A 5DZSA 1X38A 2GCPA 1W5SA 4DA6A 1XTTA 2YWGA 2EJCA 4HZUA 4AKIA 3EMVA 1I5RA 3AR9A 1EXVA 3GFVA 1E6KA 4J16C 1KS9A 1PYOA 3LQ2A 4ARZB 2FGJA 2GN8A 4OQYA 3G23A 2ODPA 3MJHA 4QVKA 1KS2A 4M9XA 2EQBA 5L7WA 3LVBA 1VC2A 2O4CA 4K40A 4E4YA 2CHEA 3LC0A 1SXJC 4RA9B 2VAXA 2GRAA 3CJQA 1QHGA 1S2DA 1S4MA 2C03A 3HCBA 3NTOA 3T3DA 3VO9A 3WKEA 2WJ6A 2J3JA 3NONA 3R3UA 4IEEA 4JI6B 4QDTA 4XCVA 2J0UA 3L7JA 1DAKA 3FZYA 3RVOA 3MS7A 4FGZA 4K05A 1A7UA 4KO1S 3LX6A 1ICIA 1Q92A 5GV7A 4J4HA 4CGYA 1K3TA 3DNPA 4R8MA 1WKCA 4YP9A 1AV6A 1QK4A 1N6NA 4IH9A 3G82C 2ANCA 1FMJA 1N34B 2D7JA 2HB6A 3DZ8A 1KZ6A 4HTFB 3TBHA 4Q7EA 4JSTA 4QA9A 2PANA 4G41A 1NN1A 2V58A 5ERYA 2ZQYA 3CC8A 1ZNXA 4B40A 4N41A 3A06A 2RJNA 4L02A 1W5TA 1Y6RA 1DAFA 3B1YA 3MJSA 3O3NB 4LXXA 3EOZA 4PYNA 2XCIA 3MXTA 4URUR 3ZHBA 3ICEA 4HMPA 2ENWA 2JFBA 3THWB 1RBZA 4CG1A 3URMA 4GNKA 5LOVA 5H02A 1SHZA 3WQSB 4EL5A 1XTBA 2R1UA 2X22A 2O2HA 3IPYA 4UULA 3SYMA 1MB2A 3RUEA 3ZN2A 4C06A 3RH0A 2R8EA 1U0SY 4GQBA 2AC4A 3T5AA 4MWOA 5EIOA 3CKKA 3A9UA 2C9YA 3MEQA 1W2GA 3U1VA 3CB4A 2AOUB 5IVIA 4Y2GA 3TR5A 4AMYA 1YBFA 3G2QA 3DT6A 3I4CA 3H1BA 4ZP1A 3AVXA 3DOHA 4MXDA 2OSBA 2Z9CA 1XMQB 3L4SO 4F6LA 1L7QA 1KJQA 1K7FB 4R9SA 3F2IA 1UEJA 2FEWB 1YNSA 4Y2HA 1GCIA 4PONA 4RLQA 3VGPA 1QYRA 2RGXA 5FV4A 1N7HA 3SQXA 1G5TA 4K0RA 2WF8A 4DL9A 2AR7A 4QEDA 1E3QA 1IVYA 4Q1DA 4TRRA 2Q5HA 3N7UA 3UUFA 1GTZA 3GXOA 3ENNA 3K8ZA 3CT6A 3TRFA 3ZCRA 4AS3A 1W34A 1PYDA 4HCJA 2D6FA 2RHRA 2B69A 1ZD8A 3L0OA 3ND6A 4XUGB 2FW6A 2A9QA 2FZLA 5HKOA 5K6AC 4QPCA 3OG9A 3CY6A 2OUKA 2I6QA 2DBRA 4JODA 4XLTA 3ELUA 3GUCA 4NECA 4C30A 4A73A 4AN1A 3K0KA 3C7KA 3ZX4A 5DCYA 3GFRA 3KJZA 2OCLA 1F17A 1Z47A 1F14A 4AO7A 3B6KA 1C3OA 3NCHA 3R4VA 3BZUA 3JQEA 3OTGA 3TTTA 3A14A 1CR0A 1G64A 1VKNA 4WN9B 1XALA 4ZV9A 3V9AA 2PL1A 1KSJA 1I13A 2O7QA 1U3WA 1INLA 4XCXA 5EXPA 1JKIA 1Y4UA 3TSYA 5KX5F 5K03A 3TIXB 1NF9A 2X4LA 1V11A 1M1NA 5C1PA 2FN7A 4ER3A 2P9JA 3AEUB 2P2ZA 5ADVA 3MK31 5KKAA 2H2WA 3JS5A 3RTGA 4ZHQB 2DM6A 1WOYA 4FHFA 1I4WA 4NU8X 1T4MA 1KEWA 5EZYA 4HZIA 4C08A 