1O4XA

Ternary complex of the dna binding domains of the oct1 and sox2 transcription factors with a 19mer oligonucleotide from the hoxb1 regulatory element
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
129
Chain Sequence
b'EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMAKLKPLLEKWLNDAESIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*TP*CP*TP*TP*TP*GP*TP*CP*AP*TP*GP*CP*TP*AP*AP*TP*
molecule tags Transcription/dna
source organism Homo sapiens
publication title Molecular basis for synergistic transcriptional activation by Oct1 and Sox2 revealed from the solution structure of the 42-kDa Oct1.Sox2.Hoxb1-DNA ternary transcription factor complex.
pubmed doi rcsb
total genus 41
structure length 129
sequence length 159
ec nomenclature
pdb deposition date 2003-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
A PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1o4xA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1o4xA01
3LNQA 1L1MA 3QWGA 3S1QJ 1XG1A 3IVPA 4X4EA 4I6RA 2ZB9A 5FKOA 4M3FA 2HDDA 1QVTA 1JWLA 1QP7A 3BR3A 3EUSA 1QPZA 2GBYA 1WPKA 2EZHA 4PU3C 4B4CA 1ETYA 2LYSA 1ZVVA 3G1MA 2KT0A 5IYBJ 2E2HJ 1CQTA 2IU7A 1ZQ3P 1EFAA 4D5CA 1AKHA 3BR5A 1PNRA 1RIOA 2AUWA 1AKHB 4A3GJ 4BY7J 2OF7A 1PERL 3ZHIA 2RAEA 1MH4A 4DYQA 5GPAA 4C3JJ 4UUSB 1U8BA 1ZZ6A 2KZ8A 1MBFA 1ETVA 4M3GA 3K7AJ 4BKXA 5E3MA 2JCGA 2XB5A 3LSPA 2K40A 1QP4A 3O9XA 2X9DA 4BBRJ 2DMQA 5F0CA 1JKPC 1BW5A 3HOVJ 1IC8A 3ZQCA 2HI3A 1LFBA 3A02A 1ZR4A 2ME6A 1LMB3 2JMWA 3RZDJ 3S1NJ 3CROL 4FCYA 3RZOJ 5M5YJ 1RZRD 1Z0XA 3MN2A 2FQ4A 4FISA 3S14J 1MBHA 4AC0A 3DNVB 2PUBA 2E1OA 1XC5A 1ZGWA 2PPXA 2CQQA 3R1FA 2QCOA 3DEWA 3LSJA 5GPCA 1K61A 3H5TA 1TWAJ 4M6VA 2L9RA 2LYQA 2CUFA 2JJ7A 3CQZJ 4BXXJ 2AXUA 1TC3C 4X1EA 1T33A 4YG7B 2Y9ZA 1HDPA 3S1MJ 3QPSA 4X4BA 1OCPA 3RKQA 1ZS4A 2DJNA 1ETKA 3FK6A 5FKNA 2BNMA 2CROA 1I6HJ 2I10A 2NVTJ 1R69A 1WIZA 3S2DJ 1F43A 5IPAA 4MFDA 1GUUA 1BL0A 4QTRA 4IHXA 4AYBN 2LLKA 5IOYA 1LE8A 1OCTC 3QQ6A 4PU4C 3JRCA 5FLVA 1UXCA 2YS9A 2XGCA 1CJGA 3S2HJ 3C2BA 2VPRA 4A3EJ 1QVUA 2DMNA 1BJZA 2ICTA 4MIMA 4A3KJ 1U78A 2LYLA 1MBJA 1RETA 2XRLA 2KEKA 3G1LA 2IAIA 3JRFA 4FE4A 2XPWA 4I76A 3B7HA 3ZQFA 3JXCL 2X6OA 2DMTA 3U3WA 2DA5A 2ECCA 2LYPA 2XCJA 5J1UA 4DYCA 1YRNB 4JYKA 3HOZJ 4XRSG 1Y1WJ 3B6CA 4RDUA 2LTPA 2MG4A 4YARA 4A3MJ 1FTZA 1X2MA 4XICA 5JLWA 4GFBA 5IP7J 5M3FJ 4J1XA 1BDIA 4OB4A 1ADRA 3MVPA 3WHCA 3F0CA 2YUSA 3FYAA 4I6ZA 3IH3A 1JFSA 1ETQA 1WH8A 1GVDA 4A3IJ 3VPRA 4MLOA 3S16J 2K9SA 1ZZ9A 1OJLA 4C3HJ 1WI3A 3TEDA 4JP0A 2Y0SN 3S17J 5EYRA 2M0CA 2EBYA 1SQ8A 2R92J 4DYRA 2HOSA 3BG5A 1Y1VJ 2O8KA 4J1WA 2HINA 1JGGA 5M5WJ 4IHYA 4IA8A 2IV1A 3ZQHA 5F0FA 3M4OJ 2O38A 3GBGA 3KZ3A 1FIPA 1WH6A 1U9OA 3F6WA 5FKLA 1RESA 5A7LA 5IOZA 2HSGA 3BTLA 1VI0A 3GBFA 2XJ3A 5C3EJ 1HDDC 1HOMA 2FJRA 2PUGA 2GLOA 2AW6A 4FE7A 3CECA 4M3BA 2BJCA 1ZZ7A 2XSDC 2EZKA 2JVLA 1RPWA 3OQOA 2JA7J 4X4CA 3LSRA 1E3OC 2K9QA 4M3EA 2LFBA 3IV5A 1OSLA 1RR7A 2X48A 4G12A 4I8TA 1TWFJ 2QF7A 1JJ8C 2FJ1A 2K9NA 3CMYA 4JX4A 4NDLA 1Z77A 2EBIA 1YRNA 1IUFA 1BW6A 3TW6A 4IHWA 3KJXA 1D5YA 3A01B 1ZKGA 2DA2A 2Y9YA 1FJLA 1UTXA 1UXDA 3BR1A 3NARA 2NS8A 4IVZA 4B1RA 3BTCA 2DTZA 3JRIA 3GTJJ 1UMQA 2D5VA 5C4JJ 2MW8A 3TP3A 1ZR2A 1PRAA 1POGA 2PE5A 2DMPA 3JRHA 5FKKA 2PMZN 3OOUA 5J1RA 2JA8J 1BA5A 1JT6A 5C44J 2NVQJ 1POUA 1NERA 2LYJA 1K83J 3CDLA 5K7ZA 3HGYA 3O8HA 3HOXJ 2IVGA 3SFIA 4IWRA 2R5YA 1VNDA 5C4XJ 4Z5DA 4X4HA 5JLXA 2CUEA 1IDYA 2Y2ZA 4W1UA 2OPTA 1WH5A 3RQIA 3SJMA 3S15J 2R5ZA 3OP9A 5DS9A 3JXBC 3HZIB 3H0GJ 5FLMJ 1IJWC 2DMUA 2PIJA 3PXPA 2B63J 3HB9A 3ZQIA 4DW6A 1ETWA 2AO9A 2DA6A 2EF8A 1ZK8A 1JJ6C 2XB0X 3BTIA 2JWTA 4JX5A 3BS3A 2LR8A 1H8AC 2XIUA 2LD5A 2E2IJ 2FX0A 5IP6A 3D1NI 2WV1A 4XRMA 4X6AJ 4C3IJ 1Q1VA 4QSHA 3BDNA 1OFCX 4M3DA 4IEJA 3UKGA 1O4XA 2MSYA 3Q0WA 2KEIA 3A01A 1RKTA 1VF9A 1ETOA 4Z59A 3PM1A 2HXIA 1A6IA 2VKEA 3BR0A 2XI8A 4X4GA 4J19A 4X4FA 2KEJA 2O4AA 2IBDA 5FKMA 5BNGA 3JRGA 2AXVA 4X4IA 2AHQA 1B8IB 4A3JJ 1NK3P 1JUSA 5GP9A 1JUMA 3FK7A 4Y42A 3ZQGA 2LCVA 1UG2A 2N8GA 3SDGA 4A3CJ 3K2AA 4DZPA 2WUSR 3TW7A 4EEFG 1G2HA 1LFUP 2CQXA 1MBGA 2ELKA 1LQCA 3GTLJ 2KDZA 1FTTA 4A93J 1DWKA 2H8RA 3HBLA 2DA3A 1IRZA 3G1OA 1ITYA 1UHSA 5F27A 3LSGA 3HOUJ 3BQZA 4DZJA 3HM5A 2L8NA 2GM4A 3FIWA 4MCTA 1TWHJ 1HF0A 2M8GX 3A03A 2OR1L 2LP0A 1W0TA 5M3MJ 2HQ5A 3HDDA 3OIOA 1JT0A 1W0UA 2O9LA 1LCCA 1IGNA 4XK4A 3Q0UA 1P7JA 1BDHA 3NAUA 3E7LA 2MQKA 5F08A 3I4NJ 1A5JA 3QPLA 1X2NA 4S0HB 1PRVA 2HOAA 2PUAA 1ORKA 4AUXA 4JCXA 1FEXA 3HKZN 5IP9J 5EGOB 3JRDA 1GDTA 1Y7YA 4A69C 2P81A 3HOYJ 2TRTA 3S1RJ 1B8IA 2NOGA 2LVSA 2PUDA 1RZSA 2GRLA 1LLIA 3OSFA 1QRYA 9ANTA 2AWIA 3JR9A 1Y9QA 2IEKA 1MH3A 1RKWA 4C2MJ 3W6VA 4FTHA 3GN5A 3OMTA 3SCHA 4F8DA 4FBIA 3VK0A 4UUSA 1GV2A 1X2LA 2R93J 1LCDA 2PUEA 2CRGA 2BNOA 2XGEA 3QQAA 2KPJA 2EZLA 1IV6A 2JA5J 1ZAYA 2O7OA 1NK2P 4MO7A 4RBOA 1ZZ8A 2EZIA 2L7ZA 4A3LJ 1HCRA 1B0NA 3BG9A 3HGGA 2NS7A 1APLC 3LOCA 4UUTA 4GQMA 2M34A 2L49A 4D7NA 2W48A 4QIWN 3GTKJ 3BR2A 1VPWA 2XGDA 4HNVA 2HYJA 1WETA 4CYCA 2OFYA 4YBAA 4V2GA 2IVQA 2B5AA 3BG3A 3SCGA 2VKVA 2JA6J 4I6UA 2DN0A 3B6AA 3MKLA 4MFEA 3FMYA 4V2FA 5EEAA 1R9TJ 2DA7A 4BBSJ 5FJ8J 1FIAA 3GTMJ 5F1JA 5J3LA 1R63A 2G0EA 5K7FA 4ABZA 3F52A 1GT0C 2L0KA 1NTCA 2LKXA 1ZZBA 1AU7A 4D5FA 1PUFB 3ZKCA 5EG0B 5DTDA 1JTYA 2HOTA 2L7FP 4Y52J 1XWRA 3ZHMA 3FKIJ 1P7IA 3TP0A 4A3BJ 1DW9A 1WCMJ 2Y31A 1MSEC 3OQNA 2R63A 2NVYJ 4Y7NJ 2VUMJ 3GN5B 3GTOJ 1WGXA 2LY9A 1QPIA 3M3YJ 2XPVA 1AHDP 2ICPA 1TWGJ 4D7MA 4Z5CA 1X58A 4PU7A 2CJJA 5HODA 3OSGA 4GHJA 1SANA 3CCYA 3Q0VA 5M5XJ 2FD5A 2TCTA 1VFCA 5EDNA 3F51A 1RPEL 1U9NA 3G7DA 2WIUB 2JK3A 3HEFA 2E19A 4L5EA 2WB1N 2R5YB 3QF3A 2L7MP 2ECBA 1JUPA 3O8GA 2AXZA 2O49A 1MSFC 2CSFA 1SFOJ 1HLVA 2COBA 3BQYA 3BT9A 2PUCA 2MGQA 3TRBA 1RZRA 1H88C 1ZPQA 1NEQA 1F36A 2DA1A 5EF6A 2M2EA 3SCFA 1TWCJ 3FYMA 1EF4A 2IVBA 2EH3A 3GTPJ 2MEZA 5K7HA 2GRMA 3G5GA 1X57A 3QYXA 1JTXA 3HOWJ 5EZHA 3LISA 2VI6A 4FN3A 4A3FJ 3Q3SA 3H3VK 2R7ZJ 2CU7A 1PRUA 4LOCA 3WHBA 1I50J 3CLCA 1MBEA 4Z58A 4IHVA 4I6TA 1YSEA 2WAQN 3OQMA 2H1KA 3KXAA 1JFTA 4JQDA 1QP0A 3BR6A 4JCYA 4NDWA 2EWTA 1GV5A 1IG7A 2HXOA 2GZUA 3IH2A 1ZUGA 5IYDJ 2R1JL 3JREA 1IDZA 5EGOA 4YG1A 2EQRA 3JRAA 3GTGJ 1ETXA 2ME0A 4XIDA 1B72B 4X4DA 2LYRA 3BD1A 1XS9A 2ID3A 5E3OA 3PO2J 3MLFA 4XRSA 2Y30A 4PU8A 3UFDA 5F0HA 1B72A 2BNNA 2R5ZB 1S7EA 4CYCB 1LE8B 1I3QJ 3JXDL 2A6CA 2XPUA 1H89C 3ZQLA 3JRBA 5F04A 3PO3J 2M9HA 1QQBA 4B3AA 3I4MJ 3BTJA 2R0QC 1WH7A 1ENHA 5IYCJ 3FISA 3L1PA 4O8BA 1QQAA 2JN6A 1MBKA 5K98B 4W97A 1JKQC 4Z5HA 1ZZCA 5J1YA 2NVXJ 1T56A 3ZOBA 1DU0A 1MNMC 5EG0A 5E3LA 4MCXA 3S8QA 3LFPA 2LYKA 2DA4A 4BY1J 3DCFA 1JKOC 5EZGA 2IUOA 3GTQJ 3RZZA 2PUFA 2ID6A 4YG4A 1JH9A 5E3NA 4A3DJ 1PUFA 4JX6A 2E2JJ 2YU9J 3IH4A 2LK2A 1ZTRA 1JKRC 1DU6A
chains in the Genus database with same CATH superfamily
3H3ZA 1L1MA 3ULQB 1P92A 4DE9A 1XG1A 2VQGA 3IVPA 2DOFA 2PMZA 4M3FA 3JAMK 1A35A 1QVTA 3IKVA 3K69A 4KT5C 5D8KB 3DU6A 1MMDA 2LYSA 2CW0F 1MMGA 2EV6A 1ZLJA 4Y17A 3ZN1A 1CQTA 1MIJA 1QHGA 4UV9A 1ZQ3P 1GHCA 2OA4A 2E1MB 1QQIA 2ZXJA 3BR5A 1AKHA 1QGPA 4EJVA 1PNRA 1YLFA 4O5VA 4BU2A 2MABA 1CF7A 3CC7I 1WZ2A 4A3GJ 4BY7J 3KFWX 5KK1A 5ED4A 3ZHIA 1ZZ6A 2JVHA 2R7FA 2MLGA 5E20A 4DGWB 4KISA 1W36D 1K6OA 1BC7C 4RB0A 3QODA 2JCGA 4CO8A 2XB5A 2BVMA 2LC2A 3LSPA 4K2EA 4LK0F 5CVJA 3HOTA 2PN6A 3O9XA 4LB5A 2ZSHB 1JKPC 4P5OA 1Y56A 1EH7A 2K7LA 4C9YA 4G7OF 3U1KA 4CZCA 1HBXG 5HLGA 3RPUD 1ZR4A 1UHMA 3K0LA 4FCYA 3HZJA 5M5YJ 4IZZA 1S5LC 4FISA 4I0AA 3G71I 2KISA 1BI1A 3K4NA 3OKZA 3KP2A 4AC0A 4NUBA 3SHFA 4LITA 4FT8A 2CQQA 3E6DA 2NNYA 1ZGWA 2PPXA 3R1FA 1BR2A 1TWAJ 1NG7A 2F5CA 1VQ8I 3E5XA 4IOAF 1ZYRF 2L9RA 3OYGA 3CUOA 1SFXA 5CVVA 2AXUA 2JJ7A 2QGUA 2OZ6A 1ZRFA 1BIBA 1T33A 2VQCA 3MZ8A 4YG7B 3S1MJ 4X4BA 3ZR8X 1MJAA 1VTNC 1Z6TA 2FU4A 3J7YJ 3FK6A 5FKNA 4ZJZA 1V55H 2I10A 4RAFA 2LBFB 1I6HJ 3LMMA 2Q0OA 3GZNB 1FT9A 4M9ZA 3K4CA 4PU4C 2HEOA 3GF2A 5FLVA 3ZPXA 3MZYA 2K85A 4IQJA 1HW2A 4A3EJ 1X1BA 1RC9A 2D1VA 2DMNA 1WVRA 4RS8A 2PI0A 4MIMA 4A3KJ 1LB2A 3M1CA 2VBYA 3AG3H 5LRSA 2H27A 2GA2A 2IAIA 3JRFA 4E7JA 2LNMA 3JXCL 1A6QA 3ZQFA 2K4BA 2X6OA 3ZMDA 3G4SI 3U3WA 5B1AH 2HQNA 2R7QA 3I4PA 3A1YA 1ZRDA 5FFXA 5LGNA 1SVLA 1OCZH 2V1XA 4DYCA 3OS2A 4I01A 1XDUA 3OV8A 3B6CA 3RCOA 4RDUA 1MMSA 2KDOA 3O3KA 2CFOA 1U8RA 1DGRM 1X2MA 2ZCWA 1HKTA 2JPBA 4Q48A 5IP7J 3X2QH 2BW3B 3SDBA 2MYSA 4EV0A 4Y4RA 5JVTA 4BEHA 4OAZA 1X3UA 3IH3A 5IY5H 1ETQA 1K7AA 1WH8A 2Q2EA 4A3IJ 4O6JA 3VPRA 2DODA 4EJTA 3S16J 2DOEA 3L2CA 1ZZ9A 1OJLA 3UWPA 1X19A 4I0BA 2HKOA 2IGOA 4C3HJ 4B3XA 5EYRA 4FX4A 1SQ8A 3FF5A 3CC2I 1Y1VJ 2PMUA 1JGGA 1XGNA 3P9CA 2IV1A 2PMHA 1MGTA 2UUZA 5F0FA 1IN6A 2ZFWA 3GBGA 3M4OJ 1Z05A 2ZJRF 3KZ3A 1U9OA 4OINF 4BL0B 3UR3C 4ER3A 5A7LA 3I59B 1OISA 3BTLA 3RI4A 4YIIA 2VBWA 2GLOA 4LFUA 4IHTA 1P4AA 1SVOA 2ACJA 3FXUA 4XOPA 1ZZ7A 4HX8A 5CQEA 3K4KA 3P7NA 2HR3A 1FSHA 3LSRA 1E3OC 1IV8A 5FFZA 1RRJA 1F4KA 3DTEA 1RR7A 3M07A 4I8TA 2E1CA 4BQAA 3ML6A 4HEA2 1YJNI 3TGNA 2O61A 3CMYA 3GWZA 4ER5A 4NDLA 2GAUA 1BW6A 4IHWA 5AONA 1FJLA 1UXDA 2PBIA 3QFIA 5FD5A 2V9VA 4CCMA 1PP8F 2NS8A 2RVCA 4MHGA 1U6GA 1X4OA 4E4HA 2D5VA 4AM3A 3NRVA 2PE5A 2PMZN 3OOUA 3F8NA 1D8KA 4M6YA 5DCFA 1NERA 1SC7A 1TL8A 2Y0MA 2HDWA 3SFIA 4HF2A 2IS1A 4XONA 3HSRA 4X4HA 3OYHA 3S32A 1TT5B 2ELJA 2Y2ZA 2B7EA 1S3JA 4EM2A 3BZKA 2R5ZA 1WFXA 3S93A 2GXAA 3OYCA 3ZQIA 4DW6A 3PFIA 1YOVB 2P7VB 4CCKA 2AO9A 4LLGF 3TDZC 2EF8A 4BXFA 4GRIA 3C1DA 3KP7A 5TJJA 1JJ6C 4HG2A 4OAYA 2PFBA 2UXXA 3CO7C 1GVJA 1RNLA 4JX5A 4A0ZA 2JRTA 3D1NI 2WV1A 4X6AJ 3R09A 5F64A 2GOMA 1OFCX 2DQLA 4XBFA 2WTEA 2OBPA 2UXNA 2XAQA 1O4XA 2KEIA 3A01A 4KYWA 1ETOA 3PM1A 1A6IA 2XI8A 4X4GA 1G3YA 2O4AA 1R6RA 2IBDA 4PK4A 5FKMA 5BNGA 2E34A 1ZGJA 4IF4A 3QAHA 3EPZA 1B8IB 1RZ4A 2Q2EB 2V9PA 5GP9A 1JUMA 5ILSA 4Y42A 3ZQGA 2XVCA 3K2AA 1J2XA 5CVIA 1E2XA 1TLHB 2CQ7A 2RQQA 4DZPA 3OYNA 3TW7A 1MBGA 2EA4A 1RI7A 4ENKA 1XSDA 4A93J 3WTYC 1IRZA 2H6BA 2PXKA 1UHSA 2A05A 3OR2C 4A0XA 2ZC2A 3GZDA 3VYUB 3OIPA 2M8GX 3IAM2 3A03A 4XORA 2KZ8A 4GCVA 5M3MJ 2F48A 3L2VA 4ENMA 1HA8A 1LCCA 1ZN2A 3E7LA 1FYMA 1ON1A 1XMXA 2EV5A 3QPLA 4S0HB 2X6WA 5J8FA 3OYJA 2D45A 3CF2A 1FEXA 5IP9J 5EGOB 3JRDA 3ABLH 2DFIA 4BS9A 4S04A 3KP4A 3OY9A 1LLIA 1QRYA 5DCMA 3JR9A 2XKOA 2IPQX 4C2MJ 3T5XA 3I0TA 3SCHA 4FBIA 5D5UB 1XN7A 3DTIA 3CCUI 3VK0A 1J7KA 2CQNA 2K5CA 2CRGA 1UHWA 3QQAA 2F4IA 2A6HF 3REOA 2O7OA 3CDIA 1ZZ8A 3N4MA 1HSTA 3K4MA 1Z21A 3LQQA 4I98B 3LOCA 4H4KC 4GQMA 3PSIA 5HVQC 2L49A 1J75A 4D7NA 5JFRA 1OPCA 2W48A 