1O3YA

Crystal structure of mouse arf1 (delta17-q71l), gtp form
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
166
Chain Sequence
b'GSMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGLDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title Molecular mechanism of membrane recruitment of GGA by ARF in lysosomal protein transport
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 55
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1o3yA00
4S2EA 4NCNA 5AJXA 2ZAOA 3IPYA 1NMXA 1DG3A 1A1VA 2FG5A 5KSYA 3EG5A 5JWHA 2N46A 3CF2A 5DHAA 5LD2B 2DFTA 5TXGA 5LB4A 2EFHB 1N25A 1W44A 3IPXA 2FSFA 4B3CA 2Q6TA 1G64A 4DEXA 4KSCA 1A7JA 4JBXA 3H1TA 2A5YB 5F9FA 5KO2A 5JJKA 4OYHA 1KDOA 1GRNA 3MWJA 3P4XA 4C0SA 2IWHA 1P2VA 4D26A 2BEKA 1DAIA 2FH5B 3GJ7A 4IDOA 4N3NA 1OIWA 4NCJA 2Z0MA 4LWZA 3H0KA 1XJQA 4LCBA 1FP7A 2QM8A 4D4MA 2EFDB 1Q21A 4Q9LA 5C18A 4DT1A 1G3IA 4AURA 1G7SA 1SQ5A 4WZ6A 4E5UA 3UATA 5EE9A 4JYCA 3T06B 4DCTA 5FOUA 1G5PA 2E1RA 3JZAA 3AF3A 3DKVA 1XEXA 3AVYA 3P27A 2GJSA 5KDOA 5LB2A 2YVUA 3KQHA 4GP6A 2BV3A 3RANA 4HUQA 3I92A 4TTPA 1UKEA 2L0XA 1GNPA 1S9HA 2J7KA 1R2QA 4DKXA 4BE7B 4DCVA 3C15C 1P6XA 2QAGC 2FN4A 3IEVA 4BEBA 3SI7A 4IDHA 1TF7A 1T3LA 3NBYC 1LFDB 4Q1FA 1VDZA 5C1BA 3U4QB 3HWSA 1OH6A 1TEXA 3FHCB 4L5BA 1DPFA 1VCOA 4PAQA 4HATA 4BLOA 3BGWA 5FUVA 3GLFB 3KTAA 2ZRAA 1D6JA 1E98A 1W0KD 4JL6A 5DSZA 2OCAA 4B71A 5TDHA 3NIBA 1G6OA 3RWMB 1GL9B 3PIRA 2VLIA 3CKLA 3I32A 3DHWC 2GEUA 2GXUA 1L4YA 4TT3A 1B0UA 1P61B 4JSYA 3FVQA 3MJHA 3ZQ6A 2NG1A 1E9EA 2VA8A 2GXSA 3THYB 2REOA 2BM1A 3W5JA 5BYKA 4FN5A 1VCNA 3HU3A 5BW8A 2VP4A 3KQNA 3B85A 2PZEA 3L2OB 3QKUA 3TSWA 2XB4A 3I4LA 4QNMA 5FI0B 2VSXA 5CLQA 4HAYA 2BMEA 1G8YA 2RGXA 1TPZA 1NN1A 3SU8A 1NN3A 1W5TA 1E9SA 3EW9A 3CX7A 1KI6B 1MABA 5GADl 2IS2A 1U8ZA 1OB2A 2F3TA 5LDDC 1PVOA 4LUCA 3GJ4A 1WBBA 1LNZA 1MO6A 2BMJA 3SJCA 1T8UA 3O8BA 2JLQA 1P62B 4IDPA 4DCUA 2RCNA 4U02A 1AZTA 1U9IC 4NYIR 4X8OA 4BLQA 4LYJA 4NCKA 2IW3A 4JLVA 4Q4JB 3TE6A 1M7GA 2YOFA 3WNBA 3E2IA 4M1YA 2RHDA 2QBYB 2QY9A 2F43A 1HT1E 1NVVR 1Z0AA 2AN9A 4PQRA 2XJ9A 3LBNA 1F2TB 2X19A 3WHLA 2P6RA 2QEQA 4TYQA 2BC9A 2JCSA 4PFSA 4Q1CA 1SZPA 4XWKA 2J87A 1Z6AA 1AKEA 2ODEA 2RGNC 4TMTA 3IUYA 3EIQA 1YE8A 5FOTA 4XVQA 1UEJA 3Q5DA 2P5TB 3M0EA 1E94E 4II7A 1E2GA 4V0ME 1Z83A 5L3SA 4KYIB 4DSOA 3EASA 3IHLA 1NLZA 5GJWC 4BASA 2PT7A 3DVLA 2RAPA 2VF8A 4KBGA 1EFTA 4FMDB 1E9DA 5DO9A 2ZSBA 2I1QA 3QI2A 1R5OA 4OQNA 3FOZA 2J0UA 3I61A 2QTHA 1SGWA 1AS2A 1U90A 1SXJE 2VHQA 3TR0A 2WPDD 3W9YA 5JHHB 3RLFA 3C8UA 2QN6A 4XVRA 4BZPA 3SYKA 1X6VA 5H1YA 2WHXA 2ZS8A 4W5WA 5IRCD 2J41A 1QHXA 4EPRA 1FP6A 2DBYA 1RRFA 2XGJA 3CNOA 3FPAA 1N6PA 2QG6A 2QE7A 1QZXA 1GNQA 3VKWA 1IY0A 1PUJA 2G88A 3BFKA 4Q9HA 3VX3A 2IS6A 4D4LA 1QHIA 1T5IA 2O52A 3NC1C 3QF7A 3U3JA 3T1QA 4HDOB 2PJZA 4ZO4A 1NY6A 2WM9B 2XZLA 5CLLA 2O8EA 1JJVA 4BLSA 1T5LA 2GZHA 3R8FA 1E9FA 3LBIA 3EA5A 1F2UA 3PUYA 5D3MA 4P4TA 2J7PD 2AD5A 1DBSA 2YC4C 1I4TD 1DAEA 2AFIE 5FPKA 3Q9LA 1Z2CA 2D7CA 2GCOA 4B74A 4AKGA 4EPTA 1GKIA 3CRVA 2XTMA 2QPTA 2VHCA 3B2EA 4S35A 1N2CE 4NE2A 4U5XA 4ACBA 2IUUA 3LY5A 4BRWA 4QJ4A 4DVGA 4L9SA 1KI2A 4OK3A 3V4RA 1NIJA 1W47A 3REGA 4RD3A 4W5HA 1JNYA 5DI9A 4CEHB 1DG1G 1Z6GA 1SKYE 4Q1BA 2HJGA 1P9RA 5DIFA 3VR5A 2CCGA 2PBRA 3SJBA 2O8FA 3OZXA 3SBEA 1IY1A 1G19A 4A6XA 5SZKB 4AYTA 4C7OB 1ZD8A 2ZU6A 2ZI9A 4F93B 1M7HA 1X86B 4URYR 2IEYA 4PQYA 4Q4HA 3ZDQA 1TU4A 3PEVA 4EJSB 1OFIA 1Q1QA 2VQSA 1F6BA 2PX3A 4B76A 1VECA 4QM7A 3WRYC 5CJ2A 2O8BA 4C9BA 4Q00A 2Q21A 3QKRA 4NYMQ 2IT1A 5BYJA 5AJWA 3ETLA 4PQFA 3QQ5A 3GEEA 3B1WA 2J46A 4XTRA 5DHFA 1ZM9A 1Z5ZA 2WIBA 2YWGA 4US1R 1GTVA 4IDNA 3FE2A 2AXNA 3WHKA 3GEIA 4DDVA 2P6NA 1NI3A 4PSAA 3UMSA 1OXXK 2WTUA 3QEOA 4IVQA 1S1MA 2OCYC 5FL7D 5JRZA 3A6PC 3GMTA 3W5IA 5C2JB 1IXRC 1R0WA 2YKGA 4WZAE 2WWYA 4HLUC 1JJ7A 2Q9AA 3L0IB 4OK5A 1HT2E 4D2IA 3EIEA 5EP3A 1E4VA 4RCZA 3PFIA 3KQUA 4K81B 1NG1A 4MRSA 4ZPXA 4F38A 2OCPA 4H1UA 5BN4A 4G0NA 4NYJR 3RSLA 1C9KA 1NL3A 2PEZA 2UZIR 2GA8A 3CRQA 3PEUA 4M1KA 1E2FA 1EFRD 3UG7A 3R7WA 3GLHA 4NONA 1KSHA 4ZDJA 2NO0A 2J0VA 3RRMA 5AK0A 4MDEA 4A8JA 5IK2D 4PX9A 2ATVA 4HZUB 1E6CA 4C2TA 2MSCB 4OJKA 1KHTA 5J4VA 2IBMA 2P0EA 4KYUA 3ZVNA 2WPDA 2XJ4A 3OAAD 4IEIA 5JSZA 1OV4A 1W0JA 3I5YA 2WAXA 4IXMA 4WIAA 1K5GA 1T0HB 1KO4A 4C30A 3VTKA 4I1VA 3FB4A 4R2HA 1DO0A 1DVRA 3CPJB 2A7QA 4C0AC 2C9OA 2D4HA 1G7RA 5TB5A 3EC1A 4GBMA 4B73A 3B1VA 5J4KA 5G3ZA 3H84A 3IBYA 1XZPA 1RIFA 1YJ5A 1KDTA 2H1LA 2VHJA 1I4DD 2EWWA 5L3VA 1LTQA 3QXCA 5IF9A 3ADKA 2ATXA 4OKSA 1ZAKA 2CXXA 1D5CA 1GKYA 5BQ5A 2PH1A 4K46A 1XTIA 1Z6TA 4DRZA 3CONA 5JEDA 2PZFA 5JS7A 4NH0A 3K09A 2NQ2C 1XXHB 2XB2A 1KNXA 2ZRKA 3AKDA 2OUKA 4ITRC 4PZYA 3RRYA 2QT1A 1IBRA 3O47A 3IO3A 3K0CA 3IQWA 1RJ9B 1XTRA 2GESA 2MMGA 3GCGA 4BLRA 5EXSA 4DXAA 3TKLA 3SFZA 1JQJC 3KUDA 2RGEA 5AJVB 4A9AA 4D82A 5CB6A 3QXJA 3TGPA 2QGNA 1NRJB 1KTVA 1CRPA 2IS1A 1M34E 4FMBB 2WWGA 3SS8A 2DPXA 4HUTA 2GAAA 4YMVA 4BECA 1F48A 5H70A 2GXQA 1XD9A 2D3WA 1W4AA 2OSBA 1CBUA 1ZIOA 2WSSD 1KO5A 4OQLA 3UK6A 2P67A 2A5GA 5FBRB 2KI5A 1E2KA 2XTNA 3PENA 2VP2A 3AF0A 4KXFB 4TTQA 4TWZA 5DE3A 1RPZA 3U3OA 3TH5A 2LCFA 