2EBFX 2EZUA 3JWGA 2BP7A 3X1KA 2VTEA 4RGVA 4N3GA 3DE1X 4AZ0A 5CBKA 2ZM5A 2OCGA 2VXOA 2IP1A 3I1IA 3IAEA 4U1RA 4YRRA 4FCWA 1BTOA 4ISCA 4X5OA 4L4SA 3IL2A 3LLCA 3V7YA 1LVUA 3X0DA 3AJAA 4KYIB 2VQ6A 4KN5A 2A7XA 3TM4A 4ZJYA 5HQ3A 4YMVA 5JBQA 5LQMA 2GM5A 2FX5A 3D5TA 3GLIA 3H83A 1JEYB 3C6KA 2NYAA 5J63A 4AS2A 3EPJA 2NGRA 1O9GA 3HXQA 1Y8RB 2F8MA 3UV3A 3KB2A 4TUYF 2OYCA 2RGEA 3PA6A 4NJEB 1Z7WA 4HADA 1GSOA 1W96A 2RK6A 3F67A 4IWNA 2O0LA 2Z95A 3QU9A 4D4MA 2HA7A 3BBLA 3TUZC 4B6PA 2PX6A 2O7SA 1YONA 1OT3A 1SXPA 1VPWA 3TZBA 5KDOA 1KDPA 3G9ZA 3IBSA 2AW3A 2VWPA 4EO9A 2Y1WA 1OGYA 1R8QA 3G17A 1JJBA 1DC4A 3ISJA 4RESA 2NXJA 4LQLA 4H6WA 1G2IA 5HF6A 4YIKA 1NM5C 3FN4A 3U2QA 1OJ7A 2ZRIA 3DEKA 4X90A 4WCFC 3J7AC 5KNCH 1R5NA 4DUYB 4BYGA 3SS8A 3R3SA 2DUNA 2L0XA 4B47A 1O0BA 1N6IA 5FXMA 5JADA 1L7BA 1OLOA 1RPTA 2P9QA 2OHVA 3QFHA 3HDGA 4IXDA 1XL0A 3ESDA 1QB8A 4LTMA 1XZHA 3VDQA 1P9LA 1MEOA 1X7DA 4C22A 2BONA 4D46A 2W6ZA 1L4KA 4L5CA 1D7OA 2L18A 3B8EA 2R00A 3E9ZA 3IC5A 1UC9A 4DIKA 1P9WA 1VMAA 3CLSC 2CBZA 4A7PA 3GGSA 1SCNE 1Y7PA 2R2AA 3LX8A 4OOFA 2C7GA 4O4HF 2Z57A 1C3OB 3C3MA 3DQPA 3OBBA 2C9OA 4H1HA 4O4LF 4NULA 4WE3A 1BG6A 4YJ3A 2OD7A 3HP7A 4YO8A 5EZ5A 3DC2A 5KYGA 1XUOA 1PZHA 3OX4A 5TMBA 3U4DA 1BW9B 4NFSA 3E3AA 1B8PA 4RTSA 4D3SA 3PWKA 5FTJA 3H9EO 3PEYA 2CE2X 2UV8A 4S3MA 3DE7X 4NOKA 1U7DA 2F55A 3F7TA 1HZZC 5IAAA 5JD3A 4H17A 3R7LA 4ALJA 1D4AA 3CSUA 1A9OA 3OF2A 2WF6A 2E82A 3CVYA 4BAGA 2FRXA 3BMNA 3MTBA 4CMBA 5FJIA 1Y7HA 3LT1A 1MH9A 3FYCA 2ZWOA 5KKNB 2R751 4KXQA 4MCAA 2GUGA 3HVIA 4Y2PA 3PFBA 3R74A 3EPPA 4FQ8A 3NFYA 1FBNA 2ZJYA 1RQXA 5E0KB 5J58A 3V8NA 5L3SA 5LP6A 1Q1AA 1QYIA 5C8YA 4DRYA 4KQ9A 1DMSA 1YBAA 1I24A 1ZUWA 2IYSA 3ESQA 3HH8A 3MMXA 1NBAA 2HZ7A 3N2IA 4J43A 4MV9A 1DJLA 2VDLB 2JFOA 1P1IA 3U9LA 5JS8A 2W0SA 1K92A 3Q8MA 4KAAA 1OAOC 2AGVA 3GPIA 2Y92A 2ODQA 5D87A 4U9HS 4WASA 5FPKA 4DY4A 3PNPA 2QMQA 3FSRA 5FIUA 5HXAA 5ALSA 3TM5A 2QQ5A 3R5XA 2QQ0A 3RD5A 5I01A 3A3NA 4L8WB 5KYWB 3ONFA 1JLLB 1YFLA 1BCRA 4M22A 1ZZEA 1PQ4A 2WG0A 3R76A 3HADA 3M4YA 