3DEUA 3BR2A 1V54H 2VXZA 4MEXF 1WETA 1T2KA 3HPHA 2OFYA 1D1BA 3F9KA 4KMFA 4YBAA 4V2GA 2PX9A 3KEQA 2DN0A 4D1QA 4YIRX 4HBLA 4LGWA 3OYKA 1FIAA 4XKVA 2M7BA 1YJWI 5J3LA 1W4MA 1D3YA 1D5VA 2XGXA 2R7VA 1KQ0A 3MMYB 4HX7A 3Q9SA 2LKXA 3BOQA 3SYTA 3VOEA 1GXPA 1AU7A 4L0YB 3V4GA 4XM3A 1PUFB 4I7HA 3UNGC 2KLOA 3ZKCA 4LMYA 4QPOA 3SZPA 5B1BH 4WVLA 3A4CA 4KIBA 4A3BJ 3L00A 4E7ZA 3GN5B 5JUWA 2ICPA 2XPVA 1AHDP 1BIAA 4A2UA 6PAXA 2MD0A 4GHJA 1TW2A 2FD5A 3LSMA 3HC7A 5CLSA 2P5KA 1IO2A 5EDNA 3MWMA 5GTHC 1RPEL 2DOAA 1Y8QB 4RGSA 3MCZA 2WIUB 3HEFA 2E19A 4L5EA 1FMWA 4F3QA 3R0JA 2L7MP 2ECBA 3QF3A 3O8GA 5LRRA 4U87A 2EB7A 2P8TA 2COBA 3J7ZI 3QOXA 2PUCA 2H8WA 1RZRA 2AQFA 1H88C 2I5UA 1F36A 1GLNA 3ABMH 3V7SA 2WAEA 3FXKA 2M2EA 5DYMA 1TWCJ 1O3QA 1W36C 1RUOA 3CD6I 5ICFA 2IVBA 1XMKA 4RB1A 3GTPJ 4IJAA 2VBZA 5K7HA 1X57A 3ROUA 1W5TA 3HOWJ 2VI6A 3H3VK 1ZARA 2IXSA 4LOCA 2CWEA 4Z58A 2DLLA 2ZMEC 4GDFA 2H1KA 1G3SA 4H0EA 3RKYA 2ZXHA 3KXAA 4JCYA 5H2FC 5B5EC 3BPXA 4NDWA 4BDYA 3ME5A 1OCRH 2IA0A 3LFKA 1G6NA 1ZRCA 5IYDJ 4YG1A 2RGVA 2XIGA 4FHTA 3NDBB 4HLXA 5J8CA 1D1CA 4PU8A 3FXRA 4N9HA 5D6FA 2BNNA 4KIGA 1FNNA 1LE8B 1OYIA 3BROA 3J7AY 5L3EA 3BLYA 3PO3J 1WH7A 1IW7F 2WAQA 5HS9A 4A5NA 1YW8A 3RKXA 1HKQA 3WU1B 1QQAA 2JN6A 4M71A 1LEAA 3CLOA 2QBYA 3CUQB 1FLIA 1ZZCA 3WTUC 1XSXA 1T56A 1A31A 5DEQA 1QZXA 2CMPA 1ZG1A 2XV4S 3S8QA 3FMSA 1P2FA 3VEPA 1X1DA 3BJAA 2IUOA 1JKOC 1T6SA 4PJNA 4A3DJ 4EGYA 2W4SA 1C0WA 2E2JJ 1LUJB 2DK5A 2LK2A 3ZMVA 3LA2A 4ZTJA 4I6RA 5KNLA 2ZB9A 3AAFA 3L2UA 1YG2A 1BOBA 2ZNZA 1JWLA 1Y39A 3BR3A 2BHYA 1ZAOA 4B43A 4PU3C 4ESFA 2RKHA 3E6MA 5HLIA 2BXYA 3H3UA 2VPLA 1ZVVA 4M9SA 2IU7A 2CW8A 4EK9A 1EFAA 1ONVA 4D5CA 2DPUA 1O7LA 1RIOA 2QQ9A 2QKMB 1AKHB 3M8FA 2LYCA 4XKWA 3QRFF 2B0LA 2LLWA 2VKHA 4C3JJ 2M4KA 1NW3A 1ETVA 1XTAA 5GTIC 2CYYA 3F23A 1S7AA 2HGCA 2EA2A 4U7BA 1XX5A 2JZYA 1MW7A 2GIVA 2K40A 2FOWA 3BG7A 4EQQA 1VQKI 3V7RA 1G3WA 1KONA 5HNFA 4R8HA 2X9DA 2JRMA 3F6OA 5F0CA 1BW5A 3ZQCA 3TDUC 2PJRB 2HI3A 1OR7A 4UHTA 1YIOA 2H6CA 1E3HA 3E1SA 3H35A 4ZYGA 2JMWA 3RZDJ 2UV1A 1Z7UA 4RLFA 2Y48A 2ELHA 1R5ID 2XXQA 1Z0XA 2FQ4A 2LOOA 4XKBA 3QWLA 5CPRB 4L9VA 2HCNA 1I3AA 1T0FA 2R3SA 3CF5F 3DEWA 3MEXA 2LKSA 1BI3A 3VYTB 4HAMA 2DTRA 1D8JA 4OOIA 3DTKA 3CP2A 4BACA 3PJRA 2OUMA 1TNTA 2CUFA 3CQZJ 2J7WA 4E70A 4DQ2A 1TC3C 3LL7A 4X1EA 1BR4A 5EEHA 1R36A 3KX2A 4XLAA 3QPSA 1OCPA 3S3OA 1ZS4A 3OYLA 4U7DA 1SVMA 3AL0C 1BI2A 1R69A 2A5YB 1T8IA 2K3FA 2CO5A 2O8XA 5ILVA 4IHXA 3GUUA 3FHNA 5IOYA 1LE8A 3VSKA 1KU2A 1DDNA 4G94A 2OV7A 2YS9A 2X1DA 1CJGA 3FZVA 2M45A 3KP5A 3IC7A 4LK1F 3O2PE 2ICTA 4BHBA 3BP8A 4KFCA 3KLNA 2XRLA 2KEKA 3R4KA 2MBFA 4NQWB 4OIPF 4FE4A 3SZTA 3HYIA 4D9JA 3KETA 2FNPA 4BE2A 2DXIA 2DA5A 2ECCA 2QWWA 2JTVA 3OYIA 2QUFA 5FB2A 2LYPA 2G7HA 4MTEA 3S3MA 3OIQA 5J1UA 2F4MB 4P9FA 3RKWA 1A04A 4XRSG 5LGTA 1SMYF 2DT6A 3CUQA 2LTPA 2MG4A 4BXUA 3CLQA 4IVNA 1FTZA 2PXPA 1MMNA 1S6LA 4GFBA 3DBHB 4ZZLA 3OS1A 1PYVA 4OB4A 1VQNI 3OOPA 3WHCA 1VQ7I 1IN7A 3QOWA 3AKZA 2LBFA 4RMNA 2PXUA 4X0GA 3M1EA 3ZMTA 2P5VA 3GUDA 3CMEI 1R58A 3TEDA 1WI3A 4JP0A 1IN5A 1FBSA 4U0YA 4IX7A 2EBYA 2K02A 4C2UA 4DYRA 4E7HA 4J1WA 2X4HA 3CC4I 5K1YA 4IHYA 2CUJA 3M8EA 1WH6A 5DM7F 3F6WA 4F7ZA 3PNVA 3QU6A 5IOZA 4QWQA 5ICCA 2EFQA 4HZFA 5LHGA 5C3EJ 4AD9A 1I6XA 1YI2I 1FPQA 3KYLA 3K1NA 3OL3A 1VQOI 4HRAA 2K86A 2FSWA 3GO5A 3LA3A 3WTSC 3OQOA 2O0YA 2V4JC 4X4CA 1UAAA 1BM9A 2LFBA 3D5LA 3TO9A 3FM3A 2LKPA 4G12A 3ASOH 2QF7A 2M7AA 2FJ1A 3H9QA 4NB5A 3QYFA 4JX4A 2PJRA 3G73A 2PQ8A 1N75A 2EBIA 3FDYA 4L5IA 1LPQA 3KJXA 3I54A 5ICGA 4XKCA 2DA2A 2GWRA 2Y9YA 1Q1HA 2Z9OA 2PXEA 1BJAA 1G8XA 3F8CA 4HX4A 1TW3A 1IN4A 1XGSA 2ESNA 3BPVA 4B1RA 3CUQC 2V7FA 4CH7A 2DTZA 2HOEA 2O6GE 5HNHA 2MW8A 4IRHA 1POGA 2YSRA 2HPMA 3JRHA 3LQXA 4FETA 2JA8J 5AIQA 1JT6A 1T98A 5CVRA 3WGIA 1Z9CA 2JUCA 1H0MA 1POUA 1PUEE 2DBBA 1FOXA 1K83J 3QP6A 3RYRA 3LQRA 3O8HA 4GO1A 2IVGA 3HIFA 4HLYA 1X3ZB 1LDKB 4N0BA 5JLXA 2DK8A 3J7AO 2W1OA 4YRVA 2L4AA 2OPTA 3RQIA 3WTWC 1IXSB 2DT7B 3JW4A 1K4TA 5DS9A 5FLMJ 1IJWC 2DMUA 3E3VA 5DD4A 2QZ8A 4U88A 3ZMUA 1WHUA 2PXDA 4EJUA 2L9VA 2XB0X 3VSLA 1U2WA 4LJZF 2BVLA 2PXFA 3RDIA 1H8AC 2XIUA 2LD5A 3VYSB 3DPLC 3U9GA 4M3DA 2ZO4A 3QYEA 4AWXB 3CCQI 2AQEA 1UCRA 2W84A 4CICA 1VF9A 4Z59A 2HXIA 2VKEA 3BR0A 2MH9A 4M9XA 3QOEA 3JRGA 5HLHA 3A0BC 3TL4X 3T8TA 1I1SA 2EPFA 4A3JJ 2FEZA 2N8GA 1P4XA 4JOMA 3WTTC 2L2OA 3ZQ7A 3FKJA 1FBUA 4QPQA 2JSPA 3I58A 2KDZA 3PUBA 3FMQA 2CV2A 1DWKA 2DA3A 4PSWA 1ITYA 4TV7A 2OCCH 3HM5A 3FIWA 3A9XA 1IRGA 4MCTA 3KPHA 1KYWA 3H36A 2OR1L 3J81K 4HRIA 3HUGB 1W0TA 1MFQC 1FBQA 2HQ5A 2BY1A 3DPTA 3OIOA 1JT0A 1IXRC 2LREA 3VWBA 3I9V2 2MQKA 2RV8A 2GQQA 2VB6A 3D5SC 5F08A 3E6CC 2V1UA 2HZDA 3L7WA 3I4NJ 1A5JA 2EFOA 4AUXA 4ZH4F 1JGSA 2LMDA 3VB2A 3W3CA 1XPXA 2V6EA 1GDTA 3E5QA 3AG2H 1W7PA 2DO7A 3KIOA 2TRTA 3QYBA 1NHAA 1WJFA 2NOGA 2LVSA 2PUDA 2IP2A 2MH2A 9ANTA 2AWIA 3I53A 1MH3A 2KJCA 1RKWA 2M5WA 3KP6A 2CGPA 2V79A 3AG4H 4FTHA 1K78B 2XDVA 1V5FA 2XGEA 1IRXA 3KEYA 2EZLA 1O3TA 1B9MA 4OMZA 3FXLA 1S9HA 4RBOA 3G0TA 3E6BA 5DT2A 5GAGi 4G6QA 3BCBA 3OYDA 3C2GA 3DV8A 3IHUA 3AL0B 2HQRA 2KP6A 3OL4A 1LDDA 2EIMH 2J5OA 3NWTA 2XC7A 1QU3A 3GYHX 1I39A 4QIWN 4R79A 1SFUA 2JUGA 2HVQA 1ULYA 3ZRGA 4CYCA 3DF8A 3PUFA 2XF6A 2W57A 5TRDA 2B5AA 3B02A 2IVQA 4ZC3A 1KA8A 1SFKA 2VKVA 1HKSA 1Y6IA 3TOAA 3SCGA 4I6UA 2GA1A 3LSHA 2QSHX 1G4DA 5JI6A 4V2FA 5EEAA 3FMYA 2VIXA 4RAGA 2DA7A 3QOPA 2EV0A 3KYCB 4BBSJ 1HSJA 3ABKH 1YO5C 2MC3A 2M4GA 2KQRA 4DNCA 2XAFA 5F1JA 1R63A 1U2ZA 5K7FA 2E1NA 4O3MA 5CKTA 4ENNA 1K6YA 2NRAC 1NTCA 3FXMA 3JCUC 4E7SA 4G7ZF 1W5SA 4PGHA 1WSUA 2STTA 1R49A 5EG0B 1ZLKA 3ZXSA 1JXSA 3ZHMA 3FKIJ 1P7IA 4BJTA 1DW9A 1MSEC 3OQNA 3G6EI 2RQPA 4Y7NJ 4YELA 3GTOJ 2W7NA 1WGXA 1QPIA 3M3YJ 1V3FA 1TWGJ 1FZPB 3KP3A 2CV1A 1XB4A 2CJJA 2HQAA 5HODA 5D5WB 2VJIA 4A6DA 1SANA 3CCYA 3Q0VA 4M73A 5A2QZ 2TCTA 1VFCA 2V6CA 3ZGKA 3FBIB 2HU9A 3DLLF 1H9GA 2WB1N 1ZHFA 1VQ4I 3LWFA 1JUPA 2KJBA 3AG1H 5BQTA 3PSFA 1SFOJ 1UJ8A 3BJOA 2XXPA 4CGZA 1TQMA 4Y13A 2OC6A 1ZG5A 2KZVA 1TZLA 2IA2A 4RGXA 5CYVA 4RB2C 2LG4A 3WODF 1V4RA 1G59A 2V1NA 2MEZA 3M7GA 4P1WA 2HNHA 5LFAA 3GX4X 4FQGA 3QYXA 4LG3A 2H09A 2RREA 4A3FJ 3Q3SA 5BPDA 2WY8Q 2ICWG 4EKGA 2EILH 1F1ZA 2CG4A 4KJZA 2FMLA 1FMVA 3J80Z 3I3LA 4ZDOA 2WAQN 1YSEA 5E18F 3BDDA 2P4WA 4LLLA 5GAHi 3WG7H 2QQ8A 2EWTA 1IG7A 2K9LA 1FC3A 2GZUA 2EFNA 1EA3A 3IH2A 2K3PA 2RNGA 3JREA 1IDZA 2DCEA 3JRAA 1QBJA 4HW0A 3DU5A 1W7PB 1HW5A 1ERDA 5JVGF 2L01A 3KLOA 2W00A 5E3OA 1XS9A 3PO2J 2LYRA 3BD1A 3EDPA 1B72A 4MTDA 4XQFA 2H1LA 1S7EA 4CYCB 3JXDL 1I3QJ 1H89C 3ZQLA 3JRBA 2BEOA 4B3AA 4UVBA 2FXAA 4WCGA 2RC4A 3A0HC 1M1EB 4ASNA 4EJOA 5IYCJ 5KVRA 3CJQB 2CS3A 4F55A 3L1PA 2IS2A 2IS6A 3BCAA 3V42A 5K98B 4BDZA 4W97A 2R4GA 1T08B 1BN5A 1Y0UA 5BMZA 2L9NA 3M9AA 5J47A 3CCMI 3EUHA 1EH8A 4M6XA 3L2QA 3T0YA 3ZQQA 5K5QA 2LYKA 1S7OA 1E17A 3FXOA 2A07F 3GTQJ 2PUFA 2ID6A 2M1BA 1JH9A 1WKMA 1PUFA 2DW4A 2VONA 4JX6A 3TMOA 4Q2JA 3U1DA 3LNQA 2GOXB 1Z6RA 1SD4A 1HXDA 4WF2A 1F9NA 5DDGA 2WA0A 1ZELA 2L3DA 4J01A 5LGUA 1WPKA 2EZHA 3IP4B 4B4CA 4UNOA 3TFLA 3G1MA 2KT0A 2HFHA 5IYBJ 2VJ5A 4ER7A 4DBQA 4FASD 2XF7A 1R71A 2FF4A 3TELA 5AIPA 2AUWA 2OF7A 2X1CA 2BV6A 4P9UA 5DUIA 1QB2A 2D1HA 3G3ZA 4M3GA 2VLAA 2E71A 3TBIA 3CCJI 1I27A 4ER6A 5E8IA 2VT3A 3RPQA 2EIJH 3OYEA 1X1AA 5D5VB 1QP4A 1FP1D 5FLXZ 3C2HA 4BBRJ 2DMQA 2DFEA 4DIQA 2A6EF 3HOVJ 4N4NB 3T1BA 2ZBKA 5KAFC 3A02A 2VASA 3R6SA 5FRNA 1LMB3 3C7JA 2OQRA 5DV5A 3U21A 1RZRD 2HKXA 4QLCU 2WAFA 3S14J 2HTJA 4I09A 4KDPA 1ZG3A 3OYFA 1UG0A 1MBHA 3F72A 2PUBA 3K9TA 2E1OA 2YPRA 1XC5A 4E6KG 2QCOA 2QA4I 2FUG2 5GPCA 1K61A 1IF1A 2KMUA 3H5TA 2HWVA 4M6VA 4KIFA 1QO0D 5D6EA 4MEYF 3NEUA 3EYIA 2XSJC 4G9YA 2Y9ZA 2IT0A 5L3BA 3RKQA 4OU0A 2DJNA 1OR7C 2M30A 1KQ9A 4IXAA 3OWQA 4CHUA 2BNMA 2CROA 2W24A 3I5UA 5LD2C 1QPMA 1OLTA 1WIZA 1K79A 1BBYA 1XMAA 1VZ0A 4JQFA 4CSWA 3JAMZ 5IPAA 1F43A 1BL0A 1YYVA 2WC2A 4QTRA 1J09A 4AYBN 3WU2C 4ESJA 1OCTC 3R61A 5DD8A 4AVZA 2XGCA 5HS8A 4GYGA 3R60A 2X51A 1DPUA 1FOYA 5D4RA 2ZKZA 2BY0A 1ZH5A 2LNBA 2HVSA 2KFDA 4XLCA 1U78A 2QBYB 2LYLA 3ERED 4M74A 2MA3A 2XPWA 2HFZA 4I76A 5TGTA 3B7HA 2IJLA 3EUHC 3VDXA 1YS6A 4LG0A 5DRTA 4ITVA 5HDNA 2XCJA 2W85A 3E97A 2E35A 4NNJA 4C2TA 2A5WA 4DJAA 1Y1WJ 4MNUA 1YTYA 4ZZDA 2HTSA 3IAS2 4A3MJ 4KMUX 4XICA 5JLWA 5M3FJ 4J1XA 2VE9A 2Y0SA 3A9YA 2Y75A 4I2OA 3PIOF 3F0CA 2YUSA 3FYAA 5EEGA 4IRGA 5FROA 2FBKA 1GVDA 3RSNA 2NNNA 4XMYA 1DP3A 3NZLA 1IZ1A 1MJ9A 2K9SA 3P9IA 4XSZF 4BH9A 4WWCA 4ENJA 4AIKA 1ZREA 4ER0A 2Y0SN 3MKZA 1MDMB 2OAZA 2M0CA 1DP7P 2LY1A 2XRNA 4EM0B 4CCOA 2OTLI 5GAGJ 4B47A 1Z67A 3BG5A 3R0AA 4IO9F 2CH0A 5M5WJ 1J0RA 1JI8A 2O38A 1UELB 1TTYA 1FIPA 3HKZA 1B9NA 1R00A 2DFHA 2JPCA 5FKLA 2E5NA 3I56I 2V3CC 1HW1A 1YJ9I 4Y3OA 1VI0A 5ERIA 5DSXA 1KU9A 2XJ3A 4IPAA 3PL8A 3BC8A 3TQNA 2Z33A 2QQBA 2FJRA 2G9WA 2AW6A 3NROA 4UUVA 3KZZA 1IRFA 3MAJA 4EMSA 3HHGA 2XSDC 2ZJ2A 3O6BB 1RPWA 4F52A 1LVAA 2P7CB 2JT1A 2K9QA 2YR2A 4M3EA 3OYAA 1OSLA 1H9TA 2X48A 3M9LA 4BHPA 2VODA 3PIPF 1TWFJ 2VC1A 2CUZA 2L02A 5ICEA 2K9NA 2KIQA 2L5QA 1G3TA 4U0WA 1Z77A 3HTUA 2O3FA 1D0YA 4KN4X 3TW6A 5JR3A 3A01B 3WTZA 2Q8KA 1UTXA 1XGOA 2OD5A 3NARA 2RDPA 2IGMA 3BTCA 2KRCA 3CJTB 2QKLB 4CXFA 3GTJJ 1QNTA 1UMQA 4XLFA 5C4JJ 3TP3A 5L3FA 4E7IA 4XN0A 2DDAA 4NHJA 2WWYA 4G6DA 1BA5A 1I1GA 1MJBA 1YS7A 4YEJA 1HQ1A 4HDUA 3ASNH 2IW5A 2LYJA 2K4JA 3CDLA 3CJNA 3HGYA 4EQZA 4XLHA 5H6RA 1VNDA 2XKPA 2XUBA 4Z5DA 3LSKA 2CUEA 2ZXWH 1WH5A 2DFFA 2P0WA 3S15J 4GYIA 2FFHA 2PIJA 3PXPA 3Q5FA 3IWZA 4KT6A 1Y0NA 2BXZA 1O3SA 4CZZA 1QZYA 3HL2A 2QSGX 2R7DA 2VQLA 3JSPA 3BTIA 5LHHA 2ESHA 2WY7Q 4ZYEA 2P6SA 3BS3A 2E2IJ 5DRYA 2FX0A 4PSXA 1QZZA 4XRMA 2W25A 1Q1VA 4QSHA 3DP7A 2CFXA 4IEJA 3SEQA 5CJ9A 2EINH 2XAGA 2XAHA 1SMTA 5JHFA 2IGKA 2YBDA 3L09A 3AFHA 4XNFA 4RAYA 4AIDA 4HQEA 2KIUA 3V7CA 4X4IA 1Z3YA 2AHQA 1VQMI 2X6XA 1JUSA 3FK7A 3HJEA 3DM5A 2OU2A 1UG2A 3HPGA 3GZ6A 1VQPI 3SQNA 1FX7A 3SFZA 1LFUP 3DKWA 2CQXA 3CZ6A 4ZYAA 1FTTA 1X3WB 4BYYA 5LLQA 2R7XA 3G1OA 5F27A 2A69F 3LSGA 3BQZA 5B3SH 4DZJA 5DM6F 3HOUJ 2L8NA 4M72A 3VYRB 2DJIA 3FMRA 3KCCA 4UY8I 3W6KB 2VOPA 2LP0A 3N97A 4ZYHA 3GLLA 1W0UA 2O9LA 2VBXA 4PZJA 4XK4A 2XASA 3Q0UA 1BDHA 2X1EA 3QPTA 2D2WA 1SEUA 5D8LB 2OCEA 2XROA 2DYSH 2OTJI 1F5TA 1YX3A 4RGUA 1PRVA 3HXLA 4U0VA 2GXGA 1IN8A 2NAZA 1J5YA 3JSOA 1ON2A 3ISPA 4ZDLA 2B9SA 2P81A 3TO7A 4BQNA 1O57A 1TQIA 2HZTA 4BQOA 3H5AA 4EGZA 3OSFA 5GADJ 1K78A 2V1DA 3W6VA 5FRMA 3CMAI 3GN5A 1W5CC 3OMTA 3H1CA 5K5RA 4UUSA 1X2LA 5FD6A 2R93J 1LCDA 2PUEA 1T38A 4XLNF 1VQLI 2KPJA 