1O3YA

Crystal structure of mouse arf1 (delta17-q71l), gtp form
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
166
Chain Sequence
GSMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGLDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of membrane recruitment of GGA by ARF in lysosomal protein transport
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords ADP-ribosylation factor 1
total genus 55
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1o3yA00
4K8OA 1G8YA 5JRJA 4BASA 5CM8B 1NLYA 1JBKA 2HXYA 3L0OA 5EP4A 1M74A 3SQWA 4YXWD 2H7VA 4B35A 4P4SA 2J0UA 1GKYA 4D25A 1I2MA 4ZIRB 3L2OB 3RLFA 1IN8A 2G88A 3QF7A 2ZROA 1LS6A 4DSNA 4HAZA 2G1KA 4ZIRA 5FFMA 1KOFA 1I4LD 2WKRA 4Q48A 5TVKA 5EE5B 4ZCLA 4IXMA 5EP2A 2ZREA 1F2TA 4M53A 4ZDIA 3SBDA 4OHWA 2EWVA 3B1WA 2GDJA 1PJRA 1NY6A 2Q21A 2XAUA 1KI6A 2ZRPA 1P5ZB 4BLTA 4KXFB 4C0HA 1E99A 1HT2E 1QHXA 3QF4B 1L4UA 4MGZR 5EP1A 3T35A 3K0CA 2IYWA 2QNRA 4U5XA 5JJLA 3THYA 4FD2A 2XTZA 1DE0A 3A36A 2IBMA 4D4LA 2ERYA 2R6GA 4UNPA 4AG6A 1Q3HA 4JSYA 3EZ2A 4MH0R 4MRRA 4QJ4A 1GL6A 4Q7KA 1P61B 2ODBA 2O0KA 1XTJA 2ZI4A 3PR1A 1MV5A 121PA 2F1JA 4JLAA 4RD3A 4LJ6A 3VNVA 1S96A 3UMRA 4DLYA 1KHTA 1N3BA 4NYMQ 2OE2A 2AFIE 4OHZA 2FPMA 3UK6A 1ESMA 3IKJA 4IOLA 2LKCA 3CW2A 1L4YA 1XJQA 3QJYA 2BVNA 4IRUB 4N0DA 2AD1A 2DCUA 4F7WA 3GJ8A 1Z47A 1ZP6A 3SYKA 4DCUA 1BIFA 2VHTA 5L3QA 2FN4A 3E1SA 1N6IA 2RCNA 4QG7A 2CDNA 1ZIPA 4D81A 1KYIA 3FWYA 1ZCAA 2UVQA 3GMTA 3P26A 1P75A 2CVHA 1ETUA 2ZYUX 1IY2A 5FPTA 1N25A 2VRWA 1FFHA 4JVMA 4R2HA 1CR1A 3BRWD 3V9PA 2CE7A 2IX3A 1DTSA 3R9XA 4V02A 3EIEA 1TQDA 1NNEA 1Z6AA 5DHFA 1UADA 5JS7A 1AIPA 2Q3FA 3LFUA 4M1WA 1NBMA 2WICA 1ZAKA 4DLXA 1HV8A 2AK2A 1FNNA 2JJ2A 1XZPA 1NMXA 2WBLC 1GG2A 1MRNA 1UM8A 3FFAA 4Q66C 2BWJA 2V6IA 4RD0A 1KK2A 2X19A 1M7BA 3G82C 4W5HA 3VR4A 1U8AA 2IEYA 3A1TA 3QE0A 5KNDA 4BWYA 3FVQA 4FMCB 1B0UA 1W0KD 2WWIA 1E32A 2ZJOA 3HYRA 5EUMA 3IPXA 3UIEA 2H8KA 3VU9A 3PUWA 1N6OA 1V43A 3X1WA 2HV8A 2ZS9A 5LBIA 3LWNA 4MITA 1P6XA 4NYIR 4E09A 2QRNA 3ICQB 1OYYA 1FL9A 3QQ5A 4G5RA 2F1RA 4AKGA 1VCIA 4UNSA 2FMXA 1KSGA 4IFBA 3ZH9B 3LNCA 4BQSA 1ZRHA 5AJYA 3K0EA 2GF9A 4EPWA 5G41A 4XVUA 1EG7A 5A0FA 1US8B 4GSYA 3SR0A 2R62A 1S9DA 2RGNC 4G5SA 1EFTA 2BMJA 2X2EA 1NIJA 1CULC 1KMHA 3I8XA 2GCPA 4JYBA 4B2PA 1JJVA 1Z6XA 3EPKA 1M34E 2IYSA 2D74A 4RCZA 5BQ5A 1OIVA 2OFOA 2VHCA 4Q1AA 2C99A 2IWHA 2P6RA 4A9AA 4CDGA 2ZSBA 2PCJA 1E1QD 4OHYA 2O0JA 2BV3A 1QHGA 1XEXB 4JLNA 2X8AA 1JAHA 4PC2A 3VU9B 1M1YE 4TLCA 3WNCA 3ZDQA 3K0AB 2JLXA 3KL4A 4TZ6A 3WHKA 4AYXA 4A1FA 1YU9A 2PCLA 3GEHA 4Q18A 2VQSA 2RHMA 5JWHA 3C15C 4A8JC 4YQFA 4M1MA 3F3YA 1E9SA 1QVAA 3SJZA 4ZKDA 5BW8A 3KXKA 2YWEA 1U90A 2QG6A 5IDVA 2VHJA 1LY1A 4XH9B 2WPDA 3HU3A 2RB4A 4PQYA 5EQTA 1OLOA 4B74A 4JVLA 4DXAA 1U0HC 1EXMA 2PH1A 3DEFA 5FTJA 4BFUA 5IK2A 1W7AA 3DO6A 2HEIA 2V54A 3QEOA 4EJSB 2IYUA 5DSZA 4EPYA 1TU3A 3MWYW 1JI0A 3QXSA 5G3ZA 3WBKA 5C46F 5C2JB 4Q00A 3BK7A 4Z1MA 2J0SA 4IOMA 4RFSB 8OHMA 4QJ5A 1II8A 2VP4A 4GNKA 2J41A 1GNPA 3ONWA 3GJ0A 3LX5A 3PQCA 4LJ4A 2EFGA 3EC1A 3SN6A 3W3ZB 1A2BA 4C4PA 2WVJA 4KVGA 4L9WA 4BFTA 1KK0A 2FFQA 4M1KA 3PCRB 1XD8A 2O0HA 2ZRLA 3VX3A 1XXHB 3K70C 4IFEA 1ZJ6A 1HQCA 4UXJA 2EFCB 1JQJC 4TZ0A 1R6BX 1E9DA 2JLVA 2CMKA 4UNNA 2HT6A 3Q3JB 1G17A 4DC9A 3AVWA 5D3MA 2GJSA 2CXXA 1C1YA 3I92A 4TMXA 4KVAA 3FMPB 5FTMA 1T4GA 4D6PA 1PUJA 2WPDD 3UXMA 1TNDA 2VA8A 2BMEA 4HATA 1KI3A 5F9HA 4BFYA 5FPSA 4F4JA 4HDCA 1UBEA 1VYVA 3FKSD 4A2PA 1W5SA 3ND9A 1G20E 4PTLA 3AGPA 1BH2A 2CBZA 2HLDD 1NN1A 2P5SA 4WXPA 1PLJA 1TQ2A 5K8IA 5G3YA 1FQJA 4YMUA 1GIAA 2R2AA 4US1R 3K0CC 1MT0A 2WIBA 2QGZA 1IN4A 3VX4A 3QENA 1E3MA 1P9WA 4TMKA 1UAAA 3IUYA 3LVRE 4PAMA 5DNYB 4JKIA 3UWOA 4C0KA 4MRPA 3AVYA 2GILA 1YR8A 3TSWA 3WMFA 5TMPA 3LW8A 1N0VC 1NVUQ 2AK3A 3WNBA 2R8RA 2CCJA 4DBLC 2BBTA 4B6FA 3F8TA 5BN5A 4LJYA 2QP4A 3LLUA 3WP0A 3FHCB 1YHNA 2LKDA 2ZRBA 2GCOA 2Q0HA 4UJ5A 4XVQA 2FA9A 3QXXA 4NDZA 3KJIA 3KQUA 4WVFA 1NMYA 1KO8A 3LO5A 1NY5A 4HLQB 4QM7A 2HXSA 1KI4A 1SXJA 5M04A 1CR2A 1A2KC 1J70A 2UZIR 4L4UA 4GDFA 1XEFA 3GEEA 2JLQA 1IN5A 1ZCBA 1G7RA 3RRZA 4Q4AA 4NCNA 2IHBA 4QBIA 4OJQA 4ZDKA 2CK3A 2GVDC 2GRJA 3WYGA 2JJ2D 2FSFA 2ATXA 2QORA 4XWOA 1GNRA 2WSSA 3GLGA 5HE8A 2LWIA 1N5LA 2VIIA 3C7KA 3FGNA 1W4BA 2JLWA 3BH6A 5H68A 4PO1A 1IXZA 3C5HA 3B1XA 2FDCA 2VLIA 3NBXX 4TQUS 1AKYA 5EXXA 2PL3A 1T6NA 4TL6A 2BKEA 2CHVA 1HH4A 4HI0E 3VMFA 2NMVA 2QMUA 3ASYA 1HEIA 3KJEA 1FP7A 3THOA 3RWMB 1E0KA 4GL2A 1P2UA 1UDWA 4IVQA 4Q5IA 2XEXA 1SHKA 3U7FB 2D62A 4IOKA 2WMNB 4MRNA 4PPFA 1RKBA 5TV2A 1IY0A 3OEEA 5AJXA 3ZZTA 4MKHA 2IYQA 4F4IA 1ZUIA 4GMDA 4ZI2A 2OCBA 1VYUA 1DEKA 1UKZA 4IDQA 2JLRA 4NZYA 2JJ1A 2ZS7A 4DUGA 3VHXA 3B1VA 1OW3B 3CX6A 3WYAA 3X2SA 3A4LA 2WWFA 3I5XA 3VKGA 1C4OA 4KV9A 4CZ2A 2WJVA 2HDNB 4OBEA 3OAAD 1N5JA 2AX4A 1J99A 4JBWA 2GHIA 4V0KA 5D3QA 1OH5A 4NONA 1PLKA 4G5GA 5E95A 4B3GA 3HPQA 2FPKA 4H9GA 1KSFX 1NN5A 1VECA 1HURA 5HCIA 3ZS9A 2FSIA 2GZDA 5FPKA 4DLSA 4HAVA 3GLGE 4V0OA 2RGNA 1RPZA 4B71A 2QE7A 4EKDA 1ZUNB 5IK2D 2IXGA 2OEPA 3GJ4A 3P27A 1T0HB 3UG6A 3M6AA 3AP2A 4LSGA 4DCNA 3BB1A 2EW1A 4RSGA 1WE2A 1NBME 4LYJA 1GTVA 1V5WA 2J46A 