1O4XA

Ternary complex of the dna binding domains of the oct1 and sox2 transcription factors with a 19mer oligonucleotide from the hoxb1 regulatory element
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
129
Chain Sequence
b'EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMAKLKPLLEKWLNDAESIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*TP*CP*TP*TP*TP*GP*TP*CP*AP*TP*GP*CP*TP*AP*AP*TP*
publication title Molecular basis for synergistic transcriptional activation by Oct1 and Sox2 revealed from the solution structure of the 42-kDa Oct1.Sox2.Hoxb1-DNA ternary transcription factor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 41
structure length 129
sequence length 159
ec nomenclature
pdb deposition date 2003-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
A PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1o4xA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1o4xA01
3PO2J 1LQCA 5JLXA 2NOGA 4RDUA 4A3GJ 2BNOA 2HSGA 1R9TJ 4Z5CA 3JRBA 3SCFA 2ME6A 4IA8A 2GRMA 4NDWA 1MH3A 2CUEA 2O49A 2LK2A 2LYRA 1VF9A 1GUUA 1WPKA 2R5YA 2EF8A 1ZS4A 2R5ZB 2ICPA 5K7HA 1RPEL 3JRGA 1JFSA 1BDHA 1T56A 3CROL 3GTMJ 2XGEA 3GN5B 5F0FA 1GV5A 2EH3A 3O9XA 1K61A 2DA7A 4Z58A 1U9NA 1PRUA 1JUPA 4BXXJ 2LVSA 5F04A 5C4JJ 4A3BJ 1Z0XA 1EF4A 1OFCX 3SJMA 4X1EA 4J1XA 2JMWA 4FCYA 2DA5A 4M3GA 1B72A 3E7LA 1X2MA 3PXPA 3ZQCA 1GV2A 4A3IJ 3HM5A 1MSEC 1SFOJ 2LYKA 4C3JJ 4PU4C 1GVDA 3FKIJ 5C3EJ 3WHCA 4XIDA 2IBDA 2XCJA 1FJLA 2PUGA 3KJXA 2JN6A 1Y1VJ 1ZUGA 1H88C 2PMZN 2DA3A 3A01B 2R63A 3OQMA 3F0CA 1ENHA 2JA7J 2E1OA 4IHWA 3ZQIA 2R5ZA 3Q3SA 1RETA 2LTPA 1H8AC 9ANTA 2CQXA 4A3EJ 1Y1WJ 2I10A 2DA4A 3C2BA 2G0EA 3GTGJ 1NERA 3GN5A 2KEKA 1QP0A 1GT0C 1ETVA 3ZQFA 5M5YJ 3G1MA 5E3NA 4IEJA 4A3LJ 3SFIA 4X4HA 1NK3P 4BBSJ 2K9SA 2JJ7A 4FTHA 2LYJA 2IAIA 3M4OJ 2JK3A 3FYAA 4S0HB 2NVYJ 5IPAA 3BQYA 3LNQA 4M6VA 1ZR2A 1ZKGA 4MFDA 1B8IB 1XG1A 3MN2A 3TRBA 1Y7YA 2JA6J 4MCXA 1WETA 3G7DA 4M3BA 2CROA 2M0CA 2JWTA 1OCPA 2MQKA 1ZZ6A 5IYDJ 2NS7A 4Y52J 4JYKA 1U78A 4DW6A 2O4AA 1CQTA 2GM4A 2PUAA 4FN3A 3IVPA 3HB9A 3MLFA 1ZR4A 1JKPC 1IRZA 4NDLA 2XGDA 2Y0SN 4J19A 3A01A 4MFEA 4D5FA 3S1NJ 2AXUA 1MBEA 2AXVA 5A7LA 5E3OA 3JRFA 2BJCA 1RZRD 2XPUA 1JJ8C 5E3MA 1UHSA 3S15J 3TP3A 2E2HJ 2O9LA 3I4NJ 2KEIA 1QQBA 2EWTA 2OR1L 2VPRA 2EZIA 1QQAA 3FIWA 2X9DA 2EZLA 1JTYA 3JRAA 2EQRA 1LE8B 1X2NA 3HZIB 3QPLA 1B8IA 4X4EA 2XI8A 4MCTA 1JJ6C 2R7ZJ 4A3MJ 3KXAA 1IG7A 2KZ8A 2X48A 2DMQA 1FIAA 2E19A 2Y9ZA 2O38A 2DA1A 1IJWC 5F0HA 2WIUB 3S2DJ 1I3QJ 1IDYA 1QVUA 2O8KA 4Z5DA 4PU3C 1IDZA 4Y7NJ 2DJNA 1APLC 3BTLA 3SCHA 2FX0A 1LFUP 3HGGA 1LFBA 4CYCB 2HOTA 1PRAA 2DTZA 3GTQJ 5IYBJ 1WGXA 3JXDL 4I8TA 2DA2A 3HOYJ 2H8RA 1W0UA 4AC0A 1LLIA 3FMYA 3CQZJ 3GBGA 3B7HA 4JP0A 3K2AA 2R93J 1TWHJ 4X4BA 2OPTA 2AXZA 1VFCA 2VKEA 3BTIA 2EBYA 2ICTA 1Z77A 2CRGA 2DMUA 3IH3A 4JCYA 3IH2A 1BA5A 4UUSB 1WH7A 1QVTA 2XRLA 2LYLA 2WUSR 4M3EA 2VKVA 4W1UA 1AU7A 1WI3A 1GDTA 3M3YJ 3GBFA 1BL0A 4I6ZA 3NAUA 3HOVJ 1UG2A 4GFBA 2YUSA 5FKLA 3HBLA 3BQZA 1ZZCA 1P7IA 1HOMA 1BW6A 1ETWA 1OSLA 3RZDJ 4Z5HA 1MBJA 1R69A 4B4CA 2HDDA 1ZZBA 1TWAJ 4PU8A 1LMB3 2LR8A 3FK7A 1WH8A 2ME0A 4Z59A 4CYCA 3OQOA 1JT0A 2YU9J 4X4GA 1XC5A 3D1NI 3S14J 4MLOA 2BNMA 1VI0A 3TP0A 2MW8A 4I6UA 1ZAYA 3ZHIA 4XK4A 4DYCA 1BJZA 2L7MP 4X4CA 3CLCA 3UFDA 3IV5A 3PO3J 1ZVVA 3BTJA 4JX6A 4J1WA 1JH9A 2X6OA 1ZZ7A 1K83J 1X58A 1XWRA 1UXDA 2AWIA 5EYRA 1ETYA 1Q1VA 5GPAA 1MBKA 4DYRA 1X57A 2N8GA 1QRYA 1WCMJ 4UUSA 4X4DA 2K40A 1POUA 3Q0WA 1HF0A 2LD5A 3EUSA 2XIUA 3JXBC 1HLVA 2DA6A 1R63A 3HOWJ 4I76A 2NS8A 4B3AA 1W0TA 1MNMC 3BTCA 2K9NA 2LKXA 5GP9A 1X2LA 1T33A 3B6AA 5IOYA 1NEQA 3F51A 5BNGA 2D5VA 3GTPJ 1PNRA 3BG9A 4FISA 3FYMA 2E2IJ 2HOSA 2KEJA 3GTJJ 2LLKA 4X4FA 2MGQA 3TW6A 1JKRC 2A6CA 1ZZ8A 1DWKA 4PU7A 2KDZA 4I6RA 1YRNB 3DNVB 2YS9A 2HI3A 1UTXA 1RKWA 5IOZA 4XRSA 2L0KA 4A3CJ 2DMPA 3S16J 3FK6A 2MG4A 2QF7A 4LOCA 5FJ8J 4EEFG 3TEDA 3HDDA 1UMQA 1AHDP 3LFPA 5C44J 3F6WA 5DS9A 2WAQN 1PRVA 1IC8A 3BR1A 5K98B 4A3FJ 3HOXJ 4YBAA 1F36A 2M34A 2PE5A 5M5XJ 1SQ8A 1AKHB 2ECCA 3MKLA 4YARA 2GRLA 3HEFA 2M2EA 4ABZA 4C3HJ 4MO7A 2XSDC 1ETOA 3A03A 4C3IJ 1QPIA 3B6CA 2AW6A 2LYSA 5EZGA 2B63J 1A6IA 1A5JA 4D7NA 1ZTRA 2LYPA 1EFAA 3S1QJ 5FLMJ 1JGGA 5J1YA 3RQIA 4D7MA 1JKQC 3I4MJ 1U8BA 2XB0X 2BNNA 4F8DA 2DN0A 1VPWA 4IWRA 4GQMA 2FJ1A 1ZQ3P 1YSEA 1YRNA 2GBYA 5FKOA 1G2HA 1L1MA 2VI6A 4IHXA 1TWGJ 2R1JL 4GHJA 1WIZA 5EZHA 2AO9A 