1QBKC 4LHWA 2FFQA 1FNMA 2N1BA 2OESA 1RFLA 3GJ5A 4UXJA 3IHWA 1EG7A 1U81A 4Z51A 2J0SA 2IS4A 1FX0B 3HR7A 2QPOA 2FSHA 1EK0A 2BKUA 2FGKA 4D25A 2AFHE 3EPJA 1SVLA 3LV8A 4GMDA 3QKSA 4HLCA 4TLDA 5HZKA 4RFSA 1XNJA 1PJRA 3KX2A 3KKNA 1RYHA 2BM0A 1S8FA 1D2MA 1J7KA 1GVNB 1MR3F 4H1VA 3KB2A 5FTLA 1GRQA 3VNVA 4Q18A 4B6FA 3K70C 2NZ8A 2JATA 3MRSA 2RGAA 2WJHA 3P1JA 1W36C 3V00A 5K8IA 1XPRA 4QHSA 4A15A 1KY3A 1XFAA 2GBLA 5EE1A 4EPYA 4X8HA 4NKRA 1ZD1A 2GK6A 3T1TA 3RS7A 2O8DA 2B21A 4ON9A 1KK0A 3THWA 2GVZC 5H68A 4POAA 3WBKA 1P7CA 3BWDD 2ZRIA 1WE2A 4QNRA 2HDNB 2WZQA 4RD2A 3U60B 2GKSA 1KI9A 1E2IA 2BMFA 4NL4H 5KDDA 2W00A 3EZ2A 3MWYW 4LSGA 5K8TA 3SJAA 1ONBA 1TQ6A 1PV4A 2WJVA 4QGFA 1MO5A 1OJLA 3MWKA 2FFBA 3TJZA 4ZDKA 1W36B 4GOJA 2XAUA 2QZ4A 1RKBA 5G40A 3X2SA 5UKDA 4JBWA 2HXSA 1G41A 1EESA 2HF8A 2IXGA 5GJBA 5E7MA 2OAQ1 4OI1A 1MOZA 3NDBB 4Q7KA 3BBPA 3CPHA 4JSTA 2JIZA 4FW9A 5LBIA 4RD0A 4ASUD 3TBKA 2BIFA 4L16A 3BB3A 4US2R 1A2BA 2FU5C 2CE2X 4K8OA 3EX7C 4NP6A 1T8TA 1GUAA 2ZS7A 3R20A 5FI1B 4B3FX 2QP4A 5JFGA 1U8AA 3FGNA 4M8NE 2CBZA 1AKYA 2ANCA 1Z07A 2PJRA 4C0HA 1RVDA 5KHOC 3AF2A 3NH9A 1M1YE 1XD8A 4HYYA 4HSEA 4C0QC 1KAOA 2FX3A 3A37A 1II9A 4M22A 4LV8B 2Q0HA 2P6UA 2C77A 5FTKA 4RD1A 4JLAA 3WMGA 3A36A 1JQLB 2CLCX 5EE0A 2ZS9A 5KUTA 5L3QB 1VPLA 2IUTA 1E4YA 3PUVA 2W6JD 5BWMA 1NBMD 4JL5A 3O8RA 5G41A 3CRRA 4QG7A 3FYHA 1E1RD 4TSFD 5AJYA 1GSIA 2B7BA 2GJ9A 3KKQA 1E1QA 4NPHA 5JI3E 1P2TA 1LF5A 2C99A 1OIVA 3VKGA 3CF6R 1JBKA 4YLGA 2QSYA 1G20E 5IHPA 2ZEJA 1UAAA 1ZU5A 3B60A 1S4QA 2EFEB 3B1XA 4EAQA 1DADA 3FKSD 1GP2A 1OXUA 4Q7JB 2YOGA 4RD4A 1VG1A 3U3MA 3OIUA 3NTUA 3BFXA 4A0HA 3DO6A 5JCPA 4RZ2A 3CPEA 3LFUA 4Q21A 2FE4A 1FZQA 2DFKB 5K8LA 4JKIA 1FUKA 5CK4A 2V1UA 1KY2A 1R0XA 1XMVA 1Q22A 4JVNA 4Q19A 5FOXA 2LKDA 2B92A 1J8YF 5GJVC 1N6KA 4BFWA 1CJTC 4Q9JA 4L9WA 2HUPA 4QL3A 3A1UA 5TY0A 5P21A 2CNWA 3TUZC 2A30A 4MRPA 4KLNA 3M6AA 3CLVA 4RKFA 3W8RA 1G9XA 2O0KA 3KZ1E 3GFOA 4MKFA 2ZJBA 4EQ6A 4XD7D 3SZRA 1SXJA 4WZBE 1E2QA 2Z4RA 3SYLA 1KJYA 1Q0UA 2DHRA 4OJQA 4A6PA 1Q3HA 1P3JA 2F9MA 2QMHA 1IONA 1KK2A 2IHYA 2ZSFA 2CL7X 3BD9A 3THOA 4JLKA 4AG6A 2C2HA 3AP1A 4M53A 1G5TA 1NSFA 4HB4A 2BKEA 3M4YA 2AD1A 4GFDA 2DY1A 2RB4A 1U2RA 4NCHA 1VIYA 5FTNA 1UDWA 5E3HA 2YZ2A 4DCNA 3EPHA 3WNCA 1E9RA 3B6EA 3AP2A 3AUYA 3QEJA 1CR0A 5FUXA 3SBDA 1E9BA 1XEWY 5JHGB 3ZVLA 3A1WA 4ZIRA 1OSNA 4ABYA 3WY9A 2MSEB 4IHQA 5EP4A 2R44A 4N1AA 5E7IA 4V0KA 1O3YA 3I8SA 2V1XA 4M1OA 2KB0A 3CM0A 4A2PA 2ZE5A 2VYFA 2XOKD 1N5JA 4QBFA 4XSGA 4LJ6A 3N2EA 2ZRGA 1OH7A 4V0LA 1TF2A 1UJ2A 4Z1MA 3DOEA 2NO9A 2CVFA 2R6DA 2JAQA 4GP7A 1VMAA 3SFVA 4H9GA 1YU9A 4ZCMA 1P5ZB 2GJ8A 2XX3A 3P32A 5J4YA 3Q7PA 4FINA 3PUWA 1AQUA 1XPOA 4FWIB 4X8MA 5HPYB 1Z6XA 1JXMA 1ODFA 4Q5IA 4DC9A 2A5DA 5FTJA 5EE3A 1BMFD 5J47A 5HCIA 3D3QA 4BZQA 3J81k 3CZQA 3I72A 3X1DA 5JRJA 2YHSA 2ZI3A 4NYIQ 2JLYA 1G8FA 2FA9A 1XF9A 2ONJA 4AD8A 1GOTA 3ZS9A 1IM2A 1NJFA 4KFTA 2CMKA 3DZ8A 1CJUC 5J4HA 1YR8A 4CEIA 4JL8A 2NGRA 3WYGA 1D9XA 1NVVQ 4LJ4A 2CK3D 3C16C 2H8KA 2ZJ5A 1II8A 2LWIA 4TMZA 1TTTA 4JVSB 4KU4A 4ZV4A 2CEAA 3OE7D 2RGBA 1NJGA 2BDTA 4TMVA 4RJLA 4DHEA 3LLUA 4JJZA 1TL7C 2ZYTX 1PZNA 1YHNA 2D06A 1WBDA 4RY2A 4ZCLA 4MUBA 2QTFA 1U8YA 4OQFA 2J59A 1G3MA 2YWEA 4JS0A 4Z8YA 4KCGA 1Z3IX 2H18A 2CCJA 4UKDA 2P5SA 1US8B 2XEXA 3R8CA 1E79D 2XNSA 3IDQA 1YR9A 3EWSA 3IKJA 2WWWA 3KB1A 3EZ9A 2ZM5A 1J99A 1VG9B 1CXZA 2G1KA 3MD0A 2CJWB 4TYNA 3QF4A 1G291 1S3GA 2DWPA 4UNNA 4UQOA 4W7SA 4D0GA 2IWRA 2RGDA 2ONKA 2FPLA 1E2NA 2PZGA 1EFHA 2V8OA 821PA 4DUGA 2HF9A 5HKKD 2ZE8A 721PA 3A58B 3LQRA 3VKHA 2I1VB 1E0SA 2OFXA 2O8CA 2IYQA 1ZUHA 2Q9BA 1XTSA 1N3BA 2J0UB 2ZI6A 2ZSDA 3THXA 3KKOA 4IOJA 2H57A 2WOJA 4JKYA 2KJQA 2REXB 1ZNYA 4IKEA 3DM5A 4RFVA 1G21E 1ZCAA 4IFEA 4P31A 4Q66C 3W6NA 1ZMXA 3AH8A 1ZUIA 1W4BA 4FIDA 1P60A 2XOKA 4BLTA 1UFQA 2ZE6A 1NNEA 2PT5A 621PA 1W1WA 2A9KA 2NO6A 2V9PA 1GDDA 1GRRA 2O8EB 3U2QA 1HQCA 5FUWA 1N6IA 4HZIA 1OHHD 2HLDA 3GLIB 3AVXA 5JCZA 1CKEA 4YXWD 5DH9A 5DN6D 3OF5A 4OQXA 1JI0A 3RHFA 4W9MC 1CR2A 2DWQA 4RZ3A 3TSZA 4TLEA 5FBQB 1GWNA 2QAGB 1D2NA 2QI9C 1ZM4A 3RWOA 1W2GA 3GLGA 3KXIA 2JDID 3KKMA 1KI3A 1TAGA 4FCVA 4BLPA 3U7HB 1AGPA 5FPHA 4ZDWA 2JLSA 3BB1A 1LY1A 4QKQA 5EE5B 3QENA 2WKQA 4W5JA 2Z6VA 2ORVA 1XWIA 5EQTA 1VHTA 3H4MA 1E2PA 4FCWA 3TAHA 2ZUBA 4XSHA 2J0QA 2HYIC 2EW1A 3SNHA 4IVRA 2H5EA 1GILA 2PLFA 5F98A 1L2TA 1ZCBA 2CK3A 3WBJA 4PR0A 3QOFA 4IDQA 4MRNA 1YRAA 2DFLA 4EUNA 4KO8A 3K9NA 2BWJA 2QL6A 3BS4A 5EXXA 3A1SA 3FMFA 2VF7A 2J9RA 5JLJA 3ZGXA 4KFUA 4C2UA 4DB4A 1ZM7A 4PO1A 4Q4AA 4URXR 3Q72A 4BUJA 4Q1EA 3BJIC 4OK6A 4C0KA 3O8DA 1XDBA 4TTRA 5FBLB 1DE0A 4UJ5A 1Z2AA 4B48A 4TYYA 3K0AA 4NYJQ 3LNCA 4A8JC 2BOVA 2AK2A 5HCNA 1GL6A 2ZIAA 2FNAA 4JLBA 2GDJA 3SHWA 2OLJA 1JB1A 2E9SA 4JLNA 3AVUA 1KI1A 4LHYA 2IA5A 5BN3A 1QG2A 3AF1A 1XXHE 3MMPA 1JR6A 1CP2A 3KXLA 5E4FA 1NKSA 2OM2A 2JJ1D 3A1TA 4MGZR 3ND9A 5HE9A 4LX0A 4ARZA 1VIAA 1KSFX 3ZQJA 2NOAA 4PC7A 2XSZD 3AKCA 2CCKA 5HKKA 2C9CA 2ZSAA 4CF7A 1UBCA 2ANBA 1QHHB 3VHXA 2QTVB 1H8ED 4HAVA 4CZ2A 1CS4C 2WWHA 2W0MA 2ZRBA 3N5CA 3QJYA 4G5RA 5A4JA 2IHBA 3EC2A 4WBSA 1Z0KA 3U61B 1OPXA 3RC3A 4F4CA 1OT3A 2EWVA 5DYIA 