4ERNA 4CYMA 2WJHA 2V6JA 4PR0A 3ETLA 1S0UA 4RVCA 4P4UA 3ZGXA 2JIZD 5H8WA 1LNZA 1T0JB 2REXB 2YOFA 4OHVA 2GJ9A 2ZJ2A 1JXMA 1UF9A 1NG9A 1T3LA 4MGKR 4PC3A 1WCV1 3AF0A 2XGJA 2HUPA 2A78A 1U0LA 1MO6A 821PA 3CPHA 2FZ4A 2QMEA 1DAKA 2MSDB 2O52A 4ASUA 4B34A 2ZXUA 4LRWA 4QNRA 1QDEA 2DWPA 3SJBA 1SVMA 2XZPA 3P1JA 4EQ6A 5DH9A 5KNCA 3T1OA 1NI3A 1ZNZA 3AUYA 1QHYA 3GLIA 1G5TA 1W44A 1ZUHA 3ZZUA 1ODFA 3FTQA 4W5WA 3AVTA 2GXSA 4EDHA 4OHXA 4A0GA 4UKDA 5FUVA 3C5CA 5KUTA 2AHOA 5KSZA 1IONA 5CDFA 1P9NA 2JDIA 1SVOA 1XD2B 3WRYC 2O8EA 2N42A 4DVGA 1TF2A 2ORIA 4E03A 3TIFA 1U9IC 2JEOA 1X8JA 1HE8B 1HT1E 2J87A 4IDHA 4MGIR 3MCAA 1G5RA 3FE2A 3EWSA 3ZIAA 3NBYC 2P3SA 3CONA 3PUYA 1KSJA 4OQMA 1JR3A 1COWA 3NBZC 3EIHA 4US0R 2OUKA 5JHHB 1A4RA 3RC3A 4NYIQ 2XXAA 1G19A 2VH5R 1EGAA 2P0EA 5SZIA 5DE3A 5EUQB 1G291 4PC1A 3MWKA 2BKUA 2P6UA 2ZETA 1X1RA 3KUCA 2V3CC 2FEOA 3D31A 1KAGA 4BPBA 2XJ4A 2AFHE 2YZ2A 3WYFA 5EJEA 5DYGA 2NGRA 3W6OA 1Z0KA 3WMEA 2F3TA 3IPYA 2QA5A 1G3IA 2R6FA 4EPVA 3O8CA 1DPFA 1Z63A 4FN5A 2ZRGA 4P4TA 5EXPA 1K5DA 5TXGA 3R7WA 3U4QB 1EWRA 1E9AA 4ZPXA 4N0EA 2ZE7A 2CHQA 2IXEA 2KSQA 5L3RA 3KB2A 1XTQA 4MKIA 3AF1A 3C14C 5CLLA 2V7QD 1IBRA 5TY0A 4KITB 5ELXA 1X8LA 1S1CA 4I1VA 1D6JA 2OT3B 1JR3E 1PVOA 4GPTA 5AWFC 1VIAA 2LCFA 1KNXA 4M0LA 2CEAA 4A15A 1NF3A 2R6CA 3S1AA 1X1SA 4R9UC 3WXMA 4B3CA 2F6RA 2Z83A 5JLJA 2EQBA 3RANA 1E9BA 3EG5A 5JEEA 3BD9A 5JI3E 2YKGA 2ZJAA 4PC7A 1SXJC 3H4MA 4QBGB 1X3SA 1BMFA 1XJ0A 2ZRKA 4QHSA 4Q47A 2ANBA 2GEUA 2C5LA 2C98A 4BFZA 4DUGD 2DFKB 5KU1A 5F98A 1AQUA 3B9PA 2ZPTX 3CZPA 4QHTA 4TMTA 1DS6A 4H1UA 3SC3A 4DIDA 4BUJA 4TLDA 2QTFA 3GD7A 1X86B 1Q1EA 2X1VA 5JRZA 1E6CA 4Z8YA 4LC1A 3HR8A 1LFDB 2GAOA 2OXRA 3I73A 2ZM5A 2W2XA 2QT1A 4PC6A 2CLDX 2C03A 5G53C 1CIPA 4D4KA 2N1BA 4JSTA 2ZRAA 3MWJA 1SGWA 2IXFA 4ITRC 4Q7JB 4DCVA 1KKLA 4G1UC 4PXAA 3NKVA 3WHLA 4BLRA 4RD4A 2JJ1D 1NP6A 4Q21A 1XWIA 3WY9A 1T8TA 2QEQA 1KI7A 2IK8A 4B43A 1M6NA 2JLUA 1XDBA 3GLHE 1C9KA 5DHAA 3I3SR 1OHHA 3UKDA 1T91A 1N0UA 3PEYA 3RRMA 4IJMA 1YZGA 3DDCA 3LRPA 4RZUA 3SJCA 3K09A 5CITA 1KO1A 4A2QA 2J0QA 4MA4A 2GXQA 4JVNA 4BZXA 4LBWA 5FBVB 4DB2A 1OF1A 2AXNA 2FH5B 2ZRHA 1NSTA 4PHTA 4A6XA 2FJUA 3IO5A 1E79D 1XZQA 2WAYA 1RJ9A 4PAOA 2PT5A 3B8HA 1KJWA 4A8JB 1MO5A 3ZQ6A 4QL3A 2F1HA 4AKIA 3U7EB 2WSMA 4YDSA 3Q5EA 2ZR9A 1W47A 5DLQC 3TE6A 3NEYA 3AM1A 1G9XA 1X8KA 2FGJA 3FKQA 1P62B 1ZBDA 2JDID 1I4DD 4I1OA 2NPIA 4A36A 1XXHA 1E2DA 3NH6A 5KYKA 4BEBA 4DLUA 1IN6A 4JS0A 1F2UA 1UEJA 1OXUA 4URVR 1UEIA 1OHHD 3AF2A 3OF5A 4LHXA 3SNHA 4AKEA 2QAJA 2CLCX 5JECA 3CPEA 1E2KA 2BIFA 4FCWA 2RKOA 5J4VA 3NHAA 2DR3A 1COWD 2DB3A 3BWDD 1TQ4A 1EX7A 5UKDA 3ZQJA 1SULA 2A3RA 1VCMA 3AVUA 2VBCA 4KHZA 4PZZA 1NN0A 1QG4A 1CBUA 2NO6A 1CRPA 5FPYA 3O8BA 2AD5A 5KSPA 2G9NA 5CJ2A 2OBLA 1S3SA 4DDVA 3A6PC 3TJZA 3C8UA 4WZAE 4XTRA 4P32A 2ZRMA 1J8YF 2OESA 3QXHA 4M4SA 2OFXA 4RY2A 3DHWC 1LW7A 2AKYA 2WWXA 2O8CA 1Q20A 1F5NA 5KPJA 2HYDA 2WTUA 5J4HA 1U9IA 3SU8A 1R7RA 4WZ6A 1GITA 3CWQA 3W6PA 1CF4A 1YE8A 3PIRA 3X1ZA 4O3MA 2RH5A 2EVWX 3FDIA 4CEIA 1OFHA 2L0XA 4MUBA 4OQNA 1II8B 3CRRA 1DOAA 4DSUA 3HDTA 2PT7A 2VSXA 4U7DA 3BB3A 3OAAA 2A7QA 2FFAA 4URZR 1Z8FA 2IUTA 1KJZA 4HSEA 2QBYB 2O8DB 1TX4B 4MKGA 2QL6A 2H5EA 5FBLB 1QRAA 1YQTA 1RFLA 3AP1A 3ADDA 3KFXA 1US8A 2FFHA 2EU8A 2ANCA 3QKUA 5EE3A 4TSFA 1EWQA 2GBLA 4P0TA 1U0JA 1VG1A 4D82A 1II9A 1HYQA 2W0SA 2IEZA 2OO7A 2ZI7A 4IVRA 4LX0A 2GZAA 2QE7D 5JWRA 2QSZA 1NVVR 1UJ2A 1SKYB 4IVPA 3DM9B 4KLZA 4X8LA 5FBQB 5K8LA 3H1TA 1XEXA 4IOJA 4WA7A 1NLZA 4LJ7A 3D6TB 4L5BA 4A8JA 1OXTA 3GLHB 1LB1B 4XVRA 4EJSC 3WP1B 4DSTA 4TN1A 1ZC3A 1EFCA 5SZKB 1F2TB 2ZSFA 1ZD1A 2A5GA 2QBYA 1T3HA 4R98A 1KO4A 2VP0A 4AG5A 3REGA 3CIOA 1OSNA 1E2QA 1HE1C 2GBLC 1IJFA 3W3AA 4CVNA 5JJKA 3FYHA 1FZQA 5JSZA 1MABA 3RS0A 4C0LA 2C77A 5KPDA 1Y3AA 4DLRA 2C9OA 5K8TA 1FOEB 1XTIA 1EFUA 2WWYA 2ZTSA 3REFA 3T06B 5L3SB 4B2IA 4C30A 3THWB 2XB2A 2F7SA 4JJZA 2V55B 3K9NA 1GNQA 3IIKA 3T5DA 4QM6A 1OXXK 3H0KA 1OJLA 5EZ6B 4QGFA 4UXIA 2NTYC 4OI4A 1ZD8A 4FCTA 1NN3A 3HU1A 5TARA 2R65A 4L16A 3R8CA 3AQ4A 4AWXA 1MH1A 3MGCA 3NIBA 2Z4RA 4FWIB 3CO5A 1DAMA 4JZKA 3L0IB 1VMAA 5A4JA 1W0JA 1E79A 2FF7A 4RD1A 1MO4A 1G64A 1S1MA 4MYTA 3X1YA 4LC0A 2YNMA 1DARA 3QPWA 3TUZC 1SXJE 3KX2A 2VP5A 2FPLA 1U94A 2D7CA 2REOA 2YWHA 5AUNB 4P4SB 3HWSA 1OV4A 3FPAA 4LV8B 2AR7A 5GADl 1G1MA 1D2NA 3RS4A 2GEDA 5LD2B 1E69A 1MOZA 1NBMD 2X77A 3BFVA 2ZYWX 2NPFA 3H86A 3TRFA 4A0FA 1YZUA 3OIVA 3WMGA 3U5ZB 3KQHA 1YVDA 1KZ7B 4XIGS 3TQCA 2FOLA 4B3XA 2OM2A 4OI1A 3W9YA 1S8FA 1YZLA 2ZRNA 3K53A 4NYMR 5AK0A 4C0QC 4LYHA 3ZLJA 4I81A 3ZZ0A 3CR8A 1N5IA 3KKMA 5JCPA 4TT3D 1L8QA 2O8FA 4G5OA 1F3OA 2QTHA 2CJWA 1VKJA 1EFRD 1TEVA 3ADKA 4LHZA 4HLCA 4NKRA 1EFHA 1VDZA 4AC9A 4IHQA 2V1UA 5BN4A 2W6IA 2ZRFA 3MRSA 3ZS8A 3VR3A 5IHPA 2AL7A 5F3WB 3RC8A 3K0AA 2FX3A 1XMJA 2XNDA 1Z0FA 3NC1C 2FZLA 4K46A 1KDPA 1SVWA 2ZANA 3UWKA 5KNBA 4L8GA 4KBFA 1YRBA 3QVVA 1WRBA 1OFIA 3QSYA 4PANA 1YZKA 2OAP1 4PFSA 1OB5A 3K0FA 1ZIOA 5CM9C 4Q9JA 4DLZA 2BOVA 4W9MC 4HLDA 1CTQA 4Z54A 4P31A 2JA1A 2BM0A 4B32A 4GFDA 2WOJA 1NKSA 4TLEA 4DLTA 3I62A 1BOFA 2CJWB 1YZQA 2NO1A 1QHHB 4OYHA 3VR5A 3O8DA 3TK1A 3MFYA 