2LFBA 2Y2ZA 4V2GA 1P7JA 1HDPA 5K7ZA 1U9OA 3OIOA 1ADRA 3RZOJ 1JKOC 1FTZA 3S8QA 2Y31A 3G1OA 3OQNA 2O7OA 1WH6A 1TWFJ 4A3JJ 1AKHA 5EEAA 4BY1J 1UXCA 2IEKA 4AUXA 4V2FA 1PUFB 1JUMA 2K9QA 3QF3A 4BY7J 4C2MJ 2PUEA 2DMNA 3K7AJ 3JRCA 1MSFC 1TC3C 1ORKA 2CQQA 1LE8A 4O8BA 1MBGA 1E3OC 4YG1A 4L5EA 3BT9A 1I6HJ 2IVQA 1B0NA 4A69C 1QP7A 2PUCA 2FD5A 5IP9J 5DTDA 2CU7A 2EZHA 3L1PA 2VUMJ 2FQ4A 2ID6A 1IGNA 4G12A 1F43A 3O8GA 5M3FJ 1JWLA 1FTTA 3DEWA 3R1FA 3HOZJ 3JREA 2EZKA 3H0GJ 3OSGA 2GLOA 4A3KJ 3W6VA 4OB4A 3GTKJ 2JA5J 2HXIA 3JRDA 1O4XA 3HKZN 2R0QC 1S7EA 1OJLA 2HYJA 1RKTA 2M9HA 4X6AJ 3KZ3A 4IVZA 2LCVA 5F08A 2HINA 1RZRA 1HCRA 3JRHA 1DU0A 3F52A 1QPZA 2P81A 3A02A 5F1JA 2CSFA 5M5WJ 3OP9A 5HODA 1XS9A 2ELKA 2XPVA 4DYQA 3QQAA 3GTLJ 2IV1A 5M3MJ 1PUFA 5JLWA 2XJ3A 4JX5A 3LISA 2HOAA 3MVPA 2L49A 3UKGA 1ETKA 1JTXA 1SANA 2KPJA 4B1RA 3H3VK 3BDNA 2IVBA 1ZPQA 1NK2P 2NVTJ 2PPXA 2ZB9A 3NARA 2ID3A 4FBIA 3ZKCA 4M3FA 1PERL 1OCTC 3HGYA 3RKQA 2R92J 2B5AA 2QCOA 5FKNA 5J3LA 4HNVA 4W97A 1DU6A 4BBRJ 1JFTA 3OMTA 3O8HA 1CJGA 3JR9A 1D5YA 2TCTA 5K7FA 1LCDA 3G5GA 2PUFA 2KT0A 2EBIA 4JQDA 2PIJA 1DW9A 2ECBA 1ITYA 1FEXA 2OF7A 2CUFA 2MEZA 2JA8J 3RZZA 3OSFA 3S17J 5C4XJ 5EG0B 4UUTA 5IP6A 3WHBA 1ETQA 5F27A 4FE4A 5E3LA 3U3WA 1TWCJ 5F0CA 1JUSA 1RESA 2WV1A 1VNDA 3FISA 3OOUA 4XRSG 4JCXA 4AYBN 2OFYA 2HQ5A 5EDNA 2HXOA 1IUFA 4A93J 3ZOBA 5IP7J 1RPWA 4BKXA 4YG7B 2Y30A 3BR0A 1QP4A 3CMYA 3QPSA 4JX4A 4XICA 2WB1N 4QTRA 1MBFA 3G1LA 4YG4A 3IH4A 1ZK8A 3Q0UA 3ZQHA 4DZPA 3BS3A 1ZGWA 3BR2A 3LOCA 3SCGA 3DCFA 2TRTA 4MIMA 2JCGA 3JXCL 2IU7A 2XPWA 3QQ6A 2CJJA 5FLVA 5EG0A 3BG5A 1JT6A 1HDDC 4IHVA 2GZUA 3LSPA 3QYXA 5GPCA 3BG3A 5EGOB 2IUOA 4D5CA 3VPRA 3CCYA 3CDLA 4DZJA 3S1MJ 3BR5A 5FKMA 2FJRA 2AUWA 4FE7A 2M8GX 3LSJA 2NVXJ 5IYCJ 3JRIA 1RZSA 1BW5A 2DMTA 4A3DJ 1POGA 1I50J 2LY9A 2LYQA 1RIOA 1ZZ9A 2XB5A 2E2JJ 2W48A 3TW7A 2R5YB 2AHQA 3Q0VA 4QSHA 4Y42A 4M3DA 3VK0A 1MH4A 2H1KA 2MSYA 1FIPA 3BR3A 2JVLA 5J1UA 2LP0A 2L7FP 4X4IA 3LSGA 4QIWN 3SDGA 2L8NA 1ETXA 4I6TA 1Y9QA 2PUDA 2COBA 3ZQGA 3PM1A 3H5TA 1LCCA 2RAEA 4IHYA 3BD1A 3CECA 1H89C 1RR7A 2PUBA 2XGCA 5FKKA 3BR6A 2L7ZA 2L9RA 3HOUJ 5EF6A 1MBHA 5EGOA 1NTCA 3ZQLA 1IV6A 2NVQJ 3LSRA 2IVGA 4RBOA 1B72B 3S2HJ 3ZHMA 3GTOJ 5J1RA 3S1RJ 4XRMA 3QWGA 2Y9YA 1BDIA 1WH5A
chains in the Genus database with same CATH superfamily
2H09A 1LQCA 2VT3A 4G6TB 4Z5CA 2HSGA 3K4JA 5HOOA 2ME6A 2CW0F 2FE3A 3R6SA 1GUUA 3LQQA 2R5YA 2EA4A 2IT0A 2EIJH 3KPHA 2E36A 2R5ZB 3FM3A 1UG0A 1D1BA 1U0JA 5K7HA 1RPEL 2X6WA 3K4NA 2BY3A 2FUG2 4NC8A 4UNOA 3ZMUA 3O9XA 2E60A 1DULA 4S04A 2R7FA 2LKPA 3J80Z 1G8XA 2HU9A 1FYMA 4UHTA 1A36A 2IS6A 1JUPA 1RIOH 4I0AA 4I7HA 2LVSA 1YS6A 3LSIA 5F04A 5C4JJ 4A3BJ 1XCBA 4BXXJ 3SJMA 3JSPA 2JMWA 2DW4A 3U1KA 2DA5A 2IW5A 2OA4A 4FCYA 4MEXF 3E7LA 4LB6B 4Y15A 3I56I 1MJBA 1U5TC 4LB5A 2LYKA 4XKBA 1MMNA 3T0YA 4BACA 2IBDA 5FD6A 2XCJA 2L02A 4CO8A 1E0EA 2PUGA 2I8DA 2QVOA 4HPQA 4U0WA 1A35A 2GXGA 4C2TA 2EV0A 1Y1VJ 5BS6A 2P6SA 2CV0A 1KU9A 3HUGB 2R7OA 3L00A 2KIUA 4M9ZA 3ZQIA 3Q3SA 3OYFA 1PP7U 1RETA 2VJ4A 3EQLF 1H8AC 2CQXA 4A3EJ 2R7VA 1Y1WJ 4M71A 2A6EF 2HYFA 2QQ8A 3GN5A 3OYIA 3GTGJ 2LY2A 4L18B 2KEKA 4TV7A 4LK1F 5DDGA 5B3SH 3W2VA 4BBSJ 1OCZH 1VQ5I 4IL6C 4OWRB 2NVYJ 1HXDA 3BQYA 3I4PA 3WTVC 2VE9A 2VE8A 2IGMA 2EK5A 4CCMA 1LKXA 2R7SA 3EPZA 5L3DA 3VODA 3WTYC 4LG0B 4E7HA 2XF5A 3GZCA 3ASNH 1ZRFA 2LKSA 2IS4A 2CROA 2JWTA 4L9NA 2JQEA 3MKWB 2LSOA 2L1PA 3WG9A 4D9JA 2NS7A 1MFQC 2O4AA 1CQTA 1K4TA 5DUKA 3HB9A 1R6RA 1CF7A 1MZBA 3MLFA 1IRZA 3V42A 5H2FC 1B1BA 2Y0SN 3BJOA 4PJJA 4D5FA 3A01A 3M8JA 1MBEA 4KYWA 3S1NJ 5DTQA 1Y0UA 3KX2A 2ZJRF 3JRFA 3BLYA 1RZRD 3RKYA 4ESBA 4Y17A 4XN3A 4CSWA 3I4NJ 4A5MA 4L0YB 3CP8A 4F52A 1P92A 1QQAA 2PQ8A 1RUOA 1X2NA 4OINF 2D45A 4JK1X 3KZYA 3DPTA 4X4EA 3MAJA 2W24A 2DO7A 3ZMTA 1W36D 4F92B 1IG7A 2E19A 3BWGA 2XASA 2VKHA 4UVBA 1SFKA 3FXJA 1QVUA 1WJBA 3ABUA 4PU3C 5D8KB 3MKZA 3FXMA 2XAUA 4LLNA 1LFUP 2VN2A 3HGGA 3HRUA 5ED4A 3RQ4A 4HA8A 2HOTA 2PMHA 3A9YA 3GTQJ 4YRVA 1WGXA 3FHZA 4J01A 3CTAA 2NVUB 1FP2A 1LDKB 3A1YA 2BW3A 2PXPA 2XV4S 3NDBB 2HZDA 3QFIA 2XHKA 1EV7A 1MDMB 4LLLA 2TDXA 2DYRH 4NUBA 2HNHA 1VFCA 3BTIA 2EINH 3N4MA 3CC7I 3NQOA 3ASOH 1I39A 4YFKF 2CG4A 2KDOA 1K79A 3BZCA 1OKRA 4M3EA 2VKVA 4W1UA 2PN6A 3DP7A 3GBFA 2JRMA 4I6ZA 4QWQA 1J7KA 3NAUA 1V54H 2FSWA 1UG2A 3WU2C 5FKLA 1OCOH 2CSOA 1ETWA 3RZDJ 1MBJA 1ZG1A 4B4CA 1BR4A 2DK8A 1TWAJ 1KU7A 2HDDA 3SXYA 4PU8A 2LR8A 1MMDA 