5L3CA 2L54A 4BJ5C 3GFIA 1ZAYA 4OIRF 3IUOA 3I59A 1N77A 1NK2P 2RN7A 4WXCA 1PDNC 2L7ZA 3BZ6A 1MKMA 3WGHA 1HCRA 2DYRH 3BG9A 3HGGA 1APLC 2CV0A 5F6FA 4ANJA 3ZP5A 3IWFA 4L0ZB 4WXHA 3GTKJ 1EKEA 1VPWA 4UVAA 2XGDA 4HNVA 1E3PA 4E7LA 2PXVA 3W2WA 3ERMA 4LG0B 3D0SA 3V8LA 2JA6J 3MKLA 2COMA 4BUPA 1MNDA 2FBIA 1R9TJ 2E5ZA 4XSXF 4G7HF 1WQ2A 1UFMA 5K5OA 1KGSA 3K1PA 5FJ8J 1JHFA 2R7UA 2MXDA 3GTMJ 1EJ9A 3GW2A 3SEZA 2L0KA 2EJRA 3P9KA 3RJPA 4RGRA 1PP7U 2YU3A 3VODA 1LJ9A 1SAUA 2AXTC 2HOTA 4Y52J 3WU0A 2PJPA 2F5VA 3DWLE 2ZJQF 2L7KA 2R63A 2NVYJ 2VUMJ 1IUYA 2HYFA 1ODDA 2MFZA 3H9GA 3OMYA 3K2ZA 4Z5CA 3NWSA 1V5EA 1WI9A 1X58A 3GXOA 1XGMA 3ELKA 4PU7A 3OSGA 1KU7A 2HS5A 2VJ4A 5M5XJ 3IRQA 4A0YA 4KUMA 4NC6A 1CF7B 3H9JA 1U9NA 5EJCA 1P6RA 2NXNB 2JK3A 2IS4A 2LRDA 2R5YB 2ZXIA 1LNWA 2X0LA 2AXZA 4D0PA 4B48A 2DAOA 2CSFA 3JTGA 4XLEA 4LD5A 3BQYA 2WBMA 3BT9A 2MGQA 2QQAA 3DXJF 4AIJA 5IT9Z 3TRBA 4PFOA 3KZYA 2DT5A 1LDJA 3EUKL 3RQ4A 5GAEJ 2DA1A 2V26A 5EF6A 2FE3A 2JQEA 3C18A 2FNAA 3FYMA 3BY6A 2ZMEA 2WADA 2EH3A 2KL4A 4F91B 2Z16A 2JSCA 2GRMA 5A2QK 2I8DA 1JTXA 1FSEA 2BYVE 4CCNA 2FBHA 4IOCF 3MD2A 3WHBA 3KL4A 4IRIA 3CLCA 1MBEA 4I6TA 3L9FA 4YFXF 2BY2A 3OQMA 2KIFA 5E1XA 4MQ9F 2Q1ZB 2IRFG 1YW9A 1QP0A 3BR6A 3NXHA 4P96A 1GV5A 1XSVA 2HXOA 3W2AA 4NC8A 4OBMA 5EGOA 2L1PA 1D0XA 3GTGJ 1ETXA 1P4WA 1B72B 4X4DA 5FO5A 2XAUA 3HOSA 2ID3A 1J9IA 4XRSA 2Y30A 4BE1A 3F3XA 5KCMA 5JHUA 3C3WA 4CCJA 2R5ZB 3QPHA 4FX0A 4PCQA 2VJJA 2VL8A 2YX7A 2AS5F 5F04A 1U0JA 3WE2A 1IXCA 2KZGA 2M9HA 1QQBA 4HQMA 3F21A 2R0QC 1HQCA 1ENHA 3GLXA 4YFKF 2ISYA 4O8BA 1V5GA 2LSOA 4DOZA 1OCCH 3HUGA 1MBKA 5BS6A 3F8MA 4II3A 4BNCA 2PXTA 2NVUB 1I5ZA 1NG6A 4CUGA 1YFHA 2X85A 1OYWA 1MNMC 1USTA 3PFYA 3F8FA 1N78A 3ZMSA 3LFPA 2LH9A 2DA4A 4HV6A 4BY1J 4IL6C 5EZGA 2ODRD 3WTVC 3JTHA 3RZZA 4CYDA 3GMEA 5E3NA 2ZJPF 2KIMA 2GZWA 3HRUA 3IH4A 4CA0A 1JKRC 1DU6A 4J00A 4GXOA 4BQQA 3QWGA 3S1QJ 3MZHA 1A36A 3GZCA 4X4EA 3FXQA 1Z91A 5FKOA 2HDDA 2M4HA 2F5EA 1DUXC 1QP7A 3EUSA 1QPZA 2VE8A 3LSTA 2GBYA 1ETYA 4PGGA 1JE8A 2E2HJ 3WG9A 4WX9A 2FA5A 3H5NA 2FRHA 3QP5A 1Z7LA 5L3DA 4OIOF 2QLZA 2WV0A 4RA2A 5E1ZB 3VFZA 1R22A 4UB6C 3S2WA 2RAEA 1TT0A 1PERL 1MH4A 4DYQA 5GPAA 2BY3A 1R1TA 4UUSB 1U8BA 2QYOA 1MBFA 1YE9A 3V8JA 4S05A 3FX3A 4EKIA 3FWEA 3GFLA 4L9JA 3K7AJ 4BKXA 5E3MA 1T0FC 4N4OB 1U5TB 3MQ0A 1Z3XA 3E5UA 2ADUA 2L9SA 3ZMZA 5BPIA 2R7TA 3CJRB 3BWGA 1IC8A 3KE2A 1LFBA 3COAC 2ME6A 2JVGA 3S1NJ 3CROL 4ZYDA 2OJED 3ONQA 3RZOJ 3ECHA 3OYMA 3ABTA 3MN2A 5GAHJ 2UWMA 3DKXA 3DNVB 4RAZA 5CVUA 2WB1A 3LSJA 1D0ZA 1W1WE 2ZMEB 1QZEA 2BW3A 4KA4A 1Z1DA 3OS0A 3LA7A 2O03A 2J7UA 2LYQA 1B4AA 2PXBA 4BXXJ 3RTRA 3EYYA 4BJ6C 4HNUA 5B66C 1HDPA 1D1AA 2KPMA 2BZTA 4F93B 1MDMA 2J5PA 3CCEI 3DBLB 1ETKA 2F6CA 2EWNA 2NVTJ 5J6XA 1MZBA 3S2DJ 4MFDA 1GUUA 2LLKA 3QQ6A 2QENA 1KQ8A 3RYPA 3WGGA 1R23A 3JRCA 1UXCA 3L2RA 3S2HJ 3C2BA 2VPRA 1QVUA 1BJZA 1TBXA 1SD6A 1MBJA 4UVCA 1RETA 3G1LA 3OWTA 3MKYB 2A6TA 1WJCA 1MMAA 1ZGAA 4WK8F 2DMTA 4E7KA 2MC4A 4WXDA 3LAJA 1KYZA 5DTRA 4F92B 1YRNB 4JYKA 2NOJB 2FMYA 3HOZJ 1SD5A 3CCSI 1UZCA 2PLYA 2BOLA 1WJEA 2FQ3A 3K6GA 4HSTA 4HNTA 4YARA 2KRFA 1BDIA 3HSEA 1EH6A 1ADRA 3MVPA 3Q9VA 2Z2SB 4I6ZA 2X6YA 1JFSA 2TDXA 3CCLI 3H5RA 4MLOA 4OIQF 2P5LC 2V9KA 3CCVI 2ZSIB 5E8GA 2LDUA 3S17J 1RIOH 1WJ5A 3CCRI 2R92J 5E1WA 1VQ6I 3GZDC 2HOSA 2O8KA 2HINA 1BOAA 5HDGA 3MKWB 4IA8A 3ZQHA 3CP8A 3CO6C 3BZCA 3BJ6A 2ZNYA 1DQUA 5IT3A 1RESA 4L9NA 1OMIA 3S8PA 1VQ5I 2HSGA 1KU3A 3I55I 3GBFA 5HS7A 1ACIA 1HDDC 5LEJA 4P55A 1HOMA 2HPIA 2PUGA 4FE7A 3CECA 3FHZA 4M3BA 2BJCA 2EZKA 2JVLA 3VWSA 3SX0A 2DPDA 3DKYA 2JA7J 3CTAA 5L3GA 3K4BA 2XHKA 3IV5A 1R5HA 4YFNF 2R7SA 3M8JA 2M8EA 4BEHB 1JJ8C 4HF0A 2XXAA 3KZIC 1LVKA 4KN7X 3L2WA 4BGDA 3LAPA 1XCBA 1K4SA 1YRNA 1IUFA 2P6TA 3V8KA 1SAXA 1D5YA 3ESWB 1ZKGA 2PEXA 1DGWY 4B09A 4RB3C 3BR1A 1FP2A 2H94A 4IHSA 4IVZA 3F8BA 2VT2A 4HPQA 4XR6A 4XOTA 1TQPA 2A3SA 3JRIA 3ZCOA 1ZR2A 1PRAA 2VN2A 2DMPA 3WE3A 5FKKA 5E79C 3SR4A 3IL2A 5J1RA 1YITI 3TOBA 4IQ4A 2HYGD 5C44J 2NVQJ 4UB8C 5H20A 4AIHA 2E7XA 4II2A 2KHMA 5K7ZA 3HOXJ 4IWRA 2Z5UA 2R5YA 5C4XJ 3HRSA 1REPC 1IDYA 4MQVA 1U5TA 4W1UA 4Q47A 3SJMA 2M0MA 3OP9A 5DUKA 4B8XA 2Y69H 3JXBC 3H0GJ 1FYLA 3HZIB 3A9ZA 1MD0A 3HB9A 2B63J 4Q4ZF 1PVEA 1ETWA 2ETHA 1RR8C 1OQYA 2DA6A 3EUAA 1ZK8A 1DULA 3W2VA 3EETA 4HV5A 4ESBA 2JWTA 2F5FA 4BAYA 1GXQA 5DTMA 1B59A 2LR8A 4KITB 3K70D 5IP6A 3BDNA 2IA1A 4C3IJ 1W7PD 3HG9A 4HDVA 2JQ7A 2VQHA 2XF5A 2M3AA 3UKGA 4OMYA 2MSYA 3FM5A 1L0OC 3Q0WA 2BHZA 3TEPA 3GCMA 1RKTA 2LF8A 1T95A 4V19K 2PXLA 2KEJA 3NQOA 2E1MC 3DBRB 3T8RA 3IRRA 4J19A 4X4FA 2STWA 2AXVA 3D5RC 3HRTA 1NK3P 2L4MA 2LCVA 3SDGA 4A3CJ 2E7WA 5LBQA 3F22A 1R5GA 2WUSR 4EEFG 1G2HA 1LQCA 2ELKA 1R1UA 3PNYA 1QA6A 3DEEA 3GTLJ 1SFEA 3FXJA 5LEKA 1JHHA 4RLQA 3HBLA 1YQAA 4ETSA 2H8RA 5E17F 1S72I 2IGNA 4XRFA 5FLXK 1IAWA 2GM4A 1TWHJ 3W6JB 1HF0A 3SZGA 5J4VA 4L18B 4NC7A 4LIVA 1T39A 4R1HA 4KNYA 3K4LA 3PNTA 4ZTFA 1VQ9I 3HDDA 4NQWA 5D5XB 3HTSB 4AYBA 4CCLA 1S29A 1Y8RB 2E60A 4RM3A 1IGNA 1WRJA 1P7JA 2CSOA 3RPUA 3NAUA 1QHHD 2PXQA 2VEOA 4EJWA 1X2NA 2PUAA 2HOAA 2DI3A 3J81Z 2A61A 1ORKA 3CMMA 4JCXA 2QVOA 2JA2A 3EQLF 3HKZN 4AU7A 4NBQA 2QM3A 3S3NA 4XN3A 4A69C 3DFGA 3DQVC 1Y7YA 4EZIA 3HOYJ 4HSRA 1CGPA 3U2RA 3S1RJ 4DBRA 1B8IA 4HF1A 3GVAA 4LB6B 1L3LA 2QEXI 1RZSA 2GRLA 4UXNA 3I64A 2MD5A 2R7OA 2W82A 2K9MA 3ZN0A 4CDGA 1B6AA 1Y9QA 2IEKA 1WJDA 1WJAA 2A68F 2Z99A 5J40A 1X4PA 1XD7A 3LSIA 4F8DA 1GV2A 2F5DA 5DTQA 2LLVA 2VKDA 2BNOA 1LQ1A 3G2BA 1IV6A 2JA5J 4I99C 4IKFA 1YX5A 3DLAA 4HA8A 2F4OB 4MO7A 1LEBA 4ON0A 2FOKA 4Y15A 5F1RA 2EZIA 4A3LJ 2RNJA 3ECOA 1AOYA 1B0NA 1EV7A 5D4SA 4XLPF 2KKOA 1FYKA 1TNSA 2NS7A 4LIUA 2G7UA 4UUTA 4BE0A 2M34A 3GZ5A 4JK1X 3E0JB 2HVRA 1RUNA 2CQKA 4YIFA 2K27A 2XAJA 2HYJA 4Y33A 2E36A 5CQGA 1BC8C 3BG3A 1XCVA 3FBNB 2BE5F 3B6AA 4MFEA 2R7WA 3ABUA 1R4MB 4UV8A 2DDBA 3KEOA 1MNEA 4N9IA 3PE5A 2EIKH 2G0EA 3F52A 4ABZA 3P5JA 4OWRB 4Z6YA 1O7FA 1BR1A 2PG4A 5DCMB 1GT0C 1ZZBA 1PJRA 2BBYA 4D5FA 3MFKA 5HOOA 3HRMA 4HOBA 2GIZA 4G6TB 1JTYA 5DTDA 2L7FP 1XWRA 2VOOA 3TP0A 3I71A 1WCMJ 2Z1DA 4PDKA 1FWZA 2Y31A 3N05A 4B44A 4DE8A 4XL9A 4YG2F 2ZFUA 3SXYA 1J59A 2GXBA 2LY9A 3B73A 4D7MA 1E0EA 1TP4A 1NH3A 1FY7A 1SD7A 1WWXA 1AA7A 5BOXA 1STZA 1X1PA 4A12A 3H92A 4Q5SF 3F6VA 3F51A 3G7DA 2F2EA 3GFMA 3BG6A 2OQGA 2CW7A 2NS0A 3GFJA 2O49A 3K1MA 1DPRA 1MSFC 5ILUA 1HLVA 5KHDA 4JBAA 2YX4A 1ZPQA 4MGRA 1WJBA 4Z2YA 1NEQA 2ISZA 3OYBA 1YHQI 1BI0A 3SCFA 3J80K 1S8NA 1FOWA 1EF4A 1USSA 2DQRA 1UB9A 2R7RA 4KICA 3G5GA 4EATA 2AXLA 5HLTA 5KAIC 3GEZA 2C6YA 4LLNA 3HHHA 5EZHA 3LISA 2HDCA 3HSFA 3H0DA 2BGCA 4FN3A 2R7ZJ 1LKXA 1R7JA 2MLKA 2CU7A 3PQJA 1PRUA 2LF7A 1I50J 4IHVA 1N25A 4I02A 2UZKA 2EFPA 5LHIA 3CESA 1P9QC 4G8XA 4L9TA 2M87A 4GGGA 3WTXC 1JFTA 1R1VA 1U5TC 4JQDA 4AVPA 2DU9A 5IT9K 4PFPA 3OR1C 3PQKA 1ZUGA 1AWCA 1O3RA 2HCSA 4L5JA 2R1JL 1OKRA 2EQRA 4RM2A 3TO6A 3ZPLA 1U3EM 2ME0A 2EK5A 4XIDA 3IKTA 2OZUA 3UFDA 3TKYA 3MLFA 5F0HA 1FOKA 2EFWA 5HDKA 1OCOH 2IVMA 2A6CA 1R4NB 2XPUA 3RIRA 1YIJI 3K70C 3K4JA 3I4MJ 3BTJA 3MEJA 1YW7A 2O5RA 4PUSA 2VC0A 3FISA 1XDSA 4PJLA 3DPUA 5TISC 4HYEA 1OYYA 1JKQC 4ZDPA 4Z5HA 5J1YA 5FGMA 2NVXJ 2LY2A 2QSFX 4C30A 4EM1A 3ZOBA 4A6EA 3KYDB 1LFPA 4PJJA 2Z3YA 1DU0A 5EG0A 1KZHA 5E3LA 4MCXA 3LFUA 3K10A 3DCFA 3CDHA 2KRHA 5H6QA 1X1CA 4PJ0C 4YG4A 3QU3A 1B1BA 4PJMA 2NYXA 2VXDA 5J4YA 4BHCA 4A5MA 1HC8A 2YU9J 1ZTRA 3A2KA 4EVIA
chains in the Genus database with same CATH topology
3LNQA 1L1MA 3QWGA 3S1QJ 1XG1A 3IVPA 4X4EA 4I6RA 2ZB9A 5FKOA 4M3FA 2HDDA 1QVTA 1JWLA 1QP7A 3BR3A 3EUSA 1QPZA 2GBYA 1WPKA 2EZHA 4PU3C 4B4CA 1ETYA 2LYSA 1ZVVA 3G1MA 2KT0A 5IYBJ 2E2HJ 1CQTA 2IU7A 1ZQ3P 1EFAA 4D5CA 1AKHA 3BR5A 1PNRA 1RIOA 2AUWA 1AKHB 4A3GJ 4BY7J 2OF7A 1PERL 3ZHIA 2RAEA 1MH4A 4DYQA 5GPAA 4C3JJ 4UUSB 1U8BA 1ZZ6A 2KZ8A 1MBFA 1ETVA 4M3GA 3K7AJ 4BKXA 5E3MA 2JCGA 2XB5A 3LSPA 2K40A 1QP4A 3O9XA 2X9DA 4BBRJ 2DMQA 5F0CA 1JKPC 1BW5A 3HOVJ 1IC8A 3ZQCA 2HI3A 1LFBA 3A02A 1ZR4A 2ME6A 1LMB3 2JMWA 3RZDJ 3S1NJ 3CROL 4FCYA 3RZOJ 5M5YJ 1RZRD 1Z0XA 3MN2A 2FQ4A 4FISA 3S14J 1MBHA 4AC0A 3DNVB 2PUBA 2E1OA 1XC5A 1ZGWA 2PPXA 2CQQA 3R1FA 2QCOA 3DEWA 3LSJA 5GPCA 1K61A 3H5TA 1TWAJ 4M6VA 2L9RA 2LYQA 2CUFA 2JJ7A 3CQZJ 4BXXJ 2AXUA 1TC3C 4X1EA 1T33A 4YG7B 2Y9ZA 1HDPA 3S1MJ 3QPSA 4X4BA 1OCPA 3RKQA 1ZS4A 2DJNA 1ETKA 3FK6A 5FKNA 2BNMA 2CROA 1I6HJ 2I10A 2NVTJ 1R69A 1WIZA 3S2DJ 1F43A 5IPAA 4MFDA 1GUUA 1BL0A 4QTRA 4IHXA 4AYBN 2LLKA 5IOYA 1LE8A 1OCTC 3QQ6A 4PU4C 3JRCA 5FLVA 1UXCA 2YS9A 2XGCA 1CJGA 3S2HJ 3C2BA 2VPRA 4A3EJ 1QVUA 2DMNA 1BJZA 2ICTA 4MIMA 4A3KJ 1U78A 2LYLA 1MBJA 1RETA 2XRLA 2KEKA 3G1LA 2IAIA 3JRFA 4FE4A 2XPWA 4I76A 3B7HA 3ZQFA 3JXCL 2X6OA 2DMTA 3U3WA 2DA5A 2ECCA 2LYPA 2XCJA 5J1UA 4DYCA 1YRNB 4JYKA 3HOZJ 4XRSG 1Y1WJ 3B6CA 4RDUA 2LTPA 2MG4A 4YARA 4A3MJ 1FTZA 1X2MA 4XICA 5JLWA 4GFBA 5IP7J 5M3FJ 4J1XA 1BDIA 4OB4A 1ADRA 3MVPA 3WHCA 3F0CA 2YUSA 3FYAA 4I6ZA 3IH3A 1JFSA 1ETQA 1WH8A 1GVDA 4A3IJ 3VPRA 4MLOA 3S16J 2K9SA 1ZZ9A 1OJLA 4C3HJ 1WI3A 3TEDA 4JP0A 2Y0SN 3S17J 5EYRA 2M0CA 2EBYA 1SQ8A 2R92J 4DYRA 2HOSA 3BG5A 1Y1VJ 2O8KA 4J1WA 2HINA 1JGGA 5M5WJ 4IHYA 4IA8A 2IV1A 3ZQHA 5F0FA 3M4OJ 2O38A 3GBGA 3KZ3A 1FIPA 1WH6A 1U9OA 3F6WA 5FKLA 1RESA 5A7LA 5IOZA 2HSGA 3BTLA 1VI0A 3GBFA 2XJ3A 5C3EJ 1HDDC 1HOMA 2FJRA 2PUGA 2GLOA 2AW6A 4FE7A 3CECA 4M3BA 2BJCA 1ZZ7A 2XSDC 2EZKA 2JVLA 1RPWA 3OQOA 2JA7J 4X4CA 3LSRA 1E3OC 2K9QA 4M3EA 2LFBA 3IV5A 1OSLA 1RR7A 2X48A 4G12A 4I8TA 1TWFJ 2QF7A 1JJ8C 2FJ1A 2K9NA 3CMYA 4JX4A 4NDLA 1Z77A 2EBIA 1YRNA 1IUFA 1BW6A 3TW6A 4IHWA 3KJXA 1D5YA 3A01B 1ZKGA 2DA2A 2Y9YA 1FJLA 1UTXA 1UXDA 3BR1A 3NARA 2NS8A 4IVZA 4B1RA 3BTCA 2DTZA 3JRIA 3GTJJ 1UMQA 2D5VA 5C4JJ 2MW8A 3TP3A 1ZR2A 1PRAA 1POGA 2PE5A 2DMPA 3JRHA 5FKKA 2PMZN 3OOUA 5J1RA 2JA8J 1BA5A 1JT6A 5C44J 2NVQJ 1POUA 1NERA 2LYJA 1K83J 3CDLA 5K7ZA 3HGYA 3O8HA 3HOXJ 2IVGA 3SFIA 4IWRA 2R5YA 1VNDA 5C4XJ 4Z5DA 4X4HA 5JLXA 2CUEA 1IDYA 2Y2ZA 4W1UA 2OPTA 1WH5A 3RQIA 3SJMA 3S15J 2R5ZA 3OP9A 5DS9A 3JXBC 3HZIB 3H0GJ 5FLMJ 1IJWC 2DMUA 2PIJA 3PXPA 2B63J 3HB9A 3ZQIA 4DW6A 1ETWA 2AO9A 2DA6A 2EF8A 1ZK8A 1JJ6C 2XB0X 3BTIA 2JWTA 4JX5A 3BS3A 2LR8A 1H8AC 2XIUA 2LD5A 2E2IJ 2FX0A 5IP6A 3D1NI 2WV1A 4XRMA 4X6AJ 4C3IJ 1Q1VA 4QSHA 3BDNA 1OFCX 4M3DA 4IEJA 3UKGA 1O4XA 2MSYA 3Q0WA 2KEIA 3A01A 1RKTA 1VF9A 1ETOA 4Z59A 3PM1A 2HXIA 1A6IA 2VKEA 3BR0A 2XI8A 4X4GA 4J19A 4X4FA 2KEJA 2O4AA 2IBDA 5FKMA 5BNGA 3JRGA 2AXVA 4X4IA 2AHQA 1B8IB 4A3JJ 1NK3P 1JUSA 5GP9A 1JUMA 3FK7A 4Y42A 3ZQGA 2LCVA 1UG2A 2N8GA 3SDGA 4A3CJ 