3EX7C 4KCGA 4YMWA 2HF8A 4IXNA 3ZVNA 1JB1A 2ZI5A 3U7HB 5JBQA 3G5UA 3CH4B 4V0LA 1SXJD 3EW9A 1KNQA 1VCOA 1KMQA 1E2HA 1RYFA 4PX9A 1NSFA 4DHEA 1XPRA 4LHYA 1P73A 1K8RA 4G5QA 3NHBA 4HDQB 2XSZD 1VYTA 5FR2A 4TLAA 1IOZA 3L43A 3AUXA 3U3OA 4C7OB 2VF8A 3KDSE 4LDJA 1YRAA 4YDHB 2V8OA 1SZPA 3SJAA 3VAAA 4PPGA 5IT5A 1IY1A 3MUFA 3KFVA 3D7MA 3GQBA 3GLFB 1LF5A 4UJ3A 4JT2A 3PUZA 1N6RA 2VSOA 5H70A 2B6HA 3KKPA 2HT1A 2MSCB 3JZAA 3LXRA 721PA 3NG1A 2W6JA 3PVSA 2OLKA 1ZM9A 2H18A 4CGZA 3S1AB 4B73A 2OCAA 1JR3D 221PA 4Q4JB 3OHMA 1KY3A 5SZHB 3R9WA 4MUAA 4BFVA 2R6DA 1W2GA 4BGDA 4HAUA 3VR2A 2OBNA 2GKSA 4Q4HA 1RJ9B 1XFAA 5HTKA 1KIMA 1YJ5A 3GLGB 4B3FX 3RSLA 3D8BA 3TVTA 1Z6GA 2QUZA 4C9BA 4C0JA 3NWJA 5FUYA 1DBSA 1RIFA 4TMWA 4D0GA 1ELOA 1KTVA 1G7TA 2I4IA 3IHLA 1TAGA 5GVRA 4OI0A 1RRPA 1KDOA 2D7DA 4TL7A 4YMSA 2YINC 3AKEA 1DG1G 1Y63A 1AM4D 2A5JA 1NRJB 3CNOA 5BYKA 1QZXA 4CEHB 2YWFA 4EJSA 3LX8A 1E94E 1N6PA 2XITA 4ACBA 2ZI3A 2WJJA 2GCNA 1JR6A 2I1VB 2ONKA 4LZZA 1NLFA 4V03A 3SYNA 2IYXA 1Z06A 4ILEA 1FNMA 2XOKD 3BE4A 1WXQA 2RGBA 3NH9A 3IDQA 1OYWA 3VHLB 5JFGA 1PUIA 5DYIA 1Z22A 1I2DA 2BJWA 4D80A 4HB3A 1G21E 2CLSA 4M8NE 4F91B 2PZFA 5CK4A 5DI3A 1KO5A 5EE0A 3U3KA 2GF0A 2HLDA 2JLSA 2WKPA 3QBVA 1O87A 3MSXA 4L9SA 3GLFA 4FWTA 1K5GA 2AN9A 2IS1A 3EWAA 2OCPA 4CW7A 3CBQA 3U2QA 1G6OA 2WJYA 3RRNA 1OIWA 4I99A 1SKQA 5FL7D 2PZGA 1IXSB 2FFBA 2G3YA 5CYPA 2R9VA 1VCNA 4TT3A 1W36D 2W6ID 5KDOA 2UZ3A 4CEIB 5J4KA 4B76A 2WOOA 2EYQA 2K5UA 2W00A 2B21A 3RSOA 3Q9LA 1G8HA 1KI2A 1CJMA 5H1YA 1P3JA 2YJTD 3EARA 4NCIA 3CRVA 1BS1A 4NCJA 2IUSA 4MDEA 3EPHA 4DT1B 3DMNA 1T3SA 1CJKC 4HAYA 3BFXA 3IEVA 1JAIA 1J7KA 1N6HA 2ZVPX 4QBFA 5CYOA 3T1VA 1DAFA 3NC0C 4M22A 1Q22A 3FFBA 2NZ8A 4NYJR 5F9FA 1HUQA 621PA 3B13B 1IQPA 1DG3A 4CEHA 2GZHA 2ERXA 3TW8B 2WIAA 2PX0A 4URXR 2GJ8A 4YMVA 2ORWA 1ANKA 4B3BA 4BRWA 4ZO4A 3M0EA 1G8GA 1CS4C 1KDRA 3RS3A 4E5UA 3PXGA 1JECA 5HPYB 4V0NA 1GL7A 2J1LA 2IWRA 2JLZA 1NJFA 1WB9A 1KKMA 1TUEA 5B57C 1U2RA 1E2PA 3K9LA 1BO6A 2GAAA 3CLVA 3B1YA 4GP7A 4CEJB 1Z2CA 3V00A 1XX6A 5DN6A 1XEWX 2REBA 4GZLA 1Z07A 4JLDA 1W46A 1E9RA 3I61A 1XEWY 1XXHE 3OEHA 2ZEJA 1E2MA 3QXCA 1CXZA 3NBFA 1G3UA 3AVQA 2P65A 2WAXA 3LQQA 2O8DA 2X2FA 1N2CE 4D0LB 1MRSA 4KFSA 4DRZA 3SFZA 4GOXA 4IW3B 1JALA 3IIMA 2G0NA 5D3MB 3B5JA 4MGYR 3RS7A 2ZYTX 3SYLA 1E9FA 3H2YA 1VHTA 3EIQA 3TAHA 4HYYA 1BMFD 4MQBA 2DBYA 3SFVA 3WBJA 2ZJBA 3ZVRA 4UNRA 3MLEA 4HDOB 4TQ9A 2QQEA 1W48A 4A2WA 4CEJA 5AUPB 3K70D 3N70A 3I32A 4U02A 3DPUA 3EAQA 2VP6A 3T34A 2QI9C 1FX0B 2P6NA 2J9RA 2OAQ1 1EFRA 2ATVA 2Q9CA 3CRQA 3OE7D 3QOFA 4G01B 1TTTA 1ZU4A 2ZJYA 4TL8A 3L82B 3QUSA 4Q1EA 2JAQA 4WXRA 4D4MA 1TF5A 3FMFA 5LB2A 3VR1A 3GJ6A 2FGKA 3QG1A 2R6AA 3O47A 4RKEA 3AVVA 1GP2A 4PHHA 4PSVA 4NP6A 2QRZA 3K0SA 4FIDA 1IM2A 4N3NA 5LD2C 1PV4A 2IYYA 3N2EA 4QBHA 5C4MA 4POAA 4L15A 1A1VA 2YWGA 1E96A 5JS8A 3OEED 4IEIA 4ZCIA 1ZINA 3QIAA 5IF9A 4QXAA 2GWHA 2ZUDA 1RYHA 2WWWA 4A0HA 1YZTA 1F48A 1QBKC 1J2JA 2CL0X 6Q21A 1XPOA 5JMTA 3E2IA 3K70B 5FL7A 5FOWA 4CT4B 3NDPA 1CU1A 1R10A 4II7A 5E3HA 5JCZA 1ZM4A 4Q7MB 3C41J 2O5VA 1AJEA 4Q4AB 2OXCA 1E4YA 5FBRB 2Q3MA 4LBVA 1OKKA 1TMKA 5JI2E 3EPJA 2TMKA 2ODEA 3B6EA 4N1AA 1TU4A 4KODA 5FL3A 4JJKA 4AK9A 4B33A 2YVUA 1RRFA 4DIEA 3QI2A 4BFWA 3FHTA 3TLXA 1G8PA 4RFSA 2Y8EA 5HKKD 2ZUBA 3MJHA 4HZIA 5CLQA 3T15A 3BGWA 2HJVA 3QNUA 3CB4A 2W58A 5BYJA 2FNAA 4AI6A 2NQ2C 1YR9A 2RAPA 1CJTC 1XMIA 4G0NA 1FUKA 4NMMA 2NZJA 2G0TA 2EYUA 2DY1A 3HR7A 2QZ4A 2Q9AA 2F55A 4MYUA 5FBWB 4NCHA 5HZHA 4OI2A 1CRQA 3AV0B 4XSHA 4YONB 3ZVMA 1ZD9A 4A6PA 4XSGA 3ZD7A 5HCNA 1DAGA 3OFND 1FTNA 2E87A 2OZEA 1UBFA 1G7SA 1I4TD 2IW3A 2ZI6A 3I8SA 4FMCF 5JJIA 4BLPA 2IS6A 2BEKA 2ZUCA 5HR5A 4ASUD 2DWOA 2ODWA 1TL7C 5DI9A 5SZJA 3IIJA 3JZMA 3L8ZA 2Q9BA 2CE2X 3M1IA 4WAUA 4M9ZA 3P4YA 3NDBB 4PPNA 2XZOA 1E9EA 3L0SA 1XD2A 5C4GB 1XTRA 1XMSA 1XNJA 3KXLA 4PQFA 4BZQA 1N0WA 2QM8A 4AIIA 2F9MA 3VFDA 4HB0A 2QN6A 3T61A 1EX6A 4BFSA 1SQ5A 2OLJA 2J59A 2QAGA 2B92A 3X1DA 3PEVA 3OEHD 2DWQA 4LBZA 2A5YB 1ZYUA 3BJIC 3DOFA 4FMBB 2IA5A 2ZRCA 4C3ZA 3QBTA 2PMDA 1FW6A 2O8CB 2IS4A 1E98A 1XPUA 2BBWA 1IAQA 2QY9A 2FSHA 1XCGB 1II0A 2Z4SA 4RZXA 4MKFA 3W8NA 3W90A 4DZZA 2A5FA 4BFXA 3PUVA 2CNWA 3A1UA 4HB4A 1S9HA 1A5TA 4AY2A 1Z83A 1W4CA 4JT4A 2BHRA 4K81B 2QAGC 2BDTA 3BC1A 5JSZB 1P72A 1GSIA 3AGQA 4P3YA 3KKNA 1Z0AA 3PV0A 2IUUA 4HLUA 2FWRA 1KK3A 2YOGA 2C8VA 4GOKA 1XCPA 4G3XA 4HEJA 4DEXA 2J7PD 1GWNA 4JBYA 2A5DA 3QXJA 1ZMXA 4PZYA 2ZJ8A 4ACAA 3CWZA 4U00A 3QPUA 4Q4HB 1Z0JA 5J5CA 2XXAB 2WMOB 2HCBA 4LJAA 3K09C 4B2LA 3LA6A 2C78A 1CLUA 3GJ5A 3IILA 2O8FB 4ZCMA 1IN7A 2J5XA 5TB5A 3I5YA 2F43B 1Q3TA 4GZMA 4IDPA 4YLGA 5DIFA 3GLFE 4DB4A 1KI9A 1SVSA 3A1VA 1JNYA 1OPXA 4QGHA 4HUTA 5LDDC 1JPNA 3LDAA 1ZVQA 3HYTA 4I1SA 1LTQA 3PENA 3DOEA 4KSBA 3U7GA 1GUAA 2J45A 4ZI3A 1W36C 4TYWA 4BECA 5L3QB 2QPTA 5E4FA 1E1RA 1KZGB 1QG2A 1KJYA 1RE0A 3OESA 4XD7D 4HUQB 2Z43A 3FMOB 3TNFA 2RGEA 3W8RA 3A8TA 4LPSA 1GDDA 2IT1A 2GNOA 1E0JA 3HJNA 3RAPR 4JKYA 3K9HA 2EWWA 2NG1A 4M9XA 4TLBA 2C9YA 1G16A 2E1RA 4Q9HA 1UBCA 5KDLA 4BRUA 3CM0A 2W83A 2G77B 4TYPA 1UBGA 1HTWA 4BZPA 1DVRA 5CJPA 4YXWA 4JLKA 4KYIB 2XB4A 4CIDA 5TDHA 