3FK7A 1ZREA 1WH8A 3LQRA 1LEAA 1G6NA 5A2QZ 2NNYA 2XGXA 1L0OC 3ZCOA 3RPUA 3KE2A 2ZMEB 4NC6A 5CLSA 1F9NA 1XGNA 1XMXA 2H27A 4XK4A 1U8RA 2L7MP 4BUPA 2VASA 3VWBA 5LGUA 4IOAF 3PO3J 1ZVVA 3BTJA 3LSKA 2V1UA 4JX6A 4J1WA 4IF4A 5HNFA 4NQWB 1XWRA 3V7CA 1MBKA 3I59B 3OL4A 1BC7C 2BOLA 2N8GA 4X4DA 4UB8C 4XLNF 4UUSA 1JI8A 1POUA 3OS1A 2MYSA 2W57A 2M4GA 2HS5A 2XIUA 1HLVA 1SFEA 2DLLA 2NS8A 1ZAOA 4WXCA 1W0TA 1MNMC 2IP2A 2H8WA 2VT2A 3H5AA 3HIFA 2HFZA 3NROA 2OBPA 4DIQA 3F51A 3DBRB 3IAM2 3OYKA 1YTYA 3V8JA 3KP3A 4FISA 1HKTA 2BHYA 3L2RA 4X4FA 2MGQA 2W7NA 4XKVA 4A5NA 5E17F 2F48A 1Z3XA 1Z3YA 3H3ZA 2KP6A 1T98A 4CUGA 2BY2A 2YS9A 1XDUA 3DXJF 4HSTA 1RKWA 5K5OA 4M6XA 1SD7A 4XRSA 3A0HC 3QODA 4FETA 2MG4A 2GQQA 5C44J 4YFNF 1Z05A 2ECCA 3MKLA 2ESHA 3DKYA 2CV2A 4L9JA 3MFKA 1D1AA 3A03A 5HDGA 5D6EA 4YELA 1I5ZA 1IZ1A 5EZGA 2V3CC 1ZGAA 1A6IA 3OYEA 4BJ6C 1UZCA 1EFAA 2K4JA 3CUQB 1UELB 3V8KA 5J1YA 2PXBA 4D7MA 3CCQI 1JKQC 4LG0A 3I4MJ 5LD2C 2ZNZA 1Z21A 2DN0A 4L5IA 1S7AA 5LEJA 1WJCA 3L2WA 5LBQA 4F8DA 1VPWA 2FJ1A 2OV7A 4RM2A 4FX0A 1YLFA 1Y8QB 4DBQA 4XM3A 2AO9A 2NS0A 4V2GA 3ERED 2IA0A 1WQ2A 3RZOJ 3LA3A 1SC7A 2Y31A 4BE1A 1BI2A 2R7WA 1SMYF 3VDXA 4BY1J 1OR7A 2F5EA 3JTHA 3PIPF 4EM1A 2YSRA 1JUMA 4C2MJ 3FBNB 2FMLA 5GTIC 1J0RA 3H1CA 2AS5F 1JE8A 4L5EA 3BT9A 1J2XA 2FMYA 2OQGA 4A6DA 4IZZA 5IP9J 1FSHA 5BQTA 1Z7UA 2CMPA 3DEEA 5L3GA 5IY5H 5M3FJ 3R0AA 3S32A 3R1FA 3H0GJ 2X0LA 4A3KJ 2K85A 5ILSA 3GTKJ 2CS3A 3KZ3A 3E5UA 1S7EA 3OYLA 1FBSA 4YIIA 2NXNB 3NWTA 1VQ9I 2A5WA 2YPRA 2M7BA 2DT7B 1W36C 3F52A 3NRVA 3JW4A 4BNCA 5M5WJ 2IV1A 4A2UA 2HZTA 5FFXA 1IN5A 2XJ3A 3BZKA 2HOAA 3UKGA 1J09A 3CJNA 4EV0A 4EGYA 1ZPQA 5LFAA 5B1AH 3MKYB 4XLEA 3NARA 4FBIA 1ON2A 1OCTC 3HGYA 3ZMVA 1TQMA 4XORA 1P4WA 5B1BH 1R49A 2QCOA 5CVVA 2VQCA 4P1WA 2KL4A 4BJTA 5IT3A 4G7ZF 1DU6A 1JFTA 4EVIA 1LCDA 3O8HA 1CJGA 2PUFA 2FF4A 5K7FA 2VQLA 4BDZA 2KIFA 3KEOA 3SZTA 3CO6C 1FEXA 2MEZA 3KP7A 3OSFA 3CLOA 2BVMA 1N77A 2VC1A 5EG0B 5E20A 2HFHA 2GXBA 3WHBA 2QSFX 4FE4A 3H5NA 2VQHA 1KQ8A 1LDJA 2VOPA 4PGHA 2MD5A 5B66C 3WU1B 3ZMDA 5LLQA 2WV1A 5LRSA 1VNDA 2Z16A 3PFYA 3JTGA 2OFYA 4X0GA 1EH7A 1IUFA 2XF6A 1LFPA 3VWSA 5DCMB 3FXOA 3ZOBA 1FOWA 5IP7J 4BL0B 1RPWA 2BZTA 1WHUA 2X1DA 1QP4A 1VQMI 3QPSA 1SVMA 4JX4A 4Q48A 3TDZC 5GAGJ 4BXUA 5J4YA 2J7WA 1MBFA 3UWPA 4YG4A 1ZK8A 4HNTA 4ER3A 3VYTB 3ABLH 2KLOA 2TRTA 2JCGA 2O3FA 3JXCL 1WJ5A 2VXZA 2XPWA 3DU6A 2LMDA 1R5ID 5ILVA 2R7TA 1QPMA 2RGVA 1FZPB 4LK0F 1JT6A 4XRFA 1HDDC 3LSPA 3BG3A 1J9IA 4G94A 1G3WA 1LJ9A 1ZARA 4KICA 2K9MA 2CYYA 3CCYA 2CH0A 3P9CA 4A0ZA 3BR5A 5FKMA 2FJRA 2VBYA 3LSJA 1EJ9A 3VYRB 2Y0MA 5DCFA 2WB1A 3JRIA 1L3LA 2JUGA 2R7DA 3M1CA 3WGHA 2LNBA 2DMTA 3J7AO 4EKIA 1I50J 5FO5A 2LLWA 1RIOA 1ZRDA 3EETA 1ZZ9A 4XBFA 2EIMH 2W48A 3TW7A 2R5YB 1DPUA 2P4WA 1HSJA 2JVLA 5J1UA 2BXZA 2Y0SA 4AU7A 1D1CA 4I98B 3SDGA 2L8NA 4F7ZA 3PM1A 3E1SA 3ABMH 4JQFA 3CUQA 3BP8A 1H89C 1RR7A 2GXAA 4B44A 4CHUA 5EGOA 3IUOA 1GHCA 1M1EB 4ZYGA 5ERIA 3LSRA 2IVGA 2KRCA 5ICEA 4BE2A 1T38A 3WU0A 2X1CA 2ZXWH 1BDIA 3GEZA 3PO2J 1UHWA 3ROUA 2NOGA 2LG4A 3DF8A 4IRGA 1VZ0A 4PCQA 1OYYA 3GMEA 3SCFA 2XAFA 4NDWA 3A2KA 4DBRA 2X4HA 5H6RA 2LK2A 4Y3OA 1X1BA 4CYDA 4N9IA 1WPKA 4PZJA 1XTAA 2O8XA 2MLGA 2W84A 2ZC2A 2EFOA 4WWCA 2QENA 2GA2A 2HOEA 3IKTA 3CROL 3GN5B 2W1OA 1GV5A 2ZCWA 4OIPF 1K61A 1XGSA 5KVRA 3ZRGA 4PJLA 5LGTA 1U9NA 2OTJI 2W00A 4PJNA 1YIOA 4BXFA 1ZLKA 2QKLB 1QGPA 2MC3A 1Z0XA 2K5CA 3DBHB 2KJBA 3G3ZA 3SFZA 2JUCA 3ZMSA 1JXSA 4J1XA 4XL9A 4XMYA 1IN7A 1IRFA 2UXNA 4XR6A 3HM5A 5HLTA 4ER7A 2M1BA 1ONVA 1EH6A 5HNHA 1OLTA 2O0YA 2K9LA 1SFOJ 1GVDA 4C9YA 4ZZLA 2ISZA 1XMAA 4PU4C 4IQJA 2PMUA 2D1HA 4BJ5C 2AXTC 3CMAI 4A12A 1CF7B 4M72A 4ZTFA 2JN6A 1J59A 3A01B 2XF7A 3AL0B 1U2WA 2ZMEC 2VLAA 4IHWA 3PSFA 4ZC3A 5HVQC 4ZDLA 2KJCA 9ANTA 5FB2A 3I58A 1U5TA 3K1PA 5KAIC 3C2BA 3TO7A 1QP0A 1NERA 1WVRA 3ECOA 1GT0C 1ETVA 2AQEA 5J8FA 5M5YJ 1AA7A 4IEJA 3SFIA 4A3LJ 1YX3A 1NK3P 2F5VA 3QP6A 1DUXC 2DJIA 3QOPA 2K9SA 2JJ7A 2UV1A 2IAIA 2HVQA 1N25A 1T39A 3OWQA 3FYAA 2VJ5A 4S0HB 3FXKA 5DT2A 1FPQA 3KZZA 3DTKA 4MFDA 3GZ6A 1XG1A 4IX7A 4WF2A 1MW7A 2F4OB 3L09A 1BOBA 4KT6A 4M3BA 2MQKA 4UVAA 2PXUA 2KMUA 2DFHA 5ICGA 3V7RA 1ZR4A 3M07A 1MJAA 2AXUA 4MFEA 4OAZA 5A7LA 3KYLA 2Q2EA 5GAHi 3WTWC 3GVAA 2A68F 1IAWA 4RM3A 2BW3B 1MNEA 3PFIA 3R61A 5JI6A 1UHSA 2O9LA 2KEIA 4RB0A 2HQNA 5DTRA 3SYTA 2VPRA 1R36A 2A05A 2HVRA 4L0ZB 3CP2A 4YEJA 2CV1A 1OISA 2X9DA 1JTYA 3C3WA 2HCSA 4WVLA 1QA6A 