4D4IA 5INTA 3K2BA 2LP4Y 2PZEA 4HRYA 1X1SA 5IABA 1S8NA 2YVQA 1VHJA 1MENA 1RM4A 3HVJA 2ID9A 3DYBA 1MV8A 3N8IA 3NBXX 3PFIA 4Q47A 4C4AA 4JYCA 4BX8A 4HUTA 5BWBA 3TW0A 1QC5A 1XYGA 3JR7A 3NOQA 3EBPA 3OQ6A 2V6IA 4JL6A 3H1PA 2P9HA 3WNBA 1Y3HA 5FNVF 2BW0A 5BWNA 1JEEA 4P2GA 4KFCA 4TLLB 2WTXA 4MS3B 1UM8A 1E1YA 3K05A 3P9SA 1NBHA 3S8YA 3OFSA 2WJYA 1Y33E 4Y2JA 1PU2A 3QIAA 4I55A 4KRXA 3P19A 3LO8A 1EJBA 3CPSA 3ED1A 4U5QA 3TDMA 3OUTA 2VH1A 1GKUB 1WUJS 2AR0A 1NX6A 1ZA1A 5DN6A 4BC1A 5IMSA 1HNZB 1Q74A 3M6FA 1AM4D 1F2UB 4M83A 4JOBA 1QE0A 4Q4DA 1KGSA 1ZHOA 1CEYA 3KB8A 2EFGA 3EUFA 3GPDG 3UW3A 1IEVA 5K99A 4DRXA 3HSYA 4J2TA 4G0NA 3JASA 3WIBA 1GTG1 4HX2A 1GUZA 3VVMA 5DLQC 4URHA 2KJQA 3QTTA 4TV9B 2GGSA 2LXNA 1CQZA 4LRXA 2GKSA 2BH2A 1ISRA 1E8NA 4J7CA 3AHIA 2I7VA 4ZANA 4EYGA 3SY8A 4YRPA 3BMCB 2QHXA 2PAFA 2PLFA 1JAHA 2EKQA 3HUEA 3DOCA 1EWRA 2QPLA 4C87A 4XM2A 4H4DA 4CM6A 2XTJA 4QTUB 4DKJA 3B48A 3JU3A 4KI0A 2R47A 5D5PA 2UUOA 3JAWB 3RJZA 4KVAA 1GVNB 2QR2A 4MVJF 3RR2A 2VPTA 1EFRD 2VL7A 1CKEA 3AGQA 1CHNA 4YMLA 3TINA 1YL7A 1PHRA 2I76A 2PL9A 1WXQA 3A0RB 5E1OA 5C8YF 3EOAI 1P91A 2B5WA 4DMRA 3JZIA 4FOPA 3WLQA 3L92A 1L5HB 1ZK2A 2VQEB 4GVXA 3E7DA 3ZGLA 3OY7A 3ZWAA 3Q11A 5JW6A 5F64A 1J2TA 1NONA 1MT3A 4NAHA 2A9VA 4OQEA 2RH8A 5KJCA 3ET4A 5AJHA 2JI6A 2RKBA 4LBZA 2FDCA 4TN1A 2W90A 4FDLA 4HK4A 5B37A 4OREX 3ICOA 2DETA 2FR8C 1BJRE 1FDWA 5AK4A 1WY7A 2GZSA 4IEFB 3EG9A 4E5PA 4ZAWA 1FDSA 2EV9A 1L7VC 1AGYA 2Z9BA 3ANLA 4IH1A 1PO7A 1H6DA 1N3IA 3MG9A 3Q2IA 5C1IA 3RYHB 4DY6A 2XNSA 3L0PA 1Y9EA 2O2XA 3M1AA 4H0FA 1YE5A 3O8BA 4LSWA 4CM9D 4U7HA 5IDXA 1SIBE 2GRJA 1EQ2A 2H5JA 3K53A 3G0IA 3EVBA 2R4UA 4C5AA 4ZVQA 2XTNA 4TLMB 1N2XA 1K0FA 2GF0A 4F5WA 4D25A 1XRRA 3MJDA 5JMTA 3AFOA 4BV8A 1A7JA 3N2GA 4JAVC 5AW0A 1Q3TA 3W2IA 3BE6A 2HK7A 3WO1A 2A84A 4HV4A 3KVNA 2IU4A 3HCNA 1UZMA 4V24A 4KIJA 4U02A 2X0NA 3T3IA 4P7JA 5GQSA 1A8SA 2J3EA 3QE4A 4NABA 4HDSA 2GNAA 2UYOA 4IXNA 2FVXA 2AK2A 2NMVA 4RVNA 4C7BA 3WBJA 3KVRA 2RGRA 1SVUA 1NT2A 1LBEA 1SC3A 2QT9A 3F97A 1G60A 1NRXA 3FW1A 