1O4XA

Ternary complex of the dna binding domains of the oct1 and sox2 transcription factors with a 19mer oligonucleotide from the hoxb1 regulatory element
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
129
Chain Sequence
EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMAKLKPLLEKWLNDAESIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*TP*CP*TP*TP*TP*GP*TP*CP*AP*TP*GP*CP*TP*AP*AP*TP*
publication title Molecular basis for synergistic transcriptional activation by Oct1 and Sox2 revealed from the solution structure of the 42-kDa Oct1.Sox2.Hoxb1-DNA ternary transcription factor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 41
structure length 129
sequence length 159
ec nomenclature
pdb deposition date 2003-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
A PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1o4xA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1o4xA01
3IH2A 1A6IA 1I50J 2DA7A 2CSFA 3JRBA 4IHXA 2AWIA 3JRAA 3O9XA 3SDGA 1SANA 2JMWA 4W97A 5C4JJ 5K7ZA 1JH9A 2XB0X 1BDHA 3WHCA 1RR7A 1AU7A 4AYBN 2WIUB 1UHSA 3B7HA 2LTPA 4PU4C 5M5XJ 3GTLJ 3CROL 1RIOA 2IBDA 1LFUP 3DCFA 1QPIA 1TWGJ 5F1JA 1NEQA 2KPJA 4YARA 2FX0A 2LR8A 2KDZA 3ZQLA 1HOMA 3BTCA 1F43A 1RESA 5F0HA 2IUOA 1E3OC 3OOUA 2XGEA 2VI6A 3ZQCA 4XICA 2LYKA 4A3MJ 1D5YA 1NK2P 3GN5A 3TRBA 4YG7B 1PRVA 4UUSB 1IGNA 2FJ1A 9ANTA 5FLMJ 4RBOA 3G1LA 3BTIA 4DW6A 4FBIA 2EH3A 3BR2A 2HXIA 2P81A 1FTZA 1PRUA 4A3CJ 3S8QA 4A3EJ 2IEKA 3E7LA 1ZK8A 2B63J 1FTTA 2DMPA 1F36A 4IVZA 5J1RA 4FCYA 1ZGWA 3RZZA 2PE5A 4PU3C 2JA7J 4I6RA 2O38A 1I3QJ 3BR1A 2M9HA 1QRYA 3FISA 2D5VA 4X4IA 2NS8A 2KT0A 1IRZA 3JXCL 4Z58A 4A3BJ 1ZAYA 1G2HA 1LCDA 3L1PA 2OF7A 4IHWA 3BTJA 5E3LA 3G1MA 2R7ZJ 4AC0A 2AHQA 2K9SA 2R63A 2LY9A 1RKTA 4UUSA 2LP0A 2MW8A 3S1MJ 1GVDA 4GHJA 2XPWA 3FKIJ 1PERL 3A03A 2X9DA 2O4AA 3K7AJ 1GT0C 1X2NA 3QQ6A 4DYQA 1JKOC 1LE8B 2DA4A 3CCYA 2LD5A 3G5GA 3RQIA 3MVPA 5EG0B 1R69A 1RETA 1QP4A 3HM5A 1U8BA 1A5JA 4A3KJ 2FQ4A 3H3VK 1RZRD 2MEZA 1RKWA 3F0CA 1GUUA 1NTCA 2AXZA 2MGQA 4C3IJ 5DS9A 3ZOBA 3LOCA 4J19A 2L7FP 4A69C 3IV5A 4LOCA 1P7JA 1XWRA 1ZS4A 3ZQFA 3OMTA 2VKVA 3UKGA 1K83J 2HINA 2PUBA 1GV5A 4W1UA 3GTJJ 2FJRA 2EZHA 1YRNB 2CUFA 1MBKA 4D7MA 2HQ5A 2L7MP 3OQMA 5E3MA 1JUSA 3TW7A 2NVXJ 1ETQA 3NAUA 3S15J 4A3DJ 4A3JJ 3GTOJ 2DJNA 1OCPA 3HDDA 1IDZA 2Y30A 4M3FA 1LE8A 2E2HJ 3A02A 3OQOA 4BKXA 1JUPA 2CUEA 2HYJA 5EG0A 4I76A 2WUSR 3LISA 2DMUA 2DMTA 3HOVJ 4Y7NJ 5IOZA 5IYDJ 1APLC 4X4CA 4ABZA 1H8AC 2CRGA 4XK4A 3OP9A 3QQAA 1SFOJ 4M3DA 2ECCA 5M3FJ 4NDWA 1MBGA 2R0QC 4XRMA 2O7OA 2GZUA 3IVPA 1W0UA 1VF9A 1Y7YA 2JCGA 3ZHMA 3VK0A 4MCTA 2IVBA 1YRNA 4HNVA 3H5TA 3D1NI 4Z5HA 1JJ8C 3BT9A 4XRSG 2JVLA 4X6AJ 3S2DJ 3HZIB 3Q0VA 2AW6A 3Q0UA 4FE7A 1XS9A 2ICTA 1O4XA 2YU9J 1WH8A 3HGYA 3HOXJ 2XJ3A 3JXDL 2N8GA 2WB1N 3FIWA 3QPSA 2Y31A 4J1WA 1MH4A 5IYCJ 3Q0WA 2L9RA 1TWFJ 3BR0A 1UMQA 3JRCA 2XPUA 4X4EA 4JX6A 5FKNA 4C3JJ 2KEKA 4A93J 3GTQJ 4O8BA 3B6AA 5JLXA 2CQXA 2JN6A 3Q3SA 2CROA 4I8TA 1BL0A 1ETVA 2TCTA 3PO2J 4Y52J 1ZZ8A 2GRLA 2CJJA 1ZZ7A 1ETXA 1IG7A 2EBYA 3UFDA 1B72B 5K7HA 1R9TJ 1LQCA 2QF7A 1JUMA 1B8IA 2L8NA 3R1FA 1IJWC 3H0GJ 3OQNA 1IC8A 1QPZA 1HDPA 3BS3A 3JRFA 3S2HJ 3HBLA 2PUGA 4BBSJ 1WGXA 3FK6A 1MSEC 4PU8A 5F04A 4YG4A 1ETWA 5E3OA 5K98B 3JRGA 1ZZ6A 2JJ7A 3QPLA 2E2JJ 1VFCA 5F0CA 1MBJA 1U9OA 3TEDA 1FJLA 3G1OA 2AXVA 4UUTA 1HF0A 2LLKA 4M3GA 3HKZN 3GBFA 2TRTA 1JTYA 4B4CA 2E2IJ 4B1RA 1GDTA 3HOZJ 3JRIA 1L1MA 4M3BA 1ITYA 1BJZA 1WIZA 5IYBJ 1OFCX 3EUSA 1B72A 1FIPA 1P7IA 4X4DA 2EBIA 1ZPQA 5BNGA 2DTZA 1Y1VJ 3VPRA 2PPXA 1Y1WJ 1TWHJ 3SCHA 3IH3A 1SQ8A 1ZZ9A 1QVTA 1JGGA 1AKHB 2OPTA 2E1OA 1Z0XA 2MSYA 5FJ8J 1XG1A 4D5FA 3F51A 5C4XJ 2Y2ZA 1S7EA 3TP0A 2DMNA 1DW9A 2PUFA 4DYCA 4IEJA 1FEXA 2YS9A 2VUMJ 1I6HJ 5M5WJ 3HOYJ 2YUSA 2NOGA 3I4NJ 2ICPA 2BNOA 2B5AA 1IDYA 1H89C 2XPVA 3O8HA 3GTMJ 4BXXJ 1POUA 3U3WA 4J1XA 4A3GJ 4XIDA 3QWGA 3OSGA 4MFEA 3CDLA 2R5ZB 4IHYA 4DZPA 3DNVB 2LYPA 3LFPA 5EZHA 1HLVA 2KEJA 5GPAA 4OB4A 1LMB3 5IOYA 5IP7J 1AKHA 2M8GX 3QF3A 5J3LA 2H8RA 2CQQA 1MBHA 2Y0SN 4BBRJ 4CYCB 2NVQJ 1OCTC 1ZZBA 2K9QA 1VPWA 2IAIA 1Q1VA 2KZ8A 4IWRA 5F08A 1TWCJ 1JKPC 3B6CA 2LCVA 5JLWA 1X58A 2AO9A 3OSFA 1R63A 2JK3A 2VPRA 1JTXA 4Z59A 4D5CA 2M0CA 4D7NA 4IA8A 2EF8A 3S17J 4B3AA 3BQYA 3WHBA 5IP9J 4I6UA 2MG4A 1CJGA 3HB9A 1ZQ3P 3ZHIA 4QIWN 2R5ZA 4GQMA 2K40A 1ETOA 1MH3A 4JYKA 2E19A 3S1RJ 2H1KA 2I10A 2PUEA 1X2MA 1Y9QA 3LSRA 2LYSA 5EF6A 2COBA 1U78A 4GFBA 4JX4A 3G7DA 2LKXA 4CYCA 3BTLA 1HDDC 2DMQA 2EZIA 4M3EA 2NS7A 4FE4A 3QYXA 2DA5A 1B8IB 4Y42A 2K9NA 2HOSA 3HOUJ 1LLIA 2JA6J 1W0TA 2L49A 3BR5A 2XI8A 4X4HA 3ZKCA 4IHVA 1Z77A 3JR9A 2GBYA 4MFDA 5E3NA 5EYRA 4JP0A 3CMYA 2NVTJ 2BNMA 4Z5CA 2WV1A 1QVUA 5J1UA 4PU7A 1LFBA 1U9NA 2ECBA 1RPEL 2ID3A 3FK7A 3M3YJ 1ZVVA 3W6VA 1WCMJ 3C2BA 2ZB9A 4DYRA 2Y9ZA 5FLVA 5DTDA 3BD1A 5C44J 2LFBA 2R5YB 5F0FA 4MCXA 1ZR2A 5F27A 4X4BA 1WI3A 4JCXA 4A3FJ 1RZSA 2LYRA 3GTKJ 4C3HJ 1B0NA 1MBEA 2XGDA 3FMYA 3LSJA 1EF4A 3NARA 1VNDA 4NDLA 2HSGA 2HOAA 3SCGA 1WH5A 1RPWA 1ETKA 2M34A 2PMZN 4FN3A 4YG1A 3BDNA 2NVYJ 2LYJA 4RDUA 2EZKA 3S1NJ 3GTPJ 3OIOA 3JRHA 3K2AA 3LNQA 1HCRA 4QSHA 1NERA 1QP0A 1VI0A 4MO7A 3HOWJ 2IVGA 3PO3J 2ID6A 3M4OJ 3BG9A 5EZGA 3FYAA 2DN0A 1JT6A 1BW5A 3JXBC 4BY7J 5EGOB 2JA5J 5GPCA 2JWTA 1X2LA 2R5YA 4JCYA 3F52A 4V2FA 4QTRA 1JFSA 1PNRA 2L7ZA 5EDNA 4AUXA 2GLOA 2HOTA 1PRAA 3KXAA 1JFTA 1CQTA 2DA1A 1YSEA 2XRLA 3BR6A 4JQDA 4XRSA 1AHDP 3O8GA 1QQBA 2FD5A 1UXDA 5C3EJ 3RZOJ 2HI3A 1JKRC 2RAEA 3SJMA 3BQZA 3F6WA 2KEIA 2DA2A 1MBFA 5M3MJ 3S1QJ 1ZUGA 3HGGA 1UTXA 4V2GA 1PUFB 5EEAA 1BA5A 1FIAA 2O49A 3PXPA 4YBAA 3MKLA 5A7LA 3I4MJ 2ELKA 3JREA 5EGOA 2BNNA 1ORKA 3SCFA 2R1JL 4M6VA 2LYQA 2QCOA 5M5YJ 2XCJA 3ZQIA 1GV2A 3KZ3A 4I6ZA 3JRDA 2JA8J 2IV1A 2LYLA 2GM4A 1NK3P 1ADRA 4MIMA 2A6CA 5IP6A 4X4GA 4DZJA 2M2EA 5FKLA 5J1YA 2DA3A 1WH6A 2GRMA 5IPAA 3MLFA 3BG5A 1XC5A 4I6TA 1QQAA 5FKKA 1JWLA 2ME6A 4MLOA 2ME0A 3A01B 1T56A 2OR1L 1MSFC 1WPKA 2XGCA 4Z5DA 2CU7A 1K61A 1OSLA 2X48A 3TP3A 1UXCA 1PUFA 1DU0A 1TC3C 1BDIA 3GBGA 3DEWA 1LCCA 2EWTA 2X6OA 1OJLA 3KJXA 3LSPA 2R93J 2PUDA 2AUWA 3GTGJ 3IH4A 2PUAA 4L5EA 2Y9YA 1JT0A 2HDDA 3S14J 2BJCA 4BY1J 2O9LA 3CLCA 3CECA 3RKQA 2O8KA 2EQRA 2HXOA 3CQZJ 2WAQN 4FISA 5FKOA 4X4FA 3BR3A 3PM1A 3LSGA 3SFIA 2IVQA 2VKEA 1X57A 3FYMA 3A01A 4A3LJ 2PIJA 1UG2A 3BG3A 1DU6A 2W48A 4FTHA 3S16J 1IUFA 5HODA 1JJ6C 4G12A 4C2MJ 1ZKGA 2DA6A 1MNMC 3RZDJ 2L0KA 1ZR4A 4F8DA 2G0EA 2XSDC 2XIUA 2EZLA 4EEFG 1POGA 3ZQGA 4A3IJ 5GP9A 2LVSA 1QP7A 2MQKA 1ZTRA 1H88C 1WH7A 2PUCA 4JX5A 1IV6A 2AXUA 1T33A 1ETYA 1ZZCA 2IU7A 2OFYA 2LK2A 3HEFA 1WETA 4S0HB 1JKQC 2XB5A 1RZRA 1TWAJ 3TW6A 4X1EA 1BW6A 3GN5B 1ENHA 3MN2A 5FKMA 5K7FA 3ZQHA 2R92J 1DWKA 1EFAA
chains in the Genus database with same CATH superfamily
5EJCA 4WF2A 1A6IA 3RSNA 1I50J 5DCMB 3RYRA 3ZMDA 1YJNI 4BYYA 1XGSA 4P1WA 4IHXA 3L2VA 3QFIA 1SANA 5K7ZA 2E5NA 3I0TA 1PP7U 3DKXA 3SZPA 2BY0A 3BOQA 3SZGA 4AYBN 2EV5A 1UHSA 3B7HA 3CROL 4IOCF 3K4MA 2KIFA 1H9GA 2KIUA 4M73A 3DCFA 3IL2A 1QPIA 5E20A 1H9TA 2ESNA 2KPJA 4ESJA 4U0YA 1I27A 1QGPA 3ZQLA 5K5QA 3BTCA 4DOZA 4V19K 3RDIA 1SD7A 1E3OC 3ML6A 4ZJZA 3KZYA 2MC3A 3TRBA 3U1KA 2A68F 3E6MA 3CMAI 2FJ1A 3HHHA 4IL6C 1H0MA 5FLMJ 4RGRA 2VEOA 1XDSA 1PJRA 4HF1A 2EH3A 2A6TA 2HXIA 3DF8A 2L2OA 4PGHA 1YW7A 2IEKA 2B63J 1FTTA 1P9QC 1F36A 3RZZA 2PXUA 2A6HF 4NC6A 4PU3C 4ON0A 2O38A 1I3QJ 2FBKA 3SXYA 3HRUA 1YI2I 1YX3A 2NS8A 2KT0A 3OR1C 4CCJA 3Q9SA 1IRZA 4A3BJ 1ZAYA 3T1BA 5HVQC 3L1PA 1BR4A 3MKYB 1W4MA 1HKSA 5D4RA 1Z91A 2R63A 5FRMA 2LLWA 5HDGA 4OIRF 4CCMA 3RPUD 1DP7P 2H27A 3S1MJ 1GVDA 4GHJA 3FKIJ 3SYTA 3A03A 2X9DA 4E7SA 2ZMEA 4HF0A 1D8JA 1AOYA 2MLKA 1GT0C 1JKOC 1LE8B 3GFJA 4ZYDA 3EDPA 3C2GA 5EG0B 3QODA 3ZR8X 1Z21A 5H6QA 1W7PB 2XIGA 1A5JA 4F7ZA 1RZRD 2MEZA 2PMZA 1OCZH 3M8JA 4KJZA 3HOSA 4HDVA 4AYBA 4ZYEA 4OBMA 1FZPB 1KQ8A 1DUXC 3LOCA 4CCNA 2BZTA 4PDKA 3SZTA 4LK1F 4BXFA 4HX8A 3WU1B 3E5UA 5D5UB 1XWRA 2XKPA 3RTRA 3SEZA 1EJ9A 3UKGA 1ON1A 1QZXA 1GV5A 4W1UA 3GTJJ 2EZHA 1MBKA 2F2EA 2BY1A 2PFBA 2VIXA 1KZHA 3GZNB 3TW7A 4IO9F 1BI2A 3S15J 4KUMA 5H6RA 4CCLA 3GTOJ 1EH7A 2MA3A 2Y30A 3GX4X 3D5LA 2HYGD 2V79A 4BKXA 3F9KA 2WUSR 4BJ5C 2AQFA 3LISA 4BE1A 3ERMA 4EJVA 2DMUA 4ENKA 1DQUA 5FFZA 1YIJI 4CZCA 2XC7A 2KIQA 3BZKA 4X4CA 1P6RA 3FXOA 2CRGA 2DOAA 1H8AC 3R61A 1FSEA 1FWZA 1J09A 3IRQA 2RGVA 4M3DA 2ECCA 4NDWA 2GZUA 2RNGA 3Q5FA 2E71A 3IVPA 4WXHA 2WAFA 1HKQA 1HQ1A 2HPIA 2PXEA 4M74A 3ZGKA 4MCTA 2IVBA 1YRNA 2KRCA 3JTHA 4WX9A 3KP6A 4IHSA 2E34A 4HQMA 1F5TA 2BW3A 2MH9A 2Z1DA 3PJRA 4X6AJ 4EKGA 4ENMA 4EKIA 2ICTA 2QSFX 4HAMA 1O4XA 1MMGA 1O3TA 3AG3H 3IKVA 2N8GA 4J1WA 4WK8F 2VQLA 1G3TA 2D1HA 3Q0WA 3ISPA 1FT9A 3BR0A 1DULA 1IUYA 2OD5A 3E5QA 4C3JJ 1EV7A 4PJ0C 3I53A 2IS1A 1YTYA 3B6AA 3C7JA 2Y0MA 5DUKA 4ZZDA 3OYNA 1YX5A 3DFGA 4M72A 1BOBA 5D5VB 4CXFA 1BL0A 4XSZF 1EH8A 2M3AA 2B0LA 1ZZ8A 2ISZA 2DOFA 3CCUI 2PX9A 1NG6A 2ETHA 4CH7A 2LF8A 1TT5B 1OR7C 1SFXA 1X4PA 2KPMA 4L9TA 4BQOA 2QVOA 2KP6A 1LQCA 1BC7C 4ZC3A 3TL4X 3RI4A 2DT7B 3LSHA 2A07F 4U0VA 1FSHA 5JHFA 5IT3A 3OIQA 3FK6A 2RN7A 3ZMTA 2DFFA 2EA2A 3KP3A 5CYVA 1V5FA 2ZFUA 1ZZ6A 2JJ7A 2NYXA 3QPLA 2O6GE 3TEDA 3GZ6A 3OV8A 5CVVA 2CFOA 4BL0B 2MH2A 1M1EB 1MNEA 3F6OA 4RB0A 3ULQB 1HF0A 3VEPA 4R79A 4M3GA 2VOOA 4IHTA 2UUZA 5DV5A 1YJWI 1GDTA 3HOZJ 3JRIA 3GFMA 3W2AA 1L1MA 1BJZA 3M7GA 2FU4A 2PXFA 2EBIA 1ZGAA 1Y1VJ 1LKXA 5D8KB 3SCHA 4Q2JA 3IH3A 4IRIA 2VQHA 4ER0A 1ZZ9A 3CLQA 3DM5A 1GVJA 2VE8A 1D0YA 4AM3A 1XG1A 1JE8A 3OYCA 5ICEA 4K2EA 2PUFA 2LY1A 1ZARA 4DYCA 1FEXA 3NWSA 1TTYA 1I6HJ 5E18F 3EPZA 2K3FA 3B73A 3WGGA 4YFKF 4XLPF 4LB6B 4DIQA 1H89C 2XPVA 1UAAA 2JPCA 1ZAOA 1VZ0A 1XMAA 4MTEA 3V8LA 2R5ZB 1QHGA 1UCRA 2HVSA 3DNVB 3OYJA 5LD2C 2KEJA 2H1LA 1T0FC 3O2PE 4E7ZA 2ZXWH 3FHZA 5TJJA 4N9HA 2M8GX 5J3LA 1VQLI 3LFUA 2DI3A 4JCYA 2G9WA 3AG1H 3AG4H 1D0XA 5DD8A 2KZ8A 4D0PA 2CWEA 5F08A 2CMPA 3PSFA 2F4IA 2JQEA 1S7OA 1LQ1A 3FWEA 1X58A 1T2KA 2XVCA 3OSFA 1R63A 2VPRA 1JTXA 3V7SA 4PFOA 1V5EA 3ASNH 2XV4S 4I99C 2Z33A 4GYIA 2M87A 5IP9J 2FEZA 4L9JA 2MG4A 4UVCA 3HB9A 1CJGA 3ZHIA 1P92A 2ZJRF 4E4HA 2QLZA 4ZDLA 3ZQ7A 2PUEA 2PG4A 2ISYA 2H1KA 2IA2A 2I10A 3RIRA 4DGWB 5GAGJ 5EF6A 3K70D 4BJ6C 3E5XA 4ESFA 1FOXA 3G7DA 3K1NA 4LITA 4MQ9F 3P9CA 5LLQA 4CYCA 2OUMA 1O3SA 1DGRM 1I1SA 3RPUA 3ESWB 3H3ZA 4EGYA 1J5YA 5JVTA 3HOUJ 1LLIA 2JA6J 2IS4A 1X1AA 2UWMA 4HQEA 1B9NA 1SAUA 3F21A 3WGHA 2DK8A 1Z77A 1F9NA 4EQQA 2GBYA 1BR2A 3ABKH 5EYRA 3CMYA 3TKYA 4Z5CA 2AQEA 4QPOA 2QQBA 5J1UA 2XAHA 