2KJQA 5FTNA 1XJCA 2IC5A 2PJZA 2VYFA 3QKSA 4HB2A 4EFLA 2HF9A 1R8SA 2IYVA 3RS5A 3LV8A 1MO3A 1GFIA 4WZBE 4D0NA 1HQYE 3THYB 4DWJA 5KSYA 4EPTA 1CEEA 1RZ3A 1Q1BA 3B85A 3FB4A 1DAIA 4YC7A 1E2EA 1T5IA 2GESA 4A92A 4KJZA 4F4CA 2QT0A 4PO9A 3FMIA 4Q03A 2ZIAA 1IJEA 3UMSA 3B60A 1E1RD 4XD7A 1WDTA 4OKSA 2VP2A 4A82A 5HKKA 3H84A 3P20A 4DDWA 2RGGA 5AJVB 5CDFE 5L3VA 2W2VA 4LPKA 1NMZA 2OCYC 5GVSA 1P4SA 3IBYA 1S2MA 2KBEA 4C0AC 2JJ8A 5FPHA 1GOTA 1KAOA 3KB1A 3HU2A 3ZIAD 1LF0A 2YC2C 3B7GA 3ZD6A 2C95A 3WNDA 4RKFA 4MYHA 1G4UR 3R7WB 1AK2A 2OFWA 2H57A 3EZ7A 4UQOA 4JIMA 1CR0A 3W34A 1ZM7A 5HE9A 2BM1A 5JZVA 2VF7A 2C04A 3MWLA 1UPTA 3P4XA 2G1JA 1SXJB 2ZE8A 1AS2A 5GJWC 4FXPA 2F1IA 1TUIA 3AF4A 1SVIA 3RRYA 1ZW6A 4NBSA 2VP9A 4KO8A 3KTAB 4UNQA 5EE9A 4TYQA 3W5JA 5DI3B 5J40A 5FI0B 5C1BA 1P2TA 4FCVA 1XTKA 1QHNA 2Z5FA 3B9QA 3R9IA 2IS2A 4KFRA 2EFDB 3RNLA 5E7JA 4PZLA 1AA9A 1R4AA 3CUEF 1EESA 2BMDA 1S3GA 3P32A 4RD2A 3CX7A 4B48A 2IL1A 3KXIA 3CNLA 3LVQE 2CNWD 2BC9A 2QENA 3CF6R 1TEXA 4JL8A 4WIAA 3TKLA 3AP3A 1DADA 2ZRJA 1G5PA 4Q4LA 3QKRB 4PHGA 1TPZA 4DDTA 4ESHA 2J7PA 2Q3HA 3OIWA 5FH9A 4EFNA 2RGDA 5GJBA 5CIWA 1E2NA 4DEYA 4LCBA 1XCMA 1VHLA 2H92A 3QF4A 3SOPA 4QHYA 3TBKA 4C2TA 4URYR 2ORVA 3FHOA 4JLMA 1DO0A 3PEWA 3MAAC 5DGXA 3GLIB 1T5LA 2ZSEA 2BEJA 1N6LA 2Z6VA 3GJXC 3QY0A 1MABB 1AKEA 5K8UA 1FP6A 4LJ9A 1E2FA 4EAQA 4F38A 3GEIA 3RS2A 2FE4A 4NTZA 2IYLD 2AXPA 1D2EA 1S4QA 4Q7LA 3THXB 1UKEA 4OK5A 4QOSA 4ZV4A 3T1QA 1NG1A 3BH7A 2PLRA 4S35A 1GILA 2GTPA 4X8OA 4C0BA 5J47A 1OFUX 3GLHA 4NU0A 1F60A 3KQKA 5KDDA 2C9CA 1ONBA 2C96A 4F93B 3LH5A 2QPOA 4Q4JA 2OILA 4XWKA 4TYNA 2HJGA 4QRHA 1UDXA 1JQLB 3CZQA 4TL9A 3CF0A 2PMKA 3D3QA 4HLUC 5DISB 1P60A 4M1YA 1QVRA 1GRNA 1G3MA 1SVLA 2CK3D 1RVDA 4AYTA 5LPNA 1N6NA 4FI3C 2Z0MA 4M21A 2VHUA 3EA5A 1HY3A 3DL0A 3IBGA 1XF9A 2KB0A 2D2FA 2WKQA 3G0HA 3LBNA 4XJXA 1T9HA 3O8RA 1E1QA 4ZDJA 3LW7A 1W4RA 1LV7A 2UKDA 2GXUA 1D2MA 2NIPA 3I4LA 4O25A 3BAFA 1D5CA 5A5GA 4JL5A 2C2HA 5G40A 2QAGB 2GJAA 3N5CA 1W1WA 2V1XA 2VPPA 4CF7A 2W0MA 3K1JA 5J4LA 1FMJA 2BCGY 3V4FA 2VO1A 4TYYA 1W5TA 2FU5C 4DSOA 4Q9KA 2XTNA 2PJRA 2OHFA 4H1VA 1BKDR 1U98A 4DLVA 3NTUA 4JBXA 2J0VA 3AEZA 1OT3A 5AUOB 1E9CA 1NVXQ 2WV9A 1IXRC 3CRW1 5FTKA 5IRCD 1VG0B 1TF7A 4LBYA 2CHGA 4TQAA 5FOXA 1OIXA 2BJVA 4RJLA 2P67A 1XD9A 4LJ5A 1DO2A 3LQRA 4DCSA 1ZNYA 1XTSA 4PSAA 1AGPA 2IYZA 1JPJA 2H17A 1AQYA 3OIYA 4X8MA 4TTPA 3Q5DA 2O8BA 1U8ZA 2AWNA 3Q7PA 3VNUA 5FR1A 5EP3A 2GCOB 3EZ9A 4JLVA 1WF3A 1KO7A 3RDPA 2I3BA 3TSZA 3BH0A 4M1OA 2DYKA 521PA 1M8PA 2DFLA 1QF9A 1OE0A 4IEEA 2XX3A 3A37A 5F2EA 1JXOA 5KOYA 1OH8A 1GVNB 4KAXA 1BYIA 3ASZA 5L3SA 3B2EA 3GFPA 2V4ZA 2JIZA 4LJ8A 4NE2A 3VKHA 2WJGA 3A4MA 2NOAA 1A7JA 4Z8XA 4Q02A 1U99A 5J4YA 1LVGA 2F43A 4WOPA 2WWHA 2RGAA 1H8EA 1WP9A 1DELA 1D9XA 3FKSA 5BXQC 2G83A 4TMZA 2XJ9A 1TADA 4Z51A 2DPXA 4MRVA 3LBIA 3EA0A 1VIYA 4R2IA 1G41A 1J8MF 4I4LA 2JASA 1GZSA 1GRRA 4Q19A 1P7CA 3KKOA 3DZDA 3EXAA 3KKQA 5FUXA 2JGNA 1KI1A 2A30A 4D4JA 3UG7A 2GEVA 4B3DA 1Z0DA 4IKEA 4R71A 3J81k 1N5KA 5JWOA 5DO9A 1EK0A 1X6VA 2JCSA 2V9PA 3PFIA 4O2RA 3GJ7A 3T12A 2QMHA 2PX3A 5FOSA 4GP6A 3MJRA 1Q44A 5CIQA 5LB4A 5CB8A 3NEJA 1Q1ZA 2I1QA 3A1WA 3KQNA 4FMDF 4Q1BA 1FTSA 3QKTA 1QHIA 3SDZA 2D2EA 2D4HA 2IYRA 4TWZA 4NCKA 4IDOA 4S2EA 2PLFA 4BE7B 3WRXC 3BS4A 4GRAA 4EUNA 1N6KA 2XOKA 3AB3A 3VR6A 2RGCA 2ZJZA 3HPRA 4EIWA 3THWA 2NO9A 2JATA 2W2TA 3PG5A 5FOTA 4RD6A 1T8UA 1XP8A 3TAUA 5AJWA 2ASEA 3GJ3A 2P2LA 4R7ZA 2QM7A 4A0RA 1E2LA 4KI0A 1Z28A 4JLOA 3U44A 2O8BB 1AGRA 1AS0A 2XNDD 1U81A 3AH8A 4RZ2A 4PQRA 4X8HA 2XTMA 1DAEA 4PPQA 2ZR0A 3W5IA 1G6HA 4LK2A 3VQTA 5B2ZA 2CVFA 4B75A 2WSSD 2WWGA 1XB2A 3C4JA 3L0PA 4PAQA 4Z1MD 1AN0A 3ECCA 4V0MA 4EFMA 2KI5A 4US2R 4HAWA 4P33A 3I1FA 3SEAA 1Z5ZA 2DFNA 1H8HD 1ZC4A 4RCYA 4Y0AA 1M7GA 4FMDB 2ODNA 3TSOA 3GFTA 3GCGA 5EE1A 1GAJA 1FPMA 2QSYA 1RRGA 4JMPA 4LGMA 4OK6A 3ZYCA 2ECKA 4LV5B 1NJGA 4A4DA 4O2LA 4B6EA 3BORA 3KJHA 4J0QA 3CPJB 3BXZA 2W6JD 3FOZA 2GK6A 1W0KA 1CP2A 2XSZA 4DKXA 3ND8A 1KK1A 4JLBA 2AKAB 2ZVQX 1Z6YA 3U3JA 2NO7A 1D9ZA 1KMHB 2H1LA 3EZ6A 2B7CA 3BBPA 4LY6A 2A9KA 1XRJA 4JLPA 2J0UB 3L8YA 4LYFA 4C0SA 2ZE6A 1YKSA 4KFTA 1OH6A 4ON9A 4LWZA 5BN3A 1U8YA 1RRCA 3DZ8A 3MD0A 4GI7A 4JYCA 2YYZA 2YV5A 3IGFA 3U4QA 2ZRIA 1BYUA 1SVKA 1VG9B 5KHOC 1GKUB 1P2VA 2IYTA 3GFOA 2SHKA 1PZNA 2VL7A 2KBFA 2QROA 3SI7A 4KYUA 4OQFA 3VKWA 4URUR 2JLYA 4EPRA 2MSEB 2D06A 4E07A 3CRMA 3I72A 1WBDA 4D26A 1XBTA 3HP1A 1AZSC 3IQXA 4BLOA 2NO0A 3K8YA 4OQXA 4M1SA 5FOVA 1CR4A 3AVOA 3KQLA 1OXVA 4LI0A 1AZTA 1OFTA 5AR1A 4HZUA 5JEDA 421PA 2WZQA 1WA5A 1W2HA 3TH5A 5FUWA 2OBMA 3F0TA 1WBBA 3TR0A 4TSFD 1KDTA 4NHOA 3ADCA 2QP3A 2GK7A 3TGPA 1H8ED 1ZM3A 4GOJA 2ZQ5A 4QGAA 3TW4A 3DMDA 1KSHA 5GJCA 2GETA 4DJTA 1RW4A 1IHUA 2WJIA 2ZU6A 4WW0A 3OZXA 5EXSA 5CB6A 1E2JA 3CX8A 3A58B 3AF3A 1UKVY 1J90A 3C16C 4RZ3A 3KUDA 1MR3F 2PBRA 1UKYA 1ZM2A 2DFTA 1G3RA 3DVLA 4M9SA 2RMKA 1WQ1R 1W4AA 3BFKA 3SS8A 2WM9B 1R0ZA 1ZU5A 3PITA 1H65A 2OV2A 3N2IA 2EFHB 2KE5A 1Q57A 2QPAA 4JLJA 4W7SA 4QKQA 2QMOA 1XMVA 4OK3A 3BB4A 3U61B 4M2LA 4ZDWA 3W6NA 3V4RA 1KI8A 4B47A 1M7HA 1F2UB 2RHDA 2KWIA 4XTCS 3LBHA 1FQKA 4JL6A 1FX0A 2BCJQ 