3K2AA 4DZPA 2WUSR 3TW7A 4EEFG 1G2HA 1LFUP 2CQXA 1MBGA 2ELKA 1LQCA 3GTLJ 2KDZA 1FTTA 4A93J 1DWKA 2H8RA 3HBLA 2DA3A 1IRZA 3G1OA 1ITYA 1UHSA 5F27A 3LSGA 3HOUJ 3BQZA 4DZJA 3HM5A 2L8NA 2GM4A 3FIWA 4MCTA 1TWHJ 1HF0A 2M8GX 3A03A 2OR1L 2LP0A 1W0TA 5M3MJ 2HQ5A 3HDDA 3OIOA 1JT0A 1W0UA 2O9LA 1LCCA 1IGNA 4XK4A 3Q0UA 1P7JA 1BDHA 3NAUA 3E7LA 2MQKA 5F08A 3I4NJ 1A5JA 3QPLA 1X2NA 4S0HB 1PRVA 2HOAA 2PUAA 1ORKA 4AUXA 4JCXA 1FEXA 3HKZN 5IP9J 5EGOB 3JRDA 1GDTA 1Y7YA 4A69C 2P81A 3HOYJ 2TRTA 3S1RJ 1B8IA 2NOGA 2LVSA 2PUDA 1RZSA 2GRLA 1LLIA 3OSFA 1QRYA 9ANTA 2AWIA 3JR9A 1Y9QA 2IEKA 1MH3A 1RKWA 4C2MJ 3W6VA 4FTHA 3GN5A 3OMTA 3SCHA 4F8DA 4FBIA 3VK0A 4UUSA 1GV2A 1X2LA 2R93J 1LCDA 2PUEA 2CRGA 2BNOA 2XGEA 3QQAA 2KPJA 2EZLA 1IV6A 2JA5J 1ZAYA 2O7OA 1NK2P 4MO7A 4RBOA 1ZZ8A 2EZIA 2L7ZA 4A3LJ 1HCRA 1B0NA 3BG9A 3HGGA 2NS7A 1APLC 3LOCA 4UUTA 4GQMA 2M34A 2L49A 4D7NA 2W48A 4QIWN 3GTKJ 3BR2A 1VPWA 2XGDA 4HNVA 2HYJA 1WETA 4CYCA 2OFYA 4YBAA 4V2GA 2IVQA 2B5AA 3BG3A 3SCGA 2VKVA 2JA6J 4I6UA 2DN0A 3B6AA 3MKLA 4MFEA 3FMYA 4V2FA 5EEAA 1R9TJ 2DA7A 4BBSJ 5FJ8J 1FIAA 3GTMJ 5F1JA 5J3LA 1R63A 2G0EA 5K7FA 4ABZA 3F52A 1GT0C 2L0KA 1NTCA 2LKXA 1ZZBA 1AU7A 4D5FA 1PUFB 3ZKCA 5EG0B 5DTDA 1JTYA 2HOTA 2L7FP 4Y52J 1XWRA 3ZHMA 3FKIJ 1P7IA 3TP0A 4A3BJ 1DW9A 1WCMJ 2Y31A 1MSEC 3OQNA 2R63A 2NVYJ 4Y7NJ 2VUMJ 3GN5B 3GTOJ 1WGXA 2LY9A 1QPIA 3M3YJ 2XPVA 1AHDP 2ICPA 1TWGJ 4D7MA 4Z5CA 1X58A 4PU7A 2CJJA 5HODA 3OSGA 4GHJA 1SANA 3CCYA 3Q0VA 5M5XJ 2FD5A 2TCTA 1VFCA 5EDNA 3F51A 1RPEL 1U9NA 3G7DA 2WIUB 2JK3A 3HEFA 2E19A 4L5EA 2WB1N 2R5YB 3QF3A 2L7MP 2ECBA 1JUPA 3O8GA 2AXZA 2O49A 1MSFC 2CSFA 1SFOJ 1HLVA 2COBA 3BQYA 3BT9A 2PUCA 2MGQA 3TRBA 1RZRA 1H88C 1ZPQA 1NEQA 1F36A 2DA1A 5EF6A 2M2EA 3SCFA 1TWCJ 3FYMA 1EF4A 2IVBA 2EH3A 3GTPJ 2MEZA 5K7HA 2GRMA 3G5GA 1X57A 3QYXA 1JTXA 3HOWJ 5EZHA 3LISA 2VI6A 4FN3A 4A3FJ 3Q3SA 3H3VK 2R7ZJ 2CU7A 1PRUA 4LOCA 3WHBA 1I50J 3CLCA 1MBEA 4Z58A 4IHVA 4I6TA 1YSEA 2WAQN 3OQMA 2H1KA 3KXAA 1JFTA 4JQDA 1QP0A 3BR6A 4JCYA 4NDWA 2EWTA 1GV5A 1IG7A 2HXOA 2GZUA 3IH2A 1ZUGA 5IYDJ 2R1JL 3JREA 1IDZA 5EGOA 4YG1A 2EQRA 3JRAA 3GTGJ 1ETXA 2ME0A 4XIDA 1B72B 4X4DA 2LYRA 3BD1A 1XS9A 2ID3A 5E3OA 3PO2J 3MLFA 4XRSA 2Y30A 4PU8A 3UFDA 5F0HA 1B72A 2BNNA 2R5ZB 1S7EA 4CYCB 1LE8B 1I3QJ 3JXDL 2A6CA 2XPUA 1H89C 3ZQLA 3JRBA 5F04A 3PO3J 2M9HA 1QQBA 4B3AA 3I4MJ 3BTJA 2R0QC 1WH7A 1ENHA 5IYCJ 3FISA 3L1PA 4O8BA 1QQAA 2JN6A 1MBKA 5K98B 4W97A 1JKQC 4Z5HA 1ZZCA 5J1YA 2NVXJ 1T56A 3ZOBA 1DU0A 1MNMC 5EG0A 5E3LA 4MCXA 3S8QA 3LFPA 2LYKA 2DA4A 4BY1J 3DCFA 1JKOC 5EZGA 2IUOA 3GTQJ 3RZZA 2PUFA 2ID6A 4YG4A 1JH9A 5E3NA 4A3DJ 1PUFA 4JX6A 2E2JJ 2YU9J 3IH4A 2LK2A 1ZTRA 1JKRC 1DU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LNQ A;  1L1M A;  3QWG A;  3S1Q J;  1XG1 A;  3IVP A;  4X4E A;  4I6R A;  2ZB9 A;  5FKO A;  4M3F A;  2HDD A;  1QVT A;  1JWL A;  1QP7 A;  3BR3 A;  3EUS A;  1QPZ A;  2GBY A;  1WPK A;  2EZH A;  4PU3 C;  4B4C A;  1ETY A;  2LYS A;  1ZVV A;  3G1M A;  2KT0 A;  5IYB J;  2E2H J;  1CQT A;  2IU7 A;  1ZQ3 P;  1EFA A;  4D5C A;  1AKH A;  3BR5 A;  1PNR A;  1RIO A;  2AUW A;  1AKH B;  4A3G J;  4BY7 J;  2OF7 A;  1PER L;  3ZHI A;  2RAE A;  1MH4 A;  4DYQ A;  5GPA A;  4C3J J;  4UUS B;  1U8B A;  1ZZ6 A;  2KZ8 A;  1MBF A;  1ETV A;  4M3G A;  3K7A J;  4BKX A;  5E3M A;  2JCG A;  2XB5 A;  3LSP A;  2K40 A;  1QP4 A;  3O9X A;  2X9D A;  4BBR J;  2DMQ A;  5F0C A;  1JKP C;  1BW5 A;  3HOV J;  1IC8 A;  3ZQC A;  2HI3 A;  1LFB A;  3A02 A;  1ZR4 A;  2ME6 A;  1LMB 3;  2JMW A;  3RZD J;  3S1N J;  3CRO L;  4FCY A;  3RZO J;  5M5Y J;  1RZR D;  1Z0X A;  3MN2 A;  2FQ4 A;  4FIS A;  3S14 J;  1MBH A;  4AC0 A;  3DNV B;  2PUB A;  2E1O A;  1XC5 A;  1ZGW A;  2PPX A;  2CQQ A;  3R1F A;  2QCO A;  3DEW A;  3LSJ A;  5GPC A;  1K61 A;  3H5T A;  1TWA J;  4M6V A;  2L9R A;  2LYQ A;  2CUF A;  2JJ7 A;  3CQZ J;  4BXX J;  2AXU A;  1TC3 C;  4X1E A;  1T33 A;  4YG7 B;  2Y9Z A;  1HDP A;  3S1M J;  3QPS A;  4X4B A;  1OCP A;  3RKQ A;  1ZS4 A;  2DJN A;  1ETK A;  3FK6 A;  5FKN A;  2BNM A;  2CRO A;  1I6H J;  2I10 A;  2NVT J;  1R69 A;  1WIZ A;  3S2D J;  1F43 A;  5IPA A;  4MFD A;  1GUU A;  1BL0 A;  4QTR A;  4IHX A;  4AYB N;  2LLK A;  5IOY A;  1LE8 A;  1OCT C;  3QQ6 A;  4PU4 C;  3JRC A;  5FLV A;  1UXC A;  2YS9 A;  2XGC A;  1CJG A;  3S2H J;  3C2B A;  2VPR A;  4A3E J;  1QVU A;  2DMN A;  1BJZ A;  2ICT A;  4MIM A;  4A3K J;  1U78 A;  2LYL A;  1MBJ A;  1RET A;  2XRL A;  2KEK A;  3G1L A;  2IAI A;  3JRF A;  4FE4 A;  2XPW A;  4I76 A;  3B7H A;  3ZQF A;  3JXC L;  2X6O A;  2DMT A;  3U3W A;  2DA5 A;  2ECC A;  2LYP A;  2XCJ A;  5J1U A;  4DYC A;  1YRN B;  4JYK A;  3HOZ J;  4XRS G;  1Y1W J;  3B6C A;  4RDU A;  2LTP A;  2MG4 A;  4YAR A;  4A3M J;  1FTZ A;  1X2M A;  4XIC A;  5JLW A;  4GFB A;  5IP7 J;  5M3F J;  4J1X A;  1BDI A;  4OB4 A;  1ADR A;  3MVP A;  3WHC A;  3F0C A;  2YUS A;  3FYA A;  4I6Z A;  3IH3 A;  1JFS A;  1ETQ A;  1WH8 A;  1GVD A;  4A3I J;  3VPR A;  4MLO A;  3S16 J;  2K9S A;  1ZZ9 A;  1OJL A;  4C3H J;  1WI3 A;  3TED A;  4JP0 A;  2Y0S N;  3S17 J;  5EYR A;  2M0C A;  2EBY A;  1SQ8 A;  2R92 J;  4DYR A;  2HOS A;  3BG5 A;  1Y1V J;  2O8K A;  4J1W A;  2HIN A;  1JGG A;  5M5W J;  4IHY A;  4IA8 A;  2IV1 A;  3ZQH A;  5F0F A;  3M4O J;  2O38 A;  3GBG A;  3KZ3 A;  1FIP A;  1WH6 A;  1U9O A;  3F6W A;  5FKL A;  1RES A;  5A7L A;  5IOZ A;  2HSG A;  3BTL A;  1VI0 A;  3GBF A;  2XJ3 A;  5C3E J;  1HDD C;  1HOM A;  2FJR A;  2PUG A;  2GLO A;  2AW6 A;  4FE7 A;  3CEC A;  4M3B A;  2BJC A;  1ZZ7 A;  2XSD C;  2EZK A;  2JVL A;  1RPW A;  3OQO A;  2JA7 J;  4X4C A;  3LSR A;  1E3O C;  2K9Q A;  4M3E A;  2LFB A;  3IV5 A;  1OSL A;  1RR7 A;  2X48 A;  4G12 A;  4I8T A;  1TWF J;  2QF7 A;  1JJ8 C;  2FJ1 A;  2K9N A;  3CMY A;  4JX4 A;  4NDL A;  1Z77 A;  2EBI A;  1YRN A;  1IUF A;  1BW6 A;  3TW6 A;  4IHW A;  3KJX A;  1D5Y A;  3A01 B;  1ZKG A;  2DA2 A;  2Y9Y A;  1FJL A;  1UTX A;  1UXD A;  3BR1 A;  3NAR A;  2NS8 A;  4IVZ A;  4B1R A;  3BTC A;  2DTZ A;  3JRI A;  3GTJ J;  1UMQ A;  2D5V A;  5C4J J;  2MW8 A;  3TP3 A;  1ZR2 A;  1PRA A;  1POG A;  2PE5 A;  2DMP A;  3JRH A;  5FKK A;  2PMZ N;  3OOU A;  5J1R A;  2JA8 J;  1BA5 A;  1JT6 A;  5C44 J;  2NVQ J;  1POU A;  1NER A;  2LYJ A;  1K83 J;  3CDL A;  5K7Z A;  3HGY A;  3O8H A;  3HOX J;  2IVG A;  3SFI A;  4IWR A;  2R5Y A;  1VND A;  5C4X J;  4Z5D A;  4X4H A;  5JLX A;  2CUE A;  1IDY A;  2Y2Z A;  4W1U A;  2OPT A;  1WH5 A;  3RQI A;  3SJM A;  3S15 J;  2R5Z A;  3OP9 A;  5DS9 A;  3JXB C;  3HZI B;  3H0G J;  5FLM J;  1IJW C;  2DMU A;  2PIJ A;  3PXP A;  2B63 J;  3HB9 A;  3ZQI A;  4DW6 A;  1ETW A;  2AO9 A;  2DA6 A;  2EF8 A;  1ZK8 A;  1JJ6 C;  2XB0 X;  3BTI A;  2JWT A;  4JX5 A;  3BS3 A;  2LR8 A;  1H8A C;  2XIU A;  2LD5 A;  2E2I J;  2FX0 A;  5IP6 A;  3D1N I;  2WV1 A;  4XRM A;  4X6A J;  4C3I J;  1Q1V A;  4QSH A;  3BDN A;  1OFC X;  4M3D A;  4IEJ A;  3UKG A;  1O4X A;  2MSY A;  3Q0W A;  2KEI A;  3A01 A;  1RKT A;  1VF9 A;  1ETO A;  4Z59 A;  3PM1 A;  2HXI A;  1A6I A;  2VKE A;  3BR0 A;  2XI8 A;  4X4G A;  4J19 A;  4X4F A;  2KEJ A;  2O4A A;  2IBD A;  5FKM A;  5BNG A;  3JRG A;  2AXV A;  4X4I A;  2AHQ A;  1B8I B;  4A3J J;  1NK3 P;  1JUS A;  5GP9 A;  1JUM A;  3FK7 A;  4Y42 A;  3ZQG A;  2LCV A;  1UG2 A;  2N8G A;  3SDG A;  4A3C J;  3K2A A;  4DZP A;  2WUS R;  3TW7 A;  4EEF G;  1G2H A;  1LFU P;  2CQX A;  1MBG A;  2ELK A;  1LQC A;  3GTL J;  2KDZ A;  1FTT A;  4A93 J;  1DWK A;  2H8R A;  3HBL A;  2DA3 A;  1IRZ A;  3G1O A;  1ITY A;  1UHS A;  5F27 A;  3LSG A;  3HOU J;  3BQZ A;  4DZJ A;  3HM5 A;  2L8N A;  2GM4 A;  3FIW A;  4MCT A;  1TWH J;  1HF0 A;  2M8G X;  3A03 A;  2OR1 L;  2LP0 A;  1W0T A;  5M3M J;  2HQ5 A;  3HDD A;  3OIO A;  1JT0 A;  1W0U A;  2O9L A;  1LCC A;  1IGN A;  4XK4 A;  3Q0U A;  1P7J A;  1BDH A;  3NAU A;  3E7L A;  2MQK A;  5F08 A;  3I4N J;  1A5J A;  3QPL A;  1X2N A;  4S0H B;  1PRV A;  2HOA A;  2PUA A;  1ORK A;  4AUX A;  4JCX A;  1FEX A;  3HKZ N;  5IP9 J;  5EGO B;  3JRD A;  1GDT A;  1Y7Y A;  4A69 C;  2P81 A;  3HOY J;  2TRT A;  3S1R J;  1B8I A;  2NOG A;  2LVS A;  2PUD A;  1RZS A;  2GRL A;  1LLI A;  3OSF A;  1QRY A;  9ANT A;  2AWI A;  3JR9 A;  1Y9Q A;  2IEK A;  1MH3 A;  1RKW A;  4C2M J;  3W6V A;  4FTH A;  3GN5 A;  3OMT A;  3SCH A;  4F8D A;  4FBI A;  3VK0 A;  4UUS A;  1GV2 A;  1X2L A;  2R93 J;  1LCD A;  2PUE A;  2CRG A;  2BNO A;  2XGE A;  3QQA A;  2KPJ A;  2EZL A;  1IV6 A;  2JA5 J;  1ZAY A;  2O7O A;  1NK2 P;  4MO7 A;  4RBO A;  1ZZ8 A;  2EZI A;  2L7Z A;  4A3L J;  1HCR A;  1B0N A;  3BG9 A;  3HGG A;  2NS7 A;  1APL C;  3LOC A;  4UUT A;  4GQM A;  2M34 A;  2L49 A;  4D7N A;  2W48 A;  4QIW N;  3GTK J;  3BR2 A;  1VPW A;  2XGD A;  4HNV A;  2HYJ A;  1WET A;  4CYC A;  2OFY A;  4YBA A;  4V2G A;  2IVQ A;  2B5A A;  3BG3 A;  3SCG A;  2VKV A;  2JA6 J;  4I6U A;  2DN0 A;  3B6A A;  3MKL A;  4MFE A;  3FMY A;  4V2F A;  5EEA A;  1R9T J;  2DA7 A;  4BBS J;  5FJ8 J;  1FIA A;  3GTM J;  5F1J A;  5J3L A;  1R63 A;  2G0E A;  5K7F A;  4ABZ A;  3F52 A;  1GT0 C;  2L0K A;  1NTC A;  2LKX A;  1ZZB A;  1AU7 A;  4D5F A;  1PUF B;  3ZKC A;  5EG0 B;  5DTD A;  1JTY A;  2HOT A;  2L7F P;  4Y52 J;  1XWR A;  3ZHM A;  3FKI J;  1P7I A;  3TP0 A;  4A3B J;  1DW9 A;  1WCM J;  2Y31 A;  1MSE C;  3OQN A;  2R63 A;  2NVY J;  4Y7N J;  2VUM J;  3GN5 B;  3GTO J;  1WGX A;  2LY9 A;  1QPI A;  3M3Y J;  2XPV A;  1AHD P;  2ICP A;  1TWG J;  4D7M A;  4Z5C A;  1X58 A;  4PU7 A;  2CJJ A;  5HOD A;  3OSG A;  4GHJ A;  1SAN A;  3CCY A;  3Q0V A;  5M5X J;  2FD5 A;  2TCT A;  1VFC A;  5EDN A;  3F51 A;  1RPE L;  1U9N A;  3G7D A;  2WIU B;  2JK3 A;  3HEF A;  2E19 A;  4L5E A;  2WB1 N;  2R5Y B;  3QF3 A;  2L7M P;  2ECB A;  1JUP A;  3O8G A;  2AXZ A;  2O49 A;  1MSF C;  2CSF A;  1SFO J;  1HLV A;  2COB A;  3BQY A;  3BT9 A;  2PUC A;  2MGQ A;  3TRB A;  1RZR A;  1H88 C;  1ZPQ A;  1NEQ A;  1F36 A;  2DA1 A;  5EF6 A;  2M2E A;  3SCF A;  1TWC J;  3FYM A;  1EF4 A;  2IVB A;  2EH3 A;  3GTP J;  2MEZ A;  5K7H A;  2GRM A;  3G5G A;  1X57 A;  3QYX A;  1JTX A;  3HOW J;  5EZH A;  3LIS A;  2VI6 A;  4FN3 A;  4A3F J;  3Q3S A;  3H3V K;  2R7Z J;  2CU7 A;  1PRU A;  4LOC A;  3WHB A;  1I50 J;  3CLC A;  1MBE A;  4Z58 A;  4IHV A;  4I6T A;  1YSE A;  2WAQ N;  3OQM A;  2H1K A;  3KXA A;  1JFT A;  4JQD A;  1QP0 A;  3BR6 A;  4JCY A;  4NDW A;  2EWT A;  1GV5 A;  1IG7 A;  2HXO A;  2GZU A;  3IH2 A;  1ZUG A;  5IYD J;  2R1J L;  3JRE A;  1IDZ A;  5EGO A;  4YG1 A;  2EQR A;  3JRA A;  3GTG J;  1ETX A;  2ME0 A;  4XID A;  1B72 B;  4X4D A;  2LYR A;  3BD1 A;  1XS9 A;  2ID3 A;  5E3O A;  3PO2 J;  3MLF A;  4XRS A;  2Y30 A;  4PU8 A;  3UFD A;  5F0H A;  1B72 A;  2BNN A;  2R5Z B;  1S7E A;  4CYC B;  1LE8 B;  1I3Q J;  3JXD L;  2A6C A;  2XPU A;  1H89 C;  3ZQL A;  3JRB A;  5F04 A;  3PO3 J;  2M9H A;  1QQB A;  4B3A A;  3I4M J;  3BTJ A;  2R0Q C;  1WH7 A;  1ENH A;  5IYC J;  3FIS A;  3L1P A;  4O8B A;  1QQA A;  2JN6 A;  1MBK A;  5K98 B;  4W97 A;  1JKQ C;  4Z5H A;  1ZZC A;  5J1Y A;  2NVX J;  1T56 A;  3ZOB A;  1DU0 A;  1MNM C;  5EG0 A;  5E3L A;  4MCX A;  3S8Q A;  3LFP A;  2LYK A;  2DA4 A;  4BY1 J;  3DCF A;  1JKO C;  5EZG A;  2IUO A;  3GTQ J;  3RZZ A;  2PUF A;  2ID6 A;  4YG4 A;  1JH9 A;  5E3N A;  4A3D J;  1PUF A;  4JX6 A;  2E2J J;  2YU9 J;  3IH4 A;  2LK2 A;  1ZTR A;  1JKR C;  1DU6 A; 