4XONA 4DJAA 3S3OA 3K9TA 4ASNA 3WTUC 2XI8A 2L9VA 4ER5A 4A3MJ 2CQNA 4NBQA 4AVZA 2Y9ZA 1Y0NA 2MABA 2DA1A 5EEGA 1SEUA 1I3QJ 2IVMA 1Y39A 4IHSA 2YX4A 4HQEA 3FM5A 4Y7NJ 4AIKA 2DJNA 1QO0D 2OU2A 2DT5A 3I3LA 1LFBA 1ZRCA 1HBXG 1Z9CA 3K4CA 1Y8RB 3JXDL 3I55I 3W6JB 1E3PA 2VBXA 1LLIA 1W7PA 4XN0A 3GBGA 3B7HA 3COAC 1X1PA 3K2AA 2DXIA 3L2QA 3GO5A 2BEOA 2FOWA 4MTEA 2LF7A 4EJTA 3RJPA 2GOXB 2OPTA 3S3NA 2VKEA 4CZCA 4ENMA 1WSUA 1USTA 3EUAA 2EBYA 1SD5A 2F4MB 3F23A 2CRGA 3C1DA 2ACJA 2M8EA 2DMUA 3IH3A 3DPUA 5L3EA 3L2UA 1YW8A 1H0MA 4UUSB 1BA5A 3CZ6A 2XRLA 2J5PA 4HW0A 2WUSR 2YU3A 5HS7A 4QLCU 3M3YJ 3HOVJ 3FBIB 4YIFA 3LSTA 1KU2A 1DPRA 4OU0A 3HBLA 1QBJA 1P7IA 3K0LA 1T95A 2PI0A 1DP3A 1OSLA 4G9YA 1X19A 1KONA 1STZA 3IRRA 1R69A 5FRMA 1IF1A 1LMB3 2DU9A 3BROA 4E6KG 1AOYA 3OS2A 2ICWG 1HA8A 2YU9J 4X4GA 1MJ9A 3CCRI 1XC5A 3D1NI 1VI0A 1TNSA 3HJEA 4ZH4F 1ZAYA 3K6GA 3E5XA 5FLXK 2PXTA 1GVJA 4BHCA 2X6OA 1K83J 1W5SA 1X58A 3SDBA 4KJZA 5D8LB 3F8MA 3N05A 4RLFA 2Z3YA 3S3MA 2O61A 3CCJI 2K40A 3EUHA 3Q0WA 4RA2A 1HF0A 4IKFA 2IA1A 2HPIA 2HQAA 1R63A 3H9GA 3HOWJ 3PE5A 4I76A 4RS8A 4KMFA 2AQFA 2PG4A 3DKWA 4ANJA 2HEOA 1FWZA 4ESFA 2QUFA 3BTCA 1V5GA 3ZP5A 2LKXA 3HPHA 1X2LA 1SVOA 2DOAA 4XLAA 3KFWX 3X2QH 2D5VA 1HW1A 3FXRA 1WWXA 3BG9A 1VTNC 4AWXB 3UNGC 1FOYA 5LHIA 2HOSA 4UY8I 3GCMA 1JKRC 2LYCA 2A6CA 1HC8A 3AG1H 1FMVA 2L3DA 5B5EC 4A0YA 3BJ6A 1Z1DA 3QPTA 4PU7A 2NNNA 3DNVB 2QSHX 1UTXA 5IOZA 1IRXA 2Q8KA 2WY7Q 2VQGA 6PAXA 3KP4A 2QF7A 3TEDA 2STTA 2IRFG 4BQOA 3HDDA 2CFOA 2KPMA 3QOXA 2WAQN 4U7DA 3BR1A 1O3QA 3OKZA 3PL8A 3HOXJ 1F36A 2F5CA 3ZMZA 2PE5A 3I9V2 3HSFA 1HW5A 1IV8A 3GZDC 2GRLA 4BH9A 3F3XA 4MO7A 2XSDC 2COMA 3HRSA 2FEZA 1O57A 3KEQA 2UWMA 2IS1A 2MA3A 5K5RA 2AW6A 1YOVB 2G9WA 3D5SC 3GXOA 3BPXA 4GCVA 4MHGA 2LYPA 1ZTRA 1RUNA 5K1YA 3W3CA 1FP1D 3CF2A 3EUKL 2Z5UA 1YRNA 3RPUD 1YYVA 5FKOA 4IHXA 2R1JL 2DK5A 1D3YA 1SVLA 5EZHA 1HW2A 1HDPA 1TNTA 2M5WA 4I09A 4CCKA 2HDCA 3OIOA 2E5ZA 3JAMK 1YW7A 5E8GA 3OQNA 3K1NA 3WODF 5IT9Z 3M1EA 2KRHA 1TZLA 1UXCA 5CQEA 2IEKA 3CD6I 4AUXA 5KNLA 3F6OA 2QEXI 1TQIA 4CCJA 3ABKH 4P5OA 5E1WA 2DDAA 1VQ4I 4ZDPA 3L2VA 1LDDA 3K7AJ 4KIBA 4PJMA 3DLLF 1TC3C 1ORKA 3DV8A 3U1DA 3N97A 1ZG5A 2LRDA 1A6QA 4EJWA 1B0NA 3AG2H 4A6EA 2QM3A 3ELKA 2R7XA 4U0VA 5HLGA 3BJAA 1YHQI 1I1SA 1D0YA 3L1PA 2FA5A 2ID6A 1YO5C 1F43A 3O8GA 4KA4A 3DEWA 5ILUA 3G71I 3CESA 2EZKA 2GLOA 1G3YA 2Z99A 2PXLA 2JSCA 1MKMA 3JRDA 3HKZN 2R0QC 1OJLA 1KU3A 4X6AJ 4ZYAA 1UJ8A 5E8IA 4Q4ZF 3SZPA 1RZRA 1HCRA 1WZ2A 2X6XA 1QPZA 4Z6YA 2PBIA 2CSFA 3L2CA 2ETHA 2DTRA 2IA2A 2ELKA 2VKDA 3QQAA 4R1HA 3LISA 2UXXA 5E1ZB 4I01A 5HLHA 1R1TA 4UVCA 1ETKA 1SANA 2KPJA 3FWEA 4B1RA 3BDNA 1YJ9I 2A6TA 1TL8A 2ISYA 1O7LA 1DP7P 5AONA 4RAZA 3HHHA 5DYMA 3PNYA 1PERL 3RKQA 2FNAA 2R92J 1IUYA 3ZXSA 2B5AA 4RMNA 2V9KA 2KKOA 4ER6A 1QHHD 2QYOA 5CPRB 5J3LA 3GLXA 1OMIA 1D0XA 3I71A 1WJDA 5GTHC 3H9QA 2EWNA 2XKOA 2TCTA 2BY0A 2ZSHB 3I54A 1ZH5A 1OCCH 1FOXA 2HR3A 1QZEA 2CW8A 2ECBA 3J7ZI 2CQ7A 5JVGF 1ITYA 5EJCA 3RZZA 1UB9A 3S17J 3VFZA 1UHMA 3BC8A 3AAFA 4UUTA 4BQQA 5IP6A 4E7ZA 1ZGJA 1TWCJ 2YX7A 4GXOA 1JHHA 3TKYA 1JUSA 1RESA 4BHPA 1SD6A 4JCXA 5DUIA 3K4KA 3LMMA 5JVTA 2BV6A 2I5UA 1BM9A 1NW3A 1W1WE 1EH8A 2CO5A 2QA4I 2EFPA 2KFDA 4EJOA 3VOEA 4PDKA 2X85A 3AL0C 3BR0A 3NEUA 3E3VA 3IH4A 3Q0UA 4O3MA 3BR2A 3LOCA 3QYFA 3SCGA 3H5RA 3OYBA 3SZGA 3ESWB 5JHFA 3E6BA 3WE3A 2K7LA 2Y48A 4B43A 4E7IA 1B59A 4UV8A 5GPCA 5EGOB 5D5WB 2L9SA 1BI3A 1WRJA 2DBBA 3CDLA 4B8XA 1S8NA 4DZJA 3S1MJ 5DD8A 3MZ8A 2LREA 2M8GX 3HTSB 2ZSIB 1RZSA 1BW5A 4A3DJ 1POGA 2P5KA 2LY9A 3T5XA 2ODRD 4AM3A 2BXYA 1SFXA 4QPOA 4Y42A 2AHQA 4QSHA 4P55A 4P96A 2EIKH 2JRTA 1BI1A 2QWWA 3BR3A 3ML6A 4MNUA 3CDHA 1FT9A 3TDUC 1O3SA 3LSGA 2E5NA 1V55H 2JSPA 3PUFA 2QSGX 2FXAA 1R00A 4E4HA 2ZJ2A 4II2A 3WTTC 4I6TA 2PUDA 1Y9QA 2COBA 1R4NB 2XAHA 2A69F 4Y13A 1SAXA 1XCVA 3H5TA 4GYGA 3MZHA 5L3CA 3BD1A 3WGIA 4IVNA 2PUBA 2ELJA 2XGCA 2L7ZA 2L9RA 2HYGD 3ZQLA 1NTCA 2NVQJ 1D5VA 2P7VB 3CCMI 3R09A 2ZXHA 3ABTA 3HRMA 3GUDA 5J1RA 3ZHMA 3S1RJ 4XRMA 4EM2A 1IXCA 2K3PA 1WH5A 4I99C 4BU2A 5JLXA 4I02A 4RDUA 4A3GJ 2BNOA 1R9TJ 2PJRA 3PUBA 1FNNA 1R58A 4UXNA 4IA8A 2GRMA 2L01A 5H20A 2GZWA 1MH3A 2CUEA 2O49A 2LYRA 1VF9A 2L5QA 1VQ7I 2EF8A 3FXQA 1DGRM 3OY9A 3JRGA 3CCUI 1F5TA 2DODA 2ZBKA 1U5TB 4HRIA 3I0TA 3GTMJ 2M0MA 2XGEA 2J5OA 3E0JB 5F0FA 2EH3A 3KIOA 5K5QA 1XSDA 4Z58A 2ZKZA 3LL7A 1WJAA 1OFCX 4F93B 4X1EA 2LOOA 2PEXA 3L7WA 4WX9A 2Y69H 4E7SA 