3UPUA 5L8VA 2GA8A 2RGXA 1Z0IA 4JVSB 4OJKA 2PZEA 2QU8A 4BLSA 1SKYE 3IEUA 2ZS8A 3A4NA 2ZE5A 3QG5A 3VTKA 1Z6TA 3TVDA 2IF0A 5B64A 3QVUA 2DHRA 1GKIA 3R20A 4TTQA 1CJVC 4QNMA 4M9QA 5EXTA 4XWAA 5FTLA 2ZU0C 3KTAA 4LUCA 4FW9A 3LD9A 1K6MA 1VPLA 1GL9B 3RWOA 4E22A 2ZR7A 3ICEA 4QFMA 2J3EA 4KBGA 1Z29A 1L7VC 4QGGA 2WHXA 3JVVA 3LAWA 3NVAA 1W0JD 1XU4A 4F92B 1NKTA 2ONJA 1FUUA 1VTKA 2YC4C 4HZUB 3M4YA 2VHQA 3GP8A 3Q72A 1OXSC 3U44B 1R8QA 3AKCA 4Q1DA 5KTYA 1Z08A 4B44A 2QGNA 1R0WA 3T5GA 4AYWA 5BWMA 2IHYA 2GJKA 3F5FA 1NL3A 2IF2A 4BEJA 2B8TA 3ADBA 4NH0A 3RVBA 1M2OB 3LY5A 4C7OA 4GT1A 4DCTA 3U6BA 4CRWB 1G18A 1WMSA 3CR7A 5DN6D 1SHZA 3BIFA 3BOSA 3QPVA 4Q1CA 3TMKA 5B30A 4UXHA 3A1SA 1Z3IX 3MMPA 1KI6B 4GMXA 2FSGA 3RABA 1W36B 2VSFA 1NVVQ 2O8EB 3TR5A 3IO3A 3TUJC 1RC8A 1Q21A 2GVZC 4RFVA 5AJZA 2FEMA 1O3YA 1YR7A 3GPLA 1Z2AA 1CKEA 3TUIC 4EPXA 1LS1A 1E0AA 2N46A 3Q7QA 3SBEA 1UFQA 2F9LA 2CL6X 4IDNA 3T1TA 3Q8XB 1E0SA 3RYTC 2ZJ5A 4C2UA 3DKPA 1E4VA 2PEZA 1VG8A 3PJRA 1ZNWA 1TQ6A 4KU4A 1ESNA 2BBSA 2G6BA 3K0FB 4I1UA 4QC2A 4CT5A 1A82A 2J7KA 3OFNA 4OQLA 4Q1FA 4FINA 1W49A 2F3RA 1ZNXA 3ZVLA 2OG2A 2H16A 4KSCA 2QP9X 3E5HA 3SZRA 2QQ0A 4ABYA 2B8WA 2CCKA 2EFEB 4PSKA 3KJGA 2CL7X 3CKLA 3U3MA 3K9GA 1B23P 3Q85A 3EPLA 1G3QA 2ZAMA 2ZRDA 5KSOA 3B1ZA 1YR6A 3AVXA 4DT1A 4MYCA 2ZSAA 1R2QA 1YZNA 2OSBA 5P21A 4AURA 4LHWA 1F6BA 4ARZB 2E9SA 3RHFA 4NL4H 3U60B 4TMVA 3LXXA 1DAHA 4KLNA 3CNNA 4AD8A 4NPHA 3E70C 1Q12A 1R5OA 3B78A 1KY2A 1P2SA 2FG5A 5ANRB 4MRSA 1OH7A 1R0XA 3EASA 1KGDA 2YOHA 3X1XA 3QEJA 1NVWQ 4QJ3A 4M1TA 5KO2A 1E2GA 3OIUA 2ZITA 2GXAA 5E7IA 3IQWA 4YMTA 1JJ7A 2PEYA 3SQXA 1Q1QA 3U3RA 4MDFA 5B58C 1Q0UA 2VEDA 4PHFA 3THXA 4LOAA 3EZFA 4WBSA 4Q01A 3SHFA 2HCJB 3OE7A 3QKRA 1HA3A 3QKSB 3AKYA 2BMFA 5FI1B 4LV6A 4Q9IA 4ARZA 1D8TA 2V7QA 1GRQA 2P5TB 3IHWA 4Y0VA 4D2IA 4OL0A 3KZ1E 2XNSA 2ZYVX 1MKYA 2MMGA 3GLIE 2BBOA 2R44A 4O0MA 3AKDA 2B7BA 1FMLA 2VTKA 3EC2A 5HZKA 1G7CA 1OB2A 4V0ME 1JEEA 3U6KA 4EQ6B 2YHSA 3CH5A 1P9RA 1R0YA 2QTVB 4URWR 4HUQA 4TTRA 4GBMA 2AWOA 4NYJQ 4W5JA 3SHWA 4AKHA 4XOIA 3DKVA 3UATA 2ZI9A 3B82A 3PUXA 5AUQA 3SE0A 2A2ZA 1G4AE 4LYAA 3MG9A 3ZJYA 4ZKEA 2FV8A 5E7MA 3UANA 1OKKD 2MMCA 5GJVC 5CK5A 4ESVA 2ZAOA 4PO8A 3NXSA 1JEDA 1R5BA 1GM5A 3LLMA 2XZLA 4DLWA 1G8FA 3UMFA 1NIPA 1H8HA 2D3WA 2HYIC 1E2IA 3CF2A 3JVUA 1R5NA 4BLQA 5C18A 1CJUC 5JHGB 4DDUA 1QHHA 2CCGA 2Q6TA 3AVPA 2ZSDA 1AS3A 4KFUA 1PLLA 4HAXA 1L2TA 4LHVA 3BERA 3DM5A 3R8FA 3PEUA 5FOUA 5EZ5A 3TQFA 4Q9LA 1QHSA
chains in the Genus database with same CATH superfamily
4RESA 4BASA 2HXYA 2W2MA 1NVEA 3L0OA 4RHUA 3RBVA 4B5KA 3SQWA 3ZGZA 5LYJF 1Y8QB 2H7VA 4B35A 1NUTA 3IT0A 1SU8A 2C57A 3RLFA 1XU7A 2Z09A 1MIOB 3KWFA 5AXAA 1EB8A 1M0TA 1LK7A 1XO1A 4W1SA 1PUXA 1TCBA 1ZY2A 4GP9A 4PVDA 5F7ZA 5KWIA 4P0PB 4Q48A 4X60A 4HVAA 4R1PA 2J33A 3GZJA 1F2TA 3IDSA 2ZKIA 4M53A 3VR5D 5TT0A 1ZD4A 4ZDIA 2EWVA 3B1WA 4L6AA 1N5RA 2GDJA 4X65B 1PJRA 3V8NA 1NY6A 1BFDA 4WJKB 5KWEA 1CS0A 3CIFA 1ISRA 1P5ZB 3BJEA 1TVCA 2INGX 2VPXA 3DBOB 4RACA 3HL0A 3NDJA 3MBIA 4RFLA 3O0TA 3RHSA 1U3DA 4MGZR 1HT2E 3H4VA 3AINA 4W7IA 3GGDA 1U8CB 2H8GA 3L40A 5EP1A 3HB7A 3USCS 3L5KA 3VU1A 2RKBA 2XQIA 3T41A 4A26A 4A23A 3A36A 4D4LA 1L7AA 1ND6A 4JCCA 1ICEA 3ITNA 2DG2A 1ID1A 4CGYA 3GGCA 3HY3A 4JSYA 3D6FA 4AKSA 5AKZA 4MRRA 2V7GA 3JQ8B 1O03A 2A9PA 3HKBA 4OHMA 1ZBQA 4IRXA 1L7QA 4JQOA 3DE4X 4ZOLB 5J2UB 4O4JF 2BISA 4DCOA 1XRSB 1XTJA 1UEXC 2B9VA 2R8PA 2Y1WA 3AI3A 3BCUA 4RYDA 121PA 3R7AA 3VNVA 4JLAA 2BFDA 5FNZA 2RE8A 1S96A 5LCXA 1JG6A 4NDAA 4QGSA 3EA4A 4FSHA 4B6OA 3W2HA 3IKJA 4PTYA 2ZZMA 4DGSA 3NT2A 1QQTA 2YUTA 3DAGA 3QJYA 3M8KA 4YRPA 1FFBA 1H6AA 1R0LA 4CUJA 4J3FA 5BP7A 2DCUA 4F7WA 3GJ8A 3IAUA 2I7XA 4TSRA 1IN1A 2OC4A 1BIFA 3RVSA 2PMBA 1FQWA 1UH5A 4OGKA 4QG7A 1ZIPA 2G71A 5DZSA 1P1JA 2XT6A 2JCGA 4J76A 3GMTA 4PAWA 4F71A 1OOEA 5FUMA 4AQYB 4COKA 1N25A 3E61A 3KV1A 1FUEA 1XLTA 3D2AA 3I9V1 2QW1A 1GZUA 1UMKA 3HACA 3QK7A 4R2HA 3V9PA 1DTSA 3ESXA 4V02A 1GLVA 1P4HA 1UWCA 3EIEA 3NUZA 3Q2KA 5DN9A 1TQDA 4PZCA 5DHFA 5JS7A 1KPHA 3LFUA 4M1WA 3UWDA 4RXMA 3W4KA 1HV8A 1XZDA 2AK2A 2HC9A 3H17A 4K6HA 4RK1A 4DLXA 2EZ9A 3C3MA 2ONYA 1GG2A 1WUIS 1TK2A 1UM8A 3LBYA 2BWJA 4QFBA 1SU7A 3VR2D 1TEZA 4MV5A 5LA6B 2BFBA 4RD0A 1PEDA 4KXXA 4M46A 5AYVA 3M89A 3G82C 4YJHB 3LY9A 4IDFA 2I9KA 2OCGA 5B53A 4PS1A 4RVNA 5BRAA 1XZCA 3NHWA 4H6WA 5KNDA 1NFQA 4I1YA 1KYVA 3FWNA 5IKPA 1B0UA 1Q0SA 1ZSYA 4IDBA 3TPCA 4G0XA 3P9RA 4HQLA 1EUDA 1B15A 3QUTA 2ATIA 3IPXA 4REQB 3PDUA 2I4LA 2DC1A 4V0SA 1RLJA 1A4IA 2H8KA 2QVLA 4RLFA 3LIPA 3UIEA 1P29A 4YRBA 3NIDB 2G07A 5IVIA 2V5AA 3RIHA 4E09A 3LWNA 3TF5A 2J9ZB 3I52A 4H6PA 5TPWA 3QQ5A 3HVUA 5F3WB 4I8IA 1HT0A 1LA2A 1EGHA 1YC5A 1T4CA 4TUYF 3ZH9B 4BQSA 1ZRHA 4EPWA 4DRXB 1G5QA 1ZN9A 4GSYA 1E8NA 2D1QA 3MPOA 2RGNC 4L4XA 3UOWA 3C3DA 5FWDA 1KMHA 1E3SA 1R8JA 1ECLA 2VQ6A 3AJ8A 4Q3KA 1SUWA 2Q4RA 1LUAA 2IYSA 1LU9A 1NVTA 3ZBTA 5CEFA 1VJDA 3PLNA 2G9RA 4Q1AA 1T13A 1I33A 3PQFA 4E15A 2P6RA 4BTVA 4MPDA 1W75A 4M37A 1BKSB 4MMZB 3RHZA 1U3CA 1XAJA 3ZBQA 2DQ4A 3DPSA 3NJ8A 2X8AA 1JAHA 1MXHA 2CGEA 1Y4DE 3BRSA 4TLCA 3VU9B 3WNCA 3ER8A 4X1IB 4EHJA 2IEBA 4TZ6A 5BXYA 1YU9A 