2WYUA 1LCIA 1F8YA 3QVUA 4IDFA 4M86A 1ZGAA 2NUPA 1NYRA 3AIIA 4B84A 4GM0A 1TF2A 2QAJA 1G21A 2W83A 3E48A 3MTEA 4G8BA 4TTSA 1MO4A 5LMNB 3EVNA 3GEHA 1X92A 2EYUA 1XEXA 2VJKA 4Y9UA 1Y82A 2NP6A 2CL6X 5EEHA 3O2SB 4M1KA 4PTLA 5DASA 1COWD 2XDQB 4HRAA 1ZGHA 2PR2A 3ORQA 3TAXA 4AN4A 4RTKA 2NO5A 1KR5A 3QEAZ 2TMYA 1PV4A 3E4CA 4NDZA 4AWBA 3D6UA 1SUPA 2CNKA 4DCNA 3OKFA 2VF7A 4XSHA 4BNNA 3QFTA 1JEQB 1K7SN 3BD8A 4IFIA 1NVVQ 3AUTA 3E22A 3KPJA 3LCRA 3U3RA 3WGJA 4ZVPA 3AY3A 4BLPA 1DQYA 1GZUA 1MVOA 1N2GA 1GRQA 2AQHA 2IYQA 2D8MA 2NO4A 1YO6A 2FQYA 3PYMA 3U4HA 4HQRA 1W93A 1T2CA 3NU1A 2HU8A 3SC3A 4EFKA 4KC0A 2ZQ5A 4HDNA 3V3KA 1A4XA 5CB4F 4JJ6A 1R1DA 3PYLA 1R0CA 2DFPA 3EF3A 3Q7QA 2Z30A 4HWRA 3L84A 4RM2A 4XQ9A 7GPBA 2WZQA 3TTVA 5HYVA 1U3FA 5JOQA 2CK3D 3W8RA 3PUYA 1UXKA 2HJSA 1ZUIA 4ARZA 1JECA 2C7RA 4EGSA 1HURA 2JCYA 1MNQA 3PCRB 4D0RA 3CO0S 4TKVA 1JNXX 2P0EA 4CR7A 1TK3A 3ACCA 3UEOA 3OCJA 1NR7A 1RD4A 2HMVA 1BC5A 3AI3A 2B2CA 4HFRA 1JYFA 3OPYB 4OXQA 3VDMA 4DG9A 4ZYLA 1JYEA 2VH5R 1Y1KE 2ZROA 3E18A 3N86A 3NEPX 4KZKA 4OGKA 4P7KA 2NU6B 5MN5A 1S2LA 4L73A 1DBVO 2XD9A 4MQLA 3TNJA 3CVJA 4ZODA 1Z2NX 3K6KA 4JR1A 4X1IA 4F5YA 3Q7IA 5AK3A 1JMVA 1TB4A 1LGYA 2R3SA 2JA1A 2B82A 2OK7A 3SXUA 3VR5D 5I6DA 5KQSA 1VHWA 2I2WA 3C1OA 1N0WA 1RACA 3NPAA 4UZSA 4E2ZA 3FHJA 5E7IA 2H0QA 3WRYA 3KYIB 3IODA 3P4YA 1VGQA 1B0UA 5IEJA 2HCRA 2CFIA 2RIPA 2ZSHA 4MQEA 4ZDWA 1Z7GA 4B6OA 4B45A 1M6NA 4OHOA 4M6WB 3TSOA 2OHFA 3NALA 2QNRA 3WLTA 3HRKA 3K8YA 5KNBA 1L5MA 3ETJA 2EKLA 3O8LA 4D6YA 1D6SA 5JH7B 1J99A 4RORA 2JJ2A 4RK6A 4RKFA 3BD9A 3M6XA 4GKVA 4QGAA 5B1IA 1RRCA 3PHJA 4URYR 1C2TA 1RZRD 3EXFB 1JQJC 3FSGD 2B8EA 3LVFO 1MQ9A 3MT0A 1FNCA 4IIDA 5LZ7A 4NEQA 4ALMA 4B83A 5K3DA 4F2PA 4ZV7A 2BGIA 4M99A 5GIOE 3ZHYA 1CWUA 3DWEX 4WH0A 1F3LA 5IHXA 1LQ2A 3FM9A 1NOJA 3B60A 3ILSA 3REFA 5I3CA 1WUIS 2P5YA 1IUPA 3PHIA 1U4NA 1T9GR 3UT6A 5BWLA 2PLWA 4XDGA 4HH1A 3KOWA 1MT0A 3K0BA 4LNAA 4IQGA 5DGTA 2Q9CA 4J2OA 5JFTA 2R2GA 4J1NA 1P3JA 4Y18A 4YP5A 1R6TA 4BL5A 2HQOA 4Q3DA 4BUCA 2CCGA 1IZYA 