3PG5A 1DAFA 3I73A 3QG1A 1MO4A 3UG6A 5JSZB 1G6HA 2Z83A 3QBVA 4TL7A 5D3QA 5AR1A 3K09C 3O8CA 3OIVA 3QE0A 5EXTA 5B64A 1UBFA 1N6NA 5TMPA 3K0CC 4DWJA 1OW3B 1BH2A 2P2LA 3R9XA 1HY3A 2B8WA 1T91A 3BXZA 2W2TA 4N0EA 1IN8A 1W0KA 3A1VA 3Q8XB 3QKTA 4M1TA 1GKUB 1XU4A 4B32A 2HXYA 2QAJA 2PMKA 4L4UA 3K0SA 1K8RA 1I2DA 3NDPA 3RDPA 1G8HA 4TMXA 3NHBA 2ZJYA 3REFA 2AXPA 4OHZA 4B44A 4KODA 1W4RA 2O0JA 4D81A 5A5GA 2A5FA 2Q3MA 1FMLA 4EFLA 2WJGA 4IRUB 3FKQA 2ZJZA 1AGRA 5HTKA 5FL3A 5B30A 1IJEA 2F1JA 4DSUA 2QMEA 3KJIA 3RAPR 5AUQA 1U99A 1NMYA 3CR7A 4LHXA 3GLFA 4L8GA 4UXIA 3KQKA 4LOAA 1TMKA 2CL0X 4JT2A 1N6RA 3MJRA 1ZRHA 2EFGA 1LV7A 5GJCA 2R9VA 4HLDA 2GBLC 1IN4A 1E69A 2RGCA 4HB0A 2CLDX 2XXAB 3THYA 1KSGA 2VIIA 3K9LA 3AF4A 4C3ZA 1KO7A 1NBME 3R9IA 4KLZA 3EZ6A 3TQFA 4EPWA 3KUCA 4D6PA 5FOVA 4KBFA 1ZNXA 3W8NA 3WNDA 3AUXA 4TL9A 2DYKA 4XTCS 1Z6YA 2IYLD 2OLKA 4F4JA 5F3WB 3UPUA 1X1SA 4XOIA 1M2OB 4J0QA 2ERYA 2QRZA 5CM9C 2GJKA 5DYGA 3HP1A 4F91B 3IIKA 2C9YA 1P75A 1T6NA 2ZRNA 3BC1A 1KI6A 4MQBA 3CO5A 4ESVA 2ERXA 1JR3D 4O0MA 1VKJA 2Q3FA 3DMDA 3KXKA 4XH9B 5AWFC 1IN5A 1GG2A 3CNNA 1Q1EA 2EFCB 2FPKA 5JWRA 1VCMA 3ADCA 3IIMA 4LV6A 4QHYA 1Y3AA 1KI7A 3EAQA 4TQUS 1ZNZA 3HU1A 4NCIA 1H8EA 2IC5A 5BXQC 2A78A 1R4AA 5LPNA 2YWHA 2GK7A 2OBLA 3AVTA 2XZPA 1FTSA 2ZANA 3BERA 3X1ZA 4LDJA 4Q4JA 2HCJB 3QSYA 4BEJA 4ZI3A 1G8PA 4A2QA 2QBYA 1COWD 1Z8FA 2ZJAA 5CITA 2BVNA 2RHMA 3NBFA 2EYUA 1F2TA 2VP6A 4A2WA 2HV8A 4QGAA 3LBHA 1XEWX 2CDNA 3NHAA 4Q1AA 3LA6A 5ELXA 1CJMA 3TNFA 4D4KA 1KMHB 1KYIA 3HYRA 1A82A 4LBWA 4PO9A 4RD6A 2QUZA 3RS4A 4AYXA 2ZQ5A 1W46A 1G3QA 2WWIA 1TQDA 2G83A 2ZETA 2WIAA 1LW7A 4B2LA 2ZRFA 3U44B 4CEJB 2GWHA 5JEEA 2J7PA 2GZAA 1IHUA 2FEOA 1ESNA 2YV5A 4C7OA 3LO5A 4Q4LA 4A0RA 1JEEA 4LRWA 4OL0A 3ICQB 2YWFA 2ZSEA 3PXGA 3FTQA 4WXRA 4YDHB 4PAOA 1NN5A 3DEFA 3SJZA 2JLRA 1FPMA 2G1JA 1XPUA 4R2IA 3PCRB 2WWXA 5FR1A 2ZITA 4MRRA 4UNPA 2VL7A 2A3RA 3GJ6A 1YZKA 4Q01A 1XMIA 3C7KA 4AG5A 1M6NA 1P9WA 3RVBA 2WJJA 4IOLA 2HJVA 2PL3A 4P4SB 5FBWB 1E96A 3VU9B 2JLVA 1HURA 3OIYA 4KVAA 2IL1A 2H7VA 4JLOA 4MYHA 5E7JA 5KOYA 1MKYA 2ZRCA 3CNLA 2R6AA 5CYOA 4JIMA 3GLGE 1SXJC 1F5NA 3H2YA 5B2ZA 3PITA 2ZAMA 1DELA 5FPSA 2RH5A 3X1YA 2QMUA 1Z06A 4A92A 4TMWA 2J45A 2R6CA 3BORA 1JPJA 1P2UA 2KSQA 2V7QD 4MYUA 2F3RA 2ZRHA 4Q9KA 2DWOA 2HYDA 4MYCA 4OI2A 4CEHA 2QQ0A 3PVSA 1DAGA 3WP0A 1HA3A 4BFVA 4AI6A 3BOSA 4PZZA 2Y8EA 2NIPA 2BCGY 4NU0A 5FL7A 1OKKD 2IYXA 2Q3HA 4GZLA 1E2MA 1T9HA 1IXZA 4WW0A 2IYUA 5DI3B 3OFND 3SHFA 4C0LA 4WOPA 4HAWA 4TLAA 1ZINA 4MGYR 4EJSA 2E87A 4M1WA 4JBYA 4MGIR 4DDTA 3C5HA 1XD2B 4PANA 1XBTA 4LHVA 2ZJOA 2WICA 5EXPA 4PC2A 4DLSA 1BO6A 1EFRA 4B6EA 1MT0A 4DLXA 3K0FA 1OF1A 1VTKA 3BRWD 3VMFA 4IOMA 4A4DA 4BFUA 1LF0A 1NLFA 3DMNA 3DOFA 3V9PA 4EIWA 3B13B 5IK2A 2AWNA 3QBTA 1ZD9A 5E95A 3E1SA 4B2PA 3VAAA 3K70B 3UXMA 3OAAA 4LPKA 2ZRPA 3PR1A 3QPVA 4BFTA 4DB2A 4JLJA 4BFYA 2IF2A 5F2EA 4XWOA 2JJ2D 2QROA 4UNQA 1N6HA 3D7MA 3F8TA 3OEHD 1AN0A 5JBQA 3AVPA 1GITA 2OILA 1WMSA 1PLJA 4OHVA 1CIPA 2WMOB 4DJTA 1CTQA 1RRPA 4NTZA 2B7CA 1D2EA 1XCPA 5EUMA 2KWIA 5FOWA 1RRCA 4EKDA 4URVR 1Z29A 3WRXC 1LVGA 2YNMA 3B82A 4LJ7A 2KBFA 4M9ZA 3KFVA 3S1AB 2OBMA 4HZUA 1NSTA 3K70D 3HYTA 3TK1A 1KDRA 1GL7A 1HH4A 8OHMA 4XVUA 1W36D 4BPBA 2XNDD 1GFIA 4JZKA 3RRNA 4KAXA 4Q48A 1M8PA 1RW4A 5CB8A 4LYFA 4IXNA 3ZVMA 4LJ8A 4DLWA 4OHXA 1CJVC 4V0OA 2AL7A 4ERNA 1H8HD 3CRW1 4PO8A 3R9WA 2EU8A 2QT0A 4C4PA 2QGZA 3GJ8A 3QVUA 4BFSA 5KNCA 2NMVA 4AKHA 4HDQB 1J70A 1XTJA 2VO1A 221PA 3CB4A 3QXSA 4BWYA 1GM5A 5C46F 1I2MA 1X8LA 2WSSA 3UWKA 3AP3A 4RZXA 4CEIB 2A5JA 1XMSA 2CHVA 2ODNA 3DDCA 2FZ4A 4IJMA 1II8B 5JJLA 3DPUA 1WP9A 2WBLC 3BAFA 4UNRA 1XXHA 1N5LA 4LJYA 1E2DA 1EFUA 3ONWA 4DLYA 1SVWA 5CIWA 1NP6A 1GAJA 3ZD6A 2I4IA 2AX4A 3VR2A 2V7QA 3G82C 4FMDF 1AA9A 1RJ9A 1YR6A 3TAUA 4TN1A 3B78A 2YINC 3GLFE 4O3MA 5EUQB 5JMTA 3BK7A 2GEDA 1N0VC 4ILEA 3G0HA 2GCPA 3L8YA 1QDEA 2R8RA 1QHSA 1OYWA 3IO5A 4M0LA 3GLIE 3OFNA 2JGNA 3X1WA 1ZVQA 1IN7A 3QXHA 1U0JA 4TYWA 1F60A 3B9PA 3SYNA 4R7ZA 2PLRA 1N5KA 3UIEA 2W6ID 4TL6A 1E2JA 4GOKA 1JPNA 2UZ3A 1RRGA 3EWAA 2WKPA 3QF4B 4NZYA 4QXAA 4BZXA 4Z8XA 1SHZA 1FX0A 2QRNA 4HEJA 2R6FA 1AM4D 1JALA 4M1MA 3GP8A 3MUFA 3I3SR 4DT1B 2GCNA 3LVQE 4B3XA 4U7DA 4DLZA 1MO3A 1YZLA 4QFMA 4YMSA 4DCSA 1U94A 1XEXB 5DLQC 1PUIA 3VX4A 3E70C 1A4RA 2BCJQ 4HUQB 3W34A 3JZMA 3LWNA 1MH1A 3WYAA 1UBGA 4MKIA 4CGZA 1ZUNB 4IOKA 5EZ5A 2D2EA 3NH6A 2O5VA 2X77A 2VH5R 4GT1A 4I1SA 4B34A 4GRAA 1P9NA 2W83A 3CX8A 1EWQA 2XTZA 1MRNA 4ASUA 4TLCA 3HPRA 3RS2A 2IYZA 1Q3TA 1CR1A 5DNYB 1Q1ZA 1XTQA 4QBIA 1KI4A 3KTAB 5TARA 1XCGB 5H8WA 1WQ1R 3MWLA 2H16A 1G4UR 2NO1A 3ICEA 1OXVA 1X3SA 2KBEA 3HDTA 4NMMA 4PC6A 1E0KA 3PV0A 2PCJA 3GFTA 4Y0VA 5TVKA 4GL2A 4GNKA 3CF0A 3DL0A 2QNRA 1S2MA 5KYKA 1R6BX 1G3UA 3NC0C 1ZU4A 1PLLA 2F9LA 4HLQB 1HEIA 4DBLC 2X2FA 3P26A 3UMFA 1AIPA 2JLXA 1HYQA 2W6JA 1NBMA 1NN0A 3SQXA 4QC2A 1NKTA 5JJIA 3MFYA 4OI4A 3RC8A 3AGQA 1OLOA 1DEKA 1E1RA 1N6OA 3L8ZA 3AEZA 3PUXA 4TSFA 4YC7A 3I8XA 1YKSA 1QHNA 4CDGA 1A2KC 2FOLA 2QSZA 3EPLA 4EPVA 1KJZA 1W2HA 1XMJA 2F1IA 1MABB 3F5FA 1CEEA 2PMDA 3EIHA 1AZSC 1NVXQ 2H92A 4TT3D 1NF3A 3TQCA 4I1UA 1G16A 