#chains in the Genus database with same CATH topology
 3H3Z A;  1L1M A;  3ULQ B;  1P92 A;  4DE9 A;  1XG1 A;  2VQG A;  3IVP A;  2DOF A;  2PMZ A;  4M3F A;  3JAM K;  1A35 A;  1QVT A;  3IKV A;  3K69 A;  4KT5 C;  5D8K B;  3DU6 A;  1MMD A;  2LYS A;  2CW0 F;  1MMG A;  2EV6 A;  1ZLJ A;  4Y17 A;  3ZN1 A;  1CQT A;  1MIJ A;  1QHG A;  4UV9 A;  1ZQ3 P;  1GHC A;  2OA4 A;  2E1M B;  1QQI A;  2ZXJ A;  3BR5 A;  1AKH A;  1QGP A;  4EJV A;  1PNR A;  1YLF A;  4O5V A;  4BU2 A;  2MAB A;  1CF7 A;  3CC7 I;  1WZ2 A;  4A3G J;  4BY7 J;  3KFW X;  5KK1 A;  5ED4 A;  3ZHI A;  1ZZ6 A;  2JVH A;  2R7F A;  2MLG A;  5E20 A;  4DGW B;  4KIS A;  1W36 D;  1K6O A;  1BC7 C;  4RB0 A;  3QOD A;  2JCG A;  4CO8 A;  2XB5 A;  2BVM A;  2LC2 A;  3LSP A;  4K2E A;  4LK0 F;  5CVJ A;  3HOT A;  2PN6 A;  3O9X A;  4LB5 A;  2ZSH B;  1JKP C;  4P5O A;  1Y56 A;  1EH7 A;  2K7L A;  4C9Y A;  4G7O F;  3U1K A;  4CZC A;  1HBX G;  5HLG A;  3RPU D;  1ZR4 A;  1UHM A;  3K0L A;  4FCY A;  3HZJ A;  5M5Y J;  4IZZ A;  1S5L C;  4FIS A;  4I0A A;  3G71 I;  2KIS A;  1BI1 A;  3K4N A;  3OKZ A;  3KP2 A;  4AC0 A;  4NUB A;  3SHF A;  4LIT A;  4FT8 A;  2CQQ A;  3E6D A;  2NNY A;  1ZGW A;  2PPX A;  3R1F A;  1BR2 A;  1TWA J;  1NG7 A;  2F5C A;  1VQ8 I;  3E5X A;  4IOA F;  1ZYR F;  2L9R A;  3OYG A;  3CUO A;  1SFX A;  5CVV A;  2AXU A;  2JJ7 A;  2QGU A;  2OZ6 A;  1ZRF A;  1BIB A;  1T33 A;  2VQC A;  3MZ8 A;  4YG7 B;  3S1M J;  4X4B A;  3ZR8 X;  1MJA A;  1VTN C;  1Z6T A;  2FU4 A;  3J7Y J;  3FK6 A;  5FKN A;  4ZJZ A;  1V55 H;  2I10 A;  4RAF A;  2LBF B;  1I6H J;  3LMM A;  2Q0O A;  3GZN B;  1FT9 A;  4M9Z A;  3K4C A;  4PU4 C;  2HEO A;  3GF2 A;  5FLV A;  3ZPX A;  3MZY A;  2K85 A;  4IQJ A;  1HW2 A;  4A3E J;  1X1B A;  1RC9 A;  2D1V A;  2DMN A;  1WVR A;  4RS8 A;  2PI0 A;  4MIM A;  4A3K J;  1LB2 A;  3M1C A;  2VBY A;  3AG3 H;  5LRS A;  2H27 A;  2GA2 A;  2IAI A;  3JRF A;  4E7J A;  2LNM A;  3JXC L;  1A6Q A;  3ZQF A;  2K4B A;  2X6O A;  3ZMD A;  3G4S I;  3U3W A;  5B1A H;  2HQN A;  2R7Q A;  3I4P A;  3A1Y A;  1ZRD A;  5FFX A;  5LGN A;  1SVL A;  1OCZ H;  2V1X A;  4DYC A;  3OS2 A;  4I01 A;  1XDU A;  3OV8 A;  3B6C A;  3RCO A;  4RDU A;  1MMS A;  2KDO A;  3O3K A;  2CFO A;  1U8R A;  1DGR M;  1X2M A;  2ZCW A;  1HKT A;  2JPB A;  4Q48 A;  5IP7 J;  3X2Q H;  2BW3 B;  3SDB A;  2MYS A;  4EV0 A;  4Y4R A;  5JVT A;  4BEH A;  4OAZ A;  1X3U A;  3IH3 A;  5IY5 H;  1ETQ A;  1K7A A;  1WH8 A;  2Q2E A;  4A3I J;  4O6J A;  3VPR A;  2DOD A;  4EJT A;  3S16 J;  2DOE A;  3L2C A;  1ZZ9 A;  1OJL A;  3UWP A;  1X19 A;  4I0B A;  2HKO A;  2IGO A;  4C3H J;  4B3X A;  5EYR A;  4FX4 A;  1SQ8 A;  3FF5 A;  3CC2 I;  1Y1V J;  2PMU A;  1JGG A;  1XGN A;  3P9C A;  2IV1 A;  2PMH A;  1MGT A;  2UUZ A;  5F0F A;  1IN6 A;  2ZFW A;  3GBG A;  3M4O J;  1Z05 A;  2ZJR F;  3KZ3 A;  1U9O A;  4OIN F;  4BL0 B;  3UR3 C;  4ER3 A;  5A7L A;  3I59 B;  1OIS A;  3BTL A;  3RI4 A;  4YII A;  2VBW A;  2GLO A;  4LFU A;  4IHT A;  1P4A A;  1SVO A;  2ACJ A;  3FXU A;  4XOP A;  1ZZ7 A;  4HX8 A;  5CQE A;  3K4K A;  3P7N A;  2HR3 A;  1FSH A;  3LSR A;  1E3O C;  1IV8 A;  5FFZ A;  1RRJ A;  1F4K A;  3DTE A;  1RR7 A;  3M07 A;  4I8T A;  2E1C A;  4BQA A;  3ML6 A;  4HEA 2;  1YJN I;  3TGN A;  2O61 A;  3CMY A;  3GWZ A;  4ER5 A;  4NDL A;  2GAU A;  1BW6 A;  4IHW A;  5AON A;  1FJL A;  1UXD A;  2PBI A;  3QFI A;  5FD5 A;  2V9V A;  4CCM A;  1PP8 F;  2NS8 A;  2RVC A;  4MHG A;  1U6G A;  1X4O A;  4E4H A;  2D5V A;  4AM3 A;  3NRV A;  2PE5 A;  2PMZ N;  3OOU A;  3F8N A;  1D8K A;  4M6Y A;  5DCF A;  1NER A;  1SC7 A;  1TL8 A;  2Y0M A;  2HDW A;  3SFI A;  4HF2 A;  2IS1 A;  4XON A;  3HSR A;  4X4H A;  3OYH A;  3S32 A;  1TT5 B;  2ELJ A;  2Y2Z A;  2B7E A;  1S3J A;  4EM2 A;  3BZK A;  2R5Z A;  1WFX A;  3S93 A;  2GXA A;  3OYC A;  3ZQI A;  4DW6 A;  3PFI A;  1YOV B;  2P7V B;  4CCK A;  2AO9 A;  4LLG F;  3TDZ C;  2EF8 A;  4BXF A;  4GRI A;  3C1D A;  3KP7 A;  5TJJ A;  1JJ6 C;  4HG2 A;  4OAY A;  2PFB A;  2UXX A;  3CO7 C;  1GVJ A;  1RNL A;  4JX5 A;  4A0Z A;  2JRT A;  3D1N I;  2WV1 A;  4X6A J;  3R09 A;  5F64 A;  2GOM A;  1OFC X;  2DQL A;  4XBF A;  2WTE A;  2OBP A;  2UXN A;  2XAQ A;  1O4X A;  2KEI A;  3A01 A;  4KYW A;  1ETO A;  3PM1 A;  1A6I A;  2XI8 A;  4X4G A;  1G3Y A;  2O4A A;  1R6R A;  2IBD A;  4PK4 A;  5FKM A;  5BNG A;  2E34 A;  1ZGJ A;  4IF4 A;  3QAH A;  3EPZ A;  1B8I B;  1RZ4 A;  2Q2E B;  2V9P A;  5GP9 A;  1JUM A;  5ILS A;  4Y42 A;  3ZQG A;  2XVC A;  3K2A A;  1J2X A;  5CVI A;  1E2X A;  1TLH B;  2CQ7 A;  2RQQ A;  4DZP A;  3OYN A;  3TW7 A;  1MBG A;  2EA4 A;  1RI7 A;  4ENK A;  1XSD A;  4A93 J;  3WTY C;  1IRZ A;  2H6B A;  2PXK A;  1UHS A;  2A05 A;  3OR2 C;  4A0X A;  2ZC2 A;  3GZD A;  3VYU B;  3OIP A;  2M8G X;  3IAM 2;  3A03 A;  4XOR A;  2KZ8 A;  4GCV A;  5M3M J;  2F48 A;  3L2V A;  4ENM A;  1HA8 A;  1LCC A;  1ZN2 A;  3E7L A;  1FYM A;  1ON1 A;  1XMX A;  2EV5 A;  3QPL A;  4S0H B;  2X6W A;  5J8F A;  3OYJ A;  2D45 A;  3CF2 A;  1FEX A;  5IP9 J;  5EGO B;  3JRD A;  3ABL H;  2DFI A;  4BS9 A;  4S04 A;  3KP4 A;  3OY9 A;  1LLI A;  1QRY A;  5DCM A;  3JR9 A;  2XKO A;  2IPQ X;  4C2M J;  3T5X A;  3I0T A;  3SCH A;  4FBI A;  5D5U B;  1XN7 A;  3DTI A;  3CCU I;  3VK0 A;  1J7K A;  2CQN A;  2K5C A;  2CRG A;  1UHW A;  3QQA A;  2F4I A;  2A6H F;  3REO A;  2O7O A;  3CDI A;  1ZZ8 A;  3N4M A;  1HST A;  3K4M A;  1Z21 A;  3LQQ A;  4I98 B;  3LOC A;  4H4K C;  4GQM A;  3PSI A;  5HVQ C;  2L49 A;  1J75 A;  4D7N A;  5JFR A;  1OPC A;  2W48 A;  3DEU A;  3BR2 A;  1V54 H;  2VXZ A;  4MEX F;  1WET A;  1T2K A;  3HPH A;  2OFY A;  1D1B A;  3F9K A;  4KMF A;  4YBA A;  4V2G A;  2PX9 A;  3KEQ A;  2DN0 A;  4D1Q A;  4YIR X;  4HBL A;  4LGW A;  3OYK A;  1FIA A;  4XKV A;  2M7B A;  1YJW I;  5J3L A;  1W4M A;  1D3Y A;  1D5V A;  2XGX A;  2R7V A;  1KQ0 A;  3MMY B;  4HX7 A;  3Q9S A;  2LKX A;  3BOQ A;  3SYT A;  3VOE A;  1GXP A;  1AU7 A;  4L0Y B;  3V4G A;  4XM3 A;  1PUF B;  4I7H A;  3UNG C;  2KLO A;  3ZKC A;  4LMY A;  4QPO A;  3SZP A;  5B1B H;  4WVL A;  3A4C A;  4KIB A;  4A3B J;  3L00 A;  4E7Z A;  3GN5 B;  5JUW A;  2ICP A;  2XPV A;  1AHD P;  1BIA A;  4A2U A;  6PAX A;  2MD0 A;  4GHJ A;  1TW2 A;  2FD5 A;  3LSM A;  3HC7 A;  5CLS A;  2P5K A;  1IO2 A;  5EDN A;  3MWM A;  5GTH C;  1RPE L;  2DOA A;  1Y8Q B;  4RGS A;  3MCZ A;  2WIU B;  3HEF A;  2E19 A;  4L5E A;  1FMW A;  4F3Q A;  3R0J A;  2L7M P;  2ECB A;  3QF3 A;  3O8G A;  5LRR A;  4U87 A;  2EB7 A;  2P8T A;  2COB A;  3J7Z I;  3QOX A;  2PUC A;  2H8W A;  1RZR A;  2AQF A;  1H88 C;  2I5U A;  1F36 A;  1GLN A;  3ABM H;  3V7S A;  2WAE A;  3FXK A;  2M2E A;  5DYM A;  1TWC J;  1O3Q A;  1W36 C;  1RUO A;  3CD6 I;  5ICF A;  2IVB A;  1XMK A;  4RB1 A;  3GTP J;  4IJA A;  2VBZ A;  5K7H A;  1X57 A;  3ROU A;  1W5T A;  3HOW J;  2VI6 A;  3H3V K;  1ZAR A;  2IXS A;  4LOC A;  2CWE A;  4Z58 A;  2DLL A;  2ZME C;  4GDF A;  2H1K A;  1G3S A;  4H0E A;  3RKY A;  2ZXH A;  3KXA A;  4JCY A;  5H2F C;  5B5E C;  3BPX A;  4NDW A;  4BDY A;  3ME5 A;  1OCR H;  2IA0 A;  3LFK A;  1G6N A;  1ZRC A;  5IYD J;  4YG1 A;  2RGV A;  2XIG A;  4FHT A;  3NDB B;  4HLX A;  5J8C A;  1D1C A;  4PU8 A;  3FXR A;  4N9H A;  5D6F A;  2BNN A;  4KIG A;  1FNN A;  1LE8 B;  1OYI A;  3BRO A;  3J7A Y;  5L3E A;  3BLY A;  3PO3 J;  1WH7 A;  1IW7 F;  2WAQ A;  5HS9 A;  4A5N A;  1YW8 A;  3RKX A;  1HKQ A;  3WU1 B;  1QQA A;  2JN6 A;  4M71 A;  1LEA A;  3CLO A;  2QBY A;  3CUQ B;  1FLI A;  1ZZC A;  3WTU C;  1XSX A;  1T56 A;  1A31 A;  5DEQ A;  1QZX A;  2CMP A;  1ZG1 A;  2XV4 S;  3S8Q A;  3FMS A;  1P2F A;  3VEP A;  1X1D A;  3BJA A;  2IUO A;  1JKO C;  1T6S A;  4PJN A;  4A3D J;  4EGY A;  2W4S A;  1C0W A;  2E2J J;  1LUJ B;  2DK5 A;  2LK2 A;  3ZMV A;  3LA2 A;  4ZTJ A;  4I6R A;  5KNL A;  2ZB9 A;  3AAF A;  3L2U A;  1YG2 A;  1BOB A;  2ZNZ A;  1JWL A;  1Y39 A;  3BR3 A;  2BHY A;  1ZAO A;  4B43 A;  4PU3 C;  4ESF A;  2RKH A;  3E6M A;  5HLI A;  2BXY A;  3H3U A;  2VPL A;  1ZVV A;  4M9S A;  2IU7 A;  2CW8 A;  4EK9 A;  1EFA A;  1ONV A;  4D5C A;  2DPU A;  1O7L A;  1RIO A;  2QQ9 A;  2QKM B;  1AKH B;  3M8F A;  2LYC A;  4XKW A;  3QRF F;  2B0L A;  2LLW A;  2VKH A;  4C3J J;  2M4K A;  1NW3 A;  1ETV A;  1XTA A;  5GTI C;  2CYY A;  3F23 A;  1S7A A;  2HGC A;  2EA2 A;  4U7B A;  1XX5 A;  2JZY A;  1MW7 A;  2GIV A;  2K40 A;  2FOW A;  3BG7 A;  4EQQ A;  1VQK I;  3V7R A;  1G3W A;  1KON A;  5HNF A;  4R8H A;  2X9D A;  2JRM A;  3F6O A;  5F0C A;  1BW5 A;  3ZQC A;  3TDU C;  2PJR B;  2HI3 A;  1OR7 A;  4UHT A;  1YIO A;  2H6C A;  1E3H A;  3E1S A;  3H35 A;  4ZYG A;  2JMW A;  3RZD J;  2UV1 A;  1Z7U A;  4RLF A;  2Y48 A;  2ELH A;  1R5I D;  2XXQ A;  1Z0X A;  2FQ4 A;  2LOO A;  4XKB A;  3QWL A;  5CPR B;  4L9V A;  2HCN A;  1I3A A;  1T0F A;  2R3S A;  3CF5 F;  3DEW A;  3MEX A;  2LKS A;  1BI3 A;  3VYT B;  4HAM A;  2DTR A;  1D8J A;  4OOI A;  3DTK A;  3CP2 A;  4BAC A;  3PJR A;  2OUM A;  1TNT A;  2CUF A;  3CQZ J;  2J7W A;  4E70 A;  4DQ2 A;  1TC3 C;  3LL7 A;  4X1E A;  1BR4 A;  5EEH A;  1R36 A;  3KX2 A;  4XLA A;  3QPS A;  1OCP A;  3S3O A;  1ZS4 A;  3OYL A;  4U7D A;  1SVM A;  3AL0 C;  1BI2 A;  1R69 A;  2A5Y B;  1T8I A;  2K3F A;  2CO5 A;  2O8X A;  5ILV A;  4IHX A;  3GUU A;  3FHN A;  5IOY A;  1LE8 A;  3VSK A;  1KU2 A;  1DDN A;  4G94 A;  2OV7 A;  2YS9 A;  2X1D A;  1CJG A;  3FZV A;  2M45 A;  3KP5 A;  3IC7 A;  4LK1 F;  3O2P E;  2ICT A;  4BHB A;  3BP8 A;  4KFC A;  3KLN A;  2XRL A;  2KEK A;  3R4K A;  2MBF A;  4NQW B;  4OIP F;  4FE4 A;  3SZT A;  3HYI A;  4D9J A;  3KET A;  2FNP A;  4BE2 A;  2DXI A;  