1OR7A 2RC4A 5BOXA 1X4OA 2ECBA 2HQAA 2ID3A 3CCRI 3EUHA 1WCMJ 3C2BA 4F52A 3BD1A 1MMAA 4BE0A 2LFBA 5F0FA 1R6RA 2V6CA 1ZQ3P 5J8FA 3K1PA 4A3FJ 3JSOA 1EA3A 2V9KA 2DXIA 3DPLC 1LUJB 3FDYA 4IQJA 4NDLA 2HOAA 2CUJA 3ABUA 1S9HA 4YG1A 2CW0F 2VQGA 1D1AA 2NVYJ 1Z1DA 2NXNB 1ZRDA 2FRHA 3S32A 1OQYA 1LDJA 2QWWA 1MW7A 2IW5A 2GXAA 1TQIA 3HOWJ 2XXPA 2ID6A 4HG2A 3M4OJ 3BG9A 5EZGA 3TDUC 3NZLA 3GFLA 1BW5A 2CFXA 4A5MA 4DQ2A 5GPCA 3BLYA 1OYIA 3F52A 4E7LA 2PXBA 2VLAA 3FXQA 4AUXA 3DBLB 3E6BA 4XN3A 3CF5F 5DM6F 1CQTA 5K1YA 4N9IA 4XBFA 1AHDP 4M9XA 1A36A 4XLNF 4RGUA 2RAEA 2OTLI 1TT0A 4Q47A 2JRMA 3FMRA 4NB5A 5LEJA 1O3RA 3CJRB 4V2GA 1MIJA 3PUBA 5EEAA 3FHNA 2FOWA 2L3DA 3PXPA 3MKLA 2IA0A 2BGCA 3K4BA 2V9PA 2R7OA 1T0FA 3G2BA 1IV8A 3JREA 3KP7A 3HPGA 4E6KG 4M6VA 1XTAA 3BG7A 4LIUA 2XCJA 5ERIA 1GV2A 3KZ3A 1JHFA 1TNTA 4XM3A 1NK3P 2NRAC 3H9QA 3I64A 2A6CA 3N97A 4JK1X 5DD4A 1ZG5A 2KISA 2ZC2A 1WH6A 2DA3A 1A04A 1YLFA 3S8PA 4YIRX 3ZP5A 4I6TA 1QQAA 1MDMA 4MLOA 3J80Z 2OQRA 3BCBA 4MQVA 1SEUA 1XB4A 2X6XA 4U87A 1GLNA 5FFXA 2X48A 1G4DA 2EFPA 1HQCA 3KETA 1OYYA 2YPRA 2K5CA 3HZJA 1IRFA 2FMYA 2HU9A 2W84A 3DEWA 3TGNA 1YO5C 3EUKL 1P4XA 2R93J 2VXDA 4L18B 2PUDA 2AUWA 3VYRB 3IH4A 4PUSA 4L5EA 1Z3YA 1W5SA 2DT5A 2RDPA 3H9JA 3CLCA 3MWMA 2LSOA 2HXOA 4YG2F 1YYVA 2WAQN 1ZG1A 2FBIA 5DTMA 3BR3A 2EIJH 1X1CA 3LSGA 2IVQA 5K5OA 1R5ID 1X57A 3DTEA 2Q2EB 4HYEA 2PIJA 3BG3A 1YG2A 1SD4A 2VJJA 3SQNA 1BR1A 4C2MJ 4ANJA 3R0AA 4AIDA 3MKWB 2EILH 2IS6A 4GO1A 1QBJA 2M7BA 4A3IJ 1R71A 2DJIA 2ZBKA 2AXUA 1T33A 1O3QA 1ZZCA 5A2QZ 4EM2A 2F4MB 2XB5A 2M0MA 3G73A 1TL8A 1TWAJ 2K3PA 3QU3A 2WWYA 4BDYA 4CSWA 1J75A 1QB2A 4G6QA 1ENHA 3MN2A 4LFUA 5FKMA 3ZQHA 2R92J 2XRNA 1IN8A 3ZMUA 3LQQA 3LA7A 3A9XA 2CSFA 3JRBA 2AWIA 3O9XA 4XLEA 3JRAA 3QYBA 3OYBA 1YW9A 2KZVA 2HS5A 1KQ0A 5C4JJ 3OYKA 1BDHA 3J7AY 1D5VA 3WHCA 1OMIA 3F8FA 4CYDA 4GDFA 4BU2A 2LTPA 4L5JA 2BYVE 2ODRD 1R58A 4HA8A 5CQGA 3CDIA 5F1JA 2BHYA 2LR8A 3CCQI 2F5FA 2IGOA 3A9YA 1VQ5I 1F43A 4G7ZF 3DU5A 3E6DA 4GGGA 1RRJA 2IUOA 1D1BA 1P4AA 3NWTA 3F8NA 1Z05A 4XICA 1Y39A 4PJMA 3GO5A 1MD0A 3RKWA 4A3MJ 4YG7B 4L9NA 3C1DA 1PRVA 5LGTA 2VN2A 3I71A 2WAQA 2PXQA 4RB2C 1I3AA 3OYDA 3ECHA 4FBIA 2ZMEB 3AL0C 4NC8A 5JI6A 3WGIA 2BXZA 1PRUA 1ZGJA 4A3CJ 5HS9A 4A3EJ 1ZK8A 2E35A 2DMPA 2W1OA 2VC0A 1XD7A 1ZGWA 3H5NA 2V1XA 3QRFF 1IW7F 1QRYA 2W00A 4YELA 4Y17A 1C0WA 4B43A 2E1NA 5CPRB 2ZFWA 3ZMZA 2JVHA 2DYSH 1LCDA 1WHUA 4A6EA 5FB2A 2PXLA 2OF7A 3DBHB 4E7KA 2M8EA 1QHHD 1IRGA 4BUPA 2IGNA 2LY9A 1RKTA 4UV9A 4UUSA 4I2OA 4IZZA 2R7FA 3OYGA 1PERL 2ICPA 1X1PA 5D8LB 1SMYF 2O4AA 4D9JA 1ERDA 5D5XB 1QQIA 1QO0D 3K10A 2DA4A 3ZCOA 1WRJA 3RQIA 1R69A 4N4NB 3O6BB 4EJUA 2K9MA 2ZO4A 4EJWA 1XMXA 2O3FA 3RKXA 3HM5A 4CICA 2MBFA 2I5UA 3H3VK 1RKWA 4D1QA 2QUFA 4C3IJ 2ZMEC 1MNDA 4J19A 4A69C 4LOCA 1DP3A 1YIOA 1R00A 1HA8A 3A4CA 3OIPA 1TBXA 3ZQFA 3OMTA 3IUOA 2HINA 4UV8A 3L2QA 3HHGA 1B4AA 3BPXA 1MMNA 4RM3A 1YRNB 2CUFA 2NVUB 2FJRA 1SFUA 1FC3A 3HPHA 4WXDA 1I39A 2HQ5A 5KAIC 4B44A 1JUSA 3HJEA 4P9FA 2BW3B 3J81Z 1ETQA 1ON2A 3NAUA 4A3DJ 2IRFG 1KQ9A 2VBWA 5J4YA 3OS1A 2HDCA 2K4JA 3A02A 3OQOA 1JUPA 2CUEA 4P55A 4I76A 2WY7Q 3G3ZA 2OA4A 2DMTA 4NNJA 4Y7NJ 1L3LA 1ZLKA 2XAJA 4KIGA 3J80K 3T5XA 1SFEA 4ABZA 2X6YA 1YITI 3KP5A 4RS8A 3RJPA 1VQ7I 3OP9A 3H92A 2OTJI 2GIVA 2MYSA 4XSXF 1SFOJ 4KISA 5GAGi 5M3FJ 5KNLA 1VQ9I 3K0LA 3ZMSA 1BBYA 4RLFA 3OS0A 2VT2A 3ZHMA 3PL8A 3VK0A 2XKOA 1FOWA 4HRIA 1IXRC 4Z5HA 5LHGA 1WZ2A 1R23A 1R1VA 3EUAA 3KFWX 2JVLA 1LJ9A 5FLXZ 3Q0VA 4RA2A 3JSPA 4QPQA 2YX7A 1JGSA 4ENNA 1V55H 4ER5A 2XJ3A 4ENJA 2PJPA 2GAUA 3GLLA 2H6CA 1UJ8A 5IYCJ 1VTNC 4C2UA 1UMQA 3GEZA 2VL8A 1CF7B 4XKVA 4X4EA 5FKNA 4UUVA 2XDVA 1E3PA 5JLXA 2L5QA 4A5NA 3Q3SA 4IVNA 1BI3A 1W36C 4WXCA 1IAWA 1WJCA 2WA0A 3EETA 2CROA 5DRTA 1FYKA 4I8TA 4EGZA 2IGMA 2TCTA 5ICGA 4Y52J 2GRLA 4I7HA 2LDUA 4OIPF 1ONVA 2CJJA 1ZYRF 4N0BA 4BGDA 2A3SA 4FX0A 5A2QK 1IG7A 1FBSA 4BS9A 3W2VA 1G3YA 3DXJF 3F8BA 1JHHA 2UZKA 3VSLA 2HFHA 2QGUA 4ITVA 2HR3A 1KONA 1K7AA 3R1FA 2D1VA 3P7NA 5JUWA 2KRHA 2WBMA 1QPZA 3HTUA 2X0LA 2E60A 3JRFA 1MGTA 1ODDA 5L3GA 4ZZLA 5DUIA 3QOXA 4YG4A 1ETWA 5E3OA 3IHUA 1VFCA 5ILUA 1U9OA 5CVUA 1FJLA 4IPAA 2HEOA 2M5WA 4ZYAA 5DTRA 1YE9A 1JTYA 2E2IJ 2CH0A 4M3BA 1ITYA 1W7PD 4HPQA 1OFCX 5IYBJ 3U9GA 2STWA 2L9NA 3EUSA 5LBQA 1FIPA 2O0YA 1P7IA 3MKZA 4X4DA 1ZPQA 1N25A 3KYCB 4IKFA 1UELB 2K4BA 1QVTA 1JGGA 2QKMB 1K79A 3VWSA 2OZ6A 2VC1A 3C2HA 2M45A 4U7BA 4I02A 2MSYA 3IWZA 5FJ8J 4D5FA 4WVLA 3CMEI 5C4XJ 2DMNA 1IF1A 2VUMJ 4EQZA 1RUOA 1S8NA 2NOGA 4UB8C 2STTA 3BDDA 4KNYA 3I4NJ 3DU6A 2B5AA 1ZG3A 2BNOA 3M1EA 1TQMA 2F4OB 1K4TA 3GTMJ 1XSXA 1XX5A 1BIAA 2JRTA 3KLOA 4BAYA 4YIFA 3AFHA 3HRSA 4J1XA 4DE8A 3U3WA 3OSGA 3GZCA 4DZPA 1SVMA 2LYPA 1T08B 3LFPA 1Y8RB 1E0EA 4OB4A 2FMLA 2VBYA 1AKHA 3QF3A 3DTKA 5KVRA 3CUOA 2H8RA 2M7AA 4CYCB 2Y0SN 1A6QA 2NVQJ 1VPWA 4IWRA 1ZZBA 1LEAA 2JTVA 2P7CB 2R7VA 2X1CA 2IPQX 5DSXA 2AO9A 1KU9A 4Z59A 2M0CA 3QWLA 4D7NA 2QENA 4IA8A 2XF7A 4J01A 1X3UA 2MD5A 3HRTA 3U2RA 3IP4B 4C2TA 1TP4A 1X2MA 4WWCA 2BEOA 2LMDA 4KIFA 3LSRA 4GFBA 5FD6A 4ER3A 3H35A 1CGPA 4R8HA 1HDDC 2EV0A 4CHUA 3J81K 1S3JA 1T98A 4FE4A 1B8IB 1DPRA 4A0XA 1FX7A 1W0TA 1IN4A 4IJAA 4HSTA 2XI8A 2F48A 4X4HA 2FBHA 4IHVA 2EIKH 3H36A 4BXUA 3JR9A 5E3NA 2PXTA 4O3MA 1QVUA 1LFBA 1O7FA 3LA3A 3M3YJ 4YRVA 1F1ZA 1V3FA 2IXSA 2ZB9A 4LG3A 5TISC 2GQQA 4RB3C 5C44J 3VWBA 2GXGA 3CMMA 4KMUX 4LLNA 2O03A 5F27A 4X4BA 3KP4A 1WI3A 1MMDA 3E97A 3I59B 4GXOA 3I56I 1RZSA 5K5RA 2LY2A 1MBEA 3FMYA 3LSJA 4H4KC 4Q5SF 1EF4A 2X85A 3QAHA 1T39A 1VNDA 3G0TA 4O5VA 1WH5A 3EUHC 4GYGA 1U2ZA 5FLXK 2DFEA 4FN3A 2Y0SA 1HKTA 3BDNA 2DODA 1WWXA 4RDUA 3OYHA 3GYHX 3K4NA 5LRRA 2KL4A 3WTUC 2LYJA 3VYTB 3MZ8A 4G94A 3GTPJ 3DLAA 4HBLA 2EPFA 4ESBA 5L3BA 2HGCA 1HCRA 1NERA 2J5PA 1VI0A 2JSPA 3WTTC 4RGXA 4ZDOA 4L5IA 2VONA 3BWGA 3CDHA 3QOPA 3JXBC 4BY7J 4Q4ZF 3TOBA 5B1BH 2R5YA 2CV2A 1X2LA 1KU3A 4MGRA 2Q8KA 2L7ZA 5EDNA 3KXAA 3I9V2 1YSEA 2DA1A 5GTHC 2HYFA 4XRSA 3O8GA 2CS3A 4S05A 1QQBA 3FX3A 2A69F 4UVBA 1JKRC 1MDMB 4UNOA 5L3DA 4F92B 4DE9A 3M8EA 4HW0A 4TV7A 3L2CA 2F5EA 5KK1A 2W82A 2ICWG 3WG9A 1LDDA 5BPIA 1ZUGA 4BDZA 3QYFA 1R22A 3D5RC 2VJ5A 2O49A 4KIBA 1V4RA 1FY7A 5A7LA 3I4MJ 4BNCA 2HKOA 2NAZA 2GOMA 3DLLF 2R1JL 4MNUA 2PXKA 3E3VA 3A0HC 2BBYA 2PLYA 4I6ZA 5HLGA 2VPLA 2GRMA 2K7LA 2M2EA 5J1YA 4M6XA 5IPAA 3BG5A 1YQAA 3TQNA 1IXCA 5FKKA 2PN6A 4MHGA 2ME0A 3FXMA 1T56A 3KEQA 1LVAA 3TFLA 2OR1L 1OCCH 1TW2A 2JZYA 2KMUA 2CU7A 3D0SA 5HLTA 3DTIA 3M07A 4Z5DA 4L0YB 2GA1A 4DBQA 2A6EF 1UXCA 1TC3C 1BN5A 1Y0NA 4UB6C 1ZH5A 2L02A 2D2WA 1LCCA 2EFOA 4OIQF 5DDGA 2R3SA 1Y56A 3JW4A 3K6GA 1QA6A 2XXQA 2Y9YA 3GW2A 3S14J 4BY1J 3WE3A 2EQRA 3GWZA 2L1PA 3LA2A 3IAM2 3REOA 2RQQA 2EK5A 3VODA 3PM1A 5TRDA 2M4KA 3GFIA 2VKEA 3LSKA 4XQFA 3DKYA 4HLXA 3VDXA 3FYMA 3A01A 1YHQI 3O3KA 4XMYA 4KYWA 2F5VA 4A3LJ 1HC8A 2VKHA 1DU6A 2W48A 3HC7A 1IUFA 1X3ZB 1DPUA 3OL3A 2DA6A 1UFMA 4L9VA 1SAXA 1ZR4A 1MNMC 4F8DA 2Y48A 3WU0A 2XSDC 2XIUA 2JT1A 2IVMA 2LYCA 4EJOA 4XORA 3I5UA 2O8XA 1POGA 2QYOA 5GP9A 2LVSA 2EB7A 3E1SA 2Q0OA 1WQ2A 1WH7A 3OY9A 1IV6A 4JBAA 3V7CA 2FNAA 2LK2A 3B02A 2LREA 1HSJA 1RZRA 3K1MA 1YJ9I 4KA4A 1FYMA 3K4LA 2QZ8A 2BVMA 2F5CA 1DWKA 2L4MA 5K7FA 3ZRGA 1K6OA 3IH2A 3R0JA 5HDNA 4U88A 1FOKA 3S2WA 4ETSA 5GTIC 5KCMA 3HOTA 2MXDA 3SDGA 3LMMA 3PSIA 4W97A 1TW3A 4HV6A 1JH9A 2VJ4A 2XB0X 2DCEA 3DEUA 2ZJPF 1AA7A 1RR7A 5JFRA 3OYAA 1XGNA 2OQGA 4PU4C 3GTLJ 3W6JB 1RIOA 1LFUP 3P9KA 1TWGJ 5J8CA 4YARA 2FX0A 2PQ8A 2KDZA 5CLSA 3OOPA 5F0HA 1YOVB 2XGEA 2VI6A 3CF2A 3ZQCA 3C18A 2LYKA 2HZDA 3NRVA 3GN5A 1OLTA 3K4CA 4UUSB 1IGNA 2CYYA 9ANTA 1QU3A 2ZXHA 3BTIA 4DW6A 1BI0A 1FLIA 3V7RA 5JHUA 1REPC 3BR2A 1NW3A 4BACA 1VQ6I 2QKLB 3V4GA 3S8QA 2PI0A 1Z3XA 3E7LA 3RCOA 2W25A 2G7HA 5J1RA 3PE5A 3K2ZA 4LIVA 2IP2A 1GXPA 3BR1A 5IY5H 3FISA 3Q9VA 2D5VA 2CUZA 2PXVA 4IX7A 3VYSB 3JXCL 4Z58A 3GCMA 2XAGA 3VB2A 4CDGA 3ASOH 3BTJA 1V5GA 2E1MC 5E3LA 3K70C 5D5WB 3W3CA 4XOPA 3CO7C 2R7ZJ 1SD5A 4AC0A 2AHQA 1U5TC 3OWQA 2XPWA 2D45A 2F5DA 2DQRA 2TDXA 3WTYC 1K78A 3K7AJ 5FO5A 4DYQA 1XCBA 3MZYA 3E6CC 1OCRH 1OCOH 2FFHA 3CCYA 2LD5A 1N75A 3ONQA 2EJRA 3MVPA 4C30A 3W2WA 5BQTA 2V1UA 2LLVA 2E7WA 1Z7LA 2E7XA 4UHTA 3LAPA 1QP4A 1U8BA 2JA2A 3CJNA 3F0CA 4BE2A 1GUUA 2L4AA 2KJBA 2XF6A 2VASA 4L0ZB 2MGQA 3BROA 4BEHB 3ZOBA 3J7YJ 3IV5A 5ED4A 1R4MB 1RC9A 4HNUA 1FNNA 1P7JA 4OWRB 5EEHA 2B7EA 2VKVA 2R4GA 4A0ZA 2PUBA 4KFCA 4FASD 3R4KA 3LSIA 3I55I 3DPUA 2L7MP 3OQMA 2JSCA 2NVXJ 2HDWA 2XAQA 4Y4RA 3UNGC 3OMYA 3L9FA 2E2HJ 2R7DA 4I98B 1WKMA 1W1WE 2OU2A 4M9ZA 3T8RA 3HOVJ 3FBNB 3EYIA 4F55A 1APLC 2I8DA 1D1CA 5L3FA 2JVGA 2JUGA 5B5EC 1MBGA 2R0QC 4AIKA 2KIMA 5AONA 1K6YA 2P8TA 4E7JA 1WSUA 3RQ4A 1EKEA 4AWXB 4HNVA 3H5TA 4RLQA 2CV1A 3AL0B 3OKZA 3BT9A 3OS2A 2P0WA 1KYZA 4LLLA 3HZIB 2EINH 3SEQA 2AW6A 3Q0UA 1YS6A 3KZIC 4FE7A 2BOLA 5HS7A 5E79C 2VE9A 2H6BA 1Z7UA 4U0WA 1WH8A 3HGYA 3JCUC 3HOXJ 3VFZA 3FIWA 3BZCA 1MH4A 5TGTA 1TWFJ 2XAUA 2P5VA 3JRCA 3GXOA 2ELJA 2Z16A 3TO7A 2XPUA 2KEKA 4JX6A 2DDAA 2E1CA 4A93J 4O8BA 3ZPLA 2CQXA 1LEBA 2JN6A 3H5RA 3ELKA 4IRGA 2DFHA 1ETVA 4EJTA 4EATA 4HOBA 2FA5A 3PO2J 2MD0A 1NHAA 2P6TA 2MLGA 1VQ4I 3BCAA 1ETXA 3BPVA 3V42A 3MD2A 4MEYF 4FX4A 5K7HA 4XKCA 1N78A 3P5JA 1O57A 2DU9A 2QF7A 2Z3YA 2ZJ2A 2MC4A 2L01A 3PNYA 3K4KA 3H0GJ 4DNCA 1IC8A 1HDPA 1L0OC 3BS3A 3S2HJ 3HBLA 5E8GA 3SFZA 4A0YA 4PU8A 3M1CA 4P5OA 5F04A 3CCJI 1IN5A 1B9MA 2WTEA 3I3LA 4FQGA 3R09A 2UV1A 4OAYA 5K98B 1USSA 3ERED 1U5TA 4G8XA 5AIQA 2E2JJ 1VQOI 5F0CA 1MBJA 2YR2A 3G1OA 3IC7A 3DV8A 2K9LA 3EYYA 4II3A 2LLKA 3HKZN 1J7KA 2O5RA 2HCNA 1OKRA 3WTWC 4KN4X 4YIIA 1B72A 2PMHA 3C3WA 5CKTA 1XGOA 3PQKA 4C9YA 2PPXA 1R1TA 3VPRA 1Y1WJ 5IT9Z 2DW4A 1KU7A 1R4NB 2LC2A 1N77A 2VT3A 1IN7A 1AKHB 2OPTA 5LHIA 4S04A 1Z0XA 2LKSA 2W4SA 4LK0F 2Y2ZA 1S7EA 3CTAA 2V26A 3HSEA 1GHCA 4FT8A 5M5WJ 2FF4A 2OZUA 3A0BC 2MABA 3GUDA 2XF5A 4Y33A 2WAEA 3O8HA 2EIMH 2Q1ZB 4BXXJ 1OPCA 3QU6A 4A3GJ 3VSKA 4MFEA 1FP1D 3BP8A 4IHYA 3CUQC 3ME5A 5EZHA 3BZ6A 3FKJA 1KYWA 3WG7H 5GPAA 4NC7A 5IOYA 1J59A 3LWFA 5IP7J 2GXBA 1ZLJA 5GAHJ 2LNBA 2Y75A 3N05A 5CQEA 2QSGX 2CQQA 1MBHA 4IXAA 4BBRJ 4CUGA 1OCTC 2WADA 2K9QA 3R60A 3U21A 1Z6TA 1W5CC 4AD9A 2GIZA 1JKPC 3B6CA 4DBRA 2JK3A 3HSRA 4KN7X 4QWQA 4AU7A 5EEGA 3SR4A 3ECOA 3F6VA 2R7SA 2UXXA 4F3QA 1SC7A 4KITB 4B3AA 3BQYA 2W85A 3ZQQA 3KLNA 1LNWA 1KGSA 2W57A 4GQMA 2K40A 1ETOA 3HKZA 4Z2YA 3S1RJ 2R7QA 3PNTA 4ZYGA 2IA1A 2LYSA 2CO5A 2V1NA 1FBQA 2COBA 4U7DA 1HSTA 1O7LA 2LKXA 3QP6A 1QZZA 2V4JC 3IWFA 4M3EA 1WJAA 2RNJA 4G6TB 