5KTYA 1KJWA 2OV2A 2Q9CA 3FKSA 4CT4B 3GJ3A 4MDFA 3ZLJA 2IX3A 4FXPA 2WWFA 1UM8A 2CHQA 3CX6A 1G17A 2ZYUX 1N6LA 5JWOA 1KK3A 4WVFA 5L3QA 4WXPA 3TMKA 2FEMA 2IYSA 4AK9A 1XTKA 2J3EA 1KO8A 2ZYVX 2ZJ2A 1QHGA 4UXHA 1ZBDA 3SC3A 3T12A 5LD2C 1XX6A 2ORIA 4Q03A 4AKIA 1KSJA 4GZMA 4DIEA 2F43B 2IXFA 3U7GA 1P2SA 1NVWQ 2B6HA 3GD7A 4HDCA 5IDVA 4TZ6A 3P4YA 4C0BA 5TV2A 3T1OA 1DAKA 4ARZB 4BRUA 3BH7A 2ZI4A 4ZKDA 2G77B 1N0UA 4XD7A 2DR3A 1Z0FA 2OE2A 1E99A 5FTMA 4G01B 5CK5A 1SULA 1E2HA 1CLUA 3L0PA 4FMCF 1W4CA 2PX0A 1KDPA 4KVGA 3A4LA 5CYPA 5L3SB 2OFWA 3NXSA 4HI0E 3CZPA 4V0NA 3PJRA 3I1FA 1JR3E 3LH5A 1KGDA 1KZ7B 2GILA 3PQCA 4DDUA 1DARA 3D8BA 2FWRA 3V4FA 4DSTA 4NBSA 1AJEA 5FBVB 5AJZA 3DM9B 2F6RA 4PPQA 2HT6A 1UDXA 1KZGB 1OXSC 1TEVA 4LBVA 1JAIA 2WV9A 3UWOA 2QP9X 3ECCA 1XJ0A 3A4MA 3BH0A 3LDAA 2UKDA 4HB3A 4TQ9A 3WMFA 4JLDA 1E2LA 1Q12A 3JVVA 5A0FA 4PSVA 2FFAA 2NO7A 3ADDA 2F1RA 2ZPTX 3D6TB 1HTWA 1V5WA 1ANKA 3NBZC 1F2UB 1M74A 5D3MB 2OT3B 3UKDA 4Q1DA 4YMTA 3VFDA 2HCBA 4MA4A 3TW4A 1VG8A 3OIWA 2GCOB 2ZRJA 1HUQA 2ZYWX 4TZ0A 4QHTA 2K5UA 2C04A 2OCBA 1BMFA 3AVQA 1G8GA 4OQMA 4A1FA 4AC9A 4IEEA 3MLEA 4JJKA 2BJWA 1RYFA 1ZJ6A 3NEYA 2H17A 2DCUA 2Z43A 3C41J 5KNDA 2PEYA 3ZZTA 4TYPA 2QE7D 3MGCA 2O8FB 4KFSA 4LHZA 4JYBA 4QGGA 3TIFA 4E03A 1YZNA 4NHOA 2HEIA 2B8TA 4Q4HB 4HB2A 3HJNA 3AKEA 4JLPA 3FHOA 3ZJYA 1JECA 1KK1A 3RS5A 1W7AA 1V43A 121PA 3CWZA 2O8BB 1Y63A 2ZR0A 3QKRB 3OE7A 1IOZA 2DFNA 4F4IA 1Z22A 3F0TA 1R10A 1TF5A 2JJ8A 3GJ0A 3U3KA 2ZU0C 4DSNA 2QU8A 3VR4A 4GOXA 2GEVA 2QM7A 4RSGA 1VYUA 4CRWB 2VEDA 4JVMA 1XP8A 1NG9A 3FWYA 3U7EB 1E79A 1YZGA 4IVPA 4KHZA 2WAYA 1SVKA 1CF4A 1O87A 3QXXA 3ND8A 1WXQA 4GDFA 4A0GA 2V4ZA 1TX4B 1KMQA 2GZDA 1II0A 3T5DA 3ZIAD 3K1JA 1ZIPA 3WYFA 1ZP6A 4LYAA 4G3XA 5CDFA 3K9HA 4EFNA 1SVIA 2C8VA 2ZJ8A 3T35A 1OH8A 2C96A 3TVTA 1BOFA 2X1VA 5JECA 1HE1C 5JI2E 2V55B 1F3OA 3Q5EA 4TQAA 3R7WB 3GLHB 3I62A 1C4OA 4PHGA 4A8JB 1TNDA 4LV5B 4LI0A 2FFHA 4U00A 1QRAA 1ZW6A 3T1VA 3TW8B 2V54A 2W0SA 3IIJA 1US8A 2G6BA 4P32A 1S0UA 3ADBA 2D7DA 2BBWA 3HR8A 1JEDA 3CBQA 2VPPA 1FMJA 4M9SA 1YRBA 2XITA 2KE5A 3B1ZA 2CVHA 2CJWA 2AK3A 4F7WA 2QMOA 5SZHB 5KU1A 2IYTA 1S3SA 3W3AA 4KJZA 4QOSA 1R5NA 1KKLA 3SE0A 3QIAA 4G5SA 3MAAC 1BKDR 1OHHA 1DTSA 2FV8A 4Z54A 4YXWA 4US0R 4QJ5A 1Z0IA 1XEFA 5DN6A 5HE8A 2JA1A 2OEPA 4P33A 4AY2A 1E0AA 1K6MA 1OXTA 1FTNA 3F3YA 1W0JD 1N0WA 3OEED 4O25A 2JEOA 2JDIA 4AYWA 1LB1B 1NLYA 3FMPB 4I81A 1IY2A 4B75A 2VRWA 3IEUA 2QPAA 1Q44A 3U4QA 2VSFA 3U3RA 1TADA 2VHTA 4F92B 3M1IA 3EZFA 3L0SA 1EX7A 1NIPA 2IF0A 3CH5A 3EA0A 1ZC3A 4B3DA 1WB9A 2AR7A 2YOHA 5FR2A 1OB5A 4KITB 1UEIA 1ZM3A 4M2LA 3GLIA 3BE4A 3FFBA 5C4MA 4HAXA 3AGPA 4EJSC 4DLRA 2OZEA 3TSOA 1FOEB 1DAHA 3EXAA 4UJ3A 2QAGA 1KAGA 5JS8A 4ACAA 3U5ZB 5GVRA 3B1YA 3QKSB 5GVSA 4XWAA 4TMKA 3FMOB 1S1CA 4RFSB 3ZZUA 1BS1A 3C14C 4LK2A 4Q47A 3I5XA 3SQWA 4DLVA 3FDIA 4PC3A 1VHLA 3RABA 2I3BA 4QJ3A 1Q57A 5FUYA 3IGFA 4B35A 4LPSA 1OYYA 3QNUA 2C95A 4M9XA 5L3RA 1G7CA 3ZIAA 2JJ1A 4L15A 2BBTA 2R65A 1JXOA 1AK2A 2O8DB 1SVSA 3U6KA 4CIDA 2G0TA 1KOFA 2XSZA 3RNLA 1YZQA 3HU2A 3THWB 2OFOA 2YJTD 3G5UA 1Z08A 1FQJA 1QVRA 3IILA 2EYQA 3K0FB 3SN6A 4AWXA 5KDLA 2IYVA 2NZJA 4PHTA 4WAUA 2BHRA 2CHGA 3RS0A 4B33A 2AKYA 2GRJA 2ZR7A 3AB3A 4RZUA 2D2FA 1J8MF 1HQYE 4R9UC 4MKHA 2IK8A 2ZUCA 4B2IA 1IAQA 1R5BA 2VHUA 1XJCA 4JVLA 1FUUA 2JLUA 3DZDA 1YVDA 5FFMA 3RS3A 3QPWA 3CUEF 4LZZA 3W90A 2ECKA 4CYMA 4CVNA 2JLWA 2IYRA 3TRFA 2G9NA 2F55A 1ZM2A 1HE8B 4FWTA 1EGAA 3VHLB 4AKEA 5B58C 1G5RA 3KJGA 5CM8B 1U9IA 2W58A 1I4LD 1FFHA 1QHHA 2ZTSA 2J1LA 4PHFA 1G4AE 1TUIA 2IUSA 3AVOA 4B3BA 5HZHA 5AUPB 5B57C 2ZREA 2AKAB 1L4UA 3K0EA 2JLZA 4GMXA 3W6OA 4QM6A 5IT5A 2G3YA 3KFXA 5J4LA 1QVAA 5AUNB 2FDCA 4FCTA 3CIOA 4PHHA 1OFUX 4LC0A 1TU3A 5AUOB 1DOAA 3ASZA 3OEEA 1E32A 4QBGB 4D0LB 2ZI5A 2G0NA 3LQQA 1FW6A 1WRBA 3LRPA 3NG1A 2CE7A 2BJVA 521PA 3GEHA 4XIGS 2GAOA 1E3MA 3ASYA 1EFCA 4YDSA 4CT5A 1LS1A 4E07A 4ZI2A 1Z47A 2JIZD 2RGNA 3N2IA 3ZZ0A 3ZD7A 1T4GA 4GI7A 3QY0A 2QA5A 3GPLA 3TR5A 2AHOA 3C5CA 4M4SA 4FMCB 4OHWA 2CLSA 1ZNWA 4PAMA 2MSDB 3EARA 4R98A 2WJIA 2IXEA 1YR7A 2ZRLA 4Q9IA 4E22A 3FFAA 5EP1A 5KPDA 3T15A 2BBOA 4FI3C 2ZR9A 2VP9A 1IXSB 1UKZA 1UPTA 4PZLA 1R7RA 5L8VA 2FJUA 3GJXC 4URUR 3KL4A 1JAHA 4JLMA 5C4GB 2FMXA 1Q20A 2RKOA 1BIFA 3AVVA 5HR5A 4DDWA 4BQSA 5KSZA 3T61A 2QENA 3N70A 4M9QA 4EFMA 4KFRA 4PTLA 3B5JA 3IBGA 2QP3A 1AS3A 3BIFA 1EXMA 1OIXA 2OXRA 5CIQA 1SKQA 3LVRE 4DLUA 1BYIA 3CWQA 4URZR 2NPIA 1N5IA 1SHKA 4KI0A 1E1QD 4YMWA 2ZE7A 1JR3A 1RE0A 2X8AA 2JASA 4PXAA 1QHYA 5KNBA 1IJFA 2AWOA 1E0JA 3MCAA 1KKMA 5FPYA 3W6PA 3WMEA 2GETA 4OBEA 3GFPA 4RVCA 4A0FA 3ZVRA 4EQ6B 3AQ4A 2XXAA 1SXJB 4MKGA 3SDZA 2IYWA 1RC8A 2ZVQX 2RGGA 4N0DA 1XZQA 4D4JA 4DIDA 1M7BA 2ODWA 5DISB 4URWR 1W5SA 3LW7A 3LLMA 4MGKR 3RSOA 2X2EA 3LW8A 4DEYA 2BEJA 4PPFA 4LY6A 1W48A 2ODBA 2FPMA 1BYUA 2QORA 5SZIA 1E2EA 1COWA 4P0TA 4B43A 2OBNA 2WKRA 3UANA 4PSKA 1QG4A 1UADA 2CNWD 5EZ6B 4LC1A 4NYMR 3CW2A 4R71A 4ZIRB 5CDFE 1T3SA 2QQEA 5G53C 4JMPA 1VYVA 5KPJA 3E5HA 2OHFA 4I1OA 4MUAA 2D62A 2BBSA 1SXJD 3CRMA 2GHIA 1CRQA 4EPXA 3EPKA 1KO1A 3B8HA 4HAZA 3KQLA 2OAP1 2N42A 3PUZA 4HAUA 4YONB 5FPTA 