2DA5 A;  2ECC A;  2QWW A;  2JTV A;  3OYI A;  2QUF A;  5FB2 A;  2LYP A;  2G7H A;  4MTE A;  3S3M A;  3OIQ A;  5J1U A;  2F4M B;  4P9F A;  3RKW A;  1A04 A;  4XRS G;  5LGT A;  1SMY F;  2DT6 A;  3CUQ A;  2LTP A;  2MG4 A;  4BXU A;  3CLQ A;  4IVN A;  1FTZ A;  2PXP A;  1MMN A;  1S6L A;  4GFB A;  3DBH B;  4ZZL A;  3OS1 A;  1PYV A;  4OB4 A;  1VQN I;  3OOP A;  3WHC A;  1VQ7 I;  1IN7 A;  3QOW A;  3AKZ A;  2LBF A;  4RMN A;  2PXU A;  4X0G A;  3M1E A;  3ZMT A;  2P5V A;  3GUD A;  3CME I;  1R58 A;  3TED A;  1WI3 A;  4JP0 A;  1IN5 A;  1FBS A;  4U0Y A;  4IX7 A;  2EBY A;  2K02 A;  4C2U A;  4DYR A;  4E7H A;  4J1W A;  2X4H A;  3CC4 I;  5K1Y A;  4IHY A;  2CUJ A;  3M8E A;  1WH6 A;  5DM7 F;  3F6W A;  4F7Z A;  3PNV A;  3QU6 A;  5IOZ A;  4QWQ A;  5ICC A;  2EFQ A;  4HZF A;  5LHG A;  5C3E J;  4AD9 A;  1I6X A;  1YI2 I;  1FPQ A;  3KYL A;  3K1N A;  3OL3 A;  1VQO I;  4HRA A;  2K86 A;  2FSW A;  3GO5 A;  3LA3 A;  3WTS C;  3OQO A;  2O0Y A;  2V4J C;  4X4C A;  1UAA A;  1BM9 A;  2LFB A;  3D5L A;  3TO9 A;  3FM3 A;  2LKP A;  4G12 A;  3ASO H;  2QF7 A;  2M7A A;  2FJ1 A;  3H9Q A;  4NB5 A;  3QYF A;  4JX4 A;  2PJR A;  3G73 A;  2PQ8 A;  1N75 A;  2EBI A;  3FDY A;  4L5I A;  1LPQ A;  3KJX A;  3I54 A;  5ICG A;  4XKC A;  2DA2 A;  2GWR A;  2Y9Y A;  1Q1H A;  2Z9O A;  2PXE A;  1BJA A;  1G8X A;  3F8C A;  4HX4 A;  1TW3 A;  1IN4 A;  1XGS A;  2ESN A;  3BPV A;  4B1R A;  3CUQ C;  2V7F A;  4CH7 A;  2DTZ A;  2HOE A;  2O6G E;  5HNH A;  2MW8 A;  4IRH A;  1POG A;  2YSR A;  2HPM A;  3JRH A;  3LQX A;  4FET A;  2JA8 J;  5AIQ A;  1JT6 A;  1T98 A;  5CVR A;  3WGI A;  1Z9C A;  2JUC A;  1H0M A;  1POU A;  1PUE E;  2DBB A;  1FOX A;  1K83 J;  3QP6 A;  3RYR A;  3LQR A;  3O8H A;  4GO1 A;  2IVG A;  3HIF A;  4HLY A;  1X3Z B;  1LDK B;  4N0B A;  5JLX A;  2DK8 A;  3J7A O;  2W1O A;  4YRV A;  2L4A A;  2OPT A;  3RQI A;  3WTW C;  1IXS B;  2DT7 B;  3JW4 A;  1K4T A;  5DS9 A;  5FLM J;  1IJW C;  2DMU A;  3E3V A;  5DD4 A;  2QZ8 A;  4U88 A;  3ZMU A;  1WHU A;  2PXD A;  4EJU A;  2L9V A;  2XB0 X;  3VSL A;  1U2W A;  4LJZ F;  2BVL A;  2PXF A;  3RDI A;  1H8A C;  2XIU A;  2LD5 A;  3VYS B;  3DPL C;  3U9G A;  4M3D A;  2ZO4 A;  3QYE A;  4AWX B;  3CCQ I;  2AQE A;  1UCR A;  2W84 A;  4CIC A;  1VF9 A;  4Z59 A;  2HXI A;  2VKE A;  3BR0 A;  2MH9 A;  4M9X A;  3QOE A;  3JRG A;  5HLH A;  3A0B C;  3TL4 X;  3T8T A;  1I1S A;  2EPF A;  4A3J J;  2FEZ A;  2N8G A;  1P4X A;  4JOM A;  3WTT C;  2L2O A;  3ZQ7 A;  3FKJ A;  1FBU A;  4QPQ A;  2JSP A;  3I58 A;  2KDZ A;  3PUB A;  3FMQ A;  2CV2 A;  1DWK A;  2DA3 A;  4PSW A;  1ITY A;  4TV7 A;  2OCC H;  3HM5 A;  3FIW A;  3A9X A;  1IRG A;  4MCT A;  3KPH A;  1KYW A;  3H36 A;  2OR1 L;  3J81 K;  4HRI A;  3HUG B;  1W0T A;  1MFQ C;  1FBQ A;  2HQ5 A;  2BY1 A;  3DPT A;  3OIO A;  1JT0 A;  1IXR C;  2LRE A;  3VWB A;  3I9V 2;  2MQK A;  2RV8 A;  2GQQ A;  2VB6 A;  3D5S C;  5F08 A;  3E6C C;  2V1U A;  2HZD A;  3L7W A;  3I4N J;  1A5J A;  2EFO A;  4AUX A;  4ZH4 F;  1JGS A;  2LMD A;  3VB2 A;  3W3C A;  1XPX A;  2V6E A;  1GDT A;  3E5Q A;  3AG2 H;  1W7P A;  2DO7 A;  3KIO A;  2TRT A;  3QYB A;  1NHA A;  1WJF A;  2NOG A;  2LVS A;  2PUD A;  2IP2 A;  2MH2 A;  9ANT A;  2AWI A;  3I53 A;  1MH3 A;  2KJC A;  1RKW A;  2M5W A;  3KP6 A;  2CGP A;  2V79 A;  3AG4 H;  4FTH A;  1K78 B;  2XDV A;  1V5F A;  2XGE A;  1IRX A;  3KEY A;  2EZL A;  1O3T A;  1B9M A;  4OMZ A;  3FXL A;  1S9H A;  4RBO A;  3G0T A;  3E6B A;  5DT2 A;  5GAG i;  4G6Q A;  3BCB A;  3OYD A;  3C2G A;  3DV8 A;  3IHU A;  3AL0 B;  2HQR A;  2KP6 A;  3OL4 A;  1LDD A;  2EIM H;  2J5O A;  3NWT A;  2XC7 A;  1QU3 A;  3GYH X;  1I39 A;  4QIW N;  4R79 A;  1SFU A;  2JUG A;  2HVQ A;  1ULY A;  3ZRG A;  4CYC A;  3DF8 A;  3PUF A;  2XF6 A;  2W57 A;  5TRD A;  2B5A A;  3B02 A;  2IVQ A;  4ZC3 A;  1KA8 A;  1SFK A;  2VKV A;  1HKS A;  1Y6I A;  3TOA A;  3SCG A;  4I6U A;  2GA1 A;  3LSH A;  2QSH X;  1G4D A;  5JI6 A;  4V2F A;  5EEA A;  3FMY A;  2VIX A;  4RAG A;  2DA7 A;  3QOP A;  2EV0 A;  3KYC B;  4BBS J;  1HSJ A;  3ABK H;  1YO5 C;  2MC3 A;  2M4G A;  2KQR A;  4DNC A;  2XAF A;  5F1J A;  1R63 A;  1U2Z A;  5K7F A;  2E1N A;  4O3M A;  5CKT A;  4ENN A;  1K6Y A;  2NRA C;  1NTC A;  3FXM A;  3JCU C;  4E7S A;  4G7Z F;  1W5S A;  4PGH A;  1WSU A;  2STT A;  1R49 A;  5EG0 B;  1ZLK A;  3ZXS A;  1JXS A;  3ZHM A;  3FKI J;  1P7I A;  4BJT A;  1DW9 A;  1MSE C;  3OQN A;  3G6E I;  2RQP A;  4Y7N J;  4YEL A;  3GTO J;  2W7N A;  1WGX A;  1QPI A;  3M3Y J;  1V3F A;  1TWG J;  1FZP B;  3KP3 A;  2CV1 A;  1XB4 A;  2CJJ A;  2HQA A;  5HOD A;  5D5W B;  2VJI A;  4A6D A;  1SAN A;  3CCY A;  3Q0V A;  4M73 A;  5A2Q Z;  2TCT A;  1VFC A;  2V6C A;  3ZGK A;  3FBI B;  2HU9 A;  3DLL F;  1H9G A;  2WB1 N;  1ZHF A;  1VQ4 I;  3LWF A;  1JUP A;  2KJB A;  3AG1 H;  5BQT A;  3PSF A;  1SFO J;  1UJ8 A;  3BJO A;  2XXP A;  4CGZ A;  1TQM A;  4Y13 A;  2OC6 A;  1ZG5 A;  2KZV A;  1TZL A;  2IA2 A;  4RGX A;  5CYV A;  4RB2 C;  2LG4 A;  3WOD F;  1V4R A;  1G59 A;  2V1N A;  2MEZ A;  3M7G A;  4P1W A;  2HNH A;  5LFA A;  3GX4 X;  4FQG A;  3QYX A;  4LG3 A;  2H09 A;  2RRE A;  4A3F J;  3Q3S A;  5BPD A;  2WY8 Q;  2ICW G;  4EKG A;  2EIL H;  1F1Z A;  2CG4 A;  4KJZ A;  2FML A;  1FMV A;  3J80 Z;  3I3L A;  4ZDO A;  2WAQ N;  1YSE A;  5E18 F;  3BDD A;  2P4W A;  4LLL A;  5GAH i;  3WG7 H;  2QQ8 A;  2EWT A;  1IG7 A;  2K9L A;  1FC3 A;  2GZU A;  2EFN A;  1EA3 A;  3IH2 A;  2K3P A;  2RNG A;  3JRE A;  1IDZ A;  2DCE A;  3JRA A;  1QBJ A;  4HW0 A;  3DU5 A;  1W7P B;  1HW5 A;  1ERD A;  5JVG F;  2L01 A;  3KLO A;  2W00 A;  5E3O A;  1XS9 A;  3PO2 J;  2LYR A;  3BD1 A;  3EDP A;  1B72 A;  4MTD A;  4XQF A;  2H1L A;  1S7E A;  4CYC B;  3JXD L;  1I3Q J;  1H89 C;  3ZQL A;  3JRB A;  2BEO A;  4B3A A;  4UVB A;  2FXA A;  4WCG A;  2RC4 A;  3A0H C;  1M1E B;  4ASN A;  4EJO A;  5IYC J;  5KVR A;  3CJQ B;  2CS3 A;  4F55 A;  3L1P A;  2IS2 A;  2IS6 A;  3BCA A;  3V42 A;  5K98 B;  4BDZ A;  4W97 A;  2R4G A;  1T08 B;  1BN5 A;  1Y0U A;  5BMZ A;  2L9N A;  3M9A A;  5J47 A;  3CCM I;  3EUH A;  1EH8 A;  4M6X A;  3L2Q A;  3T0Y A;  3ZQQ A;  5K5Q A;  2LYK A;  1S7O A;  1E17 A;  3FXO A;  2A07 F;  3GTQ J;  2PUF A;  2ID6 A;  2M1B A;  1JH9 A;  1WKM A;  1PUF A;  2DW4 A;  2VON A;  4JX6 A;  3TMO A;  4Q2J A;  3U1D A;  3LNQ A;  2GOX B;  1Z6R A;  1SD4 A;  1HXD A;  4WF2 A;  1F9N A;  5DDG A;  2WA0 A;  1ZEL A;  2L3D A;  4J01 A;  5LGU A;  1WPK A;  2EZH A;  3IP4 B;  4B4C A;  4UNO A;  3TFL A;  3G1M A;  2KT0 A;  2HFH A;  5IYB J;  2VJ5 A;  4ER7 A;  4DBQ A;  4FAS D;  2XF7 A;  1R71 A;  2FF4 A;  3TEL A;  5AIP A;  2AUW A;  2OF7 A;  2X1C A;  2BV6 A;  4P9U A;  5DUI A;  1QB2 A;  2D1H A;  3G3Z A;  4M3G A;  2VLA A;  2E71 A;  3TBI A;  3CCJ I;  1I27 A;  4ER6 A;  5E8I A;  2VT3 A;  3RPQ A;  2EIJ H;  3OYE A;  1X1A A;  5D5V B;  1QP4 A;  1FP1 D;  5FLX Z;  3C2H A;  4BBR J;  2DMQ A;  2DFE A;  4DIQ A;  2A6E F;  3HOV J;  4N4N B;  3T1B A;  2ZBK A;  5KAF C;  3A02 A;  2VAS A;  3R6S A;  5FRN A;  1LMB 3;  3C7J A;  2OQR A;  5DV5 A;  3U21 A;  1RZR D;  2HKX A;  4QLC U;  2WAF A;  3S14 J;  2HTJ A;  4I09 A;  4KDP A;  1ZG3 A;  3OYF A;  1UG0 A;  1MBH A;  3F72 A;  2PUB A;  3K9T A;  2E1O A;  2YPR A;  1XC5 A;  4E6K G;  2QCO A;  2QA4 I;  2FUG 2;  5GPC A;  1K61 A;  1IF1 A;  2KMU A;  3H5T A;  2HWV A;  4M6V A;  4KIF A;  1QO0 D;  5D6E A;  4MEY F;  3NEU A;  3EYI A;  2XSJ C;  4G9Y A;  2Y9Z A;  2IT0 A;  5L3B A;  3RKQ A;  4OU0 A;  2DJN A;  1OR7 C;  2M30 A;  1KQ9 A;  4IXA A;  3OWQ A;  4CHU A;  2BNM A;  2CRO A;  2W24 A;  3I5U A;  5LD2 C;  1QPM A;  1OLT A;  1WIZ A;  1K79 A;  1BBY A;  1XMA A;  1VZ0 A;  4JQF A;  4CSW A;  3JAM Z;  5IPA A;  1F43 A;  1BL0 A;  1YYV A;  2WC2 A;  4QTR A;  1J09 A;  4AYB N;  3WU2 C;  4ESJ A;  1OCT C;  3R61 A;  5DD8 A;  4AVZ A;  2XGC A;  5HS8 A;  4GYG A;  3R60 A;  2X51 A;  1DPU A;  1FOY A;  5D4R A;  2ZKZ A;  2BY0 A;  1ZH5 A;  2LNB A;  2HVS A;  2KFD A;  4XLC A;  1U78 A;  2QBY B;  2LYL A;  3ERE D;  4M74 A;  2MA3 A;  2XPW A;  2HFZ A;  4I76 A;  5TGT A;  3B7H A;  2IJL A;  3EUH C;  3VDX A;  1YS6 A;  4LG0 A;  5DRT A;  4ITV A;  5HDN A;  2XCJ A;  2W85 A;  3E97 A;  2E35 A;  4NNJ A;  4C2T A;  2A5W A;  4DJA A;  1Y1W J;  4MNU A;  1YTY A;  4ZZD A;  2HTS A;  3IAS 2;  4A3M J;  4KMU X;  4XIC A;  5JLW A;  5M3F J;  4J1X A;  2VE9 A;  2Y0S A;  3A9Y A;  2Y75 A;  4I2O A;  3PIO F;  3F0C A;  2YUS A;  3FYA A;  5EEG A;  4IRG A;  5FRO A;  2FBK A;  1GVD A;  3RSN A;  2NNN A;  4XMY A;  1DP3 A;  3NZL A;  1IZ1 A;  1MJ9 A;  2K9S A;  3P9I A;  4XSZ F;  4BH9 A;  4WWC A;  4ENJ A;  4AIK A;  1ZRE A;  4ER0 A;  2Y0S N;  3MKZ A;  1MDM B;  2OAZ A;  2M0C A;  1DP7 P;  2LY1 A;  2XRN A;  4EM0 B;  4CCO A;  2OTL I;  5GAG J;  4B47 A;  1Z67 A;  3BG5 A;  3R0A A;  4IO9 F;  2CH0 A;  5M5W J;  1J0R A;  1JI8 A;  2O38 A;  1UEL B;  1TTY A;  1FIP A;  3HKZ A;  1B9N A;  1R00 A;  2DFH A;  2JPC A;  5FKL A;  2E5N A;  3I56 I;  2V3C C;  1HW1 A;  1YJ9 I;  4Y3O A;  1VI0 A;  5ERI A;  5DSX A;  1KU9 A;  2XJ3 A;  4IPA A;  3PL8 A;  3BC8 A;  3TQN A;  2Z33 A;  2QQB A;  2FJR A;  2G9W A;  2AW6 A;  3NRO A;  4UUV A;  3KZZ A;  1IRF A;  3MAJ A;  4EMS A;  3HHG A;  2XSD C;  2ZJ2 A;  3O6B B;  1RPW A;  4F52 A;  1LVA A;  2P7C B;  2JT1 A;  2K9Q A;  2YR2 A;  4M3E A;  3OYA A;  1OSL A;  1H9T A;  2X48 A;  3M9L A;  4BHP A;  2VOD A;  3PIP F;  1TWF J;  2VC1 A;  2CUZ A;  2L02 A;  5ICE A;  2K9N A;  2KIQ A;  2L5Q A;  1G3T A;  4U0W A;  1Z77 A;  3HTU A;  2O3F A;  1D0Y A;  4KN4 X;  3TW6 A;  5JR3 A;  3A01 B;  3WTZ A;  2Q8K A;  1UTX A;  1XGO A;  2OD5 A;  3NAR A;  2RDP A;  2IGM A;  3BTC A;  2KRC A;  3CJT B;  2QKL B;  4CXF A;  3GTJ J;  1QNT A;  1UMQ A;  4XLF A;  5C4J J;  3TP3 A;  5L3F A;  4E7I A;  4XN0 A;  2DDA A;  4NHJ A;  2WWY A;  4G6D A;  1BA5 A;  1I1G A;  1MJB A;  1YS7 A;  4YEJ A;  1HQ1 A;  4HDU A;  3ASN H;  2IW5 A;  2LYJ A;  2K4J A;  3CDL A;  3CJN A;  3HGY A;  4EQZ A;  4XLH A;  5H6R A;  1VND A;  2XKP A;  2XUB A;  4Z5D A;  3LSK A;  2CUE A;  2ZXW H;  1WH5 A;  2DFF A;  2P0W A;  3S15 J;  4GYI A;  2FFH A;  2PIJ A;  3PXP A;  3Q5F A;  3IWZ A;  4KT6 A;  1Y0N A;  2BXZ A;  1O3S A;  4CZZ A;  1QZY A;  3HL2 A;  2QSG X;  2R7D A;  2VQL A;  3JSP A;  3BTI A;  5LHH A;  2ESH A;  2WY7 Q;  4ZYE A;  2P6S A;  3BS3 A;  2E2I J;  5DRY A;  2FX0 A;  4PSX A;  1QZZ A;  4XRM A;  2W25 A;  1Q1V A;  4QSH A;  3DP7 A;  2CFX A;  4IEJ A;  3SEQ A;  5CJ9 A;  2EIN H;  2XAG A;  2XAH A;  1SMT A;  5JHF A;  2IGK