2NS7A 3TDZC 3CD6I 4OINF 1MKMA 4B48A 1EH6A 2QM3A 2L49A 3BR5A 3ZKCA 2H8WA 2CV0A 1MJAA 4MFDA 1X1DA 3R6SA 5E1WA 3L09A 3P9IA 2BVLA 1BM9A 2WV1A 4Y3OA 1VQMI 2A05A 2QBYA 4PJNA 3OL4A 1RPEL 3FK7A 5KHDA 4E7IA 3TBIA 2R7UA 2YX4A 5DTDA 3WTVC 2R5YB 4NQWA 1Q1HA 4G7OF 3KEYA 4HNTA 4C3HJ 2K27A 3NARA 5D6FA 3M8FA 2COMA 3SCGA 1ETKA 2M34A 2PMZN 1F4KA 4CCOA 3MZHA 2OAZA 1WJFA 2RREA 1XGMA 2OCCH 3S1NJ 2X51A 3OIOA 3JRHA 3LNQA 1HW1A 1SVOA 1ZN2A 1XN7A 1QP0A 1T6SA 3PO3J 3NXHA 2DN0A 3MCZA 5ICCA 2JA5J 3T8TA 2CQNA 5BS6A 5DTQA 2FSWA 4V2FA 5HS8A 1PNRA 4BHPA 2HOTA 1HBXG 2P4WA 2IJLA 1JFTA 2ZNZA 2XRLA 3BR6A 3WTZA 1HW5A 3NROA 4KMFA 4IF4A 5C3EJ 4YEJA 1WI9A 3MQ0A 2A5YB 3WTXC 4NUBA 3F6WA 2CW7A 3ZXSA 2DA2A 1MBFA 4EV0A 4CO8A 3CUQA 1FIAA 4RM2A 3CCLI 2CQKA 2CW8A 3L2WA 2PJRA 2ELKA 5EGOA 1ORKA 1UHMA 2LKPA 3SCFA 3GZDC 1U6GA 4XR6A 2FE3A 2QCOA 5M5YJ 3ZQIA 1Z67A 3HUGA 4JOMA 3VOEA 3JRDA 2RV8A 2GM4A 4A12A 1ADRA 4MIMA 3NQOA 4X4GA 1QZYA 3GF2A 4DZJA 5FKLA 3H9GA 1RIOH 2DK5A 1XC5A 1LFPA 1XSVA 2HVQA 3EQLF 1JWLA 3NDBB 2A5WA 3LQRA 3QOEA 3A01B 4RAYA 1MSFC 5IT9K 3TO9A 5CJ9A 4CA0A 3L00A 1K61A 2CQ7A 2R7TA 3TP3A 1PUFA 2NNYA 1BI1A 3OWTA 4EZIA 1JI8A 2KKOA 4E7HA 3GBGA 1MJBA 2M1BA 2EWTA 2LBFA 2X6OA 4OMZA 1FYLA 1A31A 1BOAA 1R5HA 1IZ1A 3G4SI 2OC6A 3CJTB 4BHBA 2JQ7A 2PUAA 2BJCA 1S5LC 1SD6A 1G3SA 2DPUA 3CECA 2O8KA 1USTA 2ESHA 3HRMA 3SX0A 4FISA 5FKOA 3MEJA 4X4FA 1WJDA 4O6JA 2L9SA 3CZ6A 4LG0A 4A2UA 1U0JA 2J7UA 3WODF 4I0AA 3GUUA 1UG2A 1J0RA 3RPQA 4PFPA 4XRFA 3S16J 5HODA 1VQNI 1JJ6C 5D4SA 3RZDJ 2L0KA 2GA2A 2ZXJA 2G0EA 3HIFA 1LPQA 2EZLA 3ABTA 4MTDA 3ZQGA 3PIPF 1HW2A 3DWLE 3JAMZ 1BJAA 1ZTRA 2VQCA 2RKHA 4EVIA 1Z9CA 5BMZA 1H88C 2MQKA 3I4PA 4JX5A 2IU7A 2OFYA 2WY8Q 2K02A 2X4HA 1WETA 2KFDA 2UXNA 5FGMA 3V8KA 3TW6A 1WJ5A 4X1EA 1BW6A 3CO6C 3GN5B 1EFAA 4KICA 1IO2A 1FP2A 3FXLA 4IQ4A 1UHWA 4G9YA 2DA7A 2FOKA 1R5GA 2JMWA 2H94A 3ZN0A 4LJZF 1I6XA 4XLHA 4BQQA 1IRXA 5J4VA 1AU7A 2WIUB 1FBUA 1E2XA 5M5XJ 1HXDA 3DKWA 2IBDA 5ILVA 5HLIA 1NEQA 4IOAF 2NOJB 1RNLA 1HOMA 3QPHA 3F8CA 4PCQA 2M4HA 1RESA 5AIPA 3OOUA 1NG7A 2FQ3A 1V54H 6PAXA 2W7NA 2A61A 1WFXA 4GRIA 5E8IA 2V7FA 1D5YA 1NK2P 1MFQC 2PXPA 3KIOA 5JR3A 3HSFA 4KT6A 3X2QH 2KLOA 2BE5F 4RBOA 3G1LA 1S72I 5DCMA 1ZELA 3MFKA 2JUCA 1K78B 4CCKA 4HLYA 2P81A 1Y6IA 1FTZA 1XCVA 2HNHA 1Z6RA 2E5ZA 2EA4A 4HDUA 4RMNA 1CF7A 1PUEE 4IVZA 2PE5A 2XASA 4FCYA 1QZEA 4OIOF 3GZDA 1MJ9A 2JA7J 4I6RA 4CGZA 2QA4I 4G6DA 2M9HA 5DCFA 4X4IA 3KL4A 2ZJQF 3S3OA 1G59A 4GCVA 1E17A 1WVRA 2XAFA 1G2HA 2ZKZA 4EM0B 1IN6A 2QQ8A 1RUNA 4IHWA 2DBBA 3G1MA 2Z99A 1TNSA 1QPMA 2K9SA 2AXTC 3AKZA 2LP0A 2MW8A 3LFKA 1R49A 2O61A 2IT0A 2X1DA 4F93B 5HNHA 1FMVA 1SFKA 3KCCA 5L3CA 3OYIA 2PXDA 2OCEA 3FXJA 4II2A 4AIJA 1OYWA 1X2NA 2ADUA 2FUG2 3QQ6A 2P6SA 2XROA 2FXAA 2P7VB 3G5GA 1R36A 1RETA 2ZSIB 1LVKA 2PMUA 3G71I 3WE2A 3MAJA 4A3KJ 2FQ4A 3ABLH 2V9VA 3MEXA 1NTCA 2DLLA 3HXLA 2AXZA 5DS9A 2DYRH 3CC2I 2L7FP 5F6FA 1YW8A 2HQNA 2OBPA 2V1DA 5BPDA 2BY3A 2DAOA 1ZS4A 4ZTFA 2VJIA 1D3YA 5GAHi 1K83J 3BJ6A 1BC8C 4A6DA 4XLFA 3RYPA 1WJEA 3K4JA 4D7MA 5LEKA 1J9IA 5E3MA 3KYDB 1LDKB 3FM5A 4AVZA 4A3JJ 2DJNA 1OCPA 2DO7A 3K9TA 3HDDA 1IDZA 4M3FA 3TO6A 5J47A 3H0DA 1LE8A 3SDBA 3CP2A 4RB1A 2HYJA 3V8JA 2BY2A 5EG0A 2HKXA 4Q48A 1T95A 3L2RA 1D8KA 3FMSA 2VODA 1MZBA 1W7PA 4HV5A 5IOZA 5IYDJ 2RVCA 3J7ZI 1ACIA 1FMWA 5LGNA 1DDNA 1FOYA 4XK4A 3QQAA 1FPQA 4IRHA 4LMYA 2O7OA 4XRMA 4WCGA 1W0UA 3IAS2 2V3CC 1VF9A 3CCMI 3IRRA 2XSJC 1Y7YA 2JCGA 4AIHA 4P9UA 1UZCA 3F72A 5F1RA 3PFYA 4RAFA 3D1NI 1JJ8C 1Y8QB 3LSTA 2GOXB 4XRSG 1I5ZA 1TZLA 2P5KA 2BV6A 3S2DJ 5B3SH 3F22A 5J40A 4XOTA 1XS9A 1IXSB 1ZREA 2YU9J 2HTJA 4HRAA 3JXDL 2WB1N 3QPSA 2Y31A 1VQ8I 5L3EA 2L9RA 2E1MB 3L2UA 2KZGA 3U1DA 3A9ZA 1UG0A 3J7AO 3GTQJ 1U8RA 1U5TB 1NH3A 2DTRA 2G7UA 2HPMA 5DEQA 4BHCA 1SMTA 2GWRA 5DT2A 1GXQA 4UXNA 3JAMK 2KQRA 3HG9A 1AWCA 2VXZA 5GADJ 2GZWA 1ZZ7A 1JXSA 3K69A 2EBYA 1T38A 3UFDA 1B72B 1R9TJ 3TELA 1B6AA 4FHTA 3WU2C 3KYLA 3CCVI 1JUMA 2LG4A 1B8IA 2L8NA 3DP7A 5CVIA 1IJWC 1R7JA 3OQNA 3FF5A 2LRDA 2PUGA 4BBSJ 1WGXA 3S3MA 1MSEC 1ZRCA 2ZXIA 4ZTJA 1LB2A 2OV7A 1S6LA 3JRGA 2QQ9A 4ZH4F 2AXVA 1STZA 2L54A 1R1UA 2RQPA 3KZZA 3A1YA 4UUTA 3FMQA 3GBFA 3CJQB 2TRTA 3KE2A 4NHJA 4B4CA 3I59A 4B1RA 3CCSI 2P5LC 1WIZA 1U2WA 2XHKA 4I01A 1A35A 2VOPA 1W5TA 5DRYA 5BNGA 2DTZA 3WTSC 1TWHJ 3KPHA 3PUFA 2DOEA 1SQ8A 3ROUA 1XPXA 4PZJA 2E1OA 2YSRA 4LGWA 3KP2A 3F51A 3TP0A 1DW9A 4QLCU 4M9SA 2WB1A 4IEJA 2PEXA 4HEA2 4H0EA 2YS9A 2BHZA 1G8XA 3HOYJ 2VBZA 2YUSA 2M4GA 1IDYA 4PJJA 5FROA 4OAZA 2DQLA 5ILSA 2CG4A 3N4MA 1POUA 3TEPA 4RAGA 4E70A 4XN0A 4XIDA 3GMEA 4M71A 3CC4I 3QWGA 3I54A 3CDLA 2R7WA 2HOEA 3M9LA 1HLVA 2LH9A 3MMYB 2KDOA 4HX7A 4OMYA 2H09A 4PGGA 1LMB3 3KX2A 5E1XA 4CZZA 3BG6A 3IKTA 2QEXI 1VQPI 3GLXA 3FXKA 3AG2H 2ZCWA 1P4WA 2YU3A 4RAZA 3DEEA 1UB9A 2IAIA 1Q1VA 3COAC 4XONA 1TWCJ 3VYUB 1X1BA 3FZVA 5LFAA 2LCVA 3PNVA 5JLWA 3TOAA 2KJCA 2VBXA 5CVJA 2X1EA 4D5CA 2V6EA 3LSMA 2W24A 2DT6A 2K85A 2EF8A 3S17J 4PJLA 4YFNF 5LHHA 3WHBA 5B66C 5LGUA 3H1CA 4BQAA 4I6UA 4KT5C 4P96A 4LB5A 2QBYB 3FXUA 3QP5A 3TMOA 4B3XA 4QIWN 2MFZA 2DFIA 3GVAA 5J6XA 3BJOA 3CP8A 2R5ZA 2HVRA 1MH3A 4JYKA 2E19A 4ZYHA 5LRSA 1Y9QA 4NQWB 2IS2A 2HWVA 2L7KA 1X3WB 1U78A 3ZMVA 4JX4A 4DJAA 2Z9OA 3FBIB 3F3XA 4AVPA 3BTLA 2DMQA 2EZIA 3KEOA 2XXAA 3HTSB 2Y69H 2DA5A 2JPBA 3QYXA 1MMSA 4Y42A 2K9NA 4XKWA 2HOSA 1KU2A 1QNTA 1B1BA 4JP0A 2BNMA 2NVTJ 5D6EA 4PU7A 1U9NA 3DQVC 2HCSA 1ZVVA 4ER7A 1Y0UA 3CC7I 3W6VA 5FLVA 4DYRA 2Y9ZA 1SVLA 4BH9A 1D0ZA 4B09A 4MCXA 3AAFA 1XMKA 1ZR2A 5H20A 3QYEA 3FM3A 5HDKA 4OU0A 4HZFA 2KHMA 2LYRA 4JCXA 3E0JB 3GTKJ 2R7XA 1B0NA 2XGDA 3OYEA 1WJBA 2HZTA 4I0BA 3PIOF 5FRNA 2HSGA 2NS0A 2CSOA 1RPWA 2CGPA 2EZKA 1U3EM 2YBDA 3K2AA 3OR2C 4QSHA 1S29A 4I09A 3CUQB 4MO7A 2IVGA 1TQPA 1DGWY 5E17F 3HYIA 4LLGF 2IGKA 4BQNA 3G6EI 2DPDA 4NBQA 4Y13A 2PJRB 2VB6A 3FYAA 3CCEI 1JT6A 2ZNYA 2J7WA 5EGOB 2JWTA 4FETA 3JTGA 2XUBA 3PQJA 5CVRA 1YFHA 2EFQA 2AXLA 2QSHX 4QTRA 1J2XA 1JFSA 2GLOA 4F91B 3L7WA 3HUGB 4XKBA 1PRAA 4EK9A 1I1GA 3BY6A 4X0GA 3GZ5A 2LNMA 4JQDA 1ZHFA 1RZ4A 2FD5A 2WC2A 2F6CA 4N4OB 3F23A 4HF2A 4BJTA 5B1AH 1UXDA 3RZOJ 2HI3A 3NEUA 4B8XA 3SJMA 3DBRB 3BQZA 4HSRA 1B59A 2KEIA 5M3MJ 3S1QJ 3HGGA 1UTXA 2FNPA 1PUFB 4XLAA 2XGXA 1BA5A 3SHFA 4M6YA 4YBAA 2ACJA 3HL2A 1P2FA 3A2KA 2EWNA 2L9VA 1RI7A 3CLOA 2LBFB 2BNNA 2K86A 1ZRFA 2AS5F 1PYVA 1ULYA 2LYQA 3LQXA 1OISA 3QOWA 2Z5UA 2X6WA 3ZN1A 2JA8J 2IV1A 2LYLA 1W36D 1PDNC 5FD5A 4JQFA 2HFZA 5HOOA 5IP6A 1YS7A 4LG0B 3PFIA 3MLFA 3H3UA 4UVAA 3BJAA 4J00A 5HLHA 1RR8C 2ME6A 3OYLA 4EMSA 2M30A 2BXYA 5HNFA 1WPKA 3H5AA 2XGCA 1OSLA 2LOOA 4PSXA 1T8IA 2QQAA 2DDBA 5KAFC 2OJED 3RKYA 4R1HA 1DU0A 3UR3C 1BDIA 1XDUA 3OYFA 4MEXF 3DPTA 5F64A 4ZDPA 4G7HF 1OJLA 3KJXA 3ZPXA 1E3HA 1X19A 4Z6YA 1PVEA 4EM1A 3LSPA 1K4SA 4XL9A 4UY8I 3GTGJ 1S7AA 3BC8A 4HX4A 2HDDA 1JT0A 5E1ZB 2O9LA 2J5OA 4ASNA 1G3WA 2ZSHB 3RKQA 2PBIA 3CQZJ 2HQRA 3CESA 4XLCA 5DM7F 2C6YA 2R7RA 3F8MA 2ELHA 3SFIA 3UWPA 4YFXF 4KDPA 3T0YA 1PP8F 5DYMA 1VQKI 2EFNA 4XNFA 3D5SC 4PK4A 4FTHA 1KA8A 5JVGF 4OOIA 3FXRA 4G12A 1ZKGA 4Y15A 3OYMA 3S93A 4BEHA 2VKDA 4ER6A 3I58A 5ICFA 4EEFG 2Z2SB 3LAJA 3S3NA 1XSDA 3ABMH 2LF7A 1QP7A 2PUCA 5H2FC 1TLHB 1ETYA 2WV0A 1BIBA 4PSWA 3HEFA 2B9SA 4S0HB 3W6KB 1JKQC 5GAEJ 3M9AA 1G6NA 3QPTA 4B47A 2HTSA 4RGSA 2E36A 4LD5A 2EFWA 2NNNA 3LL7A 2KRFA 2EV6A 2Q2EA
chains in the Genus database with same CATH topology
3IH2A 1A6IA 1I50J 2DA7A 2CSFA 3JRBA 4IHXA 2AWIA 3JRAA 3O9XA 3SDGA 1SANA 2JMWA 4W97A 5C4JJ 5K7ZA 1JH9A 2XB0X 1BDHA 3WHCA 1RR7A 1AU7A 4AYBN 2WIUB 1UHSA 3B7HA 2LTPA 4PU4C 5M5XJ 3GTLJ 3CROL 1RIOA 2IBDA 1LFUP 3DCFA 1QPIA 1TWGJ 5F1JA 1NEQA 2KPJA 4YARA 2FX0A 2LR8A 2KDZA 3ZQLA 1HOMA 3BTCA 1F43A 1RESA 5F0HA 2IUOA 1E3OC 3OOUA 2XGEA 2VI6A 3ZQCA 4XICA 2LYKA 4A3MJ 1D5YA 1NK2P 3GN5A 3TRBA 4YG7B 1PRVA 4UUSB 1IGNA 2FJ1A 9ANTA 5FLMJ 4RBOA 3G1LA 3BTIA 4DW6A 4FBIA 2EH3A 3BR2A 2HXIA 2P81A 1FTZA 1PRUA 4A3CJ 3S8QA 4A3EJ 2IEKA 3E7LA 1ZK8A 2B63J 1FTTA 2DMPA 1F36A 4IVZA 5J1RA 4FCYA 1ZGWA 3RZZA 2PE5A 4PU3C 2JA7J 4I6RA 2O38A 1I3QJ 3BR1A 2M9HA 1QRYA 3FISA 2D5VA 4X4IA 2NS8A 2KT0A 1IRZA 3JXCL 4Z58A 4A3BJ 1ZAYA 1G2HA 1LCDA 3L1PA 2OF7A 4IHWA 3BTJA 5E3LA 3G1MA 2R7ZJ 4AC0A 2AHQA 2K9SA 2R63A 2LY9A 1RKTA 4UUSA 2LP0A 2MW8A 3S1MJ 1GVDA 4GHJA 2XPWA 3FKIJ 1PERL 3A03A 2X9DA 2O4AA 3K7AJ 1GT0C 1X2NA 3QQ6A 4DYQA 1JKOC 1LE8B 2DA4A 3CCYA 2LD5A 3G5GA 3RQIA 3MVPA 5EG0B 1R69A 1RETA 1QP4A 3HM5A 1U8BA 1A5JA 4A3KJ 2FQ4A 3H3VK 1RZRD 2MEZA 1RKWA 3F0CA 1GUUA 1NTCA 2AXZA 2MGQA 4C3IJ 5DS9A 3ZOBA 3LOCA 4J19A 2L7FP 4A69C 3IV5A 4LOCA 1P7JA 1XWRA 1ZS4A 3ZQFA 3OMTA 2VKVA 3UKGA 1K83J 2HINA 2PUBA 1GV5A 4W1UA 3GTJJ 2FJRA 2EZHA 1YRNB 2CUFA 1MBKA 4D7MA 2HQ5A 2L7MP 3OQMA 5E3MA 1JUSA 3TW7A 2NVXJ 1ETQA 3NAUA 3S15J 4A3DJ 4A3JJ 3GTOJ 2DJNA 1OCPA 3HDDA 1IDZA 2Y30A 4M3FA 1LE8A 2E2HJ 3A02A 3OQOA 4BKXA 1JUPA 2CUEA 2HYJA 5EG0A 4I76A 2WUSR 3LISA 2DMUA 2DMTA 3HOVJ 4Y7NJ 5IOZA 5IYDJ 1APLC 4X4CA 4ABZA 1H8AC 2CRGA 4XK4A 3OP9A 3QQAA 1SFOJ 4M3DA 2ECCA 5M3FJ 4NDWA 1MBGA 2R0QC 4XRMA 2O7OA 2GZUA 3IVPA 1W0UA 1VF9A 1Y7YA 2JCGA 3ZHMA 3VK0A 4MCTA 2IVBA 1YRNA 4HNVA 3H5TA 3D1NI 4Z5HA 1JJ8C 3BT9A 4XRSG 2JVLA 4X6AJ 3S2DJ 3HZIB 3Q0VA 2AW6A 3Q0UA 4FE7A 1XS9A 2ICTA 1O4XA 2YU9J 1WH8A 3HGYA 3HOXJ 2XJ3A 3JXDL 2N8GA 2WB1N 3FIWA 3QPSA 2Y31A 4J1WA 1MH4A 5IYCJ 3Q0WA 2L9RA 1TWFJ 3BR0A 1UMQA 3JRCA 2XPUA 4X4EA 4JX6A 5FKNA 4C3JJ 2KEKA 4A93J 3GTQJ 4O8BA 3B6AA 5JLXA 2CQXA 2JN6A 3Q3SA 2CROA 4I8TA 1BL0A 1ETVA 2TCTA 3PO2J 4Y52J 1ZZ8A 2GRLA 2CJJA 1ZZ7A 1ETXA 1IG7A 2EBYA 3UFDA 1B72B 5K7HA 1R9TJ 1LQCA 2QF7A 1JUMA 1B8IA 2L8NA 3R1FA 1IJWC 3H0GJ 3OQNA 1IC8A 1QPZA 1HDPA 3BS3A 3JRFA 3S2HJ 3HBLA 2PUGA 4BBSJ 1WGXA 3FK6A 1MSEC 4PU8A 5F04A 4YG4A 1ETWA 5E3OA 5K98B 3JRGA 1ZZ6A 2JJ7A 3QPLA 2E2JJ 1VFCA 5F0CA 1MBJA 1U9OA 3TEDA 1FJLA 3G1OA 2AXVA 4UUTA 1HF0A 2LLKA 4M3GA 3HKZN 3GBFA 2TRTA 1JTYA 4B4CA 2E2IJ 4B1RA 1GDTA 3HOZJ 3JRIA 1L1MA 4M3BA 1ITYA 1BJZA 1WIZA 5IYBJ 1OFCX 3EUSA 1B72A 1FIPA 1P7IA 4X4DA 2EBIA 1ZPQA 5BNGA 2DTZA 1Y1VJ 3VPRA 2PPXA 1Y1WJ 1TWHJ 3SCHA 3IH3A 1SQ8A 1ZZ9A 1QVTA 1JGGA 1AKHB 2OPTA 2E1OA 1Z0XA 2MSYA 5FJ8J 1XG1A 4D5FA 3F51A 5C4XJ 2Y2ZA 1S7EA 3TP0A 2DMNA 1DW9A 2PUFA 4DYCA 4IEJA 1FEXA 2YS9A 2VUMJ 1I6HJ 5M5WJ 3HOYJ 2YUSA 2NOGA 3I4NJ 2ICPA 2BNOA 2B5AA 1IDYA 1H89C 2XPVA 3O8HA 3GTMJ 4BXXJ 1POUA 3U3WA 4J1XA 4A3GJ 4XIDA 3QWGA 3OSGA 4MFEA 3CDLA 2R5ZB 4IHYA 4DZPA 3DNVB 2LYPA 3LFPA 5EZHA 1HLVA 2KEJA 5GPAA 4OB4A 1LMB3 5IOYA 5IP7J 1AKHA 2M8GX 3QF3A 5J3LA 2H8RA 