2OXCA 1C1YA 3P20A 2BMDA 4E09A 4B3GA 3A8TA 1MV5A 1NMZA 2UVQA 1P73A 1SKYB 1G1MA 3QVVA 1E9AA 2WOOA 3DKPA 1G7TA 4V03A 5KSOA 4C0JA 3AM1A 4LGMA 4Q7MB 2P3SA 4WA7A 2ZRMA 3FHTA 1FQKA 1L8QA 4FD2A 4D80A 2FZLA 1A5TA 4HLUA 3Q85A 4B47A 1Z28A 3VR1A 1KMHA 1X8KA 1YZUA 3VQTA 2EVWX 4MITA 1GZSA 2VTKA 1Z0JA 2GNOA 1ELOA 2VP0A 4PPGA 1D8TA 3ZH9B 4OHYA 2FSGA 3WP1B 4Q7LA 4Z1MD 3U7FB 4Y0AA 1PLKA 1J90A 2ZRDA 3RRZA 1KI8A 5EJEA 3U44A 1S96A 3OESA 4CEJA 3WXMA 1R8SA 2RMKA 1VG0B 4QGHA 1G3RA 1R8QA 4UNSA 4ZKEA 2W2XA 2YC2C 3TUIC 2HT1A 4I4LA 1CU1A 4RCYA 4CW7A 3AKYA 4EDHA 2C98A 1OH5A 3PEWA 1YQTA 3C4JA 4OI0A 2OG2A 3AV0B 4DZZA 4X8LA 5KSPA 1P4SA 4G5OA 1P72A 3SOPA 3TUJC 2GVDC 1XRJA 4ZDIA 4KV9A 3BFVA 5FH9A 3CH4B 3IQXA 1OKKA 1SVOA 2IYYA 2NTYC 2F1HA 4P4SA 3T5GA 2GXAA 2ORWA 3VU9A 4A36A 4A82A 1UKVY 4BGDA 3LXXA 1RZ3A 2ASEA 1KIMA 1S9DA 1LS6A 1EWRA 1W49A 1X1RA 1HV8A 3HPQA 3L43A 2ZI7A 3LAWA 1U0LA 3A4NA 2TMKA 3LX8A 1G18A 2C78A 3MG9A 3JVUA 5F9HA 2WJYA 4P4UA 1DO2A 2O8CB 1Q1BA 4YQFA 1NVUQ 4AIIA 1VCIA 4V0MA 4PPNA 3UMRA 1DAMA 1GIAA 3VR6A 1WF3A 4LJ5A 3X1XA 2J5XA 1TQ4A 2Z5FA 1ZYUA 4O2LA 3OHMA 1B23P 2REBA 3Q7QA 1NY5A 3QPUA 1DS6A 1T3HA 4G5GA 3THXB 1Z63A 2FSIA 1FL9A 4YMUA 1J2JA 2GF9A 2GJAA 5DI3A 3ZYCA 2JJ2A 1H65A 1SVMA 1OE0A 1Z0DA 1U0HC 2ZROA 3NKVA 5CJPA 4GSYA 1R0ZA 1CR4A 2VSOA 4LBYA 4P3YA 3OEHA 3KJHA 4O2RA 3B7GA 1XD2A 2WSMA 5DGXA 3BB4A 3D31A 2EQBA 3CR8A 1CULC 1AS0A 3W3ZB 3ZS8A 421PA 2SHKA 1FNNA 1IN6A 3AVWA 4DUGD 3GQBA 4Q02A 1T0JB 4BFZA 5BN5A 2C5LA 1CJKC 3BH6A 1YZTA 4JT4A 6Q21A 4MRVA 2O0HA 3SR0A 2WVJA 3NVAA 1D9ZA 4KSBA 2XNDA 1MRSA 3LXRA 2IEZA 3GLGB 1UBEA 4ESHA 5EP2A 2R2AA 4MYTA 2NPFA 2FGJA 3L0OA 1H8HA 1AQYA 1KNQA 2P65A 4QRHA 4RKEA 2R62A 3KKPA 2D74A 5J40A 3GLHE 3MSXA 2R6GA 4LYHA 3NEJA 4ZCIA 5J5CA 2ZUDA 1TQ2A 3K53A 4I99A 1WA5A 5K8UA 5SZJA 2XZOA 3KDSE 5FOSA 1OFHA 1VYTA 4XJXA 3K9GA 4PC1A 1ZC4A 4G5QA 1E9CA 5G3YA 3B9QA 1GNRA 3LX5A 3H86A 3NBXX 2HLDD 1L7VC 4BFXA 5JZVA 3S1AA 4D0NA 1ETUA 2MMCA 1UKYA 2LKCA 2GF0A 3RYTC 2F7SA 2YYZA 2V3CC 3VNUA 1X8JA 3LD9A 4Q4AB 3U6BA 1QF9A 1EX6A 2VBCA 2VP5A 2ZVPX 2V6IA 1WDTA 4IW3B 2OO7A 5ANRB 3SEAA 2V6JA 4NDZA 2CL6X 2C03A 3NWJA 3QUSA 2DB3A 2FF7A 2WMNB 1XB2A 1ESMA 1OFTA 1UF9A 3EZ7A 1XCMA 3QG5A 4LJAA 4M21A 5M04A 3K0AB 4TL8A 2ZXUA 3KJEA 4LBZA 1WCV1 4DLTA 4V02A 4GPTA 3TLXA 3L82B 4TLBA 3Q3JB 3T34A 3TVDA 2A2ZA 2W2VA 4LJ9A 4M1SA 1TUEA 3PEYA 2W6IA 2Z4SA 4G1UC 4QBHA 3VR3A 1K5DA 3FMIA 2GTPA 1U98A 4IFBA 1R0YA 4MH0R 1IQPA 2PCLA 3K8YA
chains in the Genus database with same CATH superfamily
2ENUA 3L7KA 2C2BA 3BD6A 4KN8A 3LECA 5B1DA 3EZNA 1NMXA 3UC9A 4XEHA 3EG5A 5LC1A 3FFWA 4R54A 4MROA 5DHAA 2XB8A 2DFTA 3M5PA 3ITEA 3FWKA 1IM5A 3B1FA 5C3UA 1TVKA 4A16A 1N25A 4TUYF 3IPXA 5CRIA 3PX7A 2VJBA 2XCUA 4LJKA 3BM5A 5F9FA 5KO2A 4EG3A 3K20A 2BZ1A 1KRHA 2UZ0A 5DYYA 3QW4B 3M2TA 3P4XA 1O08A 4C0SA 5AVSA 1ZJYA 2BEKA 5LP6F 1K6XA 4IDOA 4MRMA 3ZIDA 4F12A 1NDHA 3R6DA 2H4HA 3R9XB 2H2WA 1XJQA 4RNCA 4FD3A 1P1IA 3D3EA 1C9JA 5F76A 2B4QA 2DU8A 2YJ4A 3H5OA 4D4MA 4BZPA 3I9NA 1QGZA 2CYAA 5DCWA 4DT1A 1G3IA 1GZUA 2HBZA 3Q40A 1SQ5A 3R5XA 4JN6B 1RPNA 4WZ6A 5F4ZA 4AURA 4C05A 4E5UA 4C08A 3ENQA 2R85A 1RPAA 2WC1A 1UIRA 1JU4A 1XRQA 3W8EA 3DKVA 4MKRA 2CLMB 1UZAA 2AOXA 2G67A 3UXYA 4H3VA 4C5BA 3KQHA 3RR2A 4O4HA 1PT9A 3GZTB 4YRCA 2AC7A 4TTPA 1S9HA 3PQ4A 5EY5B 4Z7QB 1E64A 1VBKA 3U40A 2EJTA 1ZUNA 5KOHB 3HSYA 1P6XA 1U1IA 2FN4A 1XL1A 4FILA 1EHIA 5AKKA 4BEBA 5IDXA 4DA4A 1TF7A 1FJGB 2I7XA 3PNLA 2QJFA 1PJLA 3KEOA 5BWCA 4Q1FA 4X94A 3CVXA 4DV1B 5TPWA 3ZE1B 4GZ6A 3ZNQA 1P81A 5C1BA 3A11A 3R74A 5IKEA 4JUDX 4L5BA 1SUAA 3OFJA 3R2JA 4CDMA 5HXAA 3KTAA 1E98A 4E21A 4RXUA 5IC5A 2OCAA 2W8BA 2VPWA 5AXDA 3KHTA 2VRCD 1XLVA 5TDHA 3EEOA 3N8GA 5T5QA 4ND6A 5FLXA 4Y9UA 3DHWC 1J25A 2HFJA 3Q6IA 5LOVF 1IB6A 1L4YA 1MAWA 3R3UA 4JSYA 2X9VA 3FVQA 4TKVA 5FA8A 3P5BA 3MHTA 4KQHA 4ZARA 3U7QB 2EFJA 1AQJA 5JDCC 1P1FA 1USUA 2BM1A 3MMXA 1TA9A 2QRPA 3FUCA 4QRIA 3RQSA 5BYKA 3P9RA 4AO7A 1L7AA 1KJQA 1VCNA 3HU3A 3I53A 4LVOA 2GUWA 2AI2A 3UB2A 3NAZA 4B2IA 4BE4A 4OCZA 3TSWA 2XB4A 4OXYA 4WGFA 4QNMA 1YF3A 1MB2A 1W4ZA 2VSXA 4BVHA 3EIUA 3JXEA 5KVAA 1KOGA 3FWHA 2XE6A 5IZ4A 1HL3A 4RJTA 1G8YA 1A76A 3VSAA 3E61A 3VNBA 1L7BA 1O0SA 2VT3A 3ORRA 3Q9UA 1RBZA 1AKMA 2LE0A 4FZ5A 4N6NA 3SU8A 3SZMA 2V7PA 3PNQA 4R1SA 4DMHA 2Z8YA 4CEIB 2NUAB 4X91A 4P3PA 1PNOA 3DYIA 1MABA 1QRUA 4M8IA 4RH3A 4XGIA 4JT8A 1NR7A 1ZD4A 3Q8MA 4PGHA 2PT9A 2N75A 4LUCA 3GJ4A 1MO6A 2GLXA 3FH0A 4NK5A 4R1NA 2BMJA 3FTFA 3RB8A 2IV2X 3TOVA 5ILGA 2I9PA 1RLMA 3ILVA 4COKA 1WJGA 4DCUA 2XZDA 1TO2E 5DBEX 4NYIR 4ZO9A 3R3XA 3K2QA 2Q1TA 4BLQA 5KNDH 2B9VA 2R79A 2UUBB 1CEQA 4JLVA 5ESWA 3ZLVA 5LJIA 1JG2A 1V5GA 3KV3O 4GQIA 3EXIA 3WNBA 3W2EA 1NFRA 4B5LA 4QTTB 4QOIA 4YBZA 3S99A 3HM2A 2PVSA 3HVIA 1BKSB 4RF5A 1HT1E 1NVVR 3GGJA 4PQRA 2AN9A 4URFA 2Z30A 2X15A 1P2BA 3WGIA 2R5NA 4H2DA 4JR2A 4FQ8A 3AKZA 2WHQA 2WHRA 1CRZA 4OBBA 2BC9A 3DWGA 4Z4EA 4H59A 5JAPA 1A77A 1SZPA 3ZU5A 4ND2A 2J87A 3MCUA 2Y27A 5BV0A 1F17A 3PX3A 3HWRA 5LZ5A 3T4EA 3HRKA 1VGVA 1YS1X 5FOTA 3H2KA 3N2KB 1P33A 1UEJA 4HWRA 1SBHA 4JT9A 4MV5A 4W5NA 1R9JA 1EFPB 1PTJC 2PT7A 2RAPA 3PGXA 4IHKA 