A;  2YBD A;  3L09 A;  3AFH A;  4XNF A;  4RAY A;  4AID A;  4HQE A;  2KIU A;  3V7C A;  4X4I A;  1Z3Y A;  2AHQ A;  1VQM I;  2X6X A;  1JUS A;  3FK7 A;  3HJE A;  3DM5 A;  2OU2 A;  1UG2 A;  3HPG A;  3GZ6 A;  1VQP I;  3SQN A;  1FX7 A;  3SFZ A;  1LFU P;  3DKW A;  2CQX A;  3CZ6 A;  4ZYA A;  1FTT A;  1X3W B;  4BYY A;  5LLQ A;  2R7X A;  3G1O A;  5F27 A;  2A69 F;  3LSG A;  3BQZ A;  5B3S H;  4DZJ A;  5DM6 F;  3HOU J;  2L8N A;  4M72 A;  3VYR B;  2DJI A;  3FMR A;  3KCC A;  4UY8 I;  3W6K B;  2VOP A;  2LP0 A;  3N97 A;  4ZYH A;  3GLL A;  1W0U A;  2O9L A;  2VBX A;  4PZJ A;  4XK4 A;  2XAS A;  3Q0U A;  1BDH A;  2X1E A;  3QPT A;  2D2W A;  1SEU A;  5D8L B;  2OCE A;  2XRO A;  2DYS H;  2OTJ I;  1F5T A;  1YX3 A;  4RGU A;  1PRV A;  3HXL A;  4U0V A;  2GXG A;  1IN8 A;  2NAZ A;  1J5Y A;  3JSO A;  1ON2 A;  3ISP A;  4ZDL A;  2B9S A;  2P81 A;  3TO7 A;  4BQN A;  1O57 A;  1TQI A;  2HZT A;  4BQO A;  3H5A A;  4EGZ A;  3OSF A;  5GAD J;  1K78 A;  2V1D A;  3W6V A;  5FRM A;  3CMA I;  3GN5 A;  1W5C C;  3OMT A;  3H1C A;  5K5R A;  4UUS A;  1X2L A;  5FD6 A;  2R93 J;  1LCD A;  2PUE A;  1T38 A;  4XLN F;  1VQL I;  2KPJ A;  5L3C A;  2L54 A;  4BJ5 C;  3GFI A;  1ZAY A;  4OIR F;  3IUO A;  3I59 A;  1N77 A;  1NK2 P;  2RN7 A;  4WXC A;  1PDN C;  2L7Z A;  3BZ6 A;  1MKM A;  3WGH A;  1HCR A;  2DYR H;  3BG9 A;  3HGG A;  1APL C;  2CV0 A;  5F6F A;  4ANJ A;  3ZP5 A;  3IWF A;  4L0Z B;  4WXH A;  3GTK J;  1EKE A;  1VPW A;  4UVA A;  2XGD A;  4HNV A;  1E3P A;  4E7L A;  2PXV A;  3W2W A;  3ERM A;  4LG0 B;  3D0S A;  3V8L A;  2JA6 J;  3MKL A;  2COM A;  4BUP A;  1MND A;  2FBI A;  1R9T J;  2E5Z A;  4XSX F;  4G7H F;  1WQ2 A;  1UFM A;  5K5O A;  1KGS A;  3K1P A;  5FJ8 J;  1JHF A;  2R7U A;  2MXD A;  3GTM J;  1EJ9 A;  3GW2 A;  3SEZ A;  2L0K A;  2EJR A;  3P9K A;  3RJP A;  4RGR A;  1PP7 U;  2YU3 A;  3VOD A;  1LJ9 A;  1SAU A;  2AXT C;  2HOT A;  4Y52 J;  3WU0 A;  2PJP A;  2F5V A;  3DWL E;  2ZJQ F;  2L7K A;  2R63 A;  2NVY J;  2VUM J;  1IUY A;  2HYF A;  1ODD A;  2MFZ A;  3H9G A;  3OMY A;  3K2Z A;  4Z5C A;  3NWS A;  1V5E A;  1WI9 A;  1X58 A;  3GXO A;  1XGM A;  3ELK A;  4PU7 A;  3OSG A;  1KU7 A;  2HS5 A;  2VJ4 A;  5M5X J;  3IRQ A;  4A0Y A;  4KUM A;  4NC6 A;  1CF7 B;  3H9J A;  1U9N A;  5EJC A;  1P6R A;  2NXN B;  2JK3 A;  2IS4 A;  2LRD A;  2R5Y B;  2ZXI A;  1LNW A;  2X0L A;  2AXZ A;  4D0P A;  4B48 A;  2DAO A;  2CSF A;  3JTG A;  4XLE A;  4LD5 A;  3BQY A;  2WBM A;  3BT9 A;  2MGQ A;  2QQA A;  3DXJ F;  4AIJ A;  5IT9 Z;  3TRB A;  4PFO A;  3KZY A;  2DT5 A;  1LDJ A;  3EUK L;  3RQ4 A;  5GAE J;  2DA1 A;  2V26 A;  5EF6 A;  2FE3 A;  2JQE A;  3C18 A;  2FNA A;  3FYM A;  3BY6 A;  2ZME A;  2WAD A;  2EH3 A;  2KL4 A;  4F91 B;  2Z16 A;  2JSC A;  2GRM A;  5A2Q K;  2I8D A;  1JTX A;  1FSE A;  2BYV E;  4CCN A;  2FBH A;  4IOC F;  3MD2 A;  3WHB A;  3KL4 A;  4IRI A;  3CLC A;  1MBE A;  4I6T A;  3L9F A;  4YFX F;  2BY2 A;  3OQM A;  2KIF A;  5E1X A;  4MQ9 F;  2Q1Z B;  2IRF G;  1YW9 A;  1QP0 A;  3BR6 A;  3NXH A;  4P96 A;  1GV5 A;  1XSV A;  2HXO A;  3W2A A;  4NC8 A;  4OBM A;  5EGO A;  2L1P A;  1D0X A;  3GTG J;  1ETX A;  1P4W A;  1B72 B;  4X4D A;  5FO5 A;  2XAU A;  3HOS A;  2ID3 A;  1J9I A;  4XRS A;  2Y30 A;  4BE1 A;  3F3X A;  5KCM A;  5JHU A;  3C3W A;  4CCJ A;  2R5Z B;  3QPH A;  4FX0 A;  4PCQ A;  2VJJ A;  2VL8 A;  2YX7 A;  2AS5 F;  5F04 A;  1U0J A;  3WE2 A;  1IXC A;  2KZG A;  2M9H A;  1QQB A;  4HQM A;  3F21 A;  2R0Q C;  1HQC A;  1ENH A;  3GLX A;  4YFK F;  2ISY A;  4O8B A;  1V5G A;  2LSO A;  4DOZ A;  1OCC H;  3HUG A;  1MBK A;  5BS6 A;  3F8M A;  4II3 A;  4BNC A;  2PXT A;  2NVU B;  1I5Z A;  1NG6 A;  4CUG A;  1YFH A;  2X85 A;  1OYW A;  1MNM C;  1UST A;  3PFY A;  3F8F A;  1N78 A;  3ZMS A;  3LFP A;  2LH9 A;  2DA4 A;  4HV6 A;  4BY1 J;  4IL6 C;  5EZG A;  2ODR D;  3WTV C;  3JTH A;  3RZZ A;  4CYD A;  3GME A;  5E3N A;  2ZJP F;  2KIM A;  2GZW A;  3HRU A;  3IH4 A;  4CA0 A;  1JKR C;  1DU6 A;  4J00 A;  4GXO A;  4BQQ A;  3QWG A;  3S1Q J;  3MZH A;  1A36 A;  3GZC A;  4X4E A;  3FXQ A;  1Z91 A;  5FKO A;  2HDD A;  2M4H A;  2F5E A;  1DUX C;  1QP7 A;  3EUS A;  1QPZ A;  2VE8 A;  3LST A;  2GBY A;  1ETY A;  4PGG A;  1JE8 A;  2E2H J;  3WG9 A;  4WX9 A;  2FA5 A;  3H5N A;  2FRH A;  3QP5 A;  1Z7L A;  5L3D A;  4OIO F;  2QLZ A;  2WV0 A;  4RA2 A;  5E1Z B;  3VFZ A;  1R22 A;  4UB6 C;  3S2W A;  2RAE A;  1TT0 A;  1PER L;  1MH4 A;  4DYQ A;  5GPA A;  2BY3 A;  1R1T A;  4UUS B;  1U8B A;  2QYO A;  1MBF A;  1YE9 A;  3V8J A;  4S05 A;  3FX3 A;  4EKI A;  3FWE A;  3GFL A;  4L9J A;  3K7A J;  4BKX A;  5E3M A;  1T0F C;  4N4O B;  1U5T B;  3MQ0 A;  1Z3X A;  3E5U A;  2ADU A;  2L9S A;  3ZMZ A;  5BPI A;  2R7T A;  3CJR B;  3BWG A;  1IC8 A;  3KE2 A;  1LFB A;  3COA C;  2ME6 A;  2JVG A;  3S1N J;  3CRO L;  4ZYD A;  2OJE D;  3ONQ A;  3RZO J;  3ECH A;  3OYM A;  3ABT A;  3MN2 A;  5GAH J;  2UWM A;  3DKX A;  3DNV B;  4RAZ A;  5CVU A;  2WB1 A;  3LSJ A;  1D0Z A;  1W1W E;  2ZME B;  1QZE A;  2BW3 A;  4KA4 A;  1Z1D A;  3OS0 A;  3LA7 A;  2O03 A;  2J7U A;  2LYQ A;  1B4A A;  2PXB A;  4BXX J;  3RTR A;  3EYY A;  4BJ6 C;  4HNU A;  5B66 C;  1HDP A;  1D1A A;  2KPM A;  2BZT A;  4F93 B;  1MDM A;  2J5P A;  3CCE I;  3DBL B;  1ETK A;  2F6C A;  2EWN A;  2NVT J;  5J6X A;  1MZB A;  3S2D J;  4MFD A;  1GUU A;  2LLK A;  3QQ6 A;  2QEN A;  1KQ8 A;  3RYP A;  3WGG A;  1R23 A;  3JRC A;  1UXC A;  3L2R A;  3S2H J;  3C2B A;  2VPR A;  1QVU A;  1BJZ A;  1TBX A;  1SD6 A;  1MBJ A;  4UVC A;  1RET A;  3G1L A;  3OWT A;  3MKY B;  2A6T A;  1WJC A;  1MMA A;  1ZGA A;  4WK8 F;  2DMT A;  4E7K A;  2MC4 A;  4WXD A;  3LAJ A;  1KYZ A;  5DTR A;  4F92 B;  1YRN B;  4JYK A;  2NOJ B;  2FMY A;  3HOZ J;  1SD5 A;  3CCS I;  1UZC A;  2PLY A;  2BOL A;  1WJE A;  2FQ3 A;  3K6G A;  4HST A;  4HNT A;  4YAR A;  2KRF A;  1BDI A;  3HSE A;  1EH6 A;  1ADR A;  3MVP A;  3Q9V A;  2Z2S B;  4I6Z A;  2X6Y A;  1JFS A;  2TDX A;  3CCL I;  3H5R A;  4MLO A;  4OIQ F;  2P5L C;  2V9K A;  3CCV I;  2ZSI B;  5E8G A;  2LDU A;  3S17 J;  1RIO H;  1WJ5 A;  3CCR I;  2R92 J;  5E1W A;  1VQ6 I;  3GZD C;  2HOS A;  2O8K A;  2HIN A;  1BOA A;  5HDG A;  3MKW B;  4IA8 A;  3ZQH A;  3CP8 A;  3CO6 C;  3BZC A;  3BJ6 A;  2ZNY A;  1DQU A;  5IT3 A;  1RES A;  4L9N A;  1OMI A;  3S8P A;  1VQ5 I;  2HSG A;  1KU3 A;  3I55 I;  3GBF A;  5HS7 A;  1ACI A;  1HDD C;  5LEJ A;  4P55 A;  1HOM A;  2HPI A;  2PUG A;  4FE7 A;  3CEC A;  3FHZ A;  4M3B A;  2BJC A;  2EZK A;  2JVL A;  3VWS A;  3SX0 A;  2DPD A;  3DKY A;  2JA7 J;  3CTA A;  5L3G A;  3K4B A;  2XHK A;  3IV5 A;  1R5H A;  4YFN F;  2R7S A;  3M8J A;  2M8E A;  4BEH B;  1JJ8 C;  4HF0 A;  2XXA A;  3KZI C;  1LVK A;  4KN7 X;  3L2W A;  4BGD A;  3LAP A;  1XCB A;  1K4S A;  1YRN A;  1IUF A;  2P6T A;  3V8K A;  1SAX A;  1D5Y A;  3ESW B;  1ZKG A;  2PEX A;  1DGW Y;  4B09 A;  4RB3 C;  3BR1 A;  1FP2 A;  2H94 A;  4IHS A;  4IVZ A;  3F8B A;  2VT2 A;  4HPQ A;  4XR6 A;  4XOT A;  1TQP A;  2A3S A;  3JRI A;  3ZCO A;  1ZR2 A;  1PRA A;  2VN2 A;  2DMP A;  3WE3 A;  5FKK A;  5E79 C;  3SR4 A;  3IL2 A;  5J1R A;  1YIT I;  3TOB A;  4IQ4 A;  2HYG D;  5C44 J;  2NVQ J;  4UB8 C;  5H20 A;  4AIH A;  2E7X A;  4II2 A;  2KHM A;  5K7Z A;  3HOX J;  4IWR A;  2Z5U A;  2R5Y A;  5C4X J;  3HRS A;  1REP C;  1IDY A;  4MQV A;  1U5T A;  4W1U A;  4Q47 A;  3SJM A;  2M0M A;  3OP9 A;  5DUK A;  4B8X A;  2Y69 H;  3JXB C;  3H0G J;  1FYL A;  3HZI B;  3A9Z A;  1MD0 A;  3HB9 A;  2B63 J;  4Q4Z F;  1PVE A;  1ETW A;  2ETH A;  1RR8 C;  1OQY A;  2DA6 A;  3EUA A;  1ZK8 A;  1DUL A;  3W2V A;  3EET A;  4HV5 A;  4ESB A;  2JWT A;  2F5F A;  4BAY A;  1GXQ A;  5DTM A;  1B59 A;  2LR8 A;  4KIT B;  3K70 D;  5IP6 A;  3BDN A;  2IA1 A;  4C3I J;  1W7P D;  3HG9 A;  4HDV A;  2JQ7 A;  2VQH A;  2XF5 A;  2M3A A;  3UKG A;  4OMY A;  2MSY A;  3FM5 A;  1L0O C;  3Q0W A;  2BHZ A;  3TEP A;  3GCM A;  1RKT A;  2LF8 A;  1T95 A;  4V19 K;  2PXL A;  2KEJ A;  3NQO A;  2E1M C;  3DBR B;  3T8R A;  3IRR A;  4J19 A;  4X4F A;  2STW A;  2AXV A;  3D5R C;  3HRT A;  1NK3 P;  2L4M A;  2LCV A;  3SDG A;  4A3C J;  2E7W A;  5LBQ A;  3F22 A;  1R5G A;  2WUS R;  4EEF G;  1G2H A;  1LQC A;  2ELK A;  1R1U A;  3PNY A;  1QA6 A;  3DEE A;  3GTL J;  1SFE A;  3FXJ A;  5LEK A;  1JHH A;  4RLQ A;  3HBL A;  1YQA A;  4ETS A;  2H8R A;  5E17 F;  1S72 I;  2IGN A;  4XRF A;  5FLX K;  1IAW A;  2GM4 A;  1TWH J;  3W6J B;  1HF0 A;  3SZG A;  5J4V A;  4L18 B;  4NC7 A;  4LIV A;  1T39 A;  4R1H A;  4KNY A;  3K4L A;  3PNT A;  4ZTF A;  1VQ9 I;  3HDD A;  4NQW A;  5D5X B;  3HTS B;  4AYB A;  4CCL A;  1S29 A;  1Y8R B;  2E60 A;  4RM3 A;  1IGN A;  1WRJ A;  1P7J A;  2CSO A;  3RPU A;  3NAU A;  1QHH D;  2PXQ A;  2VEO A;  4EJW A;  1X2N A;  2PUA A;  2HOA A;  2DI3 A;  3J81 Z;  2A61 A;  1ORK A;  3CMM A;  4JCX A;  2QVO A;  2JA2 A;  3EQL F;  3HKZ N;  4AU7 A;  4NBQ A;  2QM3 A;  3S3N A;  4XN3 A;  4A69 C;  3DFG A;  3DQV C;  1Y7Y A;  4EZI A;  3HOY J;  4HSR A;  1CGP A;  3U2R A;  3S1R J;  4DBR A;  1B8I A;  4HF1 A;  3GVA A;  4LB6 B;  1L3L A;  2QEX I;  1RZS A;  2GRL A;  4UXN A;  3I64 A;  2MD5 A;  2R7O A;  2W82 A;  2K9M A;  3ZN0 A;  4CDG A;  1B6A A;  1Y9Q A;  2IEK A;  1WJD A;  1WJA A;  2A68 F;  2Z99 A;  5J40 A;  1X4P A;  1XD7 A;  3LSI A;  4F8D A;  1GV2 A;  2F5D A;  5DTQ A;  2LLV A;  2VKD A;  2BNO A;  1LQ1 A;  3G2B A;  1IV6 A;  2JA5 J;  4I99 C;  4IKF A;  1YX5 A;  3DLA A;  4HA8 A;  2F4O B;  4MO7 A;  1LEB A;  4ON0 A;  2FOK A;  4Y15 A;  5F1R A;  2EZI A;  4A3L J;  2RNJ A;  3ECO A;  1AOY A;  1B0N A;  1EV7 A;  5D4S A;  4XLP F;  2KKO A;  1FYK A;  1TNS A;  2NS7 A;  4LIU A;  2G7U A;  4UUT A;  4BE0 A;  2M34 A;  3GZ5 A;  4JK1 X;  3E0J B;  2HVR A;  1RUN A;  2CQK A;  4YIF A;  2K27 A;  2XAJ A;  2HYJ A;  4Y33 A;  2E36 A;  5CQG A;  1BC8 C;  3BG3 A;  1XCV A;  3FBN B;  2BE5 F;  3B6A A;  4MFE A;  2R7W A;  3ABU A;  1R4M B;  4UV8 A;  2DDB A;  3KEO A;  1MNE A;  4N9I A;  3PE5 A;  2EIK H;  2G0E A;  3F52 A;  4ABZ A;  3P5J A;  4OWR B;  4Z6Y A;  1O7F A;  1BR1 A;  2PG4 A;  5DCM B;  1GT0 C;  1ZZB A;  1PJR A;  2BBY A;  4D5F A;  3MFK A;  5HOO A;  3HRM A;  4HOB A;  2GIZ A;  4G6T B;  1JTY A;  5DTD A;  2L7F P;  1XWR A;  2VOO A;  3TP0 A;  3I71 A;  1WCM J;  2Z1D A;  4PDK A;  1FWZ A;  2Y31 A;  3N05 A;  4B44 A;  4DE8 A;  4XL9 A;  4YG2 F;  2ZFU A;  3SXY A;  1J59 A;  2GXB A;  2LY9 A;  3B73 A;  4D7M A;  1E0E A;  1TP4 A;  1NH3 A;  1FY7 A;  1SD7 A;  1WWX A;  1AA7 A;  5BOX