3BGDA 5AW2A 3WWCA 3MC1A 4OATA 5ADWA 1NDHA 5EERA 2BR4A 5JD4A 3L1UA 1AQYA 3ANNA 3UMJA 2VPYA 3T5TA 5BMOA 1RAIA 2LIPA 3K0AA 4N8SA 1EM8A 1E8DA 1QIGA 3IHTA 4UW9A 2VWGA 4WFQA 1XZAA 4LF4B 1ZC4A 1WW3A 3KX2A 2XAUA 1D6NA 3FPCA 2GJ4A 1UH5A 2F00A 3IOMA 4GUAA 4YPOA 3BERA 1I7NA 2A9JA 2BD0A 2FWJA 2WU3A 1E61A 4II7A 3H65A 3RK0A 1W4RA 2FQQA 1YI1A 2HLDA 4BGDA 3RKSA 4RVUA 2ZTLA 3OX3A 4PGMA 1TMYA 1SQ5A 3O73A 4TXLA 1ENOA 1NZDA 4G0XA 4U4AA 2G4VA 3LPAA 5CM8B 2XADA 2GBPA 3IT2A 1M2HA 3ESAA 5FI5A 5CLFA 1GPLA 4JJGA 1V7CA 2PT7A 2QN1A 3AWDA 3TE6A 2QUJA 3ZDRA 5K0SA 3EEFA 4EARA 2GDJA 3CW8X 4HGRA 1IB0A 3UWOA 3C8DA 1JR6A 2CVZA 3GMIA 2C31A 2X8WA 3FYTA 1XVLA 3H8SA 4TTIA 5SZJA 3W1VA 4A8PA 1NQWA 3FWYA 1EUCB 4DPMA 2O20A 3N70A 2C5FA 5B53A 4UHKA 4CF7A 3ZLVA 3NHBA 4HI0E 4NSNA 5HBRA 1NWCA 4NQRA 1TCCA 2HMYB 4QHTA 3ZJTA 2FZEA 1ILWA 3IKMB 4UEOA 3TSWA 4E5KA 4QKQA 3N2EA 3U7HB 4DUGD 1U99A 1E99A 1XXHA 3PP8A 1GKYA 2IYTA 1RKQA 4B8WA 1JQLB 4DMGA 3FOBA 2DXIA 1FFBA 1B4DA 1BKSB 1C9MA 2I7DA 2QF7A 4PC7A 2VJYA 4BUJA 1PN3A 4EB6B 1VKZA 1P2VA 3PNVA 3DXZA 4XPZA 3D5EA 3IQXA 5CM9C 1M2OA 2MSWA 3UB3A 2R6JA 3I3SR 3IUQA 4D2IA 3SDBA 2XXBA 3AINA 2VNAA 2JBAB 1Z0JA 3NHKA 5HKKD 1BQ3A 2RKWA 5C9ZA 2QYTA 1F12A 4MUGA 5DTQA 4Y2YA 3KP1A 3EQ7A 4NH0A 2Q3MA 3FNIA 3FFTA 2NIPA 5CDUA 4BNHA 1P2DA 3A4YA 5HCIA 4M9RA 2XYQA 3TLEA 3QLTA 1E77A 4P82A 4QAJA 3AKZA 4BU1A 1WZNA 1B6RA 4MRMA 5JAZA 2GN0A 1RRPA 3OQHA 2CV1A 1KYWA 1XMJA 2Z3ZA 4YHBA 2A1UA 3A9SA 4CMAA 1EA5A 3GJSA 3SMQA 1OI2A 1U8YA 3RJ9A 3CVVA 2JHCA 3KKZA 2IH4A 3FWPA 4YRJA 5CLIA 1RE0A 3D2CA 3VNRA 5KHOC 1JVNA 5CLLA 2WWTA 1TVMA 4RY2A 4B3JA 3FZEA 1HUQA 1X8LA 3DQQA 3KTDA 3N2NA 2H2AA 2C7VA 3BOSA 4Q9KA 3E58A 1GG5A 4PZAA 3FYDA 1DAGA 5JLJA 2RGGA 4D5EA 1ATZA 4TRMA 2ZS9A 3I12A 3IFSA 4BATA 2W6PA 4FYIA 2ZRGA 3I37X 2HNKA 3RT9A 5IH7A 4LWOA 3VPXA 4LC9A 1VIVA 2Q6TA 4U3JA 2XOKD 3JQFC 2QJOA 3AP2A 4DDVA 1E20A 3G3EA 1GZ5A 4ZCLA 1XWFA 1KZ1A 1KAHA 1NP6A 1PGJA 1YJ8A 3H5OA 3PLRA 4M0CA 4F97A 3BIFA 2B7CA 1DUIA 3F9RA 4LHEA 1GNVA 3K1AA 3RJ5A 3B1ZA 4N0EA 3O1IC 