4KBGA 4B4UA 4BASA 5IFLA 5DO9A 2ZSBA 5F7OA 1FVHA 1R5OA 2PKXA 5KHAA 2J6HA 1TXGA 2CHFA 4MQEB 1HC7A 4WCFC 5REQB 3UJHA 1F51E 4JBHA 4NBRA 3TX2A 2VNKA 1SGWA 4IQFA 1AS2A 1I6WA 1M2JA 3ACCA 3L7NA 4BBAA 5KHLB 3T5PA 2QNIA 4JLWA 1Z7GA 4TZTA 2WHPB 3QSGA 1QCCA 3IMCA 4N8SA 4RHTA 2Z95A 4IO0A 2VXOA 4I5DA 2A9QA 4RF3A 2WHXA 2ZS8A 4W5WA 1BDHA 3X43A 4EI9A 1KKUA 4XUDA 4X5OA 5I9BA 4Z4QA 1DTWA 3COWA 3FYDA 1RRFA 3G5LA 1PJAA 2EKBA 1XU9A 2PXCA 4M55A 1U6IA 2IZZA 3LYUA 5GM1A 2FAXA 1QZXA 1GNQA 2A9VA 4Q9HA 4OX9B 1EXWA 3ZE0B 4EB8A 1T5IA 2O52A 2WTEA 2BELA 4RU1A 1TDJA 4N5NA 4ZO4A 5JZ9A 5CLLA 1ML3A 2HJSA 2J5BA 3WGYA 1T5LA 2NNLD 4ETWA 2HSWA 1EG2A 1QIKA 3MCTA 2EX0A 4L6AA 2WLSA 3VJMA 3WTBA 2XUDA 3C8HA 3G85A 5B6PA 4KXQA 2AUMA 2WT9A 4NFLA 4Z0NA 2KW5A 2WR8A 3R40A 1FSSA 1H23A 3DNFA 3U49A 2QNBA 3WL7A 1CYEA 4XM1A 3DDHA 1EBUA 2CW5A 3CRVA 3G02A 5AW2A 4IQ8A 3BJRA 4NE2A 2NXNA 2IZ1A 2IUUA 4AKTA 3PI6A 4BRWA 4DVGA 4O4HF 2VPIA 1KI2A 4HXGA 1HYHA 1MX1A 2G08A 1W5FA 1ZMRA 1GCIA 3W3AH 1ORIA 1JNYA 1I7SB 3U4MA 1MB4A 2AUTA 4W1PA 1DG1G 1Z6GA 3K6JA 3WL4A 3ZCQA 4JI2B 4Q1BA 5CFOA 2PWPA 1NQ5A 3H8JA 3OJCA 4PXSA 5GQSA 1Y1PA 1RXVA 2FWNA 4MVJF 2O8FA 1OGYA 2AN5A 1NUAA 3L8FA 4ER7A 4A6XA 1DKQA 1YTLA 1LQ2A 2ZI9A 4EGFA 1TM4E 4URYR 1X86B 1DX4A 2O2ZA 4Q4HA 1EHCA 3A05A 4QPDA 3CINA 3OJLA 5HMMA 3ZTWA 2FN7A 4QM7A 1R74A 5CJ2A 3WJ7A 2ZJ0A 3R6GA 4PLFA 2H6EA 2Q21A 5DV9A 5PGMA 3V1UA 3ESZA 4ZK6A 4QG3A 4R1UA 2IT1A 2F64A 2JVKA 5ES3A 1A7UA 3ETLA 1M76A 1C2TA 2ZAYA 4FGZA 4ZODA 5DK4A 4LMAA 4LZJA 2ZOSA 5DHFA 4PNEA 2I7TA 1Z5ZA 4FFLA 2YWGA 3DFMA 3NHJA 1GJRA 2I3ZA 5MN6A 3FE2A 4PV7A 2JJMA 5FYQA 2AXNA 2O19A 3NAGA 1T9GR 5SY4A 3CJRA 1SHUX 3UMSA 1KF0A 1OXXK 3H1PA 3QEOA 4P86A 3CUVA 3IQHX 1T4BA 3NZEA 1D1SA 4G9EA 1VIVA 3PR2B 5FL7D 1AXRA 3U3ZA 1N9GB 1PZXA 2VDWA 3H87A 2A35A 4UTZA 4UVEA 1LC0A 1SKBA 3SKVA 5BOSA 4EYOA 2GAFA 2GPYA 3UHJA 2YX1A 3GCXA 1JJ7A 3ONDA 1A8HA 1XZAA 1ZZEA 3T3DA 3JWGA 5BSFA 4K9OA 1E4VA 3DW3X 3KQUA 3E18A 4G97A 4XAQA 1EDEA 1LBQA 2EBHX 3PNSA 4GC9A 4YP7A 3WXBA 3HDYA 1EVKA 1ZRMA 4MRSA 4F38A 3FR8A 2DETA 3A6HA 1NL3A 1VP9A 3NCTA 4R0NA 3OQIA 4G85A 1ISGA 4OB7A 3L02A 3PEUA 3T5AA 4CXMA 2NZUG 2PX6A 4IJVA 1BD4A 1KSHA 4NONA 4ZDJA 2J0VA 3RRMA 3TG8A 4UM9D 1K7XB 4LKRA 3GBSA 4PX9A 4YUXA 3IE1A 1IBSA 2QZ9A 1E6CA 3ABSB 3MGGA 1AURA 4HTAA 1OASA 5J4VA 4KYUA 3N28A 5TQ2B 2O3JA 3DBIA 1JU3A 3HNPA 4GM4A 1OV4A 2A58A 4B9AA 5JSZA 3I5YA 1FMFA 3AOEA 2X7HA 1K5GA 3QH4A 4OHPA 5HNKA 2ODAA 3HKEB 1L7RA 1FLDA 4LC9A 4YRNA 3BJZA 5CFZA 3VTKA 2ZRQA 4LWPA 3FB4A 4GPD1 3CPJB 2A7QA 2C2YA 4GVPA 4C0AC 2C9OA 3ZY3A 2D4HA 2MR6A 2OKCA 1G7RA 4U3JA 3EC1A 3IDFA 5TB5A 4MLPA 5TS2A 1PZGA 3NPAA 1V4BA 3T94A 3R5JA 3H84A 3GVXA 1XZPA 1D2CA 3IUBA 1RIFA 1QB7A 1PS8A 1I4DD 1L4KA 4BGUA 4KUHA 4EUKA 1Z5NA 3QXCA 3OFVA 1H3FA 1FZTA 5JSUA 1FFAA 1ONNA 3KQMA 1CZLA 1R0LA 2ATXA 1WHSA 3ADKA 4IGAA 4OKSA 3GELA 3V55A 4CMGA 2WQZA 2EKZA 5JQWA 1UP6A 4H7FA 1P1BA 5BXYA 3CX3A 1YI1A 2PSJA 5AJTA 3TX6A 3NR2A 3K09A 4P7GA 3V80A 1J33A 2ZRKA 3Q6NA 4ITRC 2OUKA 4Y2SA 4OMFG 1TI7A 2Q4OA 2W43A 5TMEA 6REQA 4O4JA 1YRLA 3O47A 3K0CA 2VC2B 4GYJA 2GO1A 2RJNA 4P3OA 1G8SA 2G25A 2HIAA 5EXSA 3W4IA 4NDNE 2NU7A 2X0NA 3TKAA 4DXAA 3UWDA 3KUDA 5AJVB 1WXXA 2RHJA 3PFKA 1CRPA 1NRJB 13PKA 1GPYA 1KTVA 4W9NA 1B8PA 1M34E 2WWGA 5K2MA 2BTOA 1TA4A 1XLWA 3DV9A 4NOLA 4HUTA 1MB9A 1QGUB 3KOOA 5KQSA 4YMVA 3GEDA 2GR9A 1J9EA 2GXQA 3V1LA 2D3WA 1W4AA 1KO5A 1UBOS 1XLTC 3AXTA 4BNDB 4H1TA 1E2KA 1ODCA 4KXFB 4TTQA 4D41A 3WL3A 1ZUWA 4OOEA 3PWTA 2FFQA 4KX3A 4UXJA 1RFLA 2J0SA 2P1DA 1U81A 3DJYA 4KWHA 5FWYA 2X5JO 3HR7A 2QPOA 1EEXB 1VPTA 2BKUA 2FEWB 2FGKA 2X2OA 3QVTA 2P78A 1SVLA 4FFRA 4MWSA 1DGQA 3C6XA 3DCIA 1GAEO 3ZDBA 2BM0A 1RQPA 4EJFA 2GEFA 1UP4A 4KGXA 5CT9A 4DNQA 3L6BA 2PKQO 1ZGZA 4B6FA 1A9XA 3HC7A 4J0GA 3UHPA 2IXTA 2HSZA 3JR3A 3GOQA 3T0GA 2PZMA 4QHSA 4MUJA 4WOKA 3BXXA 1A27A 1TKAA 3OOSA 4CKEB 2FEPA 2GK6A 3FSGA 3GDGA 1EP2B 3I1YA 5L4NA 5EEGA 3NYWA 2ZJ1A 3MINB 4ON9A 4PQGA 1WKCA 4UUBA 2AEJA 3THWA 1TZ2A 3U0BA 3WBKA 1YMVA 5I51A 2JKZA 2P40A 2INGX 2ZRIA 1WE2A 5EINA 2ZUWA 2HDNB 4RD2A 3RK0A 4AZVA 2GKSA 1A9QA 2I4RA 1YOVB 2WDZA 3H18A 4KQFA 4REQB 5I9TA 4NL4H 3RYHA 1FVOA 2W00A 2QTWB 4LSGA 2X6QA 3KS9A 4L0MA 1ONBA 1ONOA 2JFQA 1TQ6A 2CNKA 2DH6A 1QC5B 2OP1A 2WJVA 1KERA 2ZJFA 3GFGA 4NJMB 4QGFA 4RDHA 4HLNA 1HSOA 4C4ZA 3NRBA 2DHEA 3OY2A 4OV6B 3V1NA 2RGRA 1QIIA 1ISRA 2B2CA 1ZPDA 2QZ4A 1RKBA 1HBJA 3FFXA 3WFJA 1RYYA 4AY5A 4D74A 1JR4A 1BMQA 4JBWA 3FLAA 3UAXA 5KINB 1W8DA 3ROTA 2WAMA 4BO5A 1NVGA 2IXGA 4ETIA 1XMOB 3F8WA 1F7UA 4EABA 3DHVA 4B3JA 3P2IA 4PRKA 3HBJA 4KG7A 3QA3E 3TNJA 4IQ0A 2D00A 2JIZA 1A97A 1SWWA 4ILKA 2IDJA 5K0JA 1L9KA 1PZFA 1REQB 2BR4A 2P7HA 2FU5C 2QF7A 2WG2A 1FCJA 1NOJA 2YIJA 4FDAA 3EX7C 1Y1RA 1GUAA 2CFSA 4KXMA 4DWVA 3P8ZA 1MEJA 1NT2A 1PV1A 1RAFA 3LKDA 1PSDA 3ZWCA 4M8NE 2HH9A 3P9PA 4XB1A 1YE3A 3WBFA 2ANCA 1BN7A 3DBOB 3RJMA 4ZGWA 5KQLA 1NTRA 3AF2A 1KHHA 1JFFA 2FQ1A 1U5BA 3ED1A 2YBEA 1XD8A 1YQEA 4RJKA 1UBUS 3WB2A 4PW0A 1KAOA 4HP8A 1II9A 2IP1A 5ESXA 3R5FA 2G9UA 4M22A 3FOFC 3USES 1I4WA 2QR2A 4AX8A 3ZXSA 4JA2A 3GT7A 2Q5LA 2A14A 3A36A 4IFTA 1OJ7A 2CLCX 2JFGA 4MLCA 5KUTA 