2CQQA 1MBHA 2Y0SN 4BBRJ 4CYCB 2NVQJ 1OCTC 1ZZBA 2K9QA 1VPWA 2IAIA 1Q1VA 2KZ8A 4IWRA 5F08A 1TWCJ 1JKPC 3B6CA 2LCVA 5JLWA 1X58A 2AO9A 3OSFA 1R63A 2JK3A 2VPRA 1JTXA 4Z59A 4D5CA 2M0CA 4D7NA 4IA8A 2EF8A 3S17J 4B3AA 3BQYA 3WHBA 5IP9J 4I6UA 2MG4A 1CJGA 3HB9A 1ZQ3P 3ZHIA 4QIWN 2R5ZA 4GQMA 2K40A 1ETOA 1MH3A 4JYKA 2E19A 3S1RJ 2H1KA 2I10A 2PUEA 1X2MA 1Y9QA 3LSRA 2LYSA 5EF6A 2COBA 1U78A 4GFBA 4JX4A 3G7DA 2LKXA 4CYCA 3BTLA 1HDDC 2DMQA 2EZIA 4M3EA 2NS7A 4FE4A 3QYXA 2DA5A 1B8IB 4Y42A 2K9NA 2HOSA 3HOUJ 1LLIA 2JA6J 1W0TA 2L49A 3BR5A 2XI8A 4X4HA 3ZKCA 4IHVA 1Z77A 3JR9A 2GBYA 4MFDA 5E3NA 5EYRA 4JP0A 3CMYA 2NVTJ 2BNMA 4Z5CA 2WV1A 1QVUA 5J1UA 4PU7A 1LFBA 1U9NA 2ECBA 1RPEL 2ID3A 3FK7A 3M3YJ 1ZVVA 3W6VA 1WCMJ 3C2BA 2ZB9A 4DYRA 2Y9ZA 5FLVA 5DTDA 3BD1A 5C44J 2LFBA 2R5YB 5F0FA 4MCXA 1ZR2A 5F27A 4X4BA 1WI3A 4JCXA 4A3FJ 1RZSA 2LYRA 3GTKJ 4C3HJ 1B0NA 1MBEA 2XGDA 3FMYA 3LSJA 1EF4A 3NARA 1VNDA 4NDLA 2HSGA 2HOAA 3SCGA 1WH5A 1RPWA 1ETKA 2M34A 2PMZN 4FN3A 4YG1A 3BDNA 2NVYJ 2LYJA 4RDUA 2EZKA 3S1NJ 3GTPJ 3OIOA 3JRHA 3K2AA 3LNQA 1HCRA 4QSHA 1NERA 1QP0A 1VI0A 4MO7A 3HOWJ 2IVGA 3PO3J 2ID6A 3M4OJ 3BG9A 5EZGA 3FYAA 2DN0A 1JT6A 1BW5A 3JXBC 4BY7J 5EGOB 2JA5J 5GPCA 2JWTA 1X2LA 2R5YA 4JCYA 3F52A 4V2FA 4QTRA 1JFSA 1PNRA 2L7ZA 5EDNA 4AUXA 2GLOA 2HOTA 1PRAA 3KXAA 1JFTA 1CQTA 2DA1A 1YSEA 2XRLA 3BR6A 4JQDA 4XRSA 1AHDP 3O8GA 1QQBA 2FD5A 1UXDA 5C3EJ 3RZOJ 2HI3A 1JKRC 2RAEA 3SJMA 3BQZA 3F6WA 2KEIA 2DA2A 1MBFA 5M3MJ 3S1QJ 1ZUGA 3HGGA 1UTXA 4V2GA 1PUFB 5EEAA 1BA5A 1FIAA 2O49A 3PXPA 4YBAA 3MKLA 5A7LA 3I4MJ 2ELKA 3JREA 5EGOA 2BNNA 1ORKA 3SCFA 2R1JL 4M6VA 2LYQA 2QCOA 5M5YJ 2XCJA 3ZQIA 1GV2A 3KZ3A 4I6ZA 3JRDA 2JA8J 2IV1A 2LYLA 2GM4A 1NK3P 1ADRA 4MIMA 2A6CA 5IP6A 4X4GA 4DZJA 2M2EA 5FKLA 5J1YA 2DA3A 1WH6A 2GRMA 5IPAA 3MLFA 3BG5A 1XC5A 4I6TA 1QQAA 5FKKA 1JWLA 2ME6A 4MLOA 2ME0A 3A01B 1T56A 2OR1L 1MSFC 1WPKA 2XGCA 4Z5DA 2CU7A 1K61A 1OSLA 2X48A 3TP3A 1UXCA 1PUFA 1DU0A 1TC3C 1BDIA 3GBGA 3DEWA 1LCCA 2EWTA 2X6OA 1OJLA 3KJXA 3LSPA 2R93J 2PUDA 2AUWA 3GTGJ 3IH4A 2PUAA 4L5EA 2Y9YA 1JT0A 2HDDA 3S14J 2BJCA 4BY1J 2O9LA 3CLCA 3CECA 3RKQA 2O8KA 2EQRA 2HXOA 3CQZJ 2WAQN 4FISA 5FKOA 4X4FA 3BR3A 3PM1A 3LSGA 3SFIA 2IVQA 2VKEA 1X57A 3FYMA 3A01A 4A3LJ 2PIJA 1UG2A 3BG3A 1DU6A 2W48A 4FTHA 3S16J 1IUFA 5HODA 1JJ6C 4G12A 4C2MJ 1ZKGA 2DA6A 1MNMC 3RZDJ 2L0KA 1ZR4A 4F8DA 2G0EA 2XSDC 2XIUA 2EZLA 4EEFG 1POGA 3ZQGA 4A3IJ 5GP9A 2LVSA 1QP7A 2MQKA 1ZTRA 1H88C 1WH7A 2PUCA 4JX5A 1IV6A 2AXUA 1T33A 1ETYA 1ZZCA 2IU7A 2OFYA 2LK2A 3HEFA 1WETA 4S0HB 1JKQC 2XB5A 1RZRA 1TWAJ 3TW6A 4X1EA 1BW6A 3GN5B 1ENHA 3MN2A 5FKMA 5K7FA 3ZQHA 2R92J 1DWKA 1EFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH2 A;  1A6I A;  1I50 J;  2DA7 A;  2CSF A;  3JRB A;  4IHX A;  2AWI A;  3JRA A;  3O9X A;  3SDG A;  1SAN A;  2JMW A;  4W97 A;  5C4J J;  5K7Z A;  1JH9 A;  2XB0 X;  1BDH A;  3WHC A;  1RR7 A;  1AU7 A;  4AYB N;  2WIU B;  1UHS A;  3B7H A;  2LTP A;  4PU4 C;  5M5X J;  3GTL J;  3CRO L;  1RIO A;  2IBD A;  1LFU P;  3DCF A;  1QPI A;  1TWG J;  5F1J A;  1NEQ A;  2KPJ A;  4YAR A;  2FX0 A;  2LR8 A;  2KDZ A;  3ZQL A;  1HOM A;  3BTC A;  1F43 A;  1RES A;  5F0H A;  2IUO A;  1E3O C;  3OOU A;  2XGE A;  2VI6 A;  3ZQC A;  4XIC A;  2LYK A;  4A3M J;  1D5Y A;  1NK2 P;  3GN5 A;  3TRB A;  4YG7 B;  1PRV A;  4UUS B;  1IGN A;  2FJ1 A;  9ANT A;  5FLM J;  4RBO A;  3G1L A;  3BTI A;  4DW6 A;  4FBI A;  2EH3 A;  3BR2 A;  2HXI A;  2P81 A;  1FTZ A;  1PRU A;  4A3C J;  3S8Q A;  4A3E J;  2IEK A;  3E7L A;  1ZK8 A;  2B63 J;  1FTT A;  2DMP A;  1F36 A;  4IVZ A;  5J1R A;  4FCY A;  1ZGW A;  3RZZ A;  2PE5 A;  4PU3 C;  2JA7 J;  4I6R A;  2O38 A;  1I3Q J;  3BR1 A;  2M9H A;  1QRY A;  3FIS A;  2D5V A;  4X4I A;  2NS8 A;  2KT0 A;  1IRZ A;  3JXC L;  4Z58 A;  4A3B J;  1ZAY A;  1G2H A;  1LCD A;  3L1P A;  2OF7 A;  4IHW A;  3BTJ A;  5E3L A;  3G1M A;  2R7Z J;  4AC0 A;  2AHQ A;  2K9S A;  2R63 A;  2LY9 A;  1RKT A;  4UUS A;  2LP0 A;  2MW8 A;  3S1M J;  1GVD A;  4GHJ A;  2XPW A;  3FKI J;  1PER L;  3A03 A;  2X9D A;  2O4A A;  3K7A J;  1GT0 C;  1X2N A;  3QQ6 A;  4DYQ A;  1JKO C;  1LE8 B;  2DA4 A;  3CCY A;  2LD5 A;  3G5G A;  3RQI A;  3MVP A;  5EG0 B;  1R69 A;  1RET A;  1QP4 A;  3HM5 A;  1U8B A;  1A5J A;  4A3K J;  2FQ4 A;  3H3V K;  1RZR D;  2MEZ A;  1RKW A;  3F0C A;  1GUU A;  1NTC A;  2AXZ A;  2MGQ A;  4C3I J;  5DS9 A;  3ZOB A;  3LOC A;  4J19 A;  2L7F P;  4A69 C;  3IV5 A;  4LOC A;  1P7J A;  1XWR A;  1ZS4 A;  3ZQF A;  3OMT A;  2VKV A;  3UKG A;  1K83 J;  2HIN A;  2PUB A;  1GV5 A;  4W1U A;  3GTJ J;  2FJR A;  2EZH A;  1YRN B;  2CUF A;  1MBK A;  4D7M A;  2HQ5 A;  2L7M P;  3OQM A;  5E3M A;  1JUS A;  3TW7 A;  2NVX J;  1ETQ A;  3NAU A;  3S15 J;  4A3D J;  4A3J J;  3GTO J;  2DJN A;  1OCP A;  3HDD A;  1IDZ A;  2Y30 A;  4M3F A;  1LE8 A;  2E2H J;  3A02 A;  3OQO A;  4BKX A;  1JUP A;  2CUE A;  2HYJ A;  5EG0 A;  4I76 A;  2WUS R;  3LIS A;  2DMU A;  2DMT A;  3HOV J;  4Y7N J;  5IOZ A;  5IYD J;  1APL C;  4X4C A;  4ABZ A;  1H8A C;  2CRG A;  4XK4 A;  3OP9 A;  3QQA A;  1SFO J;  4M3D A;  2ECC A;  5M3F J;  4NDW A;  1MBG A;  2R0Q C;  4XRM A;  2O7O A;  2GZU A;  3IVP A;  1W0U A;  1VF9 A;  1Y7Y A;  2JCG A;  3ZHM A;  3VK0 A;  4MCT A;  2IVB A;  1YRN A;  4HNV A;  3H5T A;  3D1N I;  4Z5H A;  1JJ8 C;  3BT9 A;  4XRS G;  2JVL A;  4X6A J;  3S2D J;  3HZI B;  3Q0V A;  2AW6 A;  3Q0U A;  4FE7 A;  1XS9 A;  2ICT A;  1O4X A;  2YU9 J;  1WH8 A;  3HGY A;  3HOX J;  2XJ3 A;  3JXD L;  2N8G A;  2WB1 N;  3FIW A;  3QPS A;  2Y31 A;  4J1W A;  1MH4 A;  5IYC J;  3Q0W A;  2L9R A;  1TWF J;  3BR0 A;  1UMQ A;  3JRC A;  2XPU A;  4X4E A;  4JX6 A;  5FKN A;  4C3J J;  2KEK A;  4A93 J;  3GTQ J;  4O8B A;  3B6A A;  5JLX A;  2CQX A;  2JN6 A;  3Q3S A;  2CRO A;  4I8T A;  1BL0 A;  1ETV A;  2TCT A;  3PO2 J;  4Y52 J;  1ZZ8 A;  2GRL A;  2CJJ A;  1ZZ7 A;  1ETX A;  1IG7 A;  2EBY A;  3UFD A;  1B72 B;  5K7H A;  1R9T J;  1LQC A;  2QF7 A;  1JUM A;  1B8I A;  2L8N A;  3R1F A;  1IJW C;  3H0G J;  3OQN A;  1IC8 A;  1QPZ A;  1HDP A;  3BS3 A;  3JRF A;  3S2H J;  3HBL A;  2PUG A;  4BBS J;  1WGX A;  3FK6 A;  1MSE C;  4PU8 A;  5F04 A;  4YG4 A;  1ETW A;  5E3O A;  5K98 B;  3JRG A;  1ZZ6 A;  2JJ7 A;  3QPL A;  2E2J J;  1VFC A;  5F0C A;  1MBJ A;  1U9O A;  3TED A;  1FJL A;  3G1O A;  2AXV A;  4UUT A;  1HF0 A;  2LLK A;  4M3G A;  3HKZ N;  3GBF A;  2TRT A;  1JTY A;  4B4C A;  2E2I J;  4B1R A;  1GDT A;  3HOZ J;  3JRI A;  1L1M A;  4M3B A;  1ITY A;  1BJZ A;  1WIZ A;  5IYB J;  1OFC X;  3EUS A;  1B72 A;  1FIP A;  1P7I A;  4X4D A;  2EBI A;  1ZPQ A;  5BNG A;  2DTZ A;  1Y1V J;  3VPR A;  2PPX A;  1Y1W J;  1TWH J;  3SCH A;  3IH3 A;  1SQ8 A;  1ZZ9 A;  1QVT A;  1JGG A;  1AKH B;  2OPT A;  2E1O A;  1Z0X A;  2MSY A;  5FJ8 J;  1XG1 A;  4D5F A;  3F51 A;  5C4X J;  2Y2Z A;  1S7E A;  3TP0 A;  2DMN A;  1DW9 A;  2PUF A;  4DYC A;  4IEJ A;  1FEX A;  2YS9 A;  2VUM J;  1I6H J;  5M5W J;  3HOY J;  2YUS A;  2NOG A;  3I4N J;  2ICP A;  2BNO A;  2B5A A;  1IDY A;  1H89 C;  2XPV A;  3O8H A;  3GTM J;  4BXX J;  1POU A;  3U3W A;  4J1X A;  4A3G J;  4XID A;  3QWG A;  3OSG A;  4MFE A;  3CDL A;  2R5Z B;  4IHY A;  4DZP A;  3DNV B;  2LYP A;  3LFP A;  5EZH A;  1HLV A;  2KEJ A;  5GPA A;  4OB4 A;  1LMB 3;  5IOY A;  5IP7 J;  1AKH A;  2M8G X;  3QF3 A;  5J3L A;  2H8R A;  2CQQ A;  1MBH A;  2Y0S N;  4BBR J;  4CYC B;  2NVQ J;  1OCT C;  1ZZB A;  2K9Q A;  1VPW A;  2IAI A;  1Q1V A;  2KZ8 A;  4IWR A;  5F08 A;  1TWC J;  1JKP C;  3B6C A;  2LCV A;  5JLW A;  1X58 A;  2AO9 A;  3OSF A;  1R63 A;  2JK3 A;  2VPR A;  1JTX A;  4Z59 A;  4D5C A;  2M0C A;  4D7N A;  4IA8 A;  2EF8 A;  3S17 J;  4B3A A;  3BQY A;  3WHB A;  5IP9 J;  4I6U A;  2MG4 A;  1CJG A;  3HB9 A;  1ZQ3 P;  3ZHI A;  4QIW N;  2R5Z A;  4GQM A;  2K40 A;  1ETO A;  1MH3 A;  4JYK A;  2E19 A;  3S1R J;  2H1K A;  2I10 A;  2PUE A;  1X2M A;  1Y9Q A;  3LSR A;  2LYS A;  5EF6 A;  2COB A;  1U78 A;  4GFB A;  4JX4 A;  3G7D A;  2LKX A;  4CYC A;  3BTL A;  1HDD C;  2DMQ A;  2EZI A;  4M3E A;  2NS7 A;  4FE4 A;  3QYX A;  2DA5 A;  1B8I B;  4Y42 A;  2K9N A;  2HOS A;  3HOU J;  1LLI A;  2JA6 J;  1W0T A;  2L49 A;  3BR5 A;  2XI8 A;  4X4H A;  3ZKC A;  4IHV A;  1Z77 A;  3JR9 A;  2GBY A;  4MFD A;  5E3N A;  5EYR A;  4JP0 A;  3CMY A;  2NVT J;  2BNM A;  4Z5C A;  2WV1 A;  1QVU A;  5J1U A;  4PU7 A;  1LFB A;  1U9N A;  2ECB A;  1RPE L;  2ID3 A;  3FK7 A;  3M3Y J;  1ZVV A;  3W6V A;  1WCM J;  3C2B A;  2ZB9 A;  4DYR A;  2Y9Z A;  5FLV A;  5DTD A;  3BD1 A;  5C44 J;  2LFB A;  2R5Y B;  5F0F A;  4MCX A;  1ZR2 A;  5F27 A;  4X4B A;  1WI3 A;  4JCX A;  4A3F J;  1RZS A;  2LYR A;  3GTK J;  4C3H J;  1B0N A;  1MBE A;  2XGD A;  3FMY A;  3LSJ A;  1EF4 A;  3NAR A;  1VND A;  4NDL A;  2HSG A;  2HOA A;  3SCG A;  1WH5 A;  1RPW A;  1ETK A;  2M34 A;  2PMZ N;  4FN3 A;  4YG1 A;  3BDN A;  2NVY J;  2LYJ A;  4RDU A;  2EZK A;  3S1N J;  3GTP J;  3OIO A;  3JRH A;  3K2A A;  3LNQ A;  1HCR A;  4QSH A;  1NER A;  1QP0 A;  1VI0 A;  4MO7 A;  3HOW J;  2IVG A;  3PO3 J;  2ID6 A;  3M4O J;  3BG9 A;  5EZG A;  3FYA A;  2DN0 A;  1JT6 A;  1BW5 A;  3JXB C;  4BY7 J;  5EGO B;  2JA5 J;  5GPC A;  2JWT A;  1X2L A;  2R5Y A;  4JCY A;  3F52 A;  4V2F A;  4QTR A;  1JFS A;  1PNR A;  2L7Z A;  5EDN A;  4AUX A;  2GLO A;  2HOT A;  1PRA A;  3KXA A;  1JFT A;  1CQT A;  2DA1 A;  1YSE A;  2XRL A;  3BR6 A;  4JQD A;  4XRS A;  1AHD P;  3O8G A;  1QQB A;  2FD5 A;  1UXD A;  5C3E J;  3RZO J;  2HI3 A;  1JKR C;  2RAE A;  3SJM A;  3BQZ A;  3F6W A;  2KEI A;  2DA2 A;  1MBF A;  5M3M J;  3S1Q J;  1ZUG A;  3HGG A;  1UTX A;  4V2G A;  1PUF B;  5EEA A;  1BA5 A;  1FIA A;  2O49 A;  3PXP A;  4YBA A;  3MKL A;  5A7L A;  3I4M J;  2ELK A;  3JRE A;  5EGO A;  2BNN A;  1ORK A;  3SCF A;  2R1J L;  4M6V A;  2LYQ A;  2QCO A;  5M5Y J;  2XCJ A;  3ZQI A;  1GV2 A;  3KZ3 A;  4I6Z A;  3JRD A;  2JA8 J;  2IV1 A;  2LYL A;  2GM4 A;  1NK3 P;  1ADR A;  4MIM A;  2A6C A;  5IP6 A;  4X4G A;  4DZJ A;  2M2E A;  5FKL A;  5J1Y A;  2DA3 A;  1WH6 A;  2GRM A;  5IPA A;  3MLF A;  3BG5 A;  1XC5 A;  4I6T A;  1QQA A;  5FKK A;  1JWL A;  2ME6 A;  4MLO A;  2ME0 A;  3A01 B;  1T56 A;  2OR1 L;  1MSF C;  1WPK A;  2XGC A;  4Z5D A;  2CU7 A;  1K61 A;  1OSL A;  2X48 A;  3TP3 A;  1UXC A;  1PUF A;  1DU0 A;  1TC3 C;  1BDI A;  3GBG A;  3DEW A;  1LCC A;  2EWT A;  2X6O A;  1OJL A;  3KJX A;  3LSP A;  2R93 J;  2PUD A;  2AUW A;  3GTG J;  3IH4 A;  2PUA A;  4L5E A;  2Y9Y A;  1JT0 A;  2HDD A;  3S14 J;  2BJC A;  4BY1 J;  2O9L A;  3CLC A;  3CEC A;  3RKQ A;  2O8K A;  2EQR A;  2HXO A;  3CQZ J;  2WAQ N;  4FIS A;  5FKO A;  4X4F A;  3BR3 A;  3PM1 A;  3LSG A;  3SFI A;  2IVQ A;  2VKE A;  1X57 A;  3FYM A;  3A01 A;  4A3L J;  2PIJ A;  1UG2 A;  3BG3 A;  1DU6 A;  2W48 A;  4FTH A;  3S16 J;  1IUF A;  5HOD A;  1JJ6 C;  4G12 A;  4C2M J;  1ZKG A;  2DA6 A;  1MNM C;  3RZD J;  2L0K A;  1ZR4 A;  4F8D A;  2G0E A;  2XSD C;  2XIU A;  2EZL A;  4EEF G;  1POG A;  3ZQG A;  4A3I J;  5GP9 A;  2LVS A;  1QP7 A;  2MQK A;  1ZTR A;  1H88 C;  1WH7 A;  2PUC A;  4JX5 A;  1IV6 A;  2AXU A;  1T33 A;  1ETY A;  1ZZC A;  2IU7 A;  2OFY A;  2LK2 A;  3HEF A;  1WET A;  4S0H B;  1JKQ C;  2XB5 A;  1RZR A;  1TWA J;  3TW6 A;  4X1E A;  1BW6 A;  3GN5 B;  1ENH A;  3MN2 A;  5FKM A;  5K7F A;  3ZQH A;  2R92 J;  1DWK A;  1EFA A; 