1X9HA 3EPRA 4DMUB 4FSHA 4RK5A 2OBLA 3VM6A 1SRQA 1WP4A 1BX1A 2VYFA 2XYRA 4R5MA 5C46F 3UO8B 3OAAA 1AGRA 1ZL2A 1SHLA 3BHJA 4FUQA 4TV8A 4PHCA 3OEYA 1HY3A 1RQGA 2Q2OA 3CX7A 4L3OA 5CT9A 1GGMA 3H05A 1N6PA 2ZSAA 3K0FB 5FCDA 5ILOA 3ZI7A 3H6HA 2A6PA 3JQQA 2BCGY 2J0UB 3R7AA 1E7RA 1E9FA 1T9GS 4XOUA 1YHNA 4N39A 1BE8A 4KEAA 1WZCA 4GS5A 2B3DA 4QOHA 4RYLA 1GAQA 2IQIA 1OB2A 2EDCA 2P67A 3BXHA 2A7QA 2BEVA 1DEHA 1L7MA 2ETVA 4MW4A 1UKCA 2C94A 1T8YA 3GGPA 4IDOA 3T52A 4DCUA 2ZJFA 3ICPA 1N1EA 3ESCA 3FAZA 3W4KA 4E1BA 1ATIA 3GAFA 4R16A 1SPBS 4HL6A 2E6KA 1JPUA 4ZVOA 3X43A 4TN5A 4P6VF 1YZVA 1H2XA 4RFLA 2WD7A 2R7LA 5IDYA 5JHGB 1SCQA 1YR2A 2QXYA 3RTBA 5IC4A 5CD1A 3K0EA 3RNLA 1Y9JA 1NDUA 3WJ2A 4GLLA 1XLVA 3ZH9B 4ZDJA 1P8AA 2IE8A 2O5RA 5E4FA 5A5VA 3B5JA 2WJIA 2ZB4A 3K70B 1I80A 4OGWA 3MBOA 3WYGA 2C59A 4HYQA 5K0BA 2N3ZA 4QASA 3HB7A 3LC7O 4RKYA 3RROA 3W2TA 5CD9A 1KY3A 1PI3A 2HV9A 5DULA 2ZJBA 2C5LA 1QH1B 4JFRA 3F4BA 5TGZA 1JALA 4AY3A 3V2GA 4N40A 4QDUA 3IHKA 5CLGA 4BS9A 1C4KA 5ITZB 3NEJA 1MJNA 1YRAA 1UOQA 1NF3A 1HFEL 3SWWA 4FZVA 4UJ5A 3QELB 4CCAA 4AICA 4BXOA 4HTAA 4KAXA 5PNTA 3S4YA 4LJKA 2V0NA 1EX1A 3KEOA 1FXWA 4WNAA 3D8BA 4BJ1A 4H7JA 1TEHA 2MU1A 3LDFA 3SHTA 1UFOA 3WB2A 4PSUA 4AKGA 4BEBA 4J76A 3P0IA 3TF5A 3QVGA 5IJ9A 4JDUA 1RTKA 2XKAA 4UVGA 1ZMBA 2XE4A 4ZRNA 1JSZA 5A6SA 1H0HA 3SYTA 2QIPA 3ZCTA 1R6BX 2H4JA 2J9RA 3HVRA 3I4FA 2VUUA 5THQA 1U4SA 2YMMA 2I8AA 3DFMA 4P35A 3VISA 1I0IA 3AW8A 4LV6A 2R84A 1I1HA 1RTTA 2A9PA 1SBIA 2O6LA 4BE9A 3MTGA 4EJMA 1Q0UA 4RIEA 1JEOA 5DLDA 1C0KA 5ALHA 3PJRA 4H2DA 2OEPA 2X5NA 4JELA 3COJA 4EYKA 3V8RA 1ENZA 3BAZA 2EJWA 3TWOA 1FP1D 5DNCA 3D64A 4YCLA 3Q8LA 2O0HA 2AFHA 4GOND 1M6VB 1XV5A 3FOAA 4GZMA 4HH4A 4D6XA 3OEED 4PN3A 5JNRA 1MG5A 4A0SA 3A3PA 3F8WA 4F7WA 3F6CA 1HDOA 1BS1A 2E5WA 3C74A 5HF5A 3WGOA 3LT0A 4OQPA 4QG7A 1OLXB 2WUVA 3HPQA 2N42A 4QU0A 3U13A 4RTPA 1W44A 2XUZA 1WMDA 2ZUVA 3GUZA 2YC2C 1SCBA 2HJVA 4FSXA 1DKRA 1WDLA 3FVRA 3CNEA 4KXNA 1F2UA 5FLYA 1JHVA 1SU4A 1PJZA 3R0VA 4Q4HA 4WBSA 5KSWB 1U0LA 1VE5A 2O8EB 