3GEHA 1A9ZA 3SZOA 3L7LA 4ZGWA 1PWXA 2AMLA 4CCYB 3IKTA 4M0FA 2ALJA 4Y1GA 2VZLA 4J9UE 1JUDA 1U90A 2QG6A 4FOTA 2VHJA 4NAHA 4XH9B 4KC0A 1DJNA 1Z0UA 3MBOA 3DVRX 3HN7A 3LPMA 3S28A 4C14A 1EXMA 1S8OA 3K30A 3G2QA 3QEOA 4J1NA 3L6BA 1XPJA 3MNFA 1RS0A 2Y93A 5A4IS 2A6PA 2CFIA 1Q83A 3DMGA 3VAYA 1ZLXA 5JPIA 1GUBA 3F8SA 2F62A 4GUAA 3WBKA 4ZQBA 1KJJA 3O9ZA 4Q00A 5ENDA 3BK7A 1MIOA 1FVXA 3HGTA 4IOMA 4RFSB 5ICEA 2CSXA 2H1HA 3QWFA 2VP4A 1N2CB 2WFMA 4GNKA 3PQCA 4IDDA 1BDMA 4JB8A 4JWKA 4U2GA 1P45A 3SN6A 3W3ZB 4P6VF 2RONA 3WRYA 1P6UA 5CCEA 1J1UA 1C1DA 5IN5A 1I0IA 2WVJA 2NACA 4L9WA 3LUBA 3INGA 5D5HA 1KK0A 5JD4A 5LP6F 3RVKA 1CIVA 3K2BA 1X1AA 5B3AA 3IUMA 1SUBA 3ZWDA 1NOIA 2I5PO 2PLNA 3ITEA 4HS9A 4JFRA 4MCAA 2XIQA 4DUPA 1R6BX 5CX1A 1E9DA 5AVOA 4DC9A 4YRDA 2EX1A 3Q3JB 5IC6A 3TBFA 4CF5A 3AVWA 1QP7A 1Q7EA 2OZPA 1SKMA 1TMGE 2P9QA 1UZUA 3FMPB 4G85A 5DBOA 3LKDA 1PUJA 4MCIA 3RS9A 5TLSA 3BGOS 1KI3A 4MQ6A 3MINB 5F9HA 4EDFA 5BQOA 5H16A 1Y7LA 1BWQA 2YJNA 1DC5A 1NVAA 1WMAA 1P4JA 3DJYA 3E4DA 1U1IA 2IYNA 4JCOA 4PTLA 4LNUB 1YKGA 5A3SA 1X70A 1NQ5A 2HLDD 2P5SA 4HQOA 4GI5A 5IYZB 1TQ2A 4PQEA 1EVEA 2DLCX 1RT9A 2DHQA 1GIAA 2X7HA 4US1R 2HK8A 3UFBA 4NE7A 4BQNA 2PIDA 2QGZA 3DMTC 3WOHA 2XD9A 3DTYA 3HXLA 3L8HA 3WGKA 3R6LA 1OZAA 4ISCA 4KDEA 2WF8A 3LVRE 3HEAA 2FN8A 3HFGA 4GLOA 4PAMA 1L1RA 1V9CA 4U9IS 2CHEA 3P9ZA 3UJBA 3VGPA 1RJFA 4DR2B 2L42A 1Q7CA 1YR8A 3VZCA 1H2BA 1ODIA 3B1JA 1WPQA 3LW8A 2AEEA 3N9IA 4C7KA 2JRLA 1QRTA 1NVUQ 1B42A 4IGIA 4RQAA 4FJ2A 5BN5A 3WP0A 3CPSA 4TV9A 1EDDA 1YHNA 3TTUA 5IM5A 3CX3A 5AICA 4DJEC 3CLUD 3F3MA 2Q0HA 1BHQ1 1F4VA 1UP6A 4U2CA 3KSUA 3HXQA 2FA9A 3QXXA 4NDZA 3KJIA 4P92A 5K4AA 4ZK6A 2X0DA 3KQUA 4ZAGA 3LO5A 3LC1O 4JP1A 4QM7A 3E7DA 5I5GA 1BU5A 1SXJA 3OE1A 1CR2A 2UZIR 2JLQA 3VDRA 3WWEA 2WE7A 1ZCBA 3VR6D 1X92A 4B8WA 3RRZA 5CH5A 2P2CA 1KGSA 4G89A 4J7AA 3JTEA 2V7XA 1S2DA 3FR8A 3DZFA 1EGQA 2IYOA 1EQAA 1YONA 1KYXA 3HSKA 2VHZA 1ESEA 2Q0QA 3L01A 3RVNA 3RR2A 1G8KA 2W93A 3I5UA 1GYRA 2FSFA 2ATXA 2JJ2D 3M4XA 3TTTA 4JI7B 3D7KA 1FMTA 3BE6A 3HR4A 3G8AA 1N5LA 2A1UB 3PPVA 1SG9A 3C2QA 3KZXA 4OOEA 5CR9A 5K6AC 3CZ9A 3BH6A 3DUWA 1C3OB 1D4FA 3N3AC 1IXZA 3F2IA 4IWNA 1RXUA 4P7JA 3RIMA 4AKTA 2JGEA 2PUVA 2ADFA 3UH1A 4P81A 4TL6A 2JG3A 2AN4A 3NAGA 1GPUA 1M1YB 1AQLA 4N49A 2JCBA 4HI0E 1HEIA 4TTJA 1T1EA 4GL2A 2HLPA 2QV7A 3D6VA 4R2LA 1UDWA 1BHJA 2YFHA 4IVQA 4Q5IA 3M5WA 4RVGA 4YJGA 3U7FB 2D62A 2HUNA 2WMNB 1Z6QA 2ZTHA 3MJVA 4IOKA 3OEEA 2OHXA 3NTRA 3TG8A 1M34B 2DJ5A 4MKHA 3QPCA 5JQGA 3S5JA 1ZUIA 3T5AA 1E64A 1TU0A 3G9TA 3MBKA 2V9ZA 4IDQA 1H1TA 2LDXA 4NZYA 4JROA 2AQKA 3DAPA 3KOUA 5L40A 3WYAA 1XYGA 2EHJA 3I5XA 2AH5A 4N54A 1C4OA 2HA2A 2R6ZA 4OBEA 1Z88A 2AX4A 4V0KA 4G5GA 2CLOB 2WHQA 1V26A 2KHZA 2FPKA 3I9KA 3ZS9A 2FSIA 3RSZA 2QUAA 5FPKA 4EVQA 1A1VA 3OT5A 2JANA 4V0OA 1EA7A 1DGQA 4OBWA 4EKDA 5A7FA 2BMVA 4O2AF 2OEPA 3GJ4A 5DNVA 4BMZA 4I4TA 1JFRA 4BX0A 3FFTA 4ENRA 1DB3A 3AP2A 3G7UA 2V65A 3AO0B 3BB1A 3AFOA 4BQFA 1F7UA 3OQIA 4FFLA 3H5VA 2PKQP 4H6VA 5D5QA 4BO9A 2NSDA 2IV7A 1VBNA 3AEKA 3VPGA 2H07A 1QBGA 1IG3A 4HDNB 3IOMA 4ERNA 2WJHA 4BNHA 1S0UA 4JMLA 4IJ5A 1G59A 4RHFA 2JIZD 3CMMA 1QCDA 1H6DA 3EDCA 3L8FA 3LRTA 4UHHA 4C76A 4MULA 1BHSA 4I5EA 1SUSA 2PGAA 1NG9A 4MGKR 3D6UA 1WCV1 3ZHTA 4W8GA 2HUPA 2RKWA 1EA5A 1ZD3A 3DYIA 4F06A 3NU1A 1J2UA 2FZ4A 4D4GA 5HKAA 5JNLA 2IELA 3DOUA 4YAEA 3AL0C 2QMEA 3PTLA 1L1QA 4K9PA 4DV4B 6ADHA 1PR0A 3IRUA 4B34A 2PFKA 4LRWA 1V8BA 1SHTX 4Q15A 3E53A 4Z0HO 3H4TA 3SJBA 4AO8A 1N8SA 5DH9A 1DKRA 4D46A 2NP6A 1ZNZA 3CNQS 1QHYA 1EVYA 3AERA 1WY7A 2BFEB 3U4DA 2ZIXA 5REQA 4GNRA 4CTKA 4QXMA 1WLYA 4DLLA 3CLSC 4JFAA 4DR6B 3F7OA 4ALKA 4W5TA 4CNBA 3L6UA 4UPEA 1RI3A 1IONA 4RK7A 5CDFA 1JWBB 1P9NA 5HGXA 4MARA 3QA9A 4F97A 2O8EA 1RAFA 2B61A 5CVVA 1TF2A 4H27A 4DVGA 1L3IA 2FWPA 1PWEA 3CEHA 5GZ6A 3STTA 1BMQA 5CFNA 1U9IC 1U9CA 3K3PA 2J87A 3BSSA 4IJUA 3MCAA 5LMZA 4MQFA 3BWVA 3GZTB 3BEDA 3ECAA 1KSJA 7ABPA 3FNGA 4NJMB 4US0R 4ZOBA 3OZ7A 4I3GA 4DA9A 4HNTA 3OUUA 2I8CA 4NYIQ 2XXAA 1PJ8A 1EDZA 1Q11A 2UXCB 4HNVA 5DE3A 4XARA 3PUHA 1A69A 1DX6A 1R3DA 3EBOA 4IQ8A 4EJFA 1T4DA 2ZETA 3KUCA 1VIDA 3P0HA 1J4AA 1EYZA 4O5OA 3ILSA 2ZYGA 3R7NA 2P9ZA 2XJ4A 1QMGA 1IQUA 2AFHE 4CF3A 1NX6A 1ZESA 1AH2A 2EBHX 5B7NA 4YALA 3O7WA 1PGQA 4OHUA 4M7OA 3GT3A 3W6OA 1YASA 2I4MA 2O2HA 8ABPA 3IPYA 5EJ6A 2H5IA 4YMGA 4RZHA 5IDXA 4EPVA 4MWOA 4C3UA 1DPFA 1Z63A 4R2WA 1QYXA 4H31A 4FN5A 4NQRA 2EG5A 4OFWA 3T7IA 1K5DA 5SYAA 3CRNA 3R5TA 1L8LA 6REQA 3WLJA 1T5TA 1KU6A 2FSVC 2PKWA 4TWIA 1EWRA 4N0EA 1AMUA 2IXEA 5L3RA 1ZOLA 3W9BA 4OSEA 5A0TA 3CC8A 4MKIA 3C14C 1JIUA 2V7QD 1G9TA 1IBRA 1ZW1A 2GH1A 1DTWB 1MGOA 4PWZA 3VSDA 1PVOA 4R31A 2OT3B 2RAUA 3OUTA 1YCHA 4H6XA 1EP1B 4S0XA 1P4GA 2GASA 1VIAA 4WY2A 3W7AA 4CM3A 5JBIA 2GT1A 1OI3A 2IPLA 1EFAA 4M89A 1QUFA 1PR2A 3UMYA 3FSJX 1M1UA 1R16A 3UAOA 2G76A 2R6CA 3NX4A 1GPBA 3WLEA 3A05A 5B7GA 1UOPA 2H00A 1EBFA 1L0BA 2QWXA 2Z83A 5C31A 3U13A 4B45A 4EFKA 1LDYA 1DJQA 1E9BA 2XYQA 4CKBB 1QHFA 2K87A 4LQ4A 5JI3E 1P39A 4PC7A 2YKGA 1DG9A 2ONZA 3LUFA 4QBGB 5JAUA 3Q4GA 4GE3A 2VTEA 4U7GA 4E5NA 1UQRA 3FCAA 4QHSA 2ANBA 4WCFC 3RT9A 1SZCA 2GN9A 4BFZA 