#chains in the Genus database with same CATH topology
 5EJC A;  4WF2 A;  1A6I A;  3RSN A;  1I50 J;  5DCM B;  3RYR A;  3ZMD A;  1YJN I;  4BYY A;  1XGS A;  4P1W A;  4IHX A;  3L2V A;  3QFI A;  1SAN A;  5K7Z A;  2E5N A;  3I0T A;  1PP7 U;  3DKX A;  3SZP A;  2BY0 A;  3BOQ A;  3SZG A;  4AYB N;  2EV5 A;  1UHS A;  3B7H A;  3CRO L;  4IOC F;  3K4M A;  2KIF A;  1H9G A;  2KIU A;  4M73 A;  3DCF A;  3IL2 A;  1QPI A;  5E20 A;  1H9T A;  2ESN A;  2KPJ A;  4ESJ A;  4U0Y A;  1I27 A;  1QGP A;  3ZQL A;  5K5Q A;  3BTC A;  4DOZ A;  4V19 K;  3RDI A;  1SD7 A;  1E3O C;  3ML6 A;  4ZJZ A;  3KZY A;  2MC3 A;  3TRB A;  3U1K A;  2A68 F;  3E6M A;  3CMA I;  2FJ1 A;  3HHH A;  4IL6 C;  1H0M A;  5FLM J;  4RGR A;  2VEO A;  1XDS A;  1PJR A;  4HF1 A;  2EH3 A;  2A6T A;  2HXI A;  3DF8 A;  2L2O A;  4PGH A;  1YW7 A;  2IEK A;  2B63 J;  1FTT A;  1P9Q C;  1F36 A;  3RZZ A;  2PXU A;  2A6H F;  4NC6 A;  4PU3 C;  4ON0 A;  2O38 A;  1I3Q J;  2FBK A;  3SXY A;  3HRU A;  1YI2 I;  1YX3 A;  2NS8 A;  2KT0 A;  3OR1 C;  4CCJ A;  3Q9S A;  1IRZ A;  4A3B J;  1ZAY A;  3T1B A;  5HVQ C;  3L1P A;  1BR4 A;  3MKY B;  1W4M A;  1HKS A;  5D4R A;  1Z91 A;  2R63 A;  5FRM A;  2LLW A;  5HDG A;  4OIR F;  4CCM A;  3RPU D;  1DP7 P;  2H27 A;  3S1M J;  1GVD A;  4GHJ A;  3FKI J;  3SYT A;  3A03 A;  2X9D A;  4E7S A;  2ZME A;  4HF0 A;  1D8J A;  1AOY A;  2MLK A;  1GT0 C;  1JKO C;  1LE8 B;  3GFJ A;  4ZYD A;  3EDP A;  3C2G A;  5EG0 B;  3QOD A;  3ZR8 X;  1Z21 A;  5H6Q A;  1W7P B;  2XIG A;  1A5J A;  4F7Z A;  1RZR D;  2MEZ A;  2PMZ A;  1OCZ H;  3M8J A;  4KJZ A;  3HOS A;  4HDV A;  4AYB A;  4ZYE A;  4OBM A;  1FZP B;  1KQ8 A;  1DUX C;  3LOC A;  4CCN A;  2BZT A;  4PDK A;  3SZT A;  4LK1 F;  4BXF A;  4HX8 A;  3WU1 B;  3E5U A;  5D5U B;  1XWR A;  2XKP A;  3RTR A;  3SEZ A;  1EJ9 A;  3UKG A;  1ON1 A;  1QZX A;  1GV5 A;  4W1U A;  3GTJ J;  2EZH A;  1MBK A;  2F2E A;  2BY1 A;  2PFB A;  2VIX A;  1KZH A;  3GZN B;  3TW7 A;  4IO9 F;  1BI2 A;  3S15 J;  4KUM A;  5H6R A;  4CCL A;  3GTO J;  1EH7 A;  2MA3 A;  2Y30 A;  3GX4 X;  3D5L A;  2HYG D;  2V79 A;  4BKX A;  3F9K A;  2WUS R;  4BJ5 C;  2AQF A;  3LIS A;  4BE1 A;  3ERM A;  4EJV A;  2DMU A;  4ENK A;  1DQU A;  5FFZ A;  1YIJ I;  4CZC A;  2XC7 A;  2KIQ A;  3BZK A;  4X4C A;  1P6R A;  3FXO A;  2CRG A;  2DOA A;  1H8A C;  3R61 A;  1FSE A;  1FWZ A;  1J09 A;  3IRQ A;  2RGV A;  4M3D A;  2ECC A;  4NDW A;  2GZU A;  2RNG A;  3Q5F A;  2E71 A;  3IVP A;  4WXH A;  2WAF A;  1HKQ A;  1HQ1 A;  2HPI A;  2PXE A;  4M74 A;  3ZGK A;  4MCT A;  2IVB A;  1YRN A;  2KRC A;  3JTH A;  4WX9 A;  3KP6 A;  4IHS A;  2E34 A;  4HQM A;  1F5T A;  2BW3 A;  2MH9 A;  2Z1D A;  3PJR A;  4X6A J;  4EKG A;  4ENM A;  4EKI A;  2ICT A;  2QSF X;  4HAM A;  1O4X A;  1MMG A;  1O3T A;  3AG3 H;  3IKV A;  2N8G A;  4J1W A;  4WK8 F;  2VQL A;  1G3T A;  2D1H A;  3Q0W A;  3ISP A;  1FT9 A;  3BR0 A;  1DUL A;  1IUY A;  2OD5 A;  3E5Q A;  4C3J J;  1EV7 A;  4PJ0 C;  3I53 A;  2IS1 A;  1YTY A;  3B6A A;  3C7J A;  2Y0M A;  5DUK A;  4ZZD A;  3OYN A;  1YX5 A;  3DFG A;  4M72 A;  1BOB A;  5D5V B;  4CXF A;  1BL0 A;  4XSZ F;  1EH8 A;  2M3A A;  2B0L A;  1ZZ8 A;  2ISZ A;  2DOF A;  3CCU I;  2PX9 A;  1NG6 A;  2ETH A;  4CH7 A;  2LF8 A;  1TT5 B;  1OR7 C;  1SFX A;  1X4P A;  2KPM A;  4L9T A;  4BQO A;  2QVO A;  2KP6 A;  1LQC A;  1BC7 C;  4ZC3 A;  3TL4 X;  3RI4 A;  2DT7 B;  3LSH A;  2A07 F;  4U0V A;  1FSH A;  5JHF A;  5IT3 A;  3OIQ A;  3FK6 A;  2RN7 A;  3ZMT A;  2DFF A;  2EA2 A;  3KP3 A;  5CYV A;  1V5F A;  2ZFU A;  1ZZ6 A;  2JJ7 A;  2NYX A;  3QPL A;  2O6G E;  3TED A;  3GZ6 A;  3OV8 A;  5CVV A;  2CFO A;  4BL0 B;  2MH2 A;  1M1E B;  1MNE A;  3F6O A;  4RB0 A;  3ULQ B;  1HF0 A;  3VEP A;  4R79 A;  4M3G A;  2VOO A;  4IHT A;  2UUZ A;  5DV5 A;  1YJW I;  1GDT A;  3HOZ J;  3JRI A;  3GFM A;  3W2A A;  1L1M A;  1BJZ A;  3M7G A;  2FU4 A;  2PXF A;  2EBI A;  1ZGA A;  1Y1V J;  1LKX A;  5D8K B;  3SCH A;  4Q2J A;  3IH3 A;  4IRI A;  2VQH A;  4ER0 A;  1ZZ9 A;  3CLQ A;  3DM5 A;  1GVJ A;  2VE8 A;  1D0Y A;  4AM3 A;  1XG1 A;  1JE8 A;  3OYC A;  5ICE A;  4K2E A;  2PUF A;  2LY1 A;  1ZAR A;  4DYC A;  1FEX A;  3NWS A;  1TTY A;  1I6H J;  5E18 F;  3EPZ A;  2K3F A;  3B73 A;  3WGG A;  4YFK F;  4XLP F;  4LB6 B;  4DIQ A;  1H89 C;  2XPV A;  1UAA A;  2JPC A;  1ZAO A;  1VZ0 A;  1XMA A;  4MTE A;  3V8L A;  2R5Z B;  1QHG A;  1UCR A;  2HVS A;  3DNV B;  3OYJ A;  5LD2 C;  2KEJ A;  2H1L A;  1T0F C;  3O2P E;  4E7Z A;  2ZXW H;  3FHZ A;  5TJJ A;  4N9H A;  2M8G X;  5J3L A;  1VQL I;  3LFU A;  2DI3 A;  4JCY A;  2G9W A;  3AG1 H;  3AG4 H;  1D0X A;  5DD8 A;  2KZ8 A;  4D0P A;  2CWE A;  5F08 A;  2CMP A;  3PSF A;  2F4I A;  2JQE A;  1S7O A;  1LQ1 A;  3FWE A;  1X58 A;  1T2K A;  2XVC A;  3OSF A;  1R63 A;  2VPR A;  1JTX A;  3V7S A;  4PFO A;  1V5E A;  3ASN H;  2XV4 S;  4I99 C;  2Z33 A;  4GYI A;  2M87 A;  5IP9 J;  2FEZ A;  4L9J A;  2MG4 A;  4UVC A;  3HB9 A;  1CJG A;  3ZHI A;  1P92 A;  2ZJR F;  4E4H A;  2QLZ A;  4ZDL A;  3ZQ7 A;  2PUE A;  2PG4 A;  2ISY A;  2H1K A;  2IA2 A;  2I10 A;  3RIR A;  4DGW B;  5GAG J;  5EF6 A;  3K70 D;  4BJ6 C;  3E5X A;  4ESF A;  1FOX A;  3G7D A;  3K1N A;  4LIT A;  4MQ9 F;  3P9C A;  5LLQ A;  4CYC A;  2OUM A;  1O3S A;  1DGR M;  1I1S A;  3RPU A;  3ESW B;  3H3Z A;  4EGY A;  1J5Y A;  5JVT A;  3HOU J;  1LLI A;  2JA6 J;  2IS4 A;  1X1A A;  2UWM A;  4HQE A;  1B9N A;  1SAU A;  3F21 A;  3WGH A;  2DK8 A;  1Z77 A;  1F9N A;  4EQQ A;  2GBY A;  1BR2 A;  3ABK H;  5EYR A;  3CMY A;  3TKY A;  4Z5C A;  2AQE A;  4QPO A;  2QQB A;  5J1U A;  2XAH A;  1OR7 A;  2RC4 A;  5BOX A;  1X4O A;  2ECB A;  2HQA A;  2ID3 A;  3CCR I;  3EUH A;  1WCM J;  3C2B A;  4F52 A;  3BD1 A;  1MMA A;  4BE0 A;  2LFB A;  5F0F A;  1R6R A;  2V6C A;  1ZQ3 P;  5J8F A;  3K1P A;  4A3F J;  3JSO A;  1EA3 A;  2V9K A;  2DXI A;  3DPL C;  1LUJ B;  3FDY A;  4IQJ A;  4NDL A;  2HOA A;  2CUJ A;  3ABU A;  1S9H A;  4YG1 A;  2CW0 F;  2VQG A;  1D1A A;  2NVY J;  1Z1D A;  2NXN B;  1ZRD A;  2FRH A;  3S32 A;  1OQY A;  1LDJ A;  2QWW A;  1MW7 A;  2IW5 A;  2GXA A;  1TQI A;  3HOW J;  2XXP A;  2ID6 A;  4HG2 A;  3M4O J;  3BG9 A;  5EZG A;  3TDU C;  3NZL A;  3GFL A;  1BW5 A;  2CFX A;  4A5M A;  4DQ2 A;  5GPC A;  3BLY A;  1OYI A;  3F52 A;  4E7L A;  2PXB A;  2VLA A;  3FXQ A;  4AUX A;  3DBL B;  3E6B A;  4XN3 A;  3CF5 F;  5DM6 F;  1CQT A;  5K1Y A;  4N9I A;  4XBF A;  1AHD P;  4M9X A;  1A36 A;  4XLN F;  4RGU A;  2RAE A;  2OTL I;  1TT0 A;  4Q47 A;  2JRM A;  3FMR A;  4NB5 A;  5LEJ A;  1O3R A;  3CJR B;  4V2G A;  1MIJ A;  3PUB A;  5EEA A;  3FHN A;  2FOW A;  2L3D A;  3PXP A;  3MKL A;  2IA0 A;  2BGC A;  3K4B A;  2V9P A;  2R7O A;  1T0F A;  3G2B A;  1IV8 A;  3JRE A;  3KP7 A;  3HPG A;  4E6K G;  4M6V A;  1XTA A;  3BG7 A;  4LIU A;  2XCJ A;  5ERI A;  1GV2 A;  3KZ3 A;  1JHF A;  1TNT A;  4XM3 A;  1NK3 P;  2NRA C;  3H9Q A;  3I64 A;  2A6C A;  3N97 A;  4JK1 X;  5DD4 A;  1ZG5 A;  2KIS A;  2ZC2 A;  1WH6 A;  2DA3 A;  1A04 A;  1YLF A;  3S8P A;  4YIR X;  3ZP5 A;  4I6T A;  1QQA A;  1MDM A;  4MLO A;  3J80 Z;  2OQR A;  3BCB A;  4MQV A;  1SEU A;  1XB4 A;  2X6X A;  4U87 A;  1GLN A;  5FFX A;  2X48 A;  1G4D A;  2EFP A;  1HQC A;  3KET A;  1OYY A;  2YPR A;  2K5C A;  3HZJ A;  1IRF A;  2FMY A;  2HU9 A;  2W84 A;  3DEW A;  3TGN A;  1YO5 C;  3EUK L;  1P4X A;  2R93 J;  2VXD A;  4L18 B;  2PUD A;  2AUW A;  3VYR B;  3IH4 A;  4PUS A;  4L5E A;  1Z3Y A;  1W5S A;  2DT5 A;  2RDP A;  3H9J A;  3CLC A;  3MWM A;  2LSO A;  2HXO A;  4YG2 F;  1YYV A;  2WAQ N;  1ZG1 A;  2FBI A;  5DTM A;  3BR3 A;  2EIJ H;  1X1C A;  3LSG A;  2IVQ A;  5K5O A;  1R5I D;  1X57 A;  3DTE A;  2Q2E B;  4HYE A;  2PIJ A;  3BG3 A;  1YG2 A;  1SD4 A;  2VJJ A;  3SQN A;  1BR1 A;  4C2M J;  4ANJ A;  3R0A A;  4AID A;  3MKW B;  2EIL H;  2IS6 A;  4GO1 A;  1QBJ A;  2M7B A;  4A3I J;  1R71 A;  2DJI A;  2ZBK A;  2AXU A;  1T33 A;  1O3Q A;  1ZZC A;  5A2Q Z;  4EM2 A;  2F4M B;  2XB5 A;  2M0M A;  3G73 A;  1TL8 A;  1TWA J;  2K3P A;  3QU3 A;  2WWY A;  4BDY A;  4CSW A;  1J75 A;  1QB2 A;  4G6Q A;  1ENH A;  3MN2 A;  4LFU A;  5FKM A;  3ZQH A;  2R92 J;  2XRN A;  1IN8 A;  3ZMU A;  3LQQ A;  3LA7 A;  3A9X A;  2CSF A;  3JRB A;  2AWI A;  3O9X A;  4XLE A;  3JRA A;  3QYB A;  3OYB A;  1YW9 A;  2KZV A;  2HS5 A;  1KQ0 A;  5C4J J;  3OYK A;  1BDH A;  3J7A Y;  1D5V A;  3WHC A;  1OMI A;  3F8F A;  4CYD A;  4GDF A;  4BU2 A;  2LTP A;  4L5J A;  2BYV E;  2ODR D;  1R58 A;  4HA8 A;  5CQG A;  3CDI A;  5F1J A;  2BHY A;  2LR8 A;  3CCQ I;  2F5F A;  2IGO A;  3A9Y A;  1VQ5 I;  1F43 A;  4G7Z F;  3DU5 A;  3E6D A;  4GGG A;  1RRJ A;  2IUO A;  1D1B A;  1P4A A;  3NWT A;  3F8N A;  1Z05 A;  4XIC A;  1Y39 A;  4PJM A;  3GO5 A;  1MD0 A;  3RKW A;  4A3M J;  4YG7 B;  4L9N A;  3C1D A;  1PRV A;  5LGT A;  2VN2 A;  3I71 A;  2WAQ A;  2PXQ A;  4RB2 C;  1I3A A;  3OYD A;  3ECH A;  4FBI A;  2ZME B;  3AL0 C;  4NC8 A;  5JI6 A;  3WGI A;  2BXZ A;  1PRU A;  1ZGJ A;  4A3C J;  5HS9 A;  4A3E J;  1ZK8 A;  2E35 A;  2DMP A;  2W1O A;  2VC0 A;  1XD7 A;  1ZGW A;  3H5N A;  2V1X A;  3QRF F;  1IW7 F;  1QRY A;  2W00 A;  4YEL A;  4Y17 A;  1C0W A;  4B43 A;  2E1N A;  5CPR B;  2ZFW A;  3ZMZ A;  2JVH A;  2DYS H;  1LCD A;  1WHU A;  4A6E A;  5FB2 A;  2PXL A;  2OF7 A;  3DBH B;  4E7K A;  2M8E A;  1QHH D;  1IRG A;  4BUP A;  2IGN A;  2LY9 A;  1RKT A;  4UV9 A;  4UUS A;  4I2O A;  4IZZ A;  2R7F A;  3OYG A;  1PER L;  2ICP A;  1X1P A;  5D8L B;  1SMY F;  2O4A A;  4D9J A;  1ERD A;  5D5X B;  1QQI A;  1QO0 D;  3K10 A;  2DA4 A;  3ZCO A;  1WRJ A;  3RQI A;  1R69 A;  4N4N B;  3O6B B;  4EJU A;  