1LVKA 1B72A 1X2MA 4CXFA 2XRNA 1GV2A 2HQRA 1BJAA 2M4KA 4XSZF 3DWLE 4C3JJ 5BMZA 2W82A 4Y33A 5C3EJ 2DI3A 3RPQA 4XIDA 1I3AA 1TW2A 2F4IA 4IPAA 4HYEA 1P9QC 5F6FA 1OPCA 3OQMA 1ZUGA 2RQQA 2R63A 2PMZN 3UR3C 1GLNA 3GFMA 3F0CA 3CUOA 2E1OA 2JA7J 3GUUA 2Q2EB 4RGXA 2LTPA 1S7OA 2I10A 2DA4A 3K69A 4XSXF 2G0EA 5E18F 3BZ6A 1RR8C 4LLGF 2VL8A 3GZ5A 4YG2F 4UB6C 4XLPF 3CC2I 4FTHA 1F4KA 3TEPA 4PSXA 4RLQA 2JK3A 4EZIA 2DFEA 2E71A 4ZYHA 1HSTA 3TRBA 3F72A 3HYIA 1GXPA 3G7DA 1P4XA 2GA1A 3CCEI 2E35A 3DU5A 1AWCA 3HRTA 5IYDJ 1D0ZA 5FFZA 1U78A 4Y52J 4DW6A 5JR3A 1K7AA 1VQ6I 4FN3A 3IVPA 2E34A 2JPBA 4I2OA 1XSVA 2XGDA 2R3SA 3K4LA 2V6CA 3WTSC 4J19A 1ACIA 2AXVA 3NZLA 3FMRA 5E3OA 1ZG3A 3H9JA 1QHGA 1JJ8C 3GF2A 2QLZA 1W7PB 1R5HA 2B0LA 5E79C 5E3MA 3J80K 3S15J 3TP3A 2E2HJ 2DT6A 4AD9A 2M7AA 3C18A 2OR1L 3G4SI 2LY1A 2JQ7A 2VODA 4LD5A 2LLVA 1LEBA 2D2WA 3HG9A 2DQRA 1B9MA 2LC2A 1HKSA 1B8IA 4GRIA 4MCTA 1HQCA 1JJ6C 3KXAA 3BCAA 2PJPA 2KZ8A 2XIGA 2X48A 1FIAA 2YR2A 2DQLA 3HZIB 1IJWC 1OR7C 3S2DJ 2K02A 1IDYA 4Z5DA 2O8KA 1B6AA 2X51A 3ZN0A 1BC8C 4MGRA 1IDZA 1VQNI 2X6YA 1LVAA 3BTLA 2FX0A 4XLCA 3U2RA 3SCHA 2ZFUA 3LFKA 4OIQF 2DTZA 2UUZA 4KN7X 4C30A 4F91B 4AVPA 2QZ8A 2DA2A 2EILH 5CVIA 1G3TA 1W0UA 4AC0A 3OYHA 1X3ZB 1Y6IA 2RV8A 4IHTA 4JP0A 1K6OA 2HTSA 3M7GA 2R93J 1TWHJ 5LEKA 4KIGA 5CVJA 3LAJA 2AXZA 4X4BA 4E70A 5FD5A 2ICTA 1Z77A 2XDVA 4PFPA 1WH7A 1QVTA 3I53A 5H6QA 2LYLA 2WV0A 1VQOI 3H0DA 3DBLB 2OZ6A 4ER0A 2FU4A 3ME5A 4XOTA 3C2GA 2YUSA 4PJ0C 3OV8A 1ZZCA 3SHFA 4LIVA 4CCLA 1IXSB 1BW6A 2XXPA 4Z5HA 1MGTA 4V19K 2WY8Q 3Q9SA 1ZZBA 2IPQX 2OJED 3M8FA 3MMYB 3B73A 3GFIA 4Z59A 2ME0A 2KHMA 4CYCA 3OQOA 4OOIA 4XKWA 1K78A 2KZGA 1X4PA 3S14J 2Z1DA 2BHZA 3REOA 4HX8A 2MW8A 4I6UA 1MMAA 3GWZA 5HDNA 3HSEA 4DYCA 1BJZA 1QB2A 3UFDA 1YE9A 2OCEA 1W4MA 4RAGA 3IWFA 2V7FA 1UXDA 3WGGA 2AWIA 4AIJA 1ETYA 1Q1VA 1TLHB 5GPAA 5LGNA 1A04A 2H1LA 4C2UA 1QRYA 1WCMJ 3M9LA 5FROA 3HKZA 3A0BC 3EUSA 3JXBC 4XLHA 2KZVA 2FQ3A 3OIPA 1UAAA 1MD0A 3OYAA 1YI2I 1JGSA 2DPUA 2E1CA 4HG2A 5CQGA 2A07F 2IS2A 2DOFA 2J7UA 3GTPJ 4O5VA 2DYSH 1MIJA 1YJWI 2PXKA 2H94A 5CYVA 3OWTA 3MWMA 4K2EA 3W2AA 4MQ9F 3GTJJ 2LLKA 2K86A 4UV9A 3QOWA 3FKJA 5JHUA 1LQ1A 1Z6TA 1KGSA 1ZZ8A 1XSXA 2BE5F 3CJRB 1T6SA 5D5UB 1DWKA 2MD0A 3HPGA 3J81K 4U7BA 4I6RA 5DV5A 1H9TA 1YRNB 4OBMA 4DE9A 1T0FC 2EFNA 2HI3A 2B7EA 3TMOA 3P9IA 1W7PD 2DMPA 1TTYA 3S16J 1ZLJA 4LOCA 4EEFG 1AHDP 4QPQA 3LFPA 3F6WA 4FASD 5DS9A 1B9NA 1PRVA 1IC8A 4A3FJ 1KZHA 1KQ0A 4CA0A 2M34A 4CDGA 3DPLC 2ZNYA 3F9KA 1TP4A 2EA2A 2M2EA 1V5FA 4ABZA 3I64A 4C3HJ 5A2QK 1ETOA 2F5DA 2VONA 1QPIA 3B6CA 3ISPA 3OYJA 2VBWA 2MFZA 3HSRA 1QZXA 2LYSA 2RKHA 2JT1A 4I0BA 4B3XA 5TJJA 3D5LA 1A5JA 2H6BA 5CKTA 2PXQA 5FLMJ 4EQZA 1I27A 3KYDB 3RQIA 1U8BA 4EK9A 3LSMA 4L9VA 3GZDA 2OUMA 4IWRA 2ELHA 4GQMA 1XDSA 1ZQ3P 1YSEA 2GBYA 2V1DA 2MC4A 4B47A 2VI6A 4CICA 1WIZA 3KYCB 2Y2ZA 5HLIA 3E6MA 5K7ZA 1JKOC 3CUQC 2XROA 1LB2A 3G1OA 2QQBA 2O7OA 4HDUA 1TWFJ 4A3JJ 1AKHA 2L7KA 1BIBA 2A3SA 2HWVA 5GAEJ 4V2FA 3OYCA 2K9QA 3O6BB 4LGWA 4BY7J 1TQPA 1O3TA 3ZGKA 2DMNA 3JRCA 3RI4A 3R0JA 3R4KA 3MEJA 1FLIA 4KN4X 2CW7A 2V9PA 3E5QA 4N4NB 1E3OC 3R60A 2IVQA 2V1XA 1S72I 4A69C 2PUCA 2IXSA 1G4DA 2FD5A 3C2HA 2M45A 3KLOA 2EZHA 4CCOA 3RYRA 2VUMJ 3FF5A 1IGNA 1JWLA 2P7CB 2OQRA 4M73A 3P5JA 2VIXA 4U87A 4OB4A 3QOEA 1PUEE 1V4RA 4R8HA 1XGOA 2HXIA 3AG4H 4M74A 1O4XA 2KQRA 4PFOA 3BS3A 2HYJA 4IVZA 1PVEA 3KP6A 4BQAA 2LCVA 4A0XA 5F08A 2HINA 3JRHA 4CZZA 1QU3A 2V6EA 3H35A 2UZKA 1TT0A 3GFLA 5F1JA 4ZZDA 4KUMA 1XS9A 1ZN2A 2RQPA 2XPVA 5AIQA 4DYQA 4HV6A 5M3MJ 1PUFA 5JLWA 2G7UA 2FBIA 3ULQB 2L49A 4ZJZA 1QQIA 2IGKA 4M6YA 2GIZA 2VOOA 2LH9A 3U9GA 1NK2P 2Q0OA 1QNTA 3JCUC 4KITB 2ID3A 2KRFA 1LUJB 4II3A 3D0SA 2STWA 3ZKCA 1IN6A 3HZJA 3K2ZA 5D6FA 1EKEA 4HX7A 4HNVA 3CJTB 2M87A 2EPFA 2BYVE 3ZQQA 4BBRJ 4KIFA 3OMTA 2VBZA 3F21A 2DOEA 3QRFF 2PX9A 2OAZA 4BAYA 1PP8F 2R7QA 2PIJA 5ICCA 3C7JA 5DD4A 1TT5B 2OF7A 2CUFA 1GXQA 4GGGA 2JA8J 4JBAA 4LIUA 5C4XJ 1S3JA 1ETQA 5F27A 2MXDA 1NH3A 1QZYA 2LBFA 1FYKA 1NHAA 3U3WA 5F0CA 1NG6A 3NXHA 4OAYA 3BG6A 3U21A 1G59A 3OOUA 3FISA 4MQVA 4XRSG 2EB7A 4AYBN 2HQ5A 1P6RA 2VJIA 2WAFA 2NAZA 4A93J 1FBUA 2R7RA 1U3EM 3MD2A 4BQNA 4HDVA 2FFHA 4YG7B 3CMYA 4XICA 4OMYA 1D8KA 2WB1N 3PQJA 2V1NA 2Z9OA 2L54A 3HTUA 3ZQHA 4DZPA 2PMZA 3DCFA 2LDUA 3QU6A 2E7XA 1XPXA 1UFMA 3CDIA 2IU7A 3QQ6A 4KFCA 3WE2A 2CJJA 3PSIA 5TGTA 1WI9A 4JOMA 4BEHA 3E97A 3K4MA 3MEXA 4LJZF 3QYXA 4D5CA 2W85A 