A;  1STZ A;  1X1P A;  4A12 A;  3H92 A;  4Q5S F;  3F6V A;  3F51 A;  3G7D A;  2F2E A;  3GFM A;  3BG6 A;  2OQG A;  2CW7 A;  2NS0 A;  3GFJ A;  2O49 A;  3K1M A;  1DPR A;  1MSF C;  5ILU A;  1HLV A;  5KHD A;  4JBA A;  2YX4 A;  1ZPQ A;  4MGR A;  1WJB A;  4Z2Y A;  1NEQ A;  2ISZ A;  3OYB A;  1YHQ I;  1BI0 A;  3SCF A;  3J80 K;  1S8N A;  1FOW A;  1EF4 A;  1USS A;  2DQR A;  1UB9 A;  2R7R A;  4KIC A;  3G5G A;  4EAT A;  2AXL A;  5HLT A;  5KAI C;  3GEZ A;  2C6Y A;  4LLN A;  3HHH A;  5EZH A;  3LIS A;  2HDC A;  3HSF A;  3H0D A;  2BGC A;  4FN3 A;  2R7Z J;  1LKX A;  1R7J A;  2MLK A;  2CU7 A;  3PQJ A;  1PRU A;  2LF7 A;  1I50 J;  4IHV A;  1N25 A;  4I02 A;  2UZK A;  2EFP A;  5LHI A;  3CES A;  1P9Q C;  4G8X A;  4L9T A;  2M87 A;  4GGG A;  3WTX C;  1JFT A;  1R1V A;  1U5T C;  4JQD A;  4AVP A;  2DU9 A;  5IT9 K;  4PFP A;  3OR1 C;  3PQK A;  1ZUG A;  1AWC A;  1O3R A;  2HCS A;  4L5J A;  2R1J L;  1OKR A;  2EQR A;  4RM2 A;  3TO6 A;  3ZPL A;  1U3E M;  2ME0 A;  2EK5 A;  4XID A;  3IKT A;  2OZU A;  3UFD A;  3TKY A;  3MLF A;  5F0H A;  1FOK A;  2EFW A;  5HDK A;  1OCO H;  2IVM A;  2A6C A;  1R4N B;  2XPU A;  3RIR A;  1YIJ I;  3K70 C;  3K4J A;  3I4M J;  3BTJ A;  3MEJ A;  1YW7 A;  2O5R A;  4PUS A;  2VC0 A;  3FIS A;  1XDS A;  4PJL A;  3DPU A;  5TIS C;  4HYE A;  1OYY A;  1JKQ C;  4ZDP A;  4Z5H A;  5J1Y A;  5FGM A;  2NVX J;  2LY2 A;  2QSF X;  4C30 A;  4EM1 A;  3ZOB A;  4A6E A;  3KYD B;  1LFP A;  4PJJ A;  2Z3Y A;  1DU0 A;  5EG0 A;  1KZH A;  5E3L A;  4MCX A;  3LFU A;  3K10 A;  3DCF A;  3CDH A;  2KRH A;  5H6Q A;  1X1C A;  4PJ0 C;  4YG4 A;  3QU3 A;  1B1B A;  4PJM A;  2NYX A;  2VXD A;  5J4Y A;  4BHC A;  4A5M A;  1HC8 A;  2YU9 J;  1ZTR A;  3A2K A;  4EVI A; 
#chains in the Genus database with same CATH homology
 3LNQ A;  1L1M A;  3QWG A;  3S1Q J;  1XG1 A;  3IVP A;  4X4E A;  4I6R A;  2ZB9 A;  5FKO A;  4M3F A;  2HDD A;  1QVT A;  1JWL A;  1QP7 A;  3BR3 A;  3EUS A;  1QPZ A;  2GBY A;  1WPK A;  2EZH A;  4PU3 C;  4B4C A;  1ETY A;  2LYS A;  1ZVV A;  3G1M A;  2KT0 A;  5IYB J;  2E2H J;  1CQT A;  2IU7 A;  1ZQ3 P;  1EFA A;  4D5C A;  1AKH A;  3BR5 A;  1PNR A;  1RIO A;  2AUW A;  1AKH B;  4A3G J;  4BY7 J;  2OF7 A;  1PER L;  3ZHI A;  2RAE A;  1MH4 A;  4DYQ A;  5GPA A;  4C3J J;  4UUS B;  1U8B A;  1ZZ6 A;  2KZ8 A;  1MBF A;  1ETV A;  4M3G A;  3K7A J;  4BKX A;  5E3M A;  2JCG A;  2XB5 A;  3LSP A;  2K40 A;  1QP4 A;  3O9X A;  2X9D A;  4BBR J;  2DMQ A;  5F0C A;  1JKP C;  1BW5 A;  3HOV J;  1IC8 A;  3ZQC A;  2HI3 A;  1LFB A;  3A02 A;  1ZR4 A;  2ME6 A;  1LMB 3;  2JMW A;  3RZD J;  3S1N J;  3CRO L;  4FCY A;  3RZO J;  5M5Y J;  1RZR D;  1Z0X A;  3MN2 A;  2FQ4 A;  4FIS A;  3S14 J;  1MBH A;  4AC0 A;  3DNV B;  2PUB A;  2E1O A;  1XC5 A;  1ZGW A;  2PPX A;  2CQQ A;  3R1F A;  2QCO A;  3DEW A;  3LSJ A;  5GPC A;  1K61 A;  3H5T A;  1TWA J;  4M6V A;  2L9R A;  2LYQ A;  2CUF A;  2JJ7 A;  3CQZ J;  4BXX J;  2AXU A;  1TC3 C;  4X1E A;  1T33 A;  4YG7 B;  2Y9Z A;  1HDP A;  3S1M J;  3QPS A;  4X4B A;  1OCP A;  3RKQ A;  1ZS4 A;  2DJN A;  1ETK A;  3FK6 A;  5FKN A;  2BNM A;  2CRO A;  1I6H J;  2I10 A;  2NVT J;  1R69 A;  1WIZ A;  3S2D J;  1F43 A;  5IPA A;  4MFD A;  1GUU A;  1BL0 A;  4QTR A;  4IHX A;  4AYB N;  2LLK A;  5IOY A;  1LE8 A;  1OCT C;  3QQ6 A;  4PU4 C;  3JRC A;  5FLV A;  1UXC A;  2YS9 A;  2XGC A;  1CJG A;  3S2H J;  3C2B A;  2VPR A;  4A3E J;  1QVU A;  2DMN A;  1BJZ A;  2ICT A;  4MIM A;  4A3K J;  1U78 A;  2LYL A;  1MBJ A;  1RET A;  2XRL A;  2KEK A;  3G1L A;  2IAI A;  3JRF A;  4FE4 A;  2XPW A;  4I76 A;  3B7H A;  3ZQF A;  3JXC L;  2X6O A;  2DMT A;  3U3W A;  2DA5 A;  2ECC A;  2LYP A;  2XCJ A;  5J1U A;  4DYC A;  1YRN B;  4JYK A;  3HOZ J;  4XRS G;  1Y1W J;  3B6C A;  4RDU A;  2LTP A;  2MG4 A;  4YAR A;  4A3M J;  1FTZ A;  1X2M A;  4XIC A;  5JLW A;  4GFB A;  5IP7 J;  5M3F J;  4J1X A;  1BDI A;  4OB4 A;  1ADR A;  3MVP A;  3WHC A;  3F0C A;  2YUS A;  3FYA A;  4I6Z A;  3IH3 A;  1JFS A;  1ETQ A;  1WH8 A;  1GVD A;  4A3I J;  3VPR A;  4MLO A;  3S16 J;  2K9S A;  1ZZ9 A;  1OJL A;  4C3H J;  1WI3 A;  3TED A;  4JP0 A;  2Y0S N;  3S17 J;  5EYR A;  2M0C A;  2EBY A;  1SQ8 A;  2R92 J;  4DYR A;  2HOS A;  3BG5 A;  1Y1V J;  2O8K A;  4J1W A;  2HIN A;  1JGG A;  5M5W J;  4IHY A;  4IA8 A;  2IV1 A;  3ZQH A;  5F0F A;  3M4O J;  2O38 A;  3GBG A;  3KZ3 A;  1FIP A;  1WH6 A;  1U9O A;  3F6W A;  5FKL A;  1RES A;  5A7L A;  5IOZ A;  2HSG A;  3BTL A;  1VI0 A;  3GBF A;  2XJ3 A;  5C3E J;  1HDD C;  1HOM A;  2FJR A;  2PUG A;  2GLO A;  2AW6 A;  4FE7 A;  3CEC A;  4M3B A;  2BJC A;  1ZZ7 A;  2XSD C;  2EZK A;  2JVL A;  1RPW A;  3OQO A;  2JA7 J;  4X4C A;  3LSR A;  1E3O C;  2K9Q A;  4M3E A;  2LFB A;  3IV5 A;  1OSL A;  1RR7 A;  2X48 A;  4G12 A;  4I8T A;  1TWF J;  2QF7 A;  1JJ8 C;  2FJ1 A;  2K9N A;  3CMY A;  4JX4 A;  4NDL A;  1Z77 A;  2EBI A;  1YRN A;  1IUF A;  1BW6 A;  3TW6 A;  4IHW A;  3KJX A;  1D5Y A;  3A01 B;  1ZKG A;  2DA2 A;  2Y9Y A;  1FJL A;  1UTX A;  1UXD A;  3BR1 A;  3NAR A;  2NS8 A;  4IVZ A;  4B1R A;  3BTC A;  2DTZ A;  3JRI A;  3GTJ J;  1UMQ A;  2D5V A;  5C4J J;  2MW8 A;  3TP3 A;  1ZR2 A;  1PRA A;  1POG A;  2PE5 A;  2DMP A;  3JRH A;  5FKK A;  2PMZ N;  3OOU A;  5J1R A;  2JA8 J;  1BA5 A;  1JT6 A;  5C44 J;  2NVQ J;  1POU A;  1NER A;  2LYJ A;  1K83 J;  3CDL A;  5K7Z A;  3HGY A;  3O8H A;  3HOX J;  2IVG A;  3SFI A;  4IWR A;  2R5Y A;  1VND A;  5C4X J;  4Z5D A;  4X4H A;  5JLX A;  2CUE A;  1IDY A;  2Y2Z A;  4W1U A;  2OPT A;  1WH5 A;  3RQI A;  3SJM A;  3S15 J;  2R5Z A;  3OP9 A;  5DS9 A;  3JXB C;  3HZI B;  3H0G J;  5FLM J;  1IJW C;  2DMU A;  2PIJ A;  3PXP A;  2B63 J;  3HB9 A;  3ZQI A;  4DW6 A;  1ETW A;  2AO9 A;  2DA6 A;  2EF8 A;  1ZK8 A;  1JJ6 C;  2XB0 X;  3BTI A;  2JWT A;  4JX5 A;  3BS3 A;  2LR8 A;  1H8A C;  2XIU A;  2LD5 A;  2E2I J;  2FX0 A;  5IP6 A;  3D1N I;  2WV1 A;  4XRM A;  4X6A J;  4C3I J;  1Q1V A;  4QSH A;  3BDN A;  1OFC X;  4M3D A;  4IEJ A;  3UKG A;  1O4X A;  2MSY A;  3Q0W A;  2KEI A;  3A01 A;  1RKT A;  1VF9 A;  1ETO A;  4Z59 A;  3PM1 A;  2HXI A;  1A6I A;  2VKE A;  3BR0 A;  2XI8 A;  4X4G A;  4J19 A;  4X4F A;  2KEJ A;  2O4A A;  2IBD A;  5FKM A;  5BNG A;  3JRG A;  2AXV A;  4X4I A;  2AHQ A;  1B8I B;  4A3J J;  1NK3 P;  1JUS A;  5GP9 A;  1JUM A;  3FK7 A;  4Y42 A;  3ZQG A;  2LCV A;  1UG2 A;  2N8G A;  3SDG A;  4A3C J;  3K2A A;  4DZP A;  2WUS R;  3TW7 A;  4EEF G;  1G2H A;  1LFU P;  2CQX A;  1MBG A;  2ELK A;  1LQC A;  3GTL J;  2KDZ A;  1FTT A;  4A93 J;  1DWK A;  2H8R A;  3HBL A;  2DA3 A;  1IRZ A;  3G1O A;  1ITY A;  1UHS A;  5F27 A;  3LSG A;  3HOU J;  3BQZ A;  4DZJ A;  3HM5 A;  2L8N A;  2GM4 A;  3FIW A;  4MCT A;  1TWH J;  1HF0 A;  2M8G X;  3A03 A;  2OR1 L;  2LP0 A;  1W0T A;  5M3M J;  2HQ5 A;  3HDD A;  3OIO A;  1JT0 A;  1W0U A;  2O9L A;  1LCC A;  1IGN A;  4XK4 A;  3Q0U A;  1P7J A;  1BDH A;  3NAU A;  3E7L A;  2MQK A;  5F08 A;  3I4N J;  1A5J A;  3QPL A;  1X2N A;  4S0H B;  1PRV A;  2HOA A;  2PUA A;  1ORK A;  4AUX A;  4JCX A;  1FEX A;  3HKZ N;  5IP9 J;  5EGO B;  3JRD A;  1GDT A;  1Y7Y A;  4A69 C;  2P81 A;  3HOY J;  2TRT A;  3S1R J;  1B8I A;  2NOG A;  2LVS A;  2PUD A;  1RZS A;  2GRL A;  1LLI A;  3OSF A;  1QRY A;  9ANT A;  2AWI A;  3JR9 A;  1Y9Q A;  2IEK A;  1MH3 A;  1RKW A;  4C2M J;  3W6V A;  4FTH A;  3GN5 A;  3OMT A;  3SCH A;  4F8D A;  4FBI A;  3VK0 A;  4UUS A;  1GV2 A;  1X2L A;  2R93 J;  1LCD A;  2PUE A;  2CRG A;  2BNO A;  2XGE A;  3QQA A;  2KPJ A;  2EZL A;  1IV6 A;  2JA5 J;  1ZAY A;  2O7O A;  1NK2 P;  4MO7 A;  4RBO A;  1ZZ8 A;  2EZI A;  2L7Z A;  4A3L J;  1HCR A;  1B0N A;  3BG9 A;  3HGG A;  2NS7 A;  1APL C;  3LOC A;  4UUT A;  4GQM A;  2M34 A;  2L49 A;  4D7N A;  2W48 A;  4QIW N;  3GTK J;  3BR2 A;  1VPW A;  2XGD A;  4HNV A;  2HYJ A;  1WET A;  4CYC A;  2OFY A;  4YBA A;  4V2G A;  2IVQ A;  2B5A A;  3BG3 A;  3SCG A;  2VKV A;  2JA6 J;  4I6U A;  2DN0 A;  3B6A A;  3MKL A;  4MFE A;  3FMY A;  4V2F A;  5EEA A;  1R9T J;  2DA7 A;  4BBS J;  5FJ8 J;  1FIA A;  3GTM J;  5F1J A;  5J3L A;  1R63 A;  2G0E A;  5K7F A;  4ABZ A;  3F52 A;  1GT0 C;  2L0K A;  1NTC A;  2LKX A;  1ZZB A;  1AU7 A;  4D5F A;  1PUF B;  3ZKC A;  5EG0 B;  5DTD A;  1JTY A;  2HOT A;  2L7F P;  4Y52 J;  1XWR A;  3ZHM A;  3FKI J;  1P7I A;  3TP0 A;  4A3B J;  1DW9 A;  1WCM J;  2Y31 A;  1MSE C;  3OQN A;  2R63 A;  2NVY J;  4Y7N J;  2VUM J;  3GN5 B;  3GTO J;  1WGX A;  2LY9 A;  1QPI A;  3M3Y J;  2XPV A;  1AHD P;  2ICP A;  1TWG J;  4D7M A;  4Z5C A;  1X58 A;  4PU7 A;  2CJJ A;  5HOD A;  3OSG A;  4GHJ A;  1SAN A;  3CCY A;  3Q0V A;  5M5X J;  2FD5 A;  2TCT A;  1VFC A;  5EDN A;  3F51 A;  1RPE L;  1U9N A;  3G7D A;  2WIU B;  2JK3 A;  3HEF A;  2E19 A;  4L5E A;  2WB1 N;  2R5Y B;  3QF3 A;  2L7M P;  2ECB A;  1JUP A;  3O8G A;  2AXZ A;  2O49 A;  1MSF C;  2CSF A;  1SFO J;  1HLV A;  2COB A;  3BQY A;  3BT9 A;  2PUC A;  2MGQ A;  3TRB A;  1RZR A;  1H88 C;  1ZPQ A;  1NEQ A;  1F36 A;  2DA1 A;  5EF6 A;  2M2E A;  3SCF A;  1TWC J;  3FYM A;  1EF4 A;  2IVB A;  2EH3 A;  3GTP J;  2MEZ A;  5K7H A;  2GRM A;  3G5G A;  1X57 A;  3QYX A;  1JTX A;  3HOW J;  5EZH A;  3LIS A;  2VI6 A;  4FN3 A;  4A3F J;  3Q3S A;  3H3V K;  2R7Z J;  2CU7 A;  1PRU A;  4LOC A;  3WHB A;  1I50 J;  3CLC A;  1MBE A;  4Z58 A;  4IHV A;  4I6T A;  1YSE A;  2WAQ N;  3OQM A;  2H1K A;  3KXA A;  1JFT A;  4JQD A;  1QP0 A;  3BR6 A;  4JCY A;  4NDW A;  2EWT A;  1GV5 A;  1IG7 A;  2HXO A;  2GZU A;  3IH2 A;  1ZUG A;  5IYD J;  2R1J L;  3JRE A;  1IDZ A;  5EGO A;  4YG1 A;  2EQR A;  3JRA A;  3GTG J;  1ETX A;  2ME0 A;  4XID A;  1B72 B;  4X4D A;  2LYR A;  3BD1 A;  1XS9 A;  2ID3 A;  5E3O A;  3PO2 J;  3MLF A;  4XRS A;  2Y30 A;  4PU8 A;  3UFD A;  5F0H A;  1B72 A;  2BNN A;  2R5Z B;  1S7E A;  4CYC B;  1LE8 B;  1I3Q J;  3JXD L;  2A6C A;  2XPU A;  1H89 C;  3ZQL A;  3JRB A;  5F04 A;  3PO3 J;  2M9H A;  1QQB A;  4B3A A;  3I4M J;  3BTJ A;  2R0Q C;  1WH7 A;  1ENH A;  5IYC J;  3FIS A;  3L1P A;  4O8B A;  1QQA A;  2JN6 A;  1MBK A;  5K98 B;  4W97 A;  1JKQ C;  4Z5H A;  1ZZC A;  5J1Y A;  2NVX J;  1T56 A;  3ZOB A;  1DU0 A;  1MNM C;  5EG0 A;  5E3L A;  4MCX A;  3S8Q A;  3LFP A;  2LYK A;  2DA4 A;  4BY1 J;  3DCF A;  1JKO C;  5EZG A;  2IUO A;  3GTQ J;  3RZZ A;  2PUF A;  2ID6 A;  4YG4 A;  1JH9 A;  5E3N A;  4A3D J;  1PUF A;  4JX6 A;  2E2J J;  2YU9 J;  3IH4 A;  2LK2 A;  1ZTR A;  1JKR C;  1DU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...