3CH6A 4DUGD 1X87A 2DFKB 5F98A 3VO8A 3B9PA 3SC3A 2ZPTX 2AGVA 1DS6A 1W9MA 2Q6LA 2Y1GA 3PGMA 4B3TB 3GD7A 3T5TA 4OJMX 4JBLA 1Q1EA 3GRZA 4Z8YA 4YAUA 4MEAA 3R6WA 4P98A 2OXRA 4IZOA 2W2XA 2YXPX 5EYPA 3EMBA 2PMFA 4PC6A 4X7BA 1JS1X 1ZGGA 2HHAA 3K35A 4MUMA 4D4KA 1O77A 2ZRAA 3MWJA 4D02A 2IXFA 3IDFA 3IVAA 5FV4A 3T5PA 3N74A 2WZBA 1XNGA 4Q7JB 4DCVA 4G1UC 3NKVA 2PMWB 1CJSA 4DR1B 5E0KB 2PVSA 3GUCA 5L51A 1F14A 1SQ0A 3BA1A 4H7PA 1U8TA 3UUEA 4C1NA 2PH7A 4K6GA 1KI7A 2ZWVA 4Q3EA 3WISA 1KRWA 3M70A 3GLHE 4P3PA 2HFKA 1HL3A 1KJIA 4N4AA 3NV7A 3UKDA 1FRQA 1NV9A 2EAUA 2GYWA 4P38A 1SXIA 4ONEA 5E1OA 3PEYA 3MUOA 3MS2A 2PMEA 5LKAA 3SM3A 4IJMA 4B4VA 1LBIA 3KLBA 4FEGA 3STXA 3VC3A 4JNCA 1X13A 4RZUA 2HA5A 3SJCA 3OHPA 1IBSA 4NS1A 2WVAA 2QTAA 1KFKB 4A2QA 2J0QA 2YDXA 4LBWA 4ZVOA 1M2GA 1XTUA 2FH5B 2GUWA 2PPLA 2ZRHA 5BSRA 3JAWB 5A62A 2M32A 1E79D 4QX6A 5G1OA 1NONA 2A59A 1F51E 2H1IA 2JD2A 1JLRA 4IIXA 4E32A 5A2GA 3WAGA 4PAOA 4BNFA 3RU7A 4W99A 3CUVA 1MO5A 1JU4A 3U7EB 1FDIA 5BWBA 3Q5EA 2ZR9A 2Q7OE 1FTQA 1ZVJA 2ISCA 3D7LA 4DUYB 1X8KA 3E5RA 4TKUB 1T2FA 1NWHA 2XODA 3FKQA 1A2QA 4IPTA 2Z3WA 4AJJA 5AW7A 5KINB 3SKXA 4TSKA 5AKJA 3SD7A 1P91A 4R8VA 2QN7A 1XXHA 1WEHA 3LA8A 1T2AA 3L3BA 3O3CA 3HM2A 4OG2A 3V8QA 4B9EA 3AOEA 1IN6A 1VI5A 3R0VA 4OA8A 4P53A 2G4VA 1OXUA 2HRRA 5A5VA 5JECA 4EAAA 4LHXA 4BO6A 3SNHA 4D3ZA 4WOCA 1YQGA 2HBQA 1VE9A 2J3LA 1E2KA 1DV2A 2XLCA 3IUEA 5CFRA 2BIFA 2RKOA 3IE2A 5GINE 2FSUA 3CMCO 2DR3A 1COWD 4DIUA 2XQFA 5DJ5A 4RK4A 1YVEI 4I5DA 1O5OA 5UKDA 3SFTA 3GAZA 1SULA 4R81A 5SY9A 3ZQJA 5BWOA 1VCMA 1M8JA 4ZYZA 3UYLA 1CBUA 3F4LA 5FPYA 2AYYA 4UE3S 5CJ2A 4RNDB 5BW6B 2PRSA 2AW3A 2YQ4A 1S3SA 4MYRA 4U5XA 2L17A 2G70A 1PDVA 4YCDA 5EVCA 3VVBA 2P2SA 1DJOA 4GVLA 4XTRA 3CUYA 1FW8A 1K7FB 1PT6A 4KVFA 4KN8A 2ZJ4A 4WBXC 5AVTA 1J0XO 1QXSA 2HO4A 1NJ8A 4AI6A 3HS3A 3FCYA 2Y1EA 4M4SA 2YVLA 3O6VA 2GR9A 3PHHA 4P3XA 5JZOA 1ZK1A 3NM5A 3FJOA 2EJUA 3JD0A 3QU5A 3JQ9C 1Q20A 2C4HA 2WNHA 3FRHA 3H3FA 4OHFA 1I3NA 1XJ5A 3M1AA 4EBBA 2HRQA 3O84A 2WP0A 5KTRA 4WZ6A 1GITA 5AK6A 1PZMA 3TAXA 3W6PA 3SICE 3RT1A 2IKQA 3PIRA 5A9TA 3X1ZA 4PF1A 2RH5A 4ZVQA 5IN4A 3FDIA 4G09A 3BMQA 1OFHA 2VBIA 2AB0A 4DWOA 1II8B 3CRRA 4JXKA 3TZHA 3W6ZA 3IOBA 1LTHR 2C61A 2OP0A 4EW3A 4U7DA 3BB3A 5LXTF 3SVZA 3TKYA 3VNQA 5FNVA 3A6DA 3Q1KA 1XQ6A 2TMYA 2DY0A 1C3JA 1YQ9A 2A0FA 3C6QA 5ALJA 1KE1A 2QL6A 4AP5A 1JKFA 1L4FA 1YQTA 2WSYB 4QDOA 1RFLA 2X40A 1Z5OA 4RHEA 4PN3A 1WXGA 4L5IA 3ZWQA 5C5CA 3EXHA 4BP3A 3K94A 2LXNA 1BD4A 3JD3A 1JMVA 2YW9A 4TSFA 3D3NA 3TDNA 4P0TA 3THRA 4O4HF 1ONSA 1DWQA 5KIAA 2YHUA 2HU7A 1G63A 2REQA 4UHCA 3AFHA 1U0JA 2HBYA 2XDYA 1II9A 3H16A 4G4SO 3VSBA 2Z8YA 1E4EA 1NZJA 4KMSA 2W0SA 4B7ZA 2ZI7A 2OD9A 1QPZA 4LX0A 5AVYA 3L1KA 2C2OA 2QSZA 1NVVR 2GFHA 2GTHA 2JHPA 2OGUA 1MAHA 3L7NA 4FGUA 3H1TA 4KLZA 3CR3C 1CRZA 5JQGF 2IE8A 4V3BA 4A8JA 4BBPA 4C5CA 1UKAA 1STOA 3WP1B 1FP2A 4BNTA 4JXZA 3R3XA 1HF3A 1ZC3A 3LXUX 3HC7A 1GU0A 3DB2A 4Z3OA 3P0RA 1A5AB 4I66A 4A5OA 5SYNA 1UBMS 3B52X 2WJ3A 2R85A 3CIOA 1OSNA 1E2QA 5JCOA 2MINB 3FYHA 2FZEA 1FZQA 5JSZA 1SQFA 1ZZEA 2YIDA 4KO1S 3RS0A 1YK1A 3BRCA 2WB4A 1MPXA 1YJCA 1YNSA 3AC0A 3GT7A 2FJPA 3FNHA 2C9OA 3HVIA 1KY4A 4D3XA 1B1CA 1XI2A 4F5WA 5HG0A 5K8TA 2C5HA 3GEDA 1Z7BA 2ZTSA 5L3SB 4B2IA 2GPSA 4C30A 3MEQA 4F21A 4WWHA 2XB2A 2F7SA 3J7TA 4ZC1A 1GG8A 4R1NA 2V55B 1A3CA 1ZN2A 2IIBA 5KOJA 2I3DA 4PE5B 2XUOA 1Y3IA 1GCOA 4UBLA 4QM6A 4BKPA 4QDUA 1WUHS 4I14A 5FWXB 4FVTA 4Y6RA 5JFOA 3K1ZA 4OI4A 1B6SA 3ABRB 2QL7A 3EVBA 1MOQA 2AFHA 4L72A 3E3AA 3GIWA 5DBFA 3R8CA 4Z9AA 1OT5A 1KQNA 4AWXA 4ALIA 3OOHA 1CYEA 2HF2A 1E1CA 3EPRA 2Y66A 2FLKA 3K0BA 2CL5A 3LBFA 3MGCA 3A27A 2Z4RA 4FWIB 4WTOA 2XHEA 4JZKA 1LRLA 1G20A 4J0IA 1F9AA 2Z3ZA 1NSYA 1M9NA 1IWPB 4RD1A 1S1MA 5DU2A 2O7VA 1E5LA 3KSMA 3L5OA 4JQSA 1QQAA 3HP7A 1E5TA 1VJGA 2TS1A 4PRYA 1JDZA 1U5BA 4R2KA 4GC9A 3SIPA 1U94A 4L73A 5AUNB 1KAQA 1OU0A 3NHJA 2A0KA 1TECE 3FPAA 1ETHA 3LYUA 4O29A 5CA0A 1D2NA 4MQFB 1VJCA 1UANA 2B0JA 2BY4A 5JCJD 4DPKA 4Q93A 3ZKWA 1T4BA 2X77A 1BG6A 2ZYWX 3BCHA 1SG0A 3C3CA 4GXRA 2ZBRA 4B4OA 4A0FA 5B37A 3WMGA 1L5ZA 2V4MA 1U0OC 2CBGA 1N7GA 2E4VA 2OBYA 4B3XA 2OM2A 4OI1A 3MTJA 1I32A 1S8FA 4JJFA 1VXRA 4KQ9A 2ZRNA 1Q0ZA 2H2FA 3K53A 4LYHA 4G1BA 5FAXA 3OY7A 1YQQA 4Z0PA 5LMUB 1NR1A 5JCPA 4XGIA 3UK7A 2VRBA 3ICVA 3V46A 4UTPA 4YXFA 1HOTA 4JIGA 3KWJA 1J06A 1YIAA 1Y9EA 1TEVA 3QTBA 2B37A 4HWTA 3TZLA 1TM4E 5M3BA 4AC9A 4TYMA 1UIMA 3IT1A 3SZ3A 2QN1A 4DNQA 5FLXA 1V95A 1JLMA 2A1UA 5SV2A 4AX4A 5ALXA 2B6NA 1PW5A 5I7AA 5BN4A 3HYSA 1QVWA 5DRYA 2AL7A 3I2GA 3B6KA 3K0AA 2PE5A 2FX3A 4TT8A 3ZU2A 1NTOA 1Z0FA 1P74A 2B99A 4RVHA 2I33A 4PAGA 3C6KA 4CMIA 4RE5A 3N53A 1ZH8A 3UXHA 5KNBA 3DEHA 5AOBA 4UU1A 5FYDA 3DLIA 1JJFA 1YRBA 5HIAA 5HIKA 1WRBA 1DFHA 2YCLA 3A9VA 3E3LA 4GI2A 4ZODA 1SUCA 5C8VA 4OA5A 3U19A 3ZK7A 4XIJA 5T8KA 1SIWA 2Y2UA 3VDQA 5ESXA 1M2NA 2WTBA 1MV8A 4UNIA 3H5NA 2DHCA 3K0FA 1ZIOA 1YH3A 1V2HE 2PPVA 1T5SA 2BOVA 3PD1A 2L2QA 5F3DA 1RABA 4HLDA 2H2GA 4KDCA 5AVJA 4J3NA 4ARSA 4ZFNA 2ZXEA 1JT2A 2PZMA 4GFDA 3FVTA 1THGA 4RGYA 4OJTA 4R6XA 1FTWA 4CIVA 3MFYA 2I3ZA 1K97A 5FUQA 2XW6A 3GBVA 4KCGA 4YMWA 4IXNA 5E7QA 5LFAA 