4U7GA 1MRNA 1TK9A 2Q5JA 5ALGA 1BS9A 1USIA 1AS3A 1DZIA 3FBGA 3FTPA 4AURA 3BFXA 4M89A 2YHBA 3M6UA 4UTOA 4KRYA 1V35A 4CM4B 5CAEA 1GOTA 4GX2A 4YUWA 2ZJAA 4HLCA 5KTPA 2C8LA 2HIGA 2ONCA 1EA7A 3JZDA 1NATA 1ZAYA 4FE3A 4IV8A 2GF9A 4WT7A 4X84A 2BY4A 3KC2A 5G1OA 4FC6A 2PA0A 3LXXA 4DA8A 2BFWA 3S29A 1AC5A 1D2GA 3LHKA 1AMUA 2B37A 1L1RA 3MCWA 5LJIA 5HK8A 3QUSA 1IC6A 1SEPA 3CLVA 2O0MA 2YFKA 3EFOA 2X3UA 3PPYA 4MB6A 1T26A 4TQUS 2CNDA 5CA1A 4O25A 3BHMA 3HCDA 3LC2O 3ZD6A 1Y0BA 4GGPA 4ZOEA 4DW8A 1PFYA 3PXXA 1XGKA 4HJXA 4DV7B 1JIIA 3UICA 1QX4A 4PLZA 1MMFB 2ZTHA 3KQTA 2LKCA 2DHRA 1C30B 3R0XA 3KQUA 5I45A 3QWHA 1MFZA 1PGPA 1L9KA 2COUA 2FKNA 2FEAA 2AZXA 3B36A 4M2LA 4E09A 1SOVA 3L7OA 3WHIA 2R4QA 3QLUC 2FSVA 3PVCA 4YRQA 4QREA 3STHA 3T3HA 1CDOA 1B14A 1D7AA 4GPEA 4MVCA 3E0XA 3O2NA 4K6MA 3OZTA 1V45E 4IR7A 2QWXA 5JY1A 4NNOA 3IXLA 1IOLA 2X7JA 3GRYA 4GC9A 5LCXA 4ESVA 5IM4F 1RW4A 1VE6A 1DRUA 3IP7A 4HGYA 1H3EA 4AAYA 3VH1A 4KK4A 3IIEA 1SB8A 2GCIA 2VSNA 4NE7A 2V55B 2BKEA 2OCYC 3RWMB 5JRZA 5FTMA 4PNPA 4U0JA 1FXWF 4PNZA 3SJ7A 1WEKA 2Q5QA 2IV2X 3UXMA 3D0KA 1QAMA 5JAUA 2IPNA 4RQUA 3SJAA 5I9IA 1EFDN 4Q03A 5H82A 5BW6B 2FP4B 5CVUA 3M1YA 3TQIA 4CDRA 5JXJA 4IVRA 1M7BA 1XZ8A 1QXSA 1T0HB 4B8YA 4YAIA 4QE3A 2PK3A 4DLPA 1GPJA 4EL0A 3TKAA 1XD9A 3UBMA 4YCDA 4DJJA 1UM9A 3VHXA 2PGDA 4OI2A 4JP5A 1TM7E 1JLMA 4OD0A 2O3SA 4QJIA 3TZCA 3W8NA 4X1IB 2ZB8A 3LD9A 1KDRA 5EWLA 1ECLA 4QDXA 3G88A 3EMBA 1ECJA 2V8OA 3I2FA 3T99A 2IOHA 4FDTA 1QHEA 2AG8A 1ZNWA 3RQIA 4ZGWA 1R2QA 3UPUA 3E84A 1Z2CA 1JFTA 1QYDA 3HB4X 3A3OA 4CNBA 3OLYA 5LP1A 3CZAA 3TD6A 4IS2A 1K9SA 1Z5UA 3F6YA 4OGFA 2X6TA 4R3WA 4K9LA 4OYYA 4U2FA 5JSKA 3T0IA 2X0JA 1PF7E 5ESDA 3CM0A 4TXMA 3DG9A 1YBHA 4GM1A 5JZOA 1Y6JA 1EP3B 1SM4A 3IIMA 4D0GA 1UPFA 2FZ5A 2PD4A 2ZG6A 2INGX 3BAFA 3IURA 3N39C 3LTNC 3BA6A 5SZIA 5DXJA 2VPPA 1ZGJA 1E18A 1EE9A 3MT8A 2HD4A 3IP8A 3WHKA 4QYMA 2XA9A 4ENRA 3KEGA 3GJ5A 1Q12A 2FN8A 4YCBA 2ZU6A 4CN8A 1XAHA 3FPAA 4OJTA 4V0SA 5ULLA 2YMPA 4FCTA 5A7FA 4FW8A 5DKFA 5M34A 4CPDA 3AIMA 1O95D 