5L3QB 1VPLA 1Y9AA 3PUVA 1DB3A 4E3ZA 2EOAA 2FWIA 3A3YA 1W6UA 4N41A 5G41A 3CRRA 4QG7A 4MVJM 2HIHA 2OO5A 5DX8A 3BHJA 2VSQA 3MT9A 1YWGO 1GSIA 4IR7A 4A27A 1J24A 3ED5A 4ZN6A 5JI3E 2Z4TA 2BEVA 4WV3A 5DPMA 1XRNA 3ET5A 4IDFA 1U2PA 2OSVA 1NVBA 1QV6A 1JBKA 5T3UA 5AHRA 1K5PA 2IZ6A 2QSYA 4HAOA 1L5HA 2W2LA 5CXUA 3KQSA 1IEWA 2C4HA 2BLLA 1WG8A 2L17A 4D9KA 3I5MA 4MTCA 4EAQA 4NU5A 4S0ZA 1NXOA 4EHLA 1OXUA 2YOGA 4HC4A 4MEBA 4ES6A 4RF4A 4EYQA 3NOOA 3B12A 2ROQA 4U9IS 1DMRA 1E8DA 1MFZA 1OA0A 2JFVA 3AZQA 3E8SA 4PSUA 5DRYA 4A0HA 1NJSA 1K88A 3ZHZA 2V0NA 3LS2A 4M89A 2OZVA 4JKIA 1P18A 1QGOA 1UBHS 3MTIA 1GA1A 4KO2S 2CF6A 1KRXA 1Y4SA 3FOBA 5FOXA 2YDXA 4NEHB 4MUHA 3OA2A 1WMDA 4PBRA 5D8DA 3TRHA 4F72A 2B92A 3JQGB 1N6KA 2WAAA 5CB4B 3F6EX 4L9WA 4O4JF 1U2GA 3JASA 4FLFA 3NC4A 2CNWA 1EK2A 1QQ6A 1R6UA 2ACKA 4CUZA 2A30A 2ZAIA 1ODKA 4MRPA 4PZUA 2UYQA 1HOTA 3NWPA 5K6AA 1G9XA 2O0KA 2Z8YM 4R0VA 3KZ1E 4DRXA 1UK9A 4ENVA 1DC4A 3QIVA 2YIMA 2I9KA 5CFRA 1E2QA 3OWXA 4GQBA 3SG0A 1VI6A 4AJEA 1LDEA 2DHRA 1VSVA 4QVGA 3D2LA 4I08A 4D8WA 1TCUA 4YLYA 5ESRA 2G1PA 1Q3HA 3QWFA 1RBMA 1JT2A 1O95A 2IHYA 2RK4A 2W5UA 4ND7A 1VE1A 2J32A 3FNHA 5A7HA 1JHDA 3EG9B 1SCJA 2EEZA 2R8ZA 3AP1A 3CF4G 3W1EA 4M53A 4YIKA 1NSFA 4J3JA 1V16A 2BKEA 2RI0A 3W4KA 2D5CA 3D3JA 1VIYA 2X5NA 3B3AA 4TXHA 1X7WA 1P3Y1 2P62A 5E3HA 4BO1A 3LT0A 4AECA 5AVQA 4TOIA 4BNTA 3WNCA 1ACJA 3WIEA 3QEJA 2LDXA 3K5WA 4G0QA 3KNZA 4JJ6A 1XEWY 5BQOA 3ABIA 1VCHA 3UICA 2FEKA 2NSJA 3GZNB 2Z57A 4ABYA 4OIMA 3CUTA 3S2YA 2RHGB 4LRYA 1LSJA 2R44A 4N1AA 2DE0X 5E7IA 2AI3A 4AJNA 3LQ1A 4Q3KA 1A9TA 3FW1A 2KB0A 1ZONA 4A2PA 3PL1A 4O2AB 2EGHA 5K7SA 4NQRA 3GG2A 5C4IA 2J4FA 4XSGA 2W98A 2GN4A 2XOXA 1RC0A 1RACA 1OH7A 3JZFA 3PLRA 1IG0A 3RIEA 1QV7A 4Z1MA 4EG7A 3DBLA 4TMYA 4LQCA 2VYQA 3H2ZA 3RVDA 2JAQA 4L95C 4PBTA 3TR6A 3SFVA 3CR3C 3GPBA 1YU9A 2VJAA 4IMRA 4KPFC 3TOSA 4ZCMA 3SJ7A 2ZBEA 5KYTA 1RS0A 3KSMA 4BAUA 3Q7PA 4KMSA 1DC3A 3NFRA 3PUWA 3H8WA 1VA4A 4OMCA 3W77A 4OLHA 1V11A 1Z6XA 1DIRA 4JP3A 5EJIA 3CN7A 1JXMA 3O1IC 2I8LA 2WU8A 3RLIA 5JH7B 2A5DA 5DBOA 2ZR8A 1BMFD 3B3QA 2FN8A 3ZBQA 4FBGA 3J81k 4YK7A 1GA4A 4AZ0B 1JYSA 5BVGA 2EQ5A 5EA2A 1F8YA 3DF9A 3OMXA 2ZI3A 2V59A 4R68A 4BO4A 3FNIA 4C4TA 2BSXA 3BRCA 3CCCA 3K1TA 1GSOA 4CQMD 1V8BA 1D2GA 3IKTA 2PSDA 4OLJA 3FPCA 3EY4A 4Z86A 2OCKA 3E4CA 3FB1A 1W75A 3QVSA 1IRIA 2RAVA 1HTTA 2CMKA 3DZ8A 4CLRA 1YR8A 1W34A 3NM5A 4JL8A 1QRDA 1ESCA 3OE5A 3WYGA 1D9XA 2GZ2A 1SQ0A 2CK3D 2PWAA 3NVMB 1J06A 1SD2A 2MDTA 4CQLA 5ABPA 5AM2A 1ADGA 3K15A 3CHYA 4IMJB 1II8A 3RGWS 2G06A 1PZHA 4JJ4A 4JVSB 4KU4A 5BQPA 1NJGA 1Q91A 1QKKA 2O7SA 1VL8A 3E48A 4DHEA 5HF8A 1FTGA 3LZCA 4GE0A 1YHNA 4NV3A 1W25A 1WBDA 2Y0PA 2H5LA 1SOVA 4NCBA 2Q4DA 1U1CA 4M86A 3MLAA 2XUPA 2HBRA 1GAQA 4OQFA 4CM8A 2J59A 1G3MA 2JGAA 3WAGA 1FNBA 2OUIA 5CFNA 2X5OA 1QMGA 4KCGA 5KKCA 2CCJA 4UKDA 3Q1LA 2Q49A 5ALHA 5DWVA 1US8B 4AJIA 1W9HA 2D7JA 4B5KA 1E79D 1K4KA 1URPA 1VXRA 5JFOA 4IKPA 2ZGVA 3O26A 3A2LA 3KB1A 4RACA 1PJSA 2C0CA 3K0KA 1VG9B 2IOYA 4FDTA 2H1VA 1QHFA 4KZPA 2FR8A 4UASA 4TYNA 1JYEA 1LFAA 1ZN7A 2LDBA 2FLWA 3QF4A 1PT8A 3RAEC 4PONA 2ONKA 4UTVA 2SECE 1E2NA 2F90A 2PVCA 4ISCA 4Y2XA 1M6YA 3EQ6A 2AFRA 1SUDA 3E5NA 5A0TA 3A58B 3DZBA 3LQRA 1SBCA 2I1VB 4M37A 4NS4A 3EQ7A 4RPLA 4OKIA 4ZJUA 3VKHA 1U3UA 4IXTA 5GONA 1X9IA 2Q6KA 3AJ9A 1WQ3A 1SK8A 2WEKA 1UDCA 4AF7A 1PEAA 5C7IO 3TGLA 1T8RA 5C51B 3SIRA 1XTSA 3H9BA 4KK4A 1IEXA 4X1KB 3WKCA 4F6RA 3Q0IA 1OX5A 3A9RA 1IUKA 1XL0A 3ELWA 1HLFA 2VJYA 3F7OA 4EUEA 3JQ8A 3RJ9A 1IN1A 1TQHA 1I7PA 1ZNQO 2RB5A 2PRZA 1ZCAA 3B48A 4AJKA 5I7RA 4Q66C 4RE5A 1NI4B 7GPBA 1XCJA 3UJ7A 1PFUA 2WUGA 1L5FA 4MUGA 4OEHA 1GPJA 1P60A 1P1KA 2XOKA 1TUBA 5LKRA 4UTOA 1T2VA 2ZKLA 3RTGA 4IRXA 1NNEA 5B12A 2CV1A 4LISA 4HQ6A 3RTAA 2NU8A 1BS9A 4X24A 1W1WA 4EVQA 3EXEA 1C81A 4Q4CA 3EWNA 5B5SA 3NKLA 1HQCA 5EKSA 5FUWA 1D8AA 4KUGA 1UXKA 1M34A 4CU5A 4EOGA 2ZUSA 2B5VA 1OHHD 3Q3VA 2HLDA 1QYVA 3HUEA 3M3PA 3LY9A 4Q16A 5C7OO 1P2FA 2AXQA 2Q1UA 5C53B 5DN6D 1QH1B 4JJ8A 1OT5A 4W9MC 4A7PA 1CR2A 3DOUA 3O2NA 1AUVA 1C8KA 4NBVA 4RZ3A 1YONA 1GWNA 3RWOA 5ENVA 3VDXA 4HO1X 3Q3IA 4N5IX 2ODTX 3HGMA 3I58A 4P38A 1KI3A 1ORDA 2CB0A 3JTMA 4OXIA 3VOSA 5JAZA 5FPHA 5ITZA 3U7HB 5BVHB 2VK4A 5E38A 5GZ3A 3WDLA 2OORC 1U2EA 3K7EA 3EBLA 4OHKA 2P68A 2V03A 4R1LA 2BHNA 2WKQA 5H4HA 1YA8A 4YALA 2ORVA 2QLBA 2DHQA 1VHTA 2VUIB 1E2PA 3H4MA 4BB6A 4DJAA 1FXUA 2DCMA 4ZGGA 3HP4A 2HYIC 3NASA 5JR3A 3ANNA 2PLFA 4E70A 1HDRA 1P4RA 1XWWA 5EZYA 1E6WA 1QGED 4MRNA 3WGNA 5DGIA 4HGZA 5CVDA 3KG2A 1DKUA 1F0YA 2QL6A 4XASA 2Y1GA 3JAKA 2Q27A 2VF7A 2BI4A 3GRCA 3ZGXA 1SUCA 2AZ4A 5EWMA 3MJ4A 4HNGA 4Q4AA 5KTRA 3WLQA 1S8OA 3ZPXA 4ZZ3A 4PCAA 1ESDA 4OQQA 1MZVA 5T4EA 5JIBA 4FGSA 3IMFA 5FBLB 1TT5A 4TYYA 4O02B 2PIAA 3SICE 5KOIA 3LNCA 5HBGA 4K9SA 1EUDB 2BOVA 1L7EA 5GOZA 1EB8A 1O8CA 5IF3A 1DEXA 5BP7A 3R4CA 3UH0A 1GL6A 2ZIAA 2FNAA 3M83A 3RU2A 2OLJA 3CLSC 1I24A 2E9SA 2IP4A 2KHZA 1INLA 2I66A 1QG2A 3C4VA 4BATA 1L4LA 3BMXA 3KXLA 2FZVA 3GL9A 3U4HA 2JJ1D 2ECFA 1GZ7A 3JQQA 1XQVA 3PQ8A 1KSFX 5G4LA 3JYHA 2WQ7A 3N0VA 3BSWA 1AKTA 4FT4A 3ZQJA 1BE6A 3KYJB 4PC7A 1T2AA 2CCKA 4YRLA 5HKKA 1UPAA 4CF7A 