5IFKA 1JB1A 2ZI5A 4NK5A 2P9CA 3EWIA 1JDSA 4HGNA 4UAJA 4M9UA 1FXWF 5B5SA 4MAFA 3EW9A 5DHQA 4DHEA 1KMQA 3DWEX 1RYFA 3VDMA 4YFVA 1XPRA 3EODA 4R41A 5LVAA 1A0OA 2VVTA 3UWPA 2QJFA 2TSYB 1QG0A 3FLBA 2SCUA 3NHBA 2VBFA 1GTG1 3UCXA 4PIMA 1JLKA 3L4SO 3GLRA 3SDBA 2QX4A 3CLRD 3IBSA 4KI7A 4KL8S 5B1IA 1EK5A 4PNHA 2IGTA 4MVJP 3PUJA 1TTHA 3DKRA 3HJUA 4R8LA 1OX4A 1XRQA 3AUXA 4WBNF 1BA3A 2OC9A 3U3OA 2WVGA 4U4AA 5K45A 3N2YA 4CLRA 5ADWA 3QVMA 1IY1A 3SGLA 5BURA 3GQBA 1E3DA 1LF5A 4FQ5A 4UJ3A 2B2CA 2VSOA 3KKPA 2OHOA 5ERGB 1ZQ9A 1O9GA 2HB6A 2VJLA 1Y7IA 2GBPA 2OLKA 4CGZA 3B36A 2ZUTA 1BU8A 1A4UA 2WLTA 3BFPA 1JR3D 4MIYA 1G60A 1GGHA 2MSNA 1XN1A 2Q4DA 3AQIA 2VAVA 3OHMA 4Q4JB 3W8FA 3DVAA 5SZHB 3MERA 3I6BA 4MUAA 4QAJA 5IJZA 2R6DA 2PRJA 3K5IA 1SC3A 2LZ0A 2PG3A 3FG9A 3Q9UA 4PYNA 4HAUA 2F8LA 2HX1A 4BO0A 4Q4HA 1RJ9B 5LQJA 1PE0A 3CYFA 1ZOPA 2Q1XA 3RSLA 3BWMA 4EB3A 1TGYA 1QUEA 2BEVA 1IG0A 2QPLA 3PFBA 4I9UA 4PLPA 1EG2A 1R0SA 3LDUA 3AOGA 4BB0A 3A10A 4ZEOA 4RM3A 1XAGA 2I1WA 4QYTA 1PR6A 2VJQA 4RMNA 1FU8A 3F46A 3NWJA 2C3OA 3JWHA 1DBSA 1RIFA 1YQWA 4TMWA 5FUYA 4AP6A 1ELOA 4O4IA 4EBFA 3IHLA 2I4IA 4YRNA 3T9AA 1ZD5A 1TAGA 3U62A 1CUWA 2QYOA 5LP1A 4OI0A 1RYNA 2RH9B 2WHYA 1I5EA 1KDOA 3SC2A 2D7DA 4CKCB 3HDQA 4NBVA 4UARA 1W59A 4ZYTA 1WXDA 4I4CA 4N3GA 1AM4D 3AM4A 5BYKA 4CEHB 4OAPA 2FW6A 1RQGA 1E63A 2CXTA 1DHRA 4EJSA 1H23A 5LNK6 2O59A 4QXOA 4BMVA 3R9XB 2HCTA 1PJ3A 2WJJA 2HA3A 3ZY2A 1SUAA 1F0NA 1QO7A 4LTDA 5FBKA 5ICCA 3ZD8A 2AOUA 3MCTA 1NLFA 4FX5A 5T3YA 1O57A 4ILEA 4HS4A 1Z82A 2DBRA 3VPXA 4U7FA 3DYVA 1FNMA 1KY5A 2RGBA 3NH9A 5BRNA 1Y1SA 1PUIA 3SPXA 2ZK7A 4L8LA 3GU3A 4KB5A 3T3DA 1LDEA 2H08A 2XGMA 5LOVB 5DYIA 4TV8B 1BVHA 1Z22A 3IXLA 3KCNA 1N92A 3QUCA 2SKCA 4AW9A 3OG9A 4LDAA 4JGBA 3KZCA 4PLHA 3HL4A 1RHMA 4EABA 4JI2B 4ZMSA 3GF4A 3ASUA 1PG5A 1BN7A 2WKPA 3MSXA 3P9KA 4JYZA 1WSWA 3GQBB 4WK4B 2FPRA 5C8YF 2E82A 1K66A 2HKIA 3TI9A 2YZGA 4BNLA 2E3JA 3BDVA 1A9TA 3CBQA 4URHA 3U2QA 3OY2A 4HL6A 4MR8B 2WJYA 5I9MA 2W2KB 4UMVA 5AKEA 5CYPA 2A0YA 2FFBA 2ODTX 2W6ID 2UZ3A 4RGBA 4CEIB 2HSDA 4L7QA 2C3PA 3D0QA 2I6UA 3GDHA 1HE3A 1UJ6A 4B76A 4LFBB 5AM0A 2ZCJA 1QTRA 3H2ZA 2QM3A 2YRWA 4FNOA 4G1VA 3C3EA 2W00A 5J2TB 2VDNB 4G0YA 1UJBA 4M9CA 4PICA 4BKQA 5DBGA 1V3UA 5H1YA 2GCIA 2GEJA 3NHUA 4HR7A 2RH4A 2YJTD 4JEMA 1YUBA 4O2BF 1L5MA 2JKVA 4HN2A 2R6JA 1JDVA 1IDN1 2BR5A 3G3EA 3EJWA 1Y6RA 5DCWA 4CMJA 3U40A 3L05A 4MI1A 3WS7A 3IEVA 1J7KA 2W7TA 1Z8HA 1EBBA 3A1EA 5CYOA 4AULA 3W5AA 1MHTA 1N9GB 2A57A 1ACMA 4FIZA 3D8UA 4MS3A 4BMPB 4RTRA 3LLVA 3KTDA 3WV5A 3PUIA 4WERA 3TW8B 2WIAA 3ZWAA 4NWIA 2HR1A 4M0PA 3ZHOA 4FS8A 4LRSB 2XNCA 3ZDXB 2GJ8A 1PYDA 3LG2A 3PFKA 1SCNE 2QAIA 1ANKA 2YH2A 2Y67A 3PC2A 4UHBA 2EWMA 2CVQA 3URMA 3FPBA 1X2EA 2CB0A 2WK1A 4RK0A 3HCPA 4E5UA 3IPAA 4PR3A 1JECA 3IALA 3RTEA 4YV2A 5HPYB 1UXGA 4QUIA 4B81A 3X2EA 5K01A 1TFUA 4E5MA 1RCUA 2J1LA 3F9CA 4IXTA 4QBKA 1DRVA 1MJ5A 4R3NA 3GDGA 4UM5A 2C42A 1LQTA 4YCAA 4P93A 1L1FA 5EKDA 1DCMA 3UJ8A 3EEQA 3VMMA 4K6CA 5B57C 1E2PA 1WXHA 1F4PA 3O8QA 1IZ9A 2GAAA 3DL7A 2X6TA 4DMKA 5HYVA 1UL1X 3GBSA 3OX3A 3V00A 1D3AA 1SKUA 1HQKA 1WWKA 5DN6A 1BDBA 4GZLA 5B12A 1W5EA 3VPAA 4EHKA 1UC5B 2XOXA 2GZRA 1XEWY 2DJIA 4GM0A 3I61A 4JI0B 4J94A 2X2OA 3REOA 3BDIA 3QXCA 1G2IA 3W1WA 4IL5A 1B3BA 1MOPA 3V5NA 2WAXA 4XQEA 1A98A 4UDYX 2B36A 2X2FA 1P7PA 4IDEA 2ACEA 4KFSA 1WS6A 1O58A 4O59O 1BWRA 4GOXA 3SBXA 5A7GA 3SFZA 2J3IA 4B3JA 3IIMA 5D3MB 4MGYR 1PN3A 3RS7A 4AO7A 1EM8B 5A1JA 3H2YA 1AHHA 1VHTA 2ZP1A 1KL7A 2IHTA 1NUSA 1BMFD 3EIXA 3SFVA 1A76A 2GAFA 3LZCA 4D8TA 2ZJBA 1JDNA 2JFQA 4IO1A 3I09A 4OMDA 5A03A 4UNRA 1R64A 3MLEA 4HDOB 3T3IA 2C5SA 4PLVA 4Y6LA 2JFWA 4NPAA 2EW8A 5AUPB 1D4ZA 4WA8A 3VYRB 3I32A 2YNMD 4C08A 4DADA 3DPUA 2PV0A 2D8AA 3CEAA 1RYZA 3E3MA 1PSDA 5P8WA 3UV7A 1YKFA 1FX0B 1UOEA 2Z6UA 4Y6GB 5E4JA 1SZDA 5H82A 1EFRA 1E6WA 4R83A 4PGAA 1ZK2A 3QOFA 3WZ2A 3KBBA 2BSQA 4CG1A 4AZ0A 4TL8A 3DBRA 2I2BA 3P94A 4MZDA 4Q1EA 4XOUA 3U3DA 4C1BA 4QYSA 4DLKA 2IUFA 3IPCA 4BYGA 2M2IA 2H6EA 1U5BB 1VE6A 4IZHA 3O8OB 4FFRA 3GLQA 2O1WA 5EQDA 1J1ZA 1URPA 1P6QA 3C1AA 1V7CA 4ZO8A 5LB2A 1G0OA 2QF7A 3QFTA 3QG1A 1HBJA 2F3PA 3FIJA 1ATIA 3CUWA 1V4NA 4RKEA 2FZVA 3RKUA 2FRDC 1TO2E 5CU7A 3HBLA 1FU4A 1NDQA 2RC5A 2I76A 1D1QA 5AP9A 4C4YA 2YHIA 5KMGB 1KEEA 3ANYB 3PQDA 4PSVA 4DABA 1V16B 4IIHA 5KTOA 2IOYA 1U8UA 4N3NA 5LD2C 2IYYA 3N2EA 3EEOA 1L7OA 2Q5HA 2O4CA 5DWQA 2PDAA 1E96A 2PQ2A 2XKBA 2VZ8A 2JI6A 3REQA 2CDAA 4BIMA 2I2XB 3EUFA 5AI0A 2Q5FA 4XVCA 2WWWA 8LDHA 4YRFA 1FP4A 1YZTA 1M73E 2X8JB 3M3DA 6Q21A 4KZKA 3K70B 1JHQA 2WMYA 4CT4B 1U2QA 5FOWA 5LU8A 1CU1A 1R10A 3IIIA 1B73A 1Q1NA 1A4XA 4HTFA 4YAGA 1AG9A 1AV7A 1GUDA 4Q4AB 3TQTA 4C7VA 1J0AA 1E4YA 5FBRB 2O2GA 5C53B 3WLIA 4HZGA 1FDRA 2LRHA 2Q2QA 5JFTA 2J9FB 1AMNA 2ODEA 3ZJVA 3M2TA 3B6EA 1HMPA 1IPHA 2QS9A 3HE3A 4KODA 3D1JA 4MS4B 2DQZA 3T4PA 4AK9A 5EPOA 3DXZA 1RMTA 3L6OO 4BMXA 1BNCA 1T8YA 4NULA 2QUJA 2PO7A 3TLXA 1G8PA 5LA6F 4G37A 3VZQA 5HKKD 1P9LA 1YS2X 1Z8NA 2V7PA 3NASA 4TS4A 5B1HA 4C7MA 1IOVA 1FDSA 1QU2A 4D25A 1GTMA 2HJVA 2V0GA 2FNAA 3BWBA 3IJPA 5HUHA 3T3HA 1MAUA 1ULUA 1YR9A 3C6ZA 2RAPA 4JJAA 4ZARA 2R5NA 1YU6A