3IQZA 2OO5C 2DE0X 1E9SA 1OVGA 5CYFA 1VYHA 4ZDKA 1H2AS 1H6AA 3LDGA 4MUIA 3VC7A 2WIJA 1V8ZA 2WPDD 2G40A 3DL4A 1QGUB 2G9UA 1KI2A 3BF7A 4EUFA 5DHFA 4URVR 4K46A 1CJCA 3ND7A 3EWNA 4JBYA 2X8BA 3LOUA 1P73A 1UODA 4YJ2B 1ARZA 3SXUB 3ACDA 2ODTX 4KQWA 5L3RA 2PZAA 4KAJA 3B89A 4ZQBA 2WJ4A 3VU1A 1ORWA 1N5JA 1TO1E 2RK4A 2XUDA 2ZYRA 4K9PA 4C7OB 2P4HX 3D6FA 1T0JB 2YWXA 1HLFA 2WIBA 5FOUA 2Z8XA 3QSYA 3USCS 3T9CA 2X2EA 1MH1A 2VRWA 1E9EA 1K8XB 3F96A 1XHFA 4YRIA 5J4KA 4CM1A 3V8EA 4WXPA 4KUEA 2GS9A 1COZA 1SXIA 5C8YB 1PJ8A 1ULUA 5ILGA 4XI9A 3HA5A 3LCCA 5C31A 4RPJA 1TO6A 1B23P 3VI3B 4EEZA 4ZO7A 3K92A 4ZIRA 4LV5B 2WKQA 5J5VA 3WQHA 3AONB 1W581 4UVEA 2FUG1 4ND4A 3ZQJA 4ZI5A 4G1MB 2P3LA 3N3AC 3O7WA 5FHRA 4ZYXA 1YJAA 3FR7A 1A88A 2NZ2A 5EG5A 3Q3JB 3B1WA 5CUQA 2QTGA 1CFJA 4R8RA 1NZJA 1H2FA 4PW0A 4ZYUA 2WWVD 4BJ3A 2HHAA 1IHUA 1YI0A 2BM8A 2NO1A 2PWYA 2YDXA 4H18A 3TEMA 1KIAA 3AHCA 4PTZA 2I4MA 4IZ6A 5DTIA 4AXBA 5GADl 2XA1A 2WUFA 4QBIA 4GU5A 5FV7A 2NSHA 2BSQA 3LPCA 2P1ZA 4FS8A 5AW3A 3DXYA 4G23A 1U0OC 1KI7A 3ZE0B 4AZ0B 5I4CA 1G3UA 1DRWA 2BFMA 4NG4A 4P92A 3BWMA 2IOQA 4IHJB 4QARA 1NKSA 2YOFA 2X8JB 2Z8YM 4B43A 3VR5A 3C7TA 4EA8A 4QECA 4DF3A 2JIBA 2CSXA 4PANA 1Q7TA 2KE5A 3JZMA 3NHUA 4RLSA 1SD2A 3FA2A 1E89A 2Q2VA 1GA1A 3OTHA 4QOSA 2O1WA 4EW2A 5JWOA 3QVTA 4ZQHA 3VYWA 1Z75A 4FGWA 3ZHVA 1KJJA 4N82A 5JWHA 4YC7A 3H1GA 2GAFA 4X85A 2EBUA 3I09A 1NVTA 3K9FC 3MIIA 1EAMA 1LK5A 2JJ2D 1QANA 3E5RA 3WTBA 1IOVA 1A8IA 1IN5A 3LZ6A 1W94A 3LS2A 4YRFA 1RLMA 5BWCA 1W35A 1C3LA 2YIDA 2DFNA 4RSHA 5DMXA 3HFGA 2ZIZA 5JYDA 1GGNA 2Z09A 5EPUA 4GKBA 2B7BA 2HW8A 1Y8RA 1E59A 1KC1A 3H19A 3KT3A 4RNCA 5FL7A 1G8GA 2ZR0A 3L49A 4HAUA 3Q0TA 5L3VA 4XWOA 1RP1A 2FDXA 1FLDA 3AZQA 3ORSA 4G0OA 4IQ0A 4CR6A 2IXFA 4LSMA 1MC8A 4NOJA 2Z56A 2VBCA 5DE3A 2CVHA 5TIIA 3VZRA 4CM4A 1J24A 2E2WA 4OFZA 4TX1A 5K3CA 1Z4JA 2WZCA 3BKXA 3DULA 4O59O 1GTL1 3HR7A 1U94A 5TF4A 1NOIA 1QQ7A 1BE6A 3GJ6A 4LK3A 1DQPA 4IDPA 1UBKS 1V1MB 2ZIXA 3MRXA 1DLJA 1XVIA 2DPHA 2XDWA 2G4LA 2QLTA 1TGVA 4XVCA 1XLWA 1BXGB 5JQWA