5KWVA 1IZ9A 1UBCA 2ANBA 2WKSA 1G60A 2QTVB 5HRCA 1Q7CA 3CA8A 5B1HA 3EGCA 1PYGA 1YULA 2VCHA 3KWFA 5AW5A 1SCNE 4P54A 4G5RA 5CX1B 3UH1A 3O8OB 1KJ9A 1FX1A 3FF1A 5DT9A 3U61B 3ZY6A 4HYQA 3JQAB 1OT3A 2EWVA 2WYVA 3ESAA 3BIOA 3RUAA 5HILA 2ZWPA 5KYWB 8ADHA 1MO4A 3TL3A 1G6HA 1I7NA 5EIAA 3QBVA 1C30B 1CQJB 3PFHA 4BX9A 3A9CA 5AR1A 1ZVVA 3O8CA 3TSAA 4RGBA 3V4OA 3X1MA 1X0XA 2YIDA 1ZQ1A 1FDWA 4LXTA 2WQ6A 1OW3B 1PR9A 1RP7A 1BH2A 1SCAA 1V6CA 3NBUA 1SBTA 3R9XA 2YWBA 4GE3A 1TECE 4WFJA 1N2SA 2XUAA 3EEIA 3HO1A 1SPBS 1AK1A 3VU3A 4N0EA 5FXMA 2P9EA 2DR0A 1W0KA 1DKRA 3AR9A 4NPAA 1L7XA 5A9TA 4M1TA 3W9SA 2DM6A 5CBPB 1KQPA 3PC8A 2AE1A 3O93A 2HXYA 1IFXA 5KSWB 1ULTA 3K0SA 2JFHA 2O0MA 2VPZA 3GT3A 1C4WA 4TMXA 3NHBA 2OCGA 2Z9DA 1DOZA 4WCFB 4B7UA 1T43A 3A7EA 3ZVKA 4Y2GA 5C5CA 1KMMA 2B35A 2X0IA 3ABRB 3DO5A 3M4ZA 3M82A 4LZAA 1N75A 1IIRA 1SIBE 2ZIZA 2DFPA 3CKKA 5FO1A 2IBSA 3GRUA 2J9GA 5KOHA 2WJGA 2FW8A 2WD8A 1RBYA 2ZJZA 3I39X 5GONF 1CYDA 5JO0A 5FL3A 3GBPA 4BP8A 1XMQB 2HT1A 3QKIA 4KGZA 3W1VA 2FW9A 4M87A 2I2BA 3WK7A 3R7DA 5JROA 2Z8XA 4BS9A 3FVWA 1U8TA 4EJ6A 3W2HA 2QMEA 3KJIA 3RAPR 2X76A 4QT4A 5IHXA 4F3YA 2BHLA 2MHCA 2J33A 1A8UA 3ZK8A 1XTVA 4YRBA 1LDNA 2H0AA 1MHPA 2GCIA 3GXBA 4LOAA 3KQKA 4JT2A 4QWMA 1VJGA 1NFQA 3MJRA 4CG3A 2QLFA 1GKKA 2EFGA 3GN2A 1LV7A 3OJFA 5TC4A 3TINA 2R9VA 1KYXA 1DUVG 4M9RA 1IN4A 5KU7A 3SVTA 1UPUA 3WLEA 1E69A 5KREA 2OHXA 3WKDA 2L82A 2ZWMA 1P45A 3U7QA 3S8YA 1KSGA 3O3MB 1YR3A 1KO7A 4V0RA 4XWYA 1BH6A 2QQFA 5KVQA 1Z6PA 3RVQA 4FM9A 3PJDA 5F5XA 1X7YB 4KBFA 1ZNXA 5JZBA 4QUGA 3AUXA 5F7XA 3LK7A 3VC3A 4XX0B 1NRIA 4UFOA 4AM8A 4MO9A 3TI7A 1X1SA 4OL9A 4XOIA 4MICA 2ERYA 2QRZA 5CM9C 3WWPA 2ZZMA 2BFNA 4F91B 2XQFA 3FSJX 4MQBA 1P75A 3KZMA 2JEZA 1YACA 1M1ZA 4HNQA 2Y0CA 3DMDA 3KXKA 4FZVA 3D8NA 5AWFC 3M70A 5CLHA 1Q1EA 1JDSA 1WNTA 2O06A 4O5AA 4LV6A 1CSEE 2HIGA 4XDZA 1Y3AA 5GV8A 3HUTA 1N2XA 3PHLA 3EAQA 1KAEA 4U7WA 5LKAA 1P7YA 1QM5A 5HIIA 3KVNA 2Z3VA 4DBZA 4I8XA 1MG5A 2IKSA 5LPNA 4ZO8A 2J9ZB 7MHTA 3DMHA 2QTMA 4F4DA 5EZYF 3AVTA 3UKOA 1PD0A 1TTHA 1SD5A 3A6GA 2WYWA 2ZANA 2H65A 3PQ7A 4FHDA 3G89A 2RKWA 4QEZA 5C52B 4LDJA 1A50B 2VDJA 4GKKB 5FWDA 3DGEC 5JCXA 1UPCA 5P8WA 2HNAA 1MIOB 2PWYA 4DLNA 2RHMA 3AQIA 3NBFA 3OZVA 4GPIB 4ZV9A 2O2JA 4EEXA 1KYVA 3SVLA 3IIEA 4MCAA 4OA5A 1CUDA 3LBHA 4AT1A 1XEWX 2Z2YA 1Y7LA 3IQGX 3LA6A 1LI4A 5ELXA 3KOYA 3HYRA 1T0IA 2M6SA 3K05A 4LBWA 5D87A 3RS4A 1MA0A 2CC2A 4WKOA 4BGIA 2FHPA 2CXNA 4JP2A 2ZQ5A 4MQLA 1F0PA 4G9GA 3KLBA 4GR9A 1JMYA 1LBHA 2WE7A 1JDTA 3N2KA 4ESEA 4NEGA 1LBIA 5DJ5A 2P9FA 2G83A 3ACBA 3M6VA 4AFNA 1NUPA 1Z73A 4TVKA 4G0UA 2JHAA 1LPPA 4BO0A 1GG8A 1T5SA 4U6SA 2GCGA 2BF7A 4ARAA 5CPFA 1EFPA 1R4ZA 1NUHA 4NIMA 4BFCA 4QGSA 3SZ3A 4RK5A 3NV7A 2GWHA 1G63A 1E5TA 3E22A 3IDZA 3BDVA 1BJRE 2RIPA 4MQEA 1EH5A 5REQA 3L1JA 3ZGYA 1Z4JA 5G02A 2GZAA 1NX9A 1IHUA 3RT7A 3OM9A 2HCTA 4QDOA 3TDNA 2A6PA 5HIAA 1HRKA 3RC9A 4OL0A 3OPQA 2PTGA 2WHPA 2YWFA 4UUQA 2C3PA 2ID9A 3L7JA 4BNJA 3LYAA 4R5HA 3FTQA 1T29A 1QE3A 1IY8A 1PR4A 4PBSA 1NN5A 4KQMA 2A84A 3ES9A 5KQMA 2WYOA 4J0CA 1X1QA 1O0BA 2OCXA 3DDUA 3CVVA 1KEVA 1CNFA 4ZCTA 5FR1A 5AXCA 5IU6A 2VL7A 2A3RA 2W2PA 3BL6A 3BSYA 3GJ6A 4FBMA 2HHHB 1PJ3A 3OTIA 2CSXA 5EGSA 1M6NA 4YI3A 5FBWB 1E96A 3UMBA 2JLVA 1DO8A 3IUJA 4BN0A 5K8VA 3OIYA 4K9KA 4MAAA 5E7JA 4DR4B 1MKYA 4NQZA 3TTSA 3K96A 3PQ5A 3GLGE 3DMTA 1COZA 2OO3A 5KTOA 4BCDA 3O4RA 1XRMA 5ADUS 1OBVA 3UPTA 2D0PB 1XUOA 2J9YB 2QMUA 1CWUA 1Z06A 1BHO1 2BI8A 3EY9A 1O4WA 4WXMA 2J45A 1JPJA 1P2UA 3ZGZA 3EIFA 4WJLA 4MVJI 1RP1A 4AZ3A 3MBOA 4MYUA 2I6QA 2X0DA 2PUFA 3MB8A 4J9VA 4ZCSA 4N7MA 4W1QA 1ZY2A 2N1MA 1XVAA 4ZOBA 1A9OA 1KFEB 4U6NA 4AS2A 4BFVA 4CIBA 4RGYA 2Y8EA 4CLDA 2BCGY 2QW1A 2Q3HA 2YV1A 1TO1E 1TW2A 4C0LA 1OROA 2C5AA 1TMGE 5F7JA 2O5RA 1M2KA 2YKGA 1ZD2P 4TLAA 4V24A 4PZAA 3T5BA 3TPZA 4MGYR 1MHTA 2H4JA 2E87A 1KTIA 1CQXA 1NVEA 1Z5UA 2RH8A 4I8IA 3EDYA 1AD2A 2VK2A 3DTYA 4UBKA 2FW7A 2JG3A 3HZHA 2C9MA 2PMWB 3F4KA 3NWBA 5EXPA 5JNUA 2B7LA 4EA6A 4M1ZA 4PX3A 4B6EA 1MT0A 3GQBB 3T99A 4IOMA 1U11A 2CZCA 4XYGA 1LF0A 3WIDA 1QORA 4EIWA 4ZYWA 5IK2A 3LDFA 3X3HA 4DJ5X 1QJ4A 5C81A 3ZJVA 3E1SA 1BXGB 1CT9A 3VAAA 4KKVA 2ZYGA 2ZDGA 3OAAA 2VJMA 5A3JA 2HY7A 5KNBH 3SZLA 4AN0A 4BFYA 1A72A 1M2FA 5KKAA 1N9GA 2XUKA 3JAWB 3SMQA 4XWOA 1MC4A 1TLLA 4ZPJA 2PS0A 3WISA 3TSYA 3O4IA 3C85A 2Q5OA 3X0DA 1MLDA 3DXYA 3AVPA 2O2DA 5JBQA 2OILA 1N92A 1VLZA 3FIJA 1PLJA 5B2EA 1IEVA 2VBFA 1CTQA 1OLUB 1RRPA 1U0SY 2ZDQA 3BCRA 4BMCA 5T3YA 3GA7A 2DUWA 2X1MA 3MS2A 4URVR 4DUYB 1NF2A 2VUUA 2H08A 1GQYA 1SVUA 1GZDA 5E1OA 1A1SA 4LJ7A 2AJBA 5A3SA 4M0UA 5ALRA 1USGA 2DKFA 3K70D 1IWOA 5ECDA 1XFDA 4FGKA 5AHOA 5TQ2A 4LRSB 2CMHA 2DUJA 4XVUA 1W36D 3IE0A 1GFIA 3TNLA 1VL6A 3ER6A 4ENUA 3FD8A 3HKEA 1RW4A 1F2DA 1VI5A 4MUFA 1IOLA 4G41A 4GD3Q 1JH9A 4Y2HA 2Q4EA 1QAOA 1CJVC 3EGDB 4OHXA 2BZGA 1H8HD 3TKYA 4ERNA 5LM3A 3R9WA 4C4PA 3H16A 2JL1A 3IQDB 3QVUA 3SKXA 1TGYA 1LH0A 4GIBA 1V71A 2VAVA 4LJSA 1C14A 2P4SA 4QEKA 4EA9A 2R7NA 1J70A 1VHJA 4PX5A 4CCAA 2A86A 2JIOA 4NC9A 4DLKA 1GM5A 2IIVA 1UDBA 3MB5A 3N2LA 1TAUA 4B9EA 3N0TA 1I2MA 1X8LA 1ZCJA 4XGKA 1Z12A 1BJTA 2IE0A 3HDJA 2BYTA 1N9KA