2K9M A;  2ZO4 A;  4EJW A;  1XMX A;  2O3F A;  3RKX A;  3HM5 A;  4CIC A;  2MBF A;  2I5U A;  3H3V K;  1RKW A;  4D1Q A;  2QUF A;  4C3I J;  2ZME C;  1MND A;  4J19 A;  4A69 C;  4LOC A;  1DP3 A;  1YIO A;  1R00 A;  1HA8 A;  3A4C A;  3OIP A;  1TBX A;  3ZQF A;  3OMT A;  3IUO A;  2HIN A;  4UV8 A;  3L2Q A;  3HHG A;  1B4A A;  3BPX A;  1MMN A;  4RM3 A;  1YRN B;  2CUF A;  2NVU B;  2FJR A;  1SFU A;  1FC3 A;  3HPH A;  4WXD A;  1I39 A;  2HQ5 A;  5KAI C;  4B44 A;  1JUS A;  3HJE A;  4P9F A;  2BW3 B;  3J81 Z;  1ETQ A;  1ON2 A;  3NAU A;  4A3D J;  2IRF G;  1KQ9 A;  2VBW A;  5J4Y A;  3OS1 A;  2HDC A;  2K4J A;  3A02 A;  3OQO A;  1JUP A;  2CUE A;  4P55 A;  4I76 A;  2WY7 Q;  3G3Z A;  2OA4 A;  2DMT A;  4NNJ A;  4Y7N J;  1L3L A;  1ZLK A;  2XAJ A;  4KIG A;  3J80 K;  3T5X A;  1SFE A;  4ABZ A;  2X6Y A;  1YIT I;  3KP5 A;  4RS8 A;  3RJP A;  1VQ7 I;  3OP9 A;  3H92 A;  2OTJ I;  2GIV A;  2MYS A;  4XSX F;  1SFO J;  4KIS A;  5GAG i;  5M3F J;  5KNL A;  1VQ9 I;  3K0L A;  3ZMS A;  1BBY A;  4RLF A;  3OS0 A;  2VT2 A;  3ZHM A;  3PL8 A;  3VK0 A;  2XKO A;  1FOW A;  4HRI A;  1IXR C;  4Z5H A;  5LHG A;  1WZ2 A;  1R23 A;  1R1V A;  3EUA A;  3KFW X;  2JVL A;  1LJ9 A;  5FLX Z;  3Q0V A;  4RA2 A;  3JSP A;  4QPQ A;  2YX7 A;  1JGS A;  4ENN A;  1V55 H;  4ER5 A;  2XJ3 A;  4ENJ A;  2PJP A;  2GAU A;  3GLL A;  2H6C A;  1UJ8 A;  5IYC J;  1VTN C;  4C2U A;  1UMQ A;  3GEZ A;  2VL8 A;  1CF7 B;  4XKV A;  4X4E A;  5FKN A;  4UUV A;  2XDV A;  1E3P A;  5JLX A;  2L5Q A;  4A5N A;  3Q3S A;  4IVN A;  1BI3 A;  1W36 C;  4WXC A;  1IAW A;  1WJC A;  2WA0 A;  3EET A;  2CRO A;  5DRT A;  1FYK A;  4I8T A;  4EGZ A;  2IGM A;  2TCT A;  5ICG A;  4Y52 J;  2GRL A;  4I7H A;  2LDU A;  4OIP F;  1ONV A;  2CJJ A;  1ZYR F;  4N0B A;  4BGD A;  2A3S A;  4FX0 A;  5A2Q K;  1IG7 A;  1FBS A;  4BS9 A;  3W2V A;  1G3Y A;  3DXJ F;  3F8B A;  1JHH A;  2UZK A;  3VSL A;  2HFH A;  2QGU A;  4ITV A;  2HR3 A;  1KON A;  1K7A A;  3R1F A;  2D1V A;  3P7N A;  5JUW A;  2KRH A;  2WBM A;  1QPZ A;  3HTU A;  2X0L A;  2E60 A;  3JRF A;  1MGT A;  1ODD A;  5L3G A;  4ZZL A;  5DUI A;  3QOX A;  4YG4 A;  1ETW A;  5E3O A;  3IHU A;  1VFC A;  5ILU A;  1U9O A;  5CVU A;  1FJL A;  4IPA A;  2HEO A;  2M5W A;  4ZYA A;  5DTR A;  1YE9 A;  1JTY A;  2E2I J;  2CH0 A;  4M3B A;  1ITY A;  1W7P D;  4HPQ A;  1OFC X;  5IYB J;  3U9G A;  2STW A;  2L9N A;  3EUS A;  5LBQ A;  1FIP A;  2O0Y A;  1P7I A;  3MKZ A;  4X4D A;  1ZPQ A;  1N25 A;  3KYC B;  4IKF A;  1UEL B;  2K4B A;  1QVT A;  1JGG A;  2QKM B;  1K79 A;  3VWS A;  2OZ6 A;  2VC1 A;  3C2H A;  2M45 A;  4U7B A;  4I02 A;  2MSY A;  3IWZ A;  5FJ8 J;  4D5F A;  4WVL A;  3CME I;  5C4X J;  2DMN A;  1IF1 A;  2VUM J;  4EQZ A;  1RUO A;  1S8N A;  2NOG A;  4UB8 C;  2STT A;  3BDD A;  4KNY A;  3I4N J;  3DU6 A;  2B5A A;  1ZG3 A;  2BNO A;  3M1E A;  1TQM A;  2F4O B;  1K4T A;  3GTM J;  1XSX A;  1XX5 A;  1BIA A;  2JRT A;  3KLO A;  4BAY A;  4YIF A;  3AFH A;  3HRS A;  4J1X A;  4DE8 A;  3U3W A;  3OSG A;  3GZC A;  4DZP A;  1SVM A;  2LYP A;  1T08 B;  3LFP A;  1Y8R B;  1E0E A;  4OB4 A;  2FML A;  2VBY A;  1AKH A;  3QF3 A;  3DTK A;  5KVR A;  3CUO A;  2H8R A;  2M7A A;  4CYC B;  2Y0S N;  1A6Q A;  2NVQ J;  1VPW A;  4IWR A;  1ZZB A;  1LEA A;  2JTV A;  2P7C B;  2R7V A;  2X1C A;  2IPQ X;  5DSX A;  2AO9 A;  1KU9 A;  4Z59 A;  2M0C A;  3QWL A;  4D7N A;  2QEN A;  4IA8 A;  2XF7 A;  4J01 A;  1X3U A;  2MD5 A;  3HRT A;  3U2R A;  3IP4 B;  4C2T A;  1TP4 A;  1X2M A;  4WWC A;  2BEO A;  2LMD A;  4KIF A;  3LSR A;  4GFB A;  5FD6 A;  4ER3 A;  3H35 A;  1CGP A;  4R8H A;  1HDD C;  2EV0 A;  4CHU A;  3J81 K;  1S3J A;  1T98 A;  4FE4 A;  1B8I B;  1DPR A;  4A0X A;  1FX7 A;  1W0T A;  1IN4 A;  4IJA A;  4HST A;  2XI8 A;  2F48 A;  4X4H A;  2FBH A;  4IHV A;  2EIK H;  3H36 A;  4BXU A;  3JR9 A;  5E3N A;  2PXT A;  4O3M A;  1QVU A;  1LFB A;  1O7F A;  3LA3 A;  3M3Y J;  4YRV A;  1F1Z A;  1V3F A;  2IXS A;  2ZB9 A;  4LG3 A;  5TIS C;  2GQQ A;  4RB3 C;  5C44 J;  3VWB A;  2GXG A;  3CMM A;  4KMU X;  4LLN A;  2O03 A;  5F27 A;  4X4B A;  3KP4 A;  1WI3 A;  1MMD A;  3E97 A;  3I59 B;  4GXO A;  3I56 I;  1RZS A;  5K5R A;  2LY2 A;  1MBE A;  3FMY A;  3LSJ A;  4H4K C;  4Q5S F;  1EF4 A;  2X85 A;  3QAH A;  1T39 A;  1VND A;  3G0T A;  4O5V A;  1WH5 A;  3EUH C;  4GYG A;  1U2Z A;  5FLX K;  2DFE A;  4FN3 A;  2Y0S A;  1HKT A;  3BDN A;  2DOD A;  1WWX A;  4RDU A;  3OYH A;  3GYH X;  3K4N A;  5LRR A;  2KL4 A;  3WTU C;  2LYJ A;  3VYT B;  3MZ8 A;  4G94 A;  3GTP J;  3DLA A;  4HBL A;  2EPF A;  4ESB A;  5L3B A;  2HGC A;  1HCR A;  1NER A;  2J5P A;  1VI0 A;  2JSP A;  3WTT C;  4RGX A;  4ZDO A;  4L5I A;  2VON A;  3BWG A;  3CDH A;  3QOP A;  3JXB C;  4BY7 J;  4Q4Z F;  3TOB A;  5B1B H;  2R5Y A;  2CV2 A;  1X2L A;  1KU3 A;  4MGR A;  2Q8K A;  2L7Z A;  5EDN A;  3KXA A;  3I9V 2;  1YSE A;  2DA1 A;  5GTH C;  2HYF A;  4XRS A;  3O8G A;  2CS3 A;  4S05 A;  1QQB A;  3FX3 A;  2A69 F;  4UVB A;  1JKR C;  1MDM B;  4UNO A;  5L3D A;  4F92 B;  4DE9 A;  3M8E A;  4HW0 A;  4TV7 A;  3L2C A;  2F5E A;  5KK1 A;  2W82 A;  2ICW G;  3WG9 A;  1LDD A;  5BPI A;  1ZUG A;  4BDZ A;  3QYF A;  1R22 A;  3D5R C;  2VJ5 A;  2O49 A;  4KIB A;  1V4R A;  1FY7 A;  5A7L A;  3I4M J;  4BNC A;  2HKO A;  2NAZ A;  2GOM A;  3DLL F;  2R1J L;  4MNU A;  2PXK A;  3E3V A;  3A0H C;  2BBY A;  2PLY A;  4I6Z A;  5HLG A;  2VPL A;  2GRM A;  2K7L A;  2M2E A;  5J1Y A;  4M6X A;  5IPA A;  3BG5 A;  1YQA A;  3TQN A;  1IXC A;  5FKK A;  2PN6 A;  4MHG A;  2ME0 A;  3FXM A;  1T56 A;  3KEQ A;  1LVA A;  3TFL A;  2OR1 L;  1OCC H;  1TW2 A;  2JZY A;  2KMU A;  2CU7 A;  3D0S A;  5HLT A;  3DTI A;  3M07 A;  4Z5D A;  4L0Y B;  2GA1 A;  4DBQ A;  2A6E F;  1UXC A;  1TC3 C;  1BN5 A;  1Y0N A;  4UB6 C;  1ZH5 A;  2L02 A;  2D2W A;  1LCC A;  2EFO A;  4OIQ F;  5DDG A;  2R3S A;  1Y56 A;  3JW4 A;  3K6G A;  1QA6 A;  2XXQ A;  2Y9Y A;  3GW2 A;  3S14 J;  4BY1 J;  3WE3 A;  2EQR A;  3GWZ A;  2L1P A;  3LA2 A;  3IAM 2;  3REO A;  2RQQ A;  2EK5 A;  3VOD A;  3PM1 A;  5TRD A;  2M4K A;  3GFI A;  2VKE A;  3LSK A;  4XQF A;  3DKY A;  4HLX A;  3VDX A;  3FYM A;  3A01 A;  1YHQ I;  3O3K A;  4XMY A;  4KYW A;  2F5V A;  4A3L J;  1HC8 A;  2VKH A;  1DU6 A;  2W48 A;  3HC7 A;  1IUF A;  1X3Z B;  1DPU A;  3OL3 A;  2DA6 A;  1UFM A;  4L9V A;  1SAX A;  1ZR4 A;  1MNM C;  4F8D A;  2Y48 A;  3WU0 A;  2XSD C;  2XIU A;  2JT1 A;  2IVM A;  2LYC A;  4EJO A;  4XOR A;  3I5U A;  2O8X A;  1POG A;  2QYO A;  5GP9 A;  2LVS A;  2EB7 A;  3E1S A;  2Q0O A;  1WQ2 A;  1WH7 A;  3OY9 A;  1IV6 A;  4JBA A;  3V7C A;  2FNA A;  2LK2 A;  3B02 A;  2LRE A;  1HSJ A;  1RZR A;  3K1M A;  1YJ9 I;  4KA4 A;  1FYM A;  3K4L A;  2QZ8 A;  2BVM A;  2F5C A;  1DWK A;  2L4M A;  5K7F A;  3ZRG A;  1K6O A;  3IH2 A;  3R0J A;  5HDN A;  4U88 A;  1FOK A;  3S2W A;  4ETS A;  5GTI C;  5KCM A;  3HOT A;  2MXD A;  3SDG A;  3LMM A;  3PSI A;  4W97 A;  1TW3 A;  4HV6 A;  1JH9 A;  2VJ4 A;  2XB0 X;  2DCE A;  3DEU A;  2ZJP F;  1AA7 A;  1RR7 A;  5JFR A;  3OYA A;  1XGN A;  2OQG A;  4PU4 C;  3GTL J;  3W6J B;  1RIO A;  1LFU P;  3P9K A;  1TWG J;  5J8C A;  4YAR A;  2FX0 A;  2PQ8 A;  2KDZ A;  5CLS A;  3OOP A;  5F0H A;  1YOV B;  2XGE A;  2VI6 A;  3CF2 A;  3ZQC A;  3C18 A;  2LYK A;  2HZD A;  3NRV A;  3GN5 A;  1OLT A;  3K4C A;  4UUS B;  1IGN A;  2CYY A;  9ANT A;  1QU3 A;  2ZXH A;  3BTI A;  4DW6 A;  1BI0 A;  1FLI A;  3V7R A;  5JHU A;  1REP C;  3BR2 A;  1NW3 A;  4BAC A;  1VQ6 I;  2QKL B;  3V4G A;  3S8Q A;  2PI0 A;  1Z3X A;  3E7L A;  3RCO A;  2W25 A;  2G7H A;  5J1R A;  3PE5 A;  3K2Z A;  4LIV A;  2IP2 A;  1GXP A;  3BR1 A;  5IY5 H;  3FIS A;  3Q9V A;  2D5V A;  2CUZ A;  2PXV A;  4IX7 A;  3VYS B;  3JXC L;  4Z58 A;  3GCM A;  2XAG A;  3VB2 A;  4CDG A;  3ASO H;  3BTJ A;  1V5G A;  2E1M C;  5E3L A;  3K70 C;  5D5W B;  3W3C A;  4XOP A;  3CO7 C;  2R7Z J;  1SD5 A;  4AC0 A;  2AHQ A;  1U5T C;  3OWQ A;  2XPW A;  2D45 A;  2F5D A;  2DQR A;  2TDX A;  3WTY C;  1K78 A;  3K7A J;  5FO5 A;  4DYQ A;  1XCB A;  3MZY A;  3E6C C;  1OCR H;  1OCO H;  2FFH A;  3CCY A;  2LD5 A;  1N75 A;  3ONQ A;  2EJR A;  3MVP A;  4C30 A;  3W2W A;  5BQT A;  2V1U A;  2LLV A;  2E7W A;  1Z7L A;  2E7X A;  4UHT A;  3LAP A;  1QP4 A;  1U8B A;  2JA2 A;  3CJN A;  3F0C A;  4BE2 A;  1GUU A;  2L4A A;  2KJB A;  2XF6 A;  2VAS A;  4L0Z B;  2MGQ A;  3BRO A;  4BEH B;  3ZOB A;  3J7Y J;  3IV5 A;  5ED4 A;  1R4M B;  1RC9 A;  4HNU A;  1FNN A;  1P7J A;  4OWR B;  5EEH A;  2B7E A;  2VKV A;  2R4G A;  4A0Z A;  2PUB A;  4KFC A;  4FAS D;  3R4K A;  3LSI A;  3I55 I;  3DPU A;  2L7M P;  3OQM A;  2JSC A;  2NVX J;  2HDW A;  2XAQ A;  4Y4R A;  3UNG C;  3OMY A;  3L9F A;  2E2H J;  2R7D A;  4I98 B;  1WKM A;  1W1W E;  2OU2 A;  4M9Z A;  3T8R A;  3HOV J;  3FBN B;  3EYI A;  4F55 A;  1APL C;  2I8D A;  1D1C A;  5L3F A;  2JVG A;  2JUG A;  5B5E C;  1MBG A;  2R0Q C;  4AIK A;  2KIM A;  5AON A;  1K6Y A;  2P8T A;  4E7J A;  1WSU A;  3RQ4 A;  1EKE A;  4AWX B;  4HNV A;  3H5T A;  4RLQ A;  2CV1 A;  3AL0 B;  3OKZ A;  3BT9 A;  3OS2 A;  2P0W A;  1KYZ A;  4LLL A;  3HZI B;  2EIN H;  3SEQ A;  2AW6 A;  3Q0U A;  1YS6 A;  3KZI C;  4FE7 A;  2BOL A;  5HS7 A;  5E79 C;  2VE9 A;  2H6B A;  1Z7U A;  4U0W A;  1WH8 A;  3HGY A;  3JCU C;  3HOX J;  3VFZ A;  3FIW A;  3BZC A;  1MH4 A;  5TGT A;  1TWF J;  2XAU A;  2P5V A;  3JRC A;  3GXO A;  2ELJ A;  2Z16 A;  3TO7 A;  2XPU A;  2KEK A;  4JX6 A;  2DDA A;  2E1C A;  4A93 J;  4O8B A;  3ZPL A;  2CQX A;  1LEB A;  2JN6 A;  3H5R A;  3ELK A;  4IRG A;  2DFH A;  1ETV A;  4EJT A;  4EAT A;  4HOB A;  2FA5 A;  3PO2 J;  2MD0 A;  1NHA A;  2P6T A;  2MLG A;  1VQ4 I;  3BCA A;  1ETX A;  3BPV A;  3V42 A;  3MD2 A;  4MEY F;  4FX4 A;  5K7H A;  4XKC A;  1N78 A;  3P5J A;  1O57 A;  2DU9 A;  2QF7 A;  2Z3Y A;  2ZJ2 A;  2MC4 A;  2L01 A;  3PNY A;  3K4K A;  3H0G J;  4DNC A;  1IC8 A;  1HDP A;  1L0O C;  3BS3 A;  3S2H J;  3HBL A;  5E8G A;  3SFZ A;  4A0Y A;  4PU8 A;  3M1C A;  4P5O A;  5F04 A;  3CCJ I;  1IN5 A;  1B9M A;  2WTE A;  3I3L A;  4FQG A;  3R09 A;  2UV1 A;  4OAY A;  5K98 B;  1USS A;  3ERE D;  1U5T A;  4G8X A;  5AIQ A;  2E2J J;  1VQO I;  5F0C A;  1MBJ A;  2YR2 A;  3G1O A;  3IC7 A;  3DV8 A;  2K9L A;  3EYY A;  4II3 A;  2LLK A;  3HKZ N;  1J7K A;  2O5R A;  2HCN A;  1OKR A;  3WTW C;  4KN4 X;  4YII A;  1B72 A;  2PMH A;  3C3W A;  5CKT A;  1XGO A;  3PQK A;  4C9Y A;  2PPX A;  1R1T A;  3VPR A;  1Y1W J;  5IT9 Z;  2DW4 A;  1KU7 A;  1R4N B;  2LC2 A;  1N77 A;  2VT3 A;  1IN7 A;  1AKH B;  2OPT A;  5LHI A;  4S04 A;  1Z0X A;  2LKS A;  2W4S A;  4LK0 F;  2Y2Z A;  1S7E A;  3CTA A;  2V26 A;  3HSE A;  1GHC A;  4FT8 A;  5M5W J;  2FF4 A;  2OZU A;  3A0B C;  2MAB A;  3GUD A;  2XF5 A;  4Y33 A;  2WAE A;  3O8H A;  2EIM H;  2Q1Z B;  4BXX J;  1OPC A;  3QU6 A;  4A3G J;  3VSK A;  4MFE A;  1FP1 D;  3BP8 A;  4IHY A;  3CUQ C;  3ME5 A;  5EZH A;  3BZ6 A;  3FKJ A;  1KYW A;  3WG7 H;  5GPA A;  4NC7 A;  5IOY A;  1J59 A;  3LWF A;  5IP7 J;  2GXB A;  1ZLJ A;  5GAH J;  2LNB A;  2Y75 A;  3N05 A;  5CQE A;  2QSG X;  2CQQ A;  1MBH A;  4IXA A;  4BBR J;  4CUG A;  1OCT C;  2WAD A;  2K9Q A;  3R60 A;  3U21 A;  1Z6T A;  1W5C C;  4AD9 A;  2GIZ A;  1JKP C;  3B6C A;  4DBR A;  2JK3 A;  3HSR A;  4KN7 X;  4QWQ A;  4AU7 A;  5EEG A;  3SR4 A;  3ECO A;  3F6V A;  2R7S A;  2UXX A;  4F3Q A;  1SC7 A;  4KIT B;  4B3A A;  3BQY A;  2W85 A;  3ZQQ A;  3KLN A;  1LNW A;  1KGS A;  2W57 A;  4GQM A;  2K40 A;  1ETO A;  3HKZ A;  4Z2Y A;  3S1R J;  2R7Q A;  3PNT A;  4ZYG A;  2IA1 A;  2LYS A;  2CO5 A;  2V1N A;  1FBQ A;  2COB A;  4U7D A;  1HST A;  1O7L A;  2LKX A;  3QP6 A;  1QZZ A;  2V4J C;  3IWF A;  4M3E A;  1WJA A;  2RNJ A;  4G6T B;  2NS7 A;  3TDZ C;  3CD6 I;  4OIN F;  1MKM A;  4B48 A;  1EH6 A;  2QM3 A;  2L49 A;  3BR5 A;  3ZKC A;  2H8W A;  2CV0 A;  1MJA A;  4MFD A;  1X1D A;  3R6S A;  5E1W A;  3L09 A;  3P9I A;  2BVL A;  1BM9 A;  2WV1 A;  4Y3O A;  1VQM I;  2A05 A;  2QBY A;  4PJN A;  3OL4 A;  1RPE L;  3FK7 A;  5KHD A;  4E7I A;  3TBI A;  2R7U A;  2YX4 A;  5DTD A;  3WTV C;  2R5Y B;  4NQW A;  1Q1H A;  4G7O F;  3KEY A;  4HNT A;  4C3H J;  2K27 A;  3NAR A;  5D6F A;  3M8F A;  2COM A;  3SCG A;  1ETK A;  2M34 A;  2PMZ N;  1F4K A;  4CCO A;  3MZH A;  2OAZ A;  1WJF A;  2RRE A;  1XGM A;  2OCC H;  3S1N J;  2X51 A;  3OIO A;  3JRH A;  3LNQ A;  1HW1 A;  1SVO A;  1ZN2 A;  1XN7 A;  1QP0 A;  1T6S A;  3PO3 J;  3NXH A;  2DN0 A;  3MCZ A;  5ICC A;  2JA5 J;  3T8T A;  2CQN A;  5BS6 A;  5DTQ A;  2FSW A;  4V2F A;  5HS8 A;  1PNR A;  4BHP A;  2HOT A;  1HBX G;  2P4W A;  2IJL A;  1JFT A;  2ZNZ A;  2XRL A;  3BR6 A;  3WTZ A;  1HW5 A;  3NRO A;  4KMF A;  4IF4 A;  5C3E J;  4YEJ A;  1WI9 A;  3MQ0 A;  2A5Y B;  3WTX C;  4NUB A;  3F6W A;  2CW7 A;  3ZXS A;  2DA2 A;  1MBF A;  4EV0 A;  4CO8 A;  3CUQ A;  1FIA A;  4RM2 A;  3CCL I;  2CQK A;  2CW8 A;  3L2W A;  2PJR A;  2ELK A;  5EGO A;  1ORK A;  1UHM A;  2LKP A;  3SCF A;  3GZD C;  1U6G A;  4XR6 A;  2FE3 A;  2QCO A;  5M5Y J;  3ZQI A;  1Z67 A;  3HUG A;  4JOM A;  3VOE A;  3JRD A;  2RV8 A;  2GM4 A;  4A12 A;  1ADR A;  4MIM A;  3NQO A;  4X4G A;  1QZY A;  3GF2 A;  4DZJ A;  5FKL A;  3H9G A;  1RIO H;  2DK5 A;  1XC5 A;  1LFP A;  1XSV A;  2HVQ A;  3EQL F;  1JWL A;  3NDB B;  2A5W A;  3LQR A;  3QOE A;  3A01 B;  4RAY A;  1MSF C;  5IT9 K;  3TO9 A;  5CJ9 A;  4CA0 A;  3L00 A;  1K61 A;  2CQ7 A;  2R7T A;  3TP3 A;  1PUF A;  2NNY A;  1BI1 A;  3OWT A;  4EZI A;  1JI8 A;  2KKO A;  4E7H A;  3GBG A;  1MJB A;  2M1B A;  2EWT A;  2LBF A;  2X6O A;  4OMZ A;  1FYL A;  1A31 A;  1BOA A;  1R5H A;  1IZ1 A;  3G4S I;  2OC6 A;  3CJT B;  4BHB A;  2JQ7 A;  2PUA A;  2BJC A;  1S5L C;  1SD6 A;  1G3S A;  2DPU A;  3CEC A;  2O8K A;  1UST A;  2ESH A;  3HRM A;  3SX0 A;  4FIS A;  5FKO A;  3MEJ A;  4X4F A;  1WJD A;  4O6J A;  2L9S A;  3CZ6 A;  4LG0 A;  4A2U A;  1U0J A;  2J7U A;  3WOD F;  4I0A A;  3GUU A;  1UG2 A;  1J0R A;  3RPQ A;  4PFP A;  4XRF A;  3S16 J;  5HOD A;  1VQN I;  1JJ6 C;  5D4S A;  3RZD J;  2L0K A;  2GA2 A;  2ZXJ A;  2G0E A;  3HIF A;  1LPQ A;  2EZL A;  3ABT A;  4MTD A;  3ZQG A;  3PIP F;  1HW2 A;  3DWL E;  3JAM Z;  1BJA A;  1ZTR A;  2VQC A;  2RKH A;  4EVI A;  1Z9C A;  5BMZ A;  1H88 C;  2MQK A;  3I4P A;  4JX5 A;  2IU7 A;  2OFY A;  2WY8 Q;  2K02 A;  2X4H A;  1WET A;  2KFD A;  2UXN A;  5FGM A;  3V8K A;  3TW6 A;  1WJ5 A;  4X1E A;  1BW6 A;  3CO6 C;  3GN5 B;  1EFA A;  4KIC A;  1IO2 A;  1FP2 A;  3FXL A;  4IQ4 A;  1UHW A;  4G9Y A;  2DA7 A;  2FOK A;  1R5G A;  2JMW A;  2H94 A;  3ZN0 A;  4LJZ F;  1I6X A;  4XLH A;  4BQQ A;  1IRX A;  5J4V A;  1AU7 A;  2WIU B;  1FBU A;  1E2X A;  5M5X J;  1HXD A;  3DKW A;  2IBD A;  5ILV A;  5HLI A;  1NEQ A;  4IOA F;  2NOJ B;  1RNL A;  1HOM A;  3QPH A;  3F8C A;  4PCQ A;  2M4H A;  1RES A;  5AIP A;  3OOU A;  1NG7 A;  2FQ3 A;  1V54 H;  6PAX A;  2W7N A;  2A61 A;  1WFX A;  4GRI A;  5E8I A;  2V7F A;  1D5Y A;  1NK2 P;  1MFQ C;  2PXP A;  3KIO A;  5JR3 A;  3HSF A;  4KT6 A;  3X2Q H;  2KLO A;  2BE5 F;  4RBO A;  3G1L A;  1S72 I;  5DCM A;  1ZEL A;  3MFK A;  2JUC A;  1K78 B;  4CCK A;  4HLY A;  2P81 A;  1Y6I A;  1FTZ A;  1XCV A;  2HNH A;  1Z6R A;  2E5Z A;  2EA4 A;  4HDU A;  4RMN A;  1CF7 A;  1PUE E;  4IVZ A;  2PE5 A;  2XAS A;  4FCY A;  1QZE A;  4OIO F;  3GZD A;  1MJ9 A;  2JA7 J;  4I6R A;  4CGZ A;  2QA4 I;  4G6D A;  2M9H A;  5DCF A;  4X4I A;  3KL4 A;  2ZJQ F;  3S3O A;  1G59 A;  4GCV A;  1E17 A;  1WVR A;  2XAF A;  1G2H A;  2ZKZ A;  4EM0 B;  1IN6 A;  2QQ8 A;  1RUN A;  4IHW A;  2DBB A;  3G1M A;  2Z99 A;  1TNS A;  1QPM A;  2K9S A;  2AXT C;  3AKZ A;  2LP0 A;  2MW8 A;  3LFK A;  1R49 A;  2O61 A;  2IT0 A;  2X1D A;  4F93 B;  5HNH A;  1FMV A;  1SFK A;  3KCC A;  5L3C A;  3OYI A;  2PXD A;  2OCE A;  3FXJ A;  4II2 A;  4AIJ A;  1OYW A;  1X2N A;  2ADU A;  2FUG 2;  3QQ6 A;  2P6S A;  2XRO A;  2FXA A;  2P7V B;  3G5G A;  1R36 A;  1RET A;  2ZSI B;  1LVK A;  2PMU A;  3G71 I;  3WE2 A;  3MAJ A;  4A3K J;  2FQ4 A;  3ABL H;  2V9V A;  3MEX A;  1NTC A;  2DLL A;  3HXL A;  2AXZ A;  5DS9 A;  2DYR H;  3CC2 I;  2L7F P;  5F6F A;  1YW8 A;  2HQN A;  2OBP A;  2V1D A;  5BPD A;  2BY3 A;  2DAO A;  1ZS4 A;  4ZTF A;  2VJI A;  1D3Y A;  5GAH i;  1K83 J;  3BJ6 A;  1BC8 C;  4A6D A;  4XLF A;  3RYP A;  1WJE A;  3K4J A;  4D7M A;  5LEK A;  1J9I A;  5E3M A;  3KYD B;  1LDK B;  3FM5 A;  4AVZ A;  4A3J J;  2DJN A;  1OCP A;  2DO7 A;  3K9T A;  3HDD A;  1IDZ A;  4M3F A;  3TO6 A;  5J47 A;  3H0D A;  1LE8 A;  3SDB A;  3CP2 A;  4RB1 A;  2HYJ A;  3V8J A;  2BY2 A;  5EG0 A;  2HKX A;  4Q48 A;  1T95 A;  3L2R A;  1D8K A;  3FMS A;  2VOD A;  1MZB A;  1W7P A;  4HV5 A;  5IOZ A;  5IYD J;  2RVC A;  3J7Z I;  1ACI A;  1FMW A;  5LGN A;  1DDN A;  1FOY A;  4XK4 A;  3QQA A;  1FPQ A;  4IRH A;  4LMY A;  2O7O A;  4XRM A;  4WCG A;  1W0U A;  3IAS 2;  2V3C C;  1VF9 A;  3CCM I;  3IRR A;  2XSJ C;  1Y7Y A;  2JCG A;  4AIH A;  4P9U A;  1UZC A;  3F72 A;  5F1R A;  3PFY A;  4RAF A;  3D1N I;  1JJ8 C;  1Y8Q B;  3LST A;  2GOX B;  4XRS G;  1I5Z A;  1TZL A;  2P5K A;  2BV6 A;  3S2D J;  5B3S H;  3F22 A;  5J40 A;  4XOT A;  1XS9 A;  1IXS B;  1ZRE A;  2YU9 J;  2HTJ A;  4HRA A;  3JXD L;  2WB1 N;  3QPS A;  2Y31 A;  1VQ8 I;  5L3E A;  2L9R A;  2E1M B;  3L2U A;  2KZG A;  3U1D A;  3A9Z A;  1UG0 A;  3J7A O;  3GTQ J;  1U8R A;  1U5T B;  1NH3 A;  2DTR A;  2G7U A;  2HPM A;  5DEQ A;  4BHC A;  1SMT A;  2GWR A;  5DT2 A;  1GXQ A;  4UXN A;  3JAM K;  2KQR A;  3HG9 A;  1AWC A;  2VXZ A;  5GAD J;  2GZW A;  1ZZ7 A;  1JXS A;  3K69 A;  2EBY A;  1T38 A;  3UFD A;  1B72 B;  1R9T J;  3TEL A;  1B6A A;  4FHT A;  3WU2 C;  3KYL A;  3CCV I;  1JUM A;  2LG4 A;  1B8I A;  2L8N A;  3DP7 A;  5CVI A;  1IJW C;  1R7J A;  3OQN A;  3FF5 A;  2LRD A;  2PUG A;  4BBS J;  1WGX A;  3S3M A;  1MSE C;  1ZRC A;  2ZXI A;  4ZTJ A;  1LB2 A;  2OV7 A;  1S6L A;  3JRG A;  2QQ9 A;  4ZH4 F;  2AXV A;  1STZ A;  2L54 A;  1R1U A;  2RQP A;  3KZZ A;  3A1Y A;  4UUT A;  3FMQ A;  3GBF A;  3CJQ B;  2TRT A;  3KE2 A;  4NHJ A;  4B4C A;  3I59 A;  4B1R A;  3CCS I;  2P5L C;  1WIZ A;  1U2W A;  2XHK A;  4I01 A;  1A35 A;  2VOP A;  1W5T A;  5DRY A;  5BNG A;  2DTZ A;  3WTS C;  1TWH J;  3KPH A;  3PUF A;  2DOE A;  1SQ8 A;  3ROU A;  1XPX A;  4PZJ A;  2E1O A;  2YSR A;  4LGW A;  3KP2 A;  3F51 A;  3TP0 A;  1DW9 A;  4QLC U;  4M9S A;  2WB1 A;  4IEJ A;  2PEX A;  4HEA 2;  4H0E A;  2YS9 A;  2BHZ A;  1G8X A;  3HOY J;  2VBZ A;  2YUS A;  2M4G A;  1IDY A;  4PJJ A;  5FRO A;  4OAZ A;  2DQL A;  5ILS A;  2CG4 A;  3N4M A;  1POU A;  3TEP A;  4RAG A;  4E70 A;  4XN0 A;  4XID A;  3GME A;  4M71 A;  3CC4 I;  3QWG A;  3I54 A;  3CDL A;  2R7W A;  2HOE A;  3M9L A;  1HLV A;  2LH9 A;  3MMY B;  2KDO A;  4HX7 A;  4OMY A;  2H09 A;  4PGG A;  1LMB 3;  3KX2 A;  5E1X A;  4CZZ A;  3BG6 A;  3IKT A;  2QEX I;  1VQP I;  3GLX A;  3FXK A;  3AG2 H;  2ZCW A;  1P4W A;  2YU3 A;  4RAZ A;  3DEE A;  1UB9 A;  2IAI A;  1Q1V A;  3COA C;  4XON A;  1TWC J;  3VYU B;  1X1B A;  3FZV A;  5LFA A;  2LCV A;  3PNV A;  5JLW A;  3TOA A;  2KJC A;  2VBX A;  5CVJ A;  2X1E A;  4D5C A;  2V6E A;  3LSM A;  2W24 A;  2DT6 A;  2K85 A;  2EF8 A;  3S17 J;  4PJL A;  4YFN F;  5LHH A;  3WHB A;  5B66 C;  5LGU A;  3H1C A;  4BQA A;  4I6U A;  4KT5 C;  4P96 A;  4LB5 A;  2QBY B;  3FXU A;  3QP5 A;  3TMO A;  4B3X A;  4QIW N;  2MFZ A;  2DFI A;  3GVA A;  5J6X A;  3BJO A;  3CP8 A;  2R5Z A;  2HVR A;  1MH3 A;  4JYK A;  2E19 A;  4ZYH A;  5LRS A;  1Y9Q A;  4NQW B;  2IS2 A;  2HWV A;  2L7K A;  1X3W B;  1U78 A;  3ZMV A;  4JX4 A;  4DJA A;  2Z9O A;  3FBI B;  3F3X A;  4AVP A;  3BTL A;  2DMQ A;  2EZI A;  3KEO A;  2XXA A;  3HTS B;  2Y69 H;  2DA5 A;  2JPB A;  3QYX A;  1MMS A;  4Y42 A;  2K9N A;  4XKW A;  2HOS A;  1KU2 A;  1QNT A;  1B1B A;  4JP0 A;  2BNM A;  2NVT J;  5D6E A;  4PU7 A;  1U9N A;  3DQV C;  2HCS A;  1ZVV A;  4ER7 A;  1Y0U A;  3CC7 I;  3W6V A;  5FLV A;  4DYR A;  2Y9Z A;  1SVL A;  4BH9 A;  1D0Z A;  4B09 A;  4MCX A;  3AAF A;  1XMK A;  1ZR2 A;  5H20 A;  3QYE A;  3FM3 A;  5HDK A;  4OU0 A;  4HZF A;  2KHM A;  2LYR A;  4JCX A;  3E0J B;  3GTK J;  2R7X A;  1B0N A;  2XGD A;  3OYE A;  1WJB A;  2HZT A;  4I0B A;  3PIO F;  5FRN A;  2HSG A;  2NS0 A;  2CSO A;  1RPW A;  2CGP A;  2EZK A;  1U3E M;  2YBD A;  3K2A A;  3OR2 C;  4QSH A;  1S29 A;  4I09 A;  3CUQ B;  4MO7 A;  2IVG A;  1TQP A;  1DGW Y;  5E17 F;  3HYI A;  4LLG F;  2IGK A;  4BQN A;  3G6E I;  2DPD A;  4NBQ A;  4Y13 A;  2PJR B;  2VB6 A;  3FYA A;  3CCE I;  1JT6 A;  2ZNY A;  2J7W A;  5EGO B;  2JWT A;  4FET A;  3JTG A;  2XUB A;  3PQJ A;  5CVR A;  1YFH A;  2EFQ A;  2AXL A;  2QSH X;  4QTR A;  1J2X A;  1JFS A;  2GLO A;  4F91 B;  3L7W A;  3HUG B;  4XKB A;  1PRA A;  4EK9 A;  1I1G A;  3BY6 A;  4X0G A;  3GZ5 A;  2LNM A;  4JQD A;  1ZHF A;  1RZ4 A;  2FD5 A;  2WC2 A;  2F6C A;  4N4O B;  3F23 A;  4HF2 A;  4BJT A;  5B1A H;  1UXD A;  3RZO J;  2HI3 A;  3NEU A;  4B8X A;  3SJM A;  3DBR B;  3BQZ A;  4HSR A;  1B59 A;  