3QP5A 4M9SA 4N4OB 4R79A 2K3FA 3P7NA 4ZDOA 2MH9A 3TO6A 4ENKA 1PJRA 3VSKA 2QBYB 1FYLA 2K27A 3T1BA 3IAS2 3G0TA 3CCVI 1O7FA 2NVXJ 2ZO4A 2PJRB 1BIAA 2DPDA 2XAGA 4HLXA 2Z2SB 3KCCA 4ENNA 4KDPA 2ZXJA 3SEZA 2XB5A 1RNLA 3VK0A 2E1MB 2BGCA 2H1KA 1E17A 1FIPA 4X4IA 2LP0A 2L7FP 3PQKA 4DNCA 4Q5SF 4IOCF 4RGUA 1ETXA 4HAMA 4D0PA 3NWSA 3ZQGA 4FX4A 3MCZA 2CQKA 2VC0A 2WAEA 2RAEA 4IHYA 1MMSA 3PNTA 3KEYA 4F55A 1Z91A 1I6XA 5D5VB 2WBMA 5FKKA 4RB2C 3DKXA 3BR6A 3HOUJ 5EF6A 1MBHA 1YIJI 1RRJA 4N9HA 2L2OA 4BS9A 4RBOA 1B72B 3S2HJ 1X4OA 2HVSA 3BPVA 3OYNA 3QWGA 4WCGA 2Y9YA 2QQ9A 4HEA2 3IHUA 3DQVC 1F1ZA 3ECHA 3TBIA 4ENJA 4XQFA 2F6CA 3JRBA 3L9FA 2JVHA 3QYEA 3J81Z 2DFIA 4MEYF 2LNMA 1REPC 5E1XA 2YBDA 4XLFA 3OR1C 1ZS4A 1OCRH 2PFBA 2ICPA 4ZYDA 1XGMA 2WA0A 2CGPA 1T56A 2O03A 4DGWB 1JFSA 4IO9F 1BDHA 4HQMA 2HGCA 3E6CC 1X1DA 1R7JA 3Q9VA 2DA7A 4B48A 4U0YA 2Z33A 2IJLA 3S8PA 4HF2A 1PRUA 2WADA 4HRAA 4DE8A 1J75A 3KZIC 3EUHC 5CVUA 1EF4A 3GFJA 3H3UA 4M3GA 3WG7H 2OCCH 2VEOA 1FSEA 3PXPA 3ZQCA 5JFRA 2P5VA 4AIDA 4A3IJ 4Z2YA 1MSEC 4ITVA 2HTJA 3EYYA 2KIQA 4WXHA 1TW3A 1XB4A 1BR2A 3FKIJ 3VEPA 5BPDA 3OS0A 3WHCA 3HOTA 1LNWA 2M4HA 2ESNA 1LPQA 2QKMB 1FJLA 1T8IA 1CGPA 4LFUA 1BOAA 4RB1A 3KJXA 5LHHA 1H88C 2DA3A 3V7SA 1X3WB 4ETSA 1ENHA 4Q47A 1SD4A 1W5TA 1ZHFA 3VYUB 2R5ZA 2KISA 4M9XA 2B9SA 2OZUA 1T2KA 3ONQA 1FX7A 3ZQFA 2CFXA 3G1MA 5E3NA 4X4HA 4P9FA 2EV6A 3P9KA 5HDKA 4CH7A 3F6VA 3CMEI 2FNPA 4E7JA 4KNYA 3M4OJ 2LYJA 1X1AA 2O5RA 3V8LA 3OYGA 5IPAA 1SFUA 3LNQA 4M6VA 3SR4A 1ZR2A 1ZKGA 1B8IB 3MN2A 2FBKA 1Y7YA 2FBHA 2JA6J 1ERDA 3VB2A 1U2ZA 4MCXA 1WETA 3OR2C 1HQ1A 2M0CA 4ON0A 1OCPA 1ZYRF 4CGZA 1ZZ6A 1BR1A 4XNFA 3FZVA 2QGUA 2IGOA 4JYKA 2NRAC 1RC9A 1TBXA 2GM4A 2PUAA 2X1EA 5KCMA 1YITI 2EFQA 4S05A 3QU3A 4NDLA 2P5LC 4B09A 1K4SA 1JKPC 2R7UA 2PXDA 3FX3A 3HUGA 4XOPA 4YFXF 2BJCA 1N78A 2XPUA 3DTEA 2DDBA 4G8XA 2ZXIA 4ZYEA 3T8TA 1D8JA 1YW9A 2RDPA 1QQBA 1P4AA 4G7OF 2EWTA 1XN7A 2EZIA 4PK4A 5FLXZ 3OYMA 4HLYA 3FIWA 3ZQ7A 2XXQA 2EZLA 3JRAA 2EQRA 1LE8B 3CCSI 4MTDA 1DGWY 1JHFA 4Y4RA 3QPLA 3GW2A 5J6XA 1O3RA 1VQLI 2R7ZJ 2ZJPF 2O6GE 2XAJA 3TL4X 3AKZA 3SX0A 2DMQA 2O38A 1XX5A 2WIUB 1KYWA 1FC3A 2BVLA 3ZR8X 5F0HA 2MBFA 4RAYA 1S29A 2CWEA 3S2WA 3RKXA 2BY1A 1V5EA 5EEHA 4GYIA 3TGNA 2RNJA 1APLC 3F8BA 3O2PE 3BOQA 3RDIA 1OYWA 3JSOA 3FXUA 1C0WA 3RTRA 4CYCB 1PRAA 4WXDA 5IYBJ 1K78B 3FXLA 1B4AA 4I8TA 2LF8A 1RI7A 3MZYA 3HOYJ 2H8RA 1VQ8I 1XMKA 1MNDA 2WTEA 4PSWA 5DEQA 3FMYA 2A6HF 3CQZJ 4NB5A 5TISC 2QBYA 3IWZA 3PNVA 4IRHA 3HXLA 1A31A 3SQNA 3GX4X 3KLNA 2PLYA 1BI0A 2CUZA 3S93A 1SMTA 4JCYA 3IH2A 1EA3A 4EJVA 1ULYA 5HS9A 1J5YA 2XC7A 3TFLA 1AU7A 1WI3A 1GDTA 3IRQA 1BL0A 3ERMA 4XKCA 4EJUA 1V3FA 4GFBA 4GO1A 3BQZA 1DDNA 1HOMA 2PXEA 1T08B 3RYPA 1VQKI 3A9XA 3BDDA 4OIRF 2PXVA 1JT0A 2RVCA 3E6DA 3F8NA 2BNMA 4RB3C 4MLOA 4ZTJA 2V26A 1S9HA 3TP0A 4N0BA 2XAQA 3K70D 3ZHIA 2ADUA 1KYZA 3WTXC 3CLCA 2OC6A 4X4CA 3IV5A 3W2WA 2XUBA 1IO2A 1R1UA 1YQAA 1MDMA 5BOXA 3QAHA 1JH9A 1ZZ7A 4G6QA 1N75A 1DQUA 5EYRA 1X57A 4DOZA 4DYRA 3G2BA 3K1MA 4BHBA 4DQ2A 5DSXA 2ZJQF 2A5YB 2LD5A 3Q5FA 4G6DA 4J00A 4HSRA 2DA6A 4IRIA 1BN5A 4KMUX 2EJRA 4HX4A 4B3AA 2FRHA 2OTLI 3JAMZ 1RZ4A 2P8TA 2K9NA 3VSLA 5GP9A 1QZZA 1T33A 2VJJA 3B6AA 3TO9A 1S5LC 2GOMA 2RC4A 5IOYA 5BNGA 5J4VA 1NEQA 3CC4I 4UUVA 1PNRA 3TQNA 2W25A 3OL3A 3FYMA 1FMWA 2E2IJ 2RN7A 2KEJA 2ZMEA 3GYHX 3CO7C 2JA2A 3TW6A 5GADJ 5J8CA 5LHGA 2JTVA 1R1VA 5BPIA 3OIQA 3F8CA 2KDZA 4AIHA 4E7LA 4NQWA 2HDWA 2L0KA 2V4JC 4A3CJ 3I59A 5F64A 4EATA 2K4BA 3FK6A 4RGRA 5FJ8J 1G3SA 3DTIA 2V9VA 1YFHA 3EYIA 1UMQA 3KP2A 4OMZA 4NNJA 5CJ9A 5KAFC 1WJFA 1IXRC 2DAOA 5K98B 4HNUA 4YBAA 5M5XJ 1SQ8A 1AKHB 3DFGA 4YARA 5L3BA 3HEFA 1WKMA 3EDPA 2M3AA 3A4CA 1Z7LA 1T0FA 2EV5A 4C3IJ 4L9TA 2QQAA 3PIOF 2XVCA 2B63J 4GDFA 4D7NA 5JUWA 3TOAA 1YS7A 3S1QJ 2F5FA 2OD5A 1JGGA 2NOJB 2BNNA 4E7KA 2XB0X 5HS8A 1OQYA 4AYBA 4P9UA 2AXLA 4H0EA 3MQ0A 4HBLA 1G2HA 2WAQA 1L1MA 2D1VA 1TWGJ 2Y75A 3H92A 5J40A 4GHJA 4RGSA 1R4MB 3LWFA 2LFBA 4FT8A 1IN4A 5CVRA 3WTZA 2P0WA 4F3QA 1P7JA 4FQGA 1U9OA 1ADRA 3BCBA 4LMYA 2M30A 1FTZA 3S8QA 1WH6A 3AFHA 3RCOA 5AIPA 3FDYA 5EEAA 3FMQA 3I5UA 3SEQA 1PUFB 3QF3A 4U88A 2PUEA 1MSFC 5DTMA 3DEUA 3M8EA 2CQQA 5GAHJ 2E7WA 2JVGA 1LE8A 4O8BA 1MBGA 4YG1A 4ESJA 1I6HJ 2W4SA 1QP7A 4HZFA 2HCNA 2VB6A 5DTDA 2CU7A 3GZNB 2DFFA 5TRDA 2C6YA 2FQ4A 4G12A 1PDNC 1FTTA 2E1MC 3HOZJ 4HF0A 3JREA 3OSGA 3W6VA 3IP4B 1Z67A 3AG3H 5J47A 2JA5J 1OYIA 4WK8F 4G7HF 