2KEI A;  5M3M J;  3S1Q J;  3HGG A;  1UTX A;  2FNP A;  1PUF B;  4XLA A;  2XGX A;  1BA5 A;  3SHF A;  4M6Y A;  4YBA A;  2ACJ A;  3HL2 A;  1P2F A;  3A2K A;  2EWN A;  2L9V A;  1RI7 A;  3CLO A;  2LBF B;  2BNN A;  2K86 A;  1ZRF A;  2AS5 F;  1PYV A;  1ULY A;  2LYQ A;  3LQX A;  1OIS A;  3QOW A;  2Z5U A;  2X6W A;  3ZN1 A;  2JA8 J;  2IV1 A;  2LYL A;  1W36 D;  1PDN C;  5FD5 A;  4JQF A;  2HFZ A;  5HOO A;  5IP6 A;  1YS7 A;  4LG0 B;  3PFI A;  3MLF A;  3H3U A;  4UVA A;  3BJA A;  4J00 A;  5HLH A;  1RR8 C;  2ME6 A;  3OYL A;  4EMS A;  2M30 A;  2BXY A;  5HNF A;  1WPK A;  3H5A A;  2XGC A;  1OSL A;  2LOO A;  4PSX A;  1T8I A;  2QQA A;  2DDB A;  5KAF C;  2OJE D;  3RKY A;  4R1H A;  1DU0 A;  3UR3 C;  1BDI A;  1XDU A;  3OYF A;  4MEX F;  3DPT A;  5F64 A;  4ZDP A;  4G7H F;  1OJL A;  3KJX A;  3ZPX A;  1E3H A;  1X19 A;  4Z6Y A;  1PVE A;  4EM1 A;  3LSP A;  1K4S A;  4XL9 A;  4UY8 I;  3GTG J;  1S7A A;  3BC8 A;  4HX4 A;  2HDD A;  1JT0 A;  5E1Z B;  2O9L A;  2J5O A;  4ASN A;  1G3W A;  2ZSH B;  3RKQ A;  2PBI A;  3CQZ J;  2HQR A;  3CES A;  4XLC A;  5DM7 F;  2C6Y A;  2R7R A;  3F8M A;  2ELH A;  3SFI A;  3UWP A;  4YFX F;  4KDP A;  3T0Y A;  1PP8 F;  5DYM A;  1VQK I;  2EFN A;  4XNF A;  3D5S C;  4PK4 A;  4FTH A;  1KA8 A;  5JVG F;  4OOI A;  3FXR A;  4G12 A;  1ZKG A;  4Y15 A;  3OYM A;  3S93 A;  4BEH A;  2VKD A;  4ER6 A;  3I58 A;  5ICF A;  4EEF G;  2Z2S B;  3LAJ A;  3S3N A;  1XSD A;  3ABM H;  2LF7 A;  1QP7 A;  2PUC A;  5H2F C;  1TLH B;  1ETY A;  2WV0 A;  1BIB A;  4PSW A;  3HEF A;  2B9S A;  4S0H B;  3W6K B;  1JKQ C;  5GAE J;  3M9A A;  1G6N A;  3QPT A;  4B47 A;  2HTS A;  4RGS A;  2E36 A;  4LD5 A;  2EFW A;  2NNN A;  3LL7 A;  2KRF A;  2EV6 A;  2Q2E A; 
#chains in the Genus database with same CATH homology
 3IH2 A;  1A6I A;  1I50 J;  2DA7 A;  2CSF A;  3JRB A;  4IHX A;  2AWI A;  3JRA A;  3O9X A;  3SDG A;  1SAN A;  2JMW A;  4W97 A;  5C4J J;  5K7Z A;  1JH9 A;  2XB0 X;  1BDH A;  3WHC A;  1RR7 A;  1AU7 A;  4AYB N;  2WIU B;  1UHS A;  3B7H A;  2LTP A;  4PU4 C;  5M5X J;  3GTL J;  3CRO L;  1RIO A;  2IBD A;  1LFU P;  3DCF A;  1QPI A;  1TWG J;  5F1J A;  1NEQ A;  2KPJ A;  4YAR A;  2FX0 A;  2LR8 A;  2KDZ A;  3ZQL A;  1HOM A;  3BTC A;  1F43 A;  1RES A;  5F0H A;  2IUO A;  1E3O C;  3OOU A;  2XGE A;  2VI6 A;  3ZQC A;  4XIC A;  2LYK A;  4A3M J;  1D5Y A;  1NK2 P;  3GN5 A;  3TRB A;  4YG7 B;  1PRV A;  4UUS B;  1IGN A;  2FJ1 A;  9ANT A;  5FLM J;  4RBO A;  3G1L A;  3BTI A;  4DW6 A;  4FBI A;  2EH3 A;  3BR2 A;  2HXI A;  2P81 A;  1FTZ A;  1PRU A;  4A3C J;  3S8Q A;  4A3E J;  2IEK A;  3E7L A;  1ZK8 A;  2B63 J;  1FTT A;  2DMP A;  1F36 A;  4IVZ A;  5J1R A;  4FCY A;  1ZGW A;  3RZZ A;  2PE5 A;  4PU3 C;  2JA7 J;  4I6R A;  2O38 A;  1I3Q J;  3BR1 A;  2M9H A;  1QRY A;  3FIS A;  2D5V A;  4X4I A;  2NS8 A;  2KT0 A;  1IRZ A;  3JXC L;  4Z58 A;  4A3B J;  1ZAY A;  1G2H A;  1LCD A;  3L1P A;  2OF7 A;  4IHW A;  3BTJ A;  5E3L A;  3G1M A;  2R7Z J;  4AC0 A;  2AHQ A;  2K9S A;  2R63 A;  2LY9 A;  1RKT A;  4UUS A;  2LP0 A;  2MW8 A;  3S1M J;  1GVD A;  4GHJ A;  2XPW A;  3FKI J;  1PER L;  3A03 A;  2X9D A;  2O4A A;  3K7A J;  1GT0 C;  1X2N A;  3QQ6 A;  4DYQ A;  1JKO C;  1LE8 B;  2DA4 A;  3CCY A;  2LD5 A;  3G5G A;  3RQI A;  3MVP A;  5EG0 B;  1R69 A;  1RET A;  1QP4 A;  3HM5 A;  1U8B A;  1A5J A;  4A3K J;  2FQ4 A;  3H3V K;  1RZR D;  2MEZ A;  1RKW A;  3F0C A;  1GUU A;  1NTC A;  2AXZ A;  2MGQ A;  4C3I J;  5DS9 A;  3ZOB A;  3LOC A;  4J19 A;  2L7F P;  4A69 C;  3IV5 A;  4LOC A;  1P7J A;  1XWR A;  1ZS4 A;  3ZQF A;  3OMT A;  2VKV A;  3UKG A;  1K83 J;  2HIN A;  2PUB A;  1GV5 A;  4W1U A;  3GTJ J;  2FJR A;  2EZH A;  1YRN B;  2CUF A;  1MBK A;  4D7M A;  2HQ5 A;  2L7M P;  3OQM A;  5E3M A;  1JUS A;  3TW7 A;  2NVX J;  1ETQ A;  3NAU A;  3S15 J;  4A3D J;  4A3J J;  3GTO J;  2DJN A;  1OCP A;  3HDD A;  1IDZ A;  2Y30 A;  4M3F A;  1LE8 A;  2E2H J;  3A02 A;  3OQO A;  4BKX A;  1JUP A;  2CUE A;  2HYJ A;  5EG0 A;  4I76 A;  2WUS R;  3LIS A;  2DMU A;  2DMT A;  3HOV J;  4Y7N J;  5IOZ A;  5IYD J;  1APL C;  4X4C A;  4ABZ A;  1H8A C;  2CRG A;  4XK4 A;  3OP9 A;  3QQA A;  1SFO J;  4M3D A;  2ECC A;  5M3F J;  4NDW A;  1MBG A;  2R0Q C;  4XRM A;  2O7O A;  2GZU A;  3IVP A;  1W0U A;  1VF9 A;  1Y7Y A;  2JCG A;  3ZHM A;  3VK0 A;  4MCT A;  2IVB A;  1YRN A;  4HNV A;  3H5T A;  3D1N I;  4Z5H A;  1JJ8 C;  3BT9 A;  4XRS G;  2JVL A;  4X6A J;  3S2D J;  3HZI B;  3Q0V A;  2AW6 A;  3Q0U A;  4FE7 A;  1XS9 A;  2ICT A;  1O4X A;  2YU9 J;  1WH8 A;  3HGY A;  3HOX J;  2XJ3 A;  3JXD L;  2N8G A;  2WB1 N;  3FIW A;  3QPS A;  2Y31 A;  4J1W A;  1MH4 A;  5IYC J;  3Q0W A;  2L9R A;  1TWF J;  3BR0 A;  1UMQ A;  3JRC A;  2XPU A;  4X4E A;  4JX6 A;  5FKN A;  4C3J J;  2KEK A;  4A93 J;  3GTQ J;  4O8B A;  3B6A A;  5JLX A;  2CQX A;  2JN6 A;  3Q3S A;  2CRO A;  4I8T A;  1BL0 A;  1ETV A;  2TCT A;  3PO2 J;  4Y52 J;  1ZZ8 A;  2GRL A;  2CJJ A;  1ZZ7 A;  1ETX A;  1IG7 A;  2EBY A;  3UFD A;  1B72 B;  5K7H A;  1R9T J;  1LQC A;  2QF7 A;  1JUM A;  1B8I A;  2L8N A;  3R1F A;  1IJW C;  3H0G J;  3OQN A;  1IC8 A;  1QPZ A;  1HDP A;  3BS3 A;  3JRF A;  3S2H J;  3HBL A;  2PUG A;  4BBS J;  1WGX A;  3FK6 A;  1MSE C;  4PU8 A;  5F04 A;  4YG4 A;  1ETW A;  5E3O A;  5K98 B;  3JRG A;  1ZZ6 A;  2JJ7 A;  3QPL A;  2E2J J;  1VFC A;  5F0C A;  1MBJ A;  1U9O A;  3TED A;  1FJL A;  3G1O A;  2AXV A;  4UUT A;  1HF0 A;  2LLK A;  4M3G A;  3HKZ N;  3GBF A;  2TRT A;  1JTY A;  4B4C A;  2E2I J;  4B1R A;  1GDT A;  3HOZ J;  3JRI A;  1L1M A;  4M3B A;  1ITY A;  1BJZ A;  1WIZ A;  5IYB J;  1OFC X;  3EUS A;  1B72 A;  1FIP A;  1P7I A;  4X4D A;  2EBI A;  1ZPQ A;  5BNG A;  2DTZ A;  1Y1V J;  3VPR A;  2PPX A;  1Y1W J;  1TWH J;  3SCH A;  3IH3 A;  1SQ8 A;  1ZZ9 A;  1QVT A;  1JGG A;  1AKH B;  2OPT A;  2E1O A;  1Z0X A;  2MSY A;  5FJ8 J;  1XG1 A;  4D5F A;  3F51 A;  5C4X J;  2Y2Z A;  1S7E A;  3TP0 A;  2DMN A;  1DW9 A;  2PUF A;  4DYC A;  4IEJ A;  1FEX A;  2YS9 A;  2VUM J;  1I6H J;  5M5W J;  3HOY J;  2YUS A;  2NOG A;  3I4N J;  2ICP A;  2BNO A;  2B5A A;  1IDY A;  1H89 C;  2XPV A;  3O8H A;  3GTM J;  4BXX J;  1POU A;  3U3W A;  4J1X A;  4A3G J;  4XID A;  3QWG A;  3OSG A;  4MFE A;  3CDL A;  2R5Z B;  4IHY A;  4DZP A;  3DNV B;  2LYP A;  3LFP A;  5EZH A;  1HLV A;  2KEJ A;  5GPA A;  4OB4 A;  1LMB 3;  5IOY A;  5IP7 J;  1AKH A;  2M8G X;  3QF3 A;  5J3L A;  2H8R A;  2CQQ A;  1MBH A;  2Y0S N;  4BBR J;  4CYC B;  2NVQ J;  1OCT C;  1ZZB A;  2K9Q A;  1VPW A;  2IAI A;  1Q1V A;  2KZ8 A;  4IWR A;  5F08 A;  1TWC J;  1JKP C;  3B6C A;  2LCV A;  5JLW A;  1X58 A;  2AO9 A;  3OSF A;  1R63 A;  2JK3 A;  2VPR A;  1JTX A;  4Z59 A;  4D5C A;  2M0C A;  4D7N A;  4IA8 A;  2EF8 A;  3S17 J;  4B3A A;  3BQY A;  3WHB A;  5IP9 J;  4I6U A;  2MG4 A;  1CJG A;  3HB9 A;  1ZQ3 P;  3ZHI A;  4QIW N;  2R5Z A;  4GQM A;  2K40 A;  1ETO A;  1MH3 A;  4JYK A;  2E19 A;  3S1R J;  2H1K A;  2I10 A;  2PUE A;  1X2M A;  1Y9Q A;  3LSR A;  2LYS A;  5EF6 A;  2COB A;  1U78 A;  4GFB A;  4JX4 A;  3G7D A;  2LKX A;  4CYC A;  3BTL A;  1HDD C;  2DMQ A;  2EZI A;  4M3E A;  2NS7 A;  4FE4 A;  3QYX A;  2DA5 A;  1B8I B;  4Y42 A;  2K9N A;  2HOS A;  3HOU J;  1LLI A;  2JA6 J;  1W0T A;  2L49 A;  3BR5 A;  2XI8 A;  4X4H A;  3ZKC A;  4IHV A;  1Z77 A;  3JR9 A;  2GBY A;  4MFD A;  5E3N A;  5EYR A;  4JP0 A;  3CMY A;  2NVT J;  2BNM A;  4Z5C A;  2WV1 A;  1QVU A;  5J1U A;  4PU7 A;  1LFB A;  1U9N A;  2ECB A;  1RPE L;  2ID3 A;  3FK7 A;  3M3Y J;  1ZVV A;  3W6V A;  1WCM J;  3C2B A;  2ZB9 A;  4DYR A;  2Y9Z A;  5FLV A;  5DTD A;  3BD1 A;  5C44 J;  2LFB A;  2R5Y B;  5F0F A;  4MCX A;  1ZR2 A;  5F27 A;  4X4B A;  1WI3 A;  4JCX A;  4A3F J;  1RZS A;  2LYR A;  3GTK J;  4C3H J;  1B0N A;  1MBE A;  2XGD A;  3FMY A;  3LSJ A;  1EF4 A;  3NAR A;  1VND A;  4NDL A;  2HSG A;  2HOA A;  3SCG A;  1WH5 A;  1RPW A;  1ETK A;  2M34 A;  2PMZ N;  4FN3 A;  4YG1 A;  3BDN A;  2NVY J;  2LYJ A;  4RDU A;  2EZK A;  3S1N J;  3GTP J;  3OIO A;  3JRH A;  3K2A A;  3LNQ A;  1HCR A;  4QSH A;  1NER A;  1QP0 A;  1VI0 A;  4MO7 A;  3HOW J;  2IVG A;  3PO3 J;  2ID6 A;  3M4O J;  3BG9 A;  5EZG A;  3FYA A;  2DN0 A;  1JT6 A;  1BW5 A;  3JXB C;  4BY7 J;  5EGO B;  2JA5 J;  5GPC A;  2JWT A;  1X2L A;  2R5Y A;  4JCY A;  3F52 A;  4V2F A;  4QTR A;  1JFS A;  1PNR A;  2L7Z A;  5EDN A;  4AUX A;  2GLO A;  2HOT A;  1PRA A;  3KXA A;  1JFT A;  1CQT A;  2DA1 A;  1YSE A;  2XRL A;  3BR6 A;  4JQD A;  4XRS A;  1AHD P;  3O8G A;  1QQB A;  2FD5 A;  1UXD A;  5C3E J;  3RZO J;  2HI3 A;  1JKR C;  2RAE A;  3SJM A;  3BQZ A;  3F6W A;  2KEI A;  2DA2 A;  1MBF A;  5M3M J;  3S1Q J;  1ZUG A;  3HGG A;  1UTX A;  4V2G A;  1PUF B;  5EEA A;  1BA5 A;  1FIA A;  2O49 A;  3PXP A;  4YBA A;  3MKL A;  5A7L A;  3I4M J;  2ELK A;  3JRE A;  5EGO A;  2BNN A;  1ORK A;  3SCF A;  2R1J L;  4M6V A;  2LYQ A;  2QCO A;  5M5Y J;  2XCJ A;  3ZQI A;  1GV2 A;  3KZ3 A;  4I6Z A;  3JRD A;  2JA8 J;  2IV1 A;  2LYL A;  2GM4 A;  1NK3 P;  1ADR A;  4MIM A;  2A6C A;  5IP6 A;  4X4G A;  4DZJ A;  2M2E A;  5FKL A;  5J1Y A;  2DA3 A;  1WH6 A;  2GRM A;  5IPA A;  3MLF A;  3BG5 A;  1XC5 A;  4I6T A;  1QQA A;  5FKK A;  1JWL A;  2ME6 A;  4MLO A;  2ME0 A;  3A01 B;  1T56 A;  2OR1 L;  1MSF C;  1WPK A;  2XGC A;  4Z5D A;  2CU7 A;  1K61 A;  1OSL A;  2X48 A;  3TP3 A;  1UXC A;  1PUF A;  1DU0 A;  1TC3 C;  1BDI A;  3GBG A;  3DEW A;  1LCC A;  2EWT A;  2X6O A;  1OJL A;  3KJX A;  3LSP A;  2R93 J;  2PUD A;  2AUW A;  3GTG J;  3IH4 A;  2PUA A;  4L5E A;  2Y9Y A;  1JT0 A;  2HDD A;  3S14 J;  2BJC A;  4BY1 J;  2O9L A;  3CLC A;  3CEC A;  3RKQ A;  2O8K A;  2EQR A;  2HXO A;  3CQZ J;  2WAQ N;  4FIS A;  5FKO A;  4X4F A;  3BR3 A;  3PM1 A;  3LSG A;  3SFI A;  2IVQ A;  2VKE A;  1X57 A;  3FYM A;  3A01 A;  4A3L J;  2PIJ A;  1UG2 A;  3BG3 A;  1DU6 A;  2W48 A;  4FTH A;  3S16 J;  1IUF A;  5HOD A;  1JJ6 C;  4G12 A;  4C2M J;  1ZKG A;  2DA6 A;  1MNM C;  3RZD J;  2L0K A;  1ZR4 A;  4F8D A;  2G0E A;  2XSD C;  2XIU A;  2EZL A;  4EEF G;  1POG A;  3ZQG A;  4A3I J;  5GP9 A;  2LVS A;  1QP7 A;  2MQK A;  1ZTR A;  1H88 C;  1WH7 A;  2PUC A;  4JX5 A;  1IV6 A;  2AXU A;  1T33 A;  1ETY A;  1ZZC A;  2IU7 A;  2OFY A;  2LK2 A;  3HEF A;  1WET A;  4S0H B;  1JKQ C;  2XB5 A;  1RZR A;  1TWA J;  3TW6 A;  4X1E A;  1BW6 A;  3GN5 B;  1ENH A;  3MN2 A;  5FKM A;  5K7F A;  3ZQH A;  2R92 J;  1DWK A;  1EFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...