2M9HA 1RKTA 2XKPA 1W5CC 3ZPXA 4NHJA 2GAUA 3F8FA 1KA8A 1PYVA 1DU0A 3A9ZA 2P81A 3A02A 3OOPA 4H4KC 3CCLI 3OP9A 1USSA 5HODA 2VPLA 1IN8A 2JPCA 3GTLJ 3DLAA 2LBFB 1FY7A 1Y56A 4EMSA 4JX5A 1X3UA 3MVPA 3J7YJ 1JTXA 3QWLA 2Q1ZB 5GAGi 2MH2A 3W6KB 3H3VK 2IVBA 3IC7A 2MLKA 3LQXA 2NVTJ 4PGGA 2IGNA 2ZFWA 2PPXA 2HKXA 3CMMA 2ZB9A 2E1NA 4M3FA 1E2XA 5D5XB 1X1CA 1Q1HA 2L4AA 5ICFA 1R22A 5FKNA 3RSNA 1YJNI 5DRYA 1ODDA 2WC2A 4W97A 4HOBA 2EFWA 3HHGA 3KL4A 3JR9A 1D5YA 4LITA 5FRNA 3G5GA 1K6YA 4Q2JA 3RIRA 2KT0A 3G73A 2BBYA 2EBIA 3T8RA 5IT9K 3VYSB 4JQDA 1DW9A 1BBYA 3FMSA 1WFXA 3KETA 1P2FA 3TELA 3DM5A 3HL2A 4EQQA 1NG7A 4BEHB 4KT5C 1R5GA 2GWRA 5E3LA 1H9GA 3KP5A 2F2EA 3FHNA 2RNGA 2G7HA 4L5JA 2KIMA 5DM7F 2RREA 3TOBA 3K4BA 3RKWA 3K10A 1HKQA 3K70C 2WWYA 5EDNA 2HXOA 3OYDA 1R71A 2HPMA 1IRGA 1FBQA 4IJAA 3CF5F 4BKXA 3LA2A 4EKGA 2Y30A 3J7AY 3LA7A 3ZN1A 3HOSA 2XSJC 4LG3A 4QTRA 3G6EI 3G1LA 2XXAA 4CCNA 3ZPLA 2HKOA 4HV5A 5KK1A 1ZGWA 4BE0A 5L3FA 5F1RA 1U6GA 4EGZA 4EM0B 1R23A 4MIMA 3IL2A 4BGDA 3QYBA 1UCRA 3LSHA 1MMGA 3D5RC 3CLQA 5EG0A 5FLVA 1FOKA 3BG5A 2PXFA 4D1QA 4IHVA 4YIRX 2GZUA 2P6TA 2IUOA 3VPRA 5D4RA 2FOKA 2L4MA 2V79A 3GLLA 3CJQB 1XD7A 4FHTA 4NC7A 1S6LA 1IW7F 4KISA 1YG2A 3LAPA 2VXDA 2NYXA 4FE7A 2AUWA 5IYCJ 1YX5A 2H6CA 3BY6A 4PUSA 3LFUA 4IQ4A 2LYQA 5LRRA 5DCMA 5KHDA 3PJRA 5D4SA 1Z6RA 3H36A 2E2JJ 3M9AA 3Q0VA 4M3DA 4O6JA 1MH4A 3HC7A 2MSYA 3B02A 4BDYA 1SAUA 2GIVA 3V4GA 2R4GA 4QIWN 1ON1A 1E3HA 3QPHA 5DM6F 2A61A 1WJEA 1LCCA 1ZELA 2CUJA 3CECA 4OIOF 4HF1A 1VQPI 1KQ9A 4RAFA 2DCEA 3BG7A 3IKVA 3O3KA 5FGMA 3OMYA 1IV6A 3F22A 4IXAA 4BYYA 3GTOJ 2JZYA 5DRTA 1I1GA 2L9NA
chains in the Genus database with same CATH topology
3PO2J 1LQCA 5JLXA 2NOGA 4RDUA 4A3GJ 2BNOA 2HSGA 1R9TJ 4Z5CA 3JRBA 3SCFA 2ME6A 4IA8A 2GRMA 4NDWA 1MH3A 2CUEA 2O49A 2LK2A 2LYRA 1VF9A 1GUUA 1WPKA 2R5YA 2EF8A 1ZS4A 2R5ZB 2ICPA 5K7HA 1RPEL 3JRGA 1JFSA 1BDHA 1T56A 3CROL 3GTMJ 2XGEA 3GN5B 5F0FA 1GV5A 2EH3A 3O9XA 1K61A 2DA7A 4Z58A 1U9NA 1PRUA 1JUPA 4BXXJ 2LVSA 5F04A 5C4JJ 4A3BJ 1Z0XA 1EF4A 1OFCX 3SJMA 4X1EA 4J1XA 2JMWA 4FCYA 2DA5A 4M3GA 1B72A 3E7LA 1X2MA 3PXPA 3ZQCA 1GV2A 4A3IJ 3HM5A 1MSEC 1SFOJ 2LYKA 4C3JJ 4PU4C 1GVDA 3FKIJ 5C3EJ 3WHCA 4XIDA 2IBDA 2XCJA 1FJLA 2PUGA 3KJXA 2JN6A 1Y1VJ 1ZUGA 1H88C 2PMZN 2DA3A 3A01B 2R63A 3OQMA 3F0CA 1ENHA 2JA7J 2E1OA 4IHWA 3ZQIA 2R5ZA 3Q3SA 1RETA 2LTPA 1H8AC 9ANTA 2CQXA 4A3EJ 1Y1WJ 2I10A 2DA4A 3C2BA 2G0EA 3GTGJ 1NERA 3GN5A 2KEKA 1QP0A 1GT0C 1ETVA 3ZQFA 5M5YJ 3G1MA 5E3NA 4IEJA 4A3LJ 3SFIA 4X4HA 1NK3P 4BBSJ 2K9SA 2JJ7A 4FTHA 2LYJA 2IAIA 3M4OJ 2JK3A 3FYAA 4S0HB 2NVYJ 5IPAA 3BQYA 3LNQA 4M6VA 1ZR2A 1ZKGA 4MFDA 1B8IB 1XG1A 3MN2A 3TRBA 1Y7YA 2JA6J 4MCXA 1WETA 3G7DA 4M3BA 2CROA 2M0CA 2JWTA 1OCPA 2MQKA 1ZZ6A 5IYDJ 2NS7A 4Y52J 4JYKA 1U78A 4DW6A 2O4AA 1CQTA 2GM4A 2PUAA 4FN3A 3IVPA 3HB9A 3MLFA 1ZR4A 1JKPC 1IRZA 4NDLA 2XGDA 2Y0SN 4J19A 3A01A 4MFEA 4D5FA 3S1NJ 2AXUA 1MBEA 2AXVA 5A7LA 5E3OA 3JRFA 2BJCA 1RZRD 2XPUA 1JJ8C 5E3MA 1UHSA 3S15J 3TP3A 2E2HJ 2O9LA 3I4NJ 2KEIA 1QQBA 2EWTA 2OR1L 2VPRA 2EZIA 1QQAA 3FIWA 2X9DA 2EZLA 1JTYA 3JRAA 2EQRA 1LE8B 1X2NA 3HZIB 3QPLA 1B8IA 4X4EA 2XI8A 4MCTA 1JJ6C 2R7ZJ 4A3MJ 3KXAA 1IG7A 2KZ8A 2X48A 2DMQA 1FIAA 2E19A 2Y9ZA 2O38A 2DA1A 1IJWC 5F0HA 2WIUB 3S2DJ 1I3QJ 1IDYA 1QVUA 2O8KA 4Z5DA 4PU3C 1IDZA 4Y7NJ 2DJNA 1APLC 3BTLA 3SCHA 2FX0A 1LFUP 3HGGA 1LFBA 4CYCB 2HOTA 1PRAA 2DTZA 3GTQJ 5IYBJ 1WGXA 3JXDL 4I8TA 2DA2A 3HOYJ 2H8RA 1W0UA 4AC0A 1LLIA 3FMYA 3CQZJ 3GBGA 3B7HA 4JP0A 3K2AA 2R93J 1TWHJ 4X4BA 2OPTA 2AXZA 1VFCA 2VKEA 3BTIA 2EBYA 2ICTA 1Z77A 2CRGA 2DMUA 3IH3A 4JCYA 3IH2A 1BA5A 4UUSB 1WH7A 1QVTA 2XRLA 2LYLA 2WUSR 4M3EA 2VKVA 4W1UA 1AU7A 1WI3A 1GDTA 3M3YJ 3GBFA 1BL0A 4I6ZA 3NAUA 3HOVJ 1UG2A 4GFBA 2YUSA 5FKLA 3HBLA 3BQZA 1ZZCA 1P7IA 1HOMA 1BW6A 1ETWA 1OSLA 3RZDJ 4Z5HA 1MBJA 1R69A 4B4CA 2HDDA 1ZZBA 1TWAJ 4PU8A 1LMB3 2LR8A 3FK7A 1WH8A 2ME0A 4Z59A 4CYCA 3OQOA 1JT0A 2YU9J 4X4GA 1XC5A 3D1NI 3S14J 4MLOA 2BNMA 1VI0A 3TP0A 2MW8A 4I6UA 1ZAYA 3ZHIA 4XK4A 4DYCA 1BJZA 2L7MP 4X4CA 3CLCA 3UFDA 3IV5A 3PO3J 1ZVVA 3BTJA 4JX6A 4J1WA 1JH9A 2X6OA 1ZZ7A 1K83J 1X58A 1XWRA 1UXDA 2AWIA 5EYRA 1ETYA 1Q1VA 5GPAA 1MBKA 4DYRA 1X57A 2N8GA 1QRYA 1WCMJ 4UUSA 4X4DA 2K40A 1POUA 3Q0WA 1HF0A 2LD5A 3EUSA 2XIUA 3JXBC 1HLVA 2DA6A 1R63A 3HOWJ 4I76A 2NS8A 4B3AA 1W0TA 1MNMC 3BTCA 2K9NA 2LKXA 5GP9A 1X2LA 1T33A 3B6AA 5IOYA 1NEQA 3F51A 5BNGA 2D5VA 3GTPJ 1PNRA 3BG9A 4FISA 3FYMA 2E2IJ 2HOSA 2KEJA 3GTJJ 2LLKA 4X4FA 2MGQA 3TW6A 1JKRC 2A6CA 1ZZ8A 1DWKA 4PU7A 2KDZA 4I6RA 1YRNB 3DNVB 2YS9A 2HI3A 1UTXA 1RKWA 5IOZA 4XRSA 2L0KA 4A3CJ 2DMPA 3S16J 3FK6A 2MG4A 2QF7A 4LOCA 5FJ8J 4EEFG 3TEDA 3HDDA 1UMQA 1AHDP 3LFPA 5C44J 3F6WA 5DS9A 2WAQN 1PRVA 1IC8A 3BR1A 5K98B 4A3FJ 3HOXJ 4YBAA 1F36A 2M34A 2PE5A 5M5XJ 1SQ8A 1AKHB 2ECCA 3MKLA 4YARA 2GRLA 3HEFA 2M2EA 4ABZA 4C3HJ 4MO7A 2XSDC 1ETOA 3A03A 4C3IJ 1QPIA 3B6CA 2AW6A 2LYSA 5EZGA 2B63J 1A6IA 1A5JA 4D7NA 1ZTRA 2LYPA 1EFAA 3S1QJ 5FLMJ 1JGGA 5J1YA 3RQIA 4D7MA 1JKQC 3I4MJ 1U8BA 2XB0X 2BNNA 4F8DA 2DN0A 1VPWA 4IWRA 4GQMA 2FJ1A 1ZQ3P 1YSEA 1YRNA 2GBYA 5FKOA 1G2HA 1L1MA 2VI6A 4IHXA 1TWGJ 2R1JL 4GHJA 1WIZA 5EZHA 2AO9A 2LFBA 2Y2ZA 4V2GA 1P7JA 1HDPA 5K7ZA 1U9OA 3OIOA 1ADRA 3RZOJ 1JKOC 1FTZA 3S8QA 2Y31A 3G1OA 3OQNA 2O7OA 1WH6A 1TWFJ 4A3JJ 1AKHA 5EEAA 4BY1J 1UXCA 2IEKA 4AUXA 4V2FA 1PUFB 1JUMA 2K9QA 3QF3A 4BY7J 4C2MJ 2PUEA 2DMNA 3K7AJ 3JRCA 1MSFC 1TC3C 1ORKA 2CQQA 1LE8A 4O8BA 1MBGA 1E3OC 4YG1A 4L5EA 3BT9A 1I6HJ 2IVQA 1B0NA 4A69C 1QP7A 2PUCA 2FD5A 5IP9J 5DTDA 2CU7A 2EZHA 3L1PA 2VUMJ 2FQ4A 2ID6A 1IGNA 4G12A 1F43A 3O8GA 5M3FJ 1JWLA 1FTTA 3DEWA 3R1FA 3HOZJ 3JREA 2EZKA 3H0GJ 3OSGA 2GLOA 4A3KJ 3W6VA 4OB4A 3GTKJ 2JA5J 2HXIA 3JRDA 1O4XA 3HKZN 2R0QC 1S7EA 1OJLA 2HYJA 1RKTA 2M9HA 4X6AJ 3KZ3A 4IVZA 2LCVA 5F08A 2HINA 1RZRA 1HCRA 3JRHA 1DU0A 3F52A 1QPZA 2P81A 3A02A 5F1JA 2CSFA 5M5WJ 3OP9A 5HODA 1XS9A 2ELKA 2XPVA 4DYQA 3QQAA 3GTLJ 2IV1A 5M3MJ 1PUFA 5JLWA 2XJ3A 4JX5A 3LISA 2HOAA 3MVPA 2L49A 3UKGA 1ETKA 1JTXA 1SANA 2KPJA 4B1RA 3H3VK 3BDNA 2IVBA 1ZPQA 1NK2P 2NVTJ 2PPXA 2ZB9A 3NARA 2ID3A 4FBIA 3ZKCA 4M3FA 1PERL 1OCTC 3HGYA 3RKQA 2R92J 2B5AA 2QCOA 5FKNA 5J3LA 4HNVA 4W97A 1DU6A 4BBRJ 1JFTA 3OMTA 3O8HA 1CJGA 3JR9A 1D5YA 2TCTA 5K7FA 1LCDA 3G5GA 2PUFA 2KT0A 2EBIA 4JQDA 2PIJA 1DW9A 2ECBA 1ITYA 1FEXA 2OF7A 2CUFA 2MEZA 2JA8J 3RZZA 3OSFA 3S17J 5C4XJ 5EG0B 4UUTA 5IP6A 3WHBA 1ETQA 5F27A 4FE4A 5E3LA 3U3WA 1TWCJ 5F0CA 1JUSA 1RESA 2WV1A 1VNDA 3FISA 3OOUA 4XRSG 4JCXA 4AYBN 2OFYA 2HQ5A 5EDNA 2HXOA 1IUFA 4A93J 3ZOBA 5IP7J 1RPWA 4BKXA 4YG7B 2Y30A 3BR0A 1QP4A 3CMYA 3QPSA 4JX4A 4XICA 2WB1N 4QTRA 1MBFA 3G1LA 4YG4A 3IH4A 1ZK8A 3Q0UA 3ZQHA 4DZPA 3BS3A 1ZGWA 3BR2A 3LOCA 3SCGA 3DCFA 2TRTA 4MIMA 2JCGA 3JXCL 2IU7A 2XPWA 3QQ6A 2CJJA 5FLVA 5EG0A 3BG5A 1JT6A 1HDDC 4IHVA 2GZUA 3LSPA 3QYXA 5GPCA 3BG3A 5EGOB 2IUOA 4D5CA 3VPRA 3CCYA 3CDLA 4DZJA 3S1MJ 3BR5A 5FKMA 2FJRA 2AUWA 4FE7A 2M8GX 3LSJA 2NVXJ 5IYCJ 3JRIA 1RZSA 1BW5A 2DMTA 4A3DJ 1POGA 1I50J 2LY9A 2LYQA 1RIOA 1ZZ9A 2XB5A 2E2JJ 2W48A 3TW7A 2R5YB 2AHQA 3Q0VA 4QSHA 4Y42A 4M3DA 3VK0A 1MH4A 2H1KA 2MSYA 1FIPA 3BR3A 2JVLA 5J1UA 2LP0A 2L7FP 4X4IA 3LSGA 4QIWN 3SDGA 2L8NA 1ETXA 4I6TA 1Y9QA 2PUDA 2COBA 3ZQGA 3PM1A 3H5TA 1LCCA 2RAEA 4IHYA 3BD1A 3CECA 1H89C 1RR7A 2PUBA 2XGCA 5FKKA 3BR6A 2L7ZA 2L9RA 3HOUJ 5EF6A 1MBHA 5EGOA 1NTCA 3ZQLA 1IV6A 2NVQJ 3LSRA 2IVGA 4RBOA 1B72B 3S2HJ 3ZHMA 3GTOJ 5J1RA 3S1RJ 4XRMA 3QWGA 2Y9YA 1BDIA 1WH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO2 J;  1LQC A;  5JLX A;  2NOG A;  4RDU A;  4A3G J;  2BNO A;  2HSG A;  1R9T J;  4Z5C A;  3JRB A;  3SCF A;  2ME6 A;  4IA8 A;  2GRM A;  4NDW A;  1MH3 A;  2CUE A;  2O49 A;  2LK2 A;  2LYR A;  1VF9 A;  1GUU A;  1WPK A;  2R5Y A;  2EF8 A;  1ZS4 A;  2R5Z B;  2ICP A;  5K7H A;  1RPE L;  3JRG A;  1JFS A;  1BDH A;  1T56 A;  3CRO L;  3GTM J;  2XGE A;  3GN5 B;  5F0F A;  1GV5 A;  2EH3 A;  3O9X A;  1K61 A;  2DA7 A;  4Z58 A;  1U9N A;  1PRU A;  1JUP A;  4BXX J;  2LVS A;  5F04 A;  5C4J J;  4A3B J;  1Z0X A;  1EF4 A;  1OFC X;  3SJM A;  4X1E A;  4J1X A;  2JMW A;  4FCY A;  2DA5 A;  4M3G A;  1B72 A;  3E7L A;  1X2M A;  3PXP A;  3ZQC A;  1GV2 A;  4A3I J;  3HM5 A;  1MSE C;  1SFO J;  2LYK A;  4C3J J;  4PU4 C;  1GVD A;  3FKI J;  5C3E J;  3WHC A;  4XID A;  2IBD A;  2XCJ A;  1FJL A;  2PUG A;  3KJX A;  2JN6 A;  1Y1V J;  1ZUG A;  1H88 C;  2PMZ N;  2DA3 A;  3A01 B;  2R63 A;  3OQM A;  3F0C A;  1ENH A;  2JA7 J;  2E1O A;  4IHW A;  3ZQI A;  2R5Z A;  3Q3S A;  1RET A;  2LTP A;  1H8A C;  9ANT A;  2CQX A;  4A3E J;  1Y1W J;  2I10 A;  2DA4 A;  3C2B A;  2G0E A;  3GTG J;  1NER A;  3GN5 A;  2KEK A;  1QP0 A;  1GT0 C;  1ETV A;  3ZQF A;  5M5Y J;  3G1M A;  5E3N A;  4IEJ A;  4A3L J;  3SFI A;  4X4H A;  1NK3 P;  4BBS J;  2K9S A;  2JJ7 A;  4FTH A;  2LYJ A;  2IAI A;  3M4O J;  2JK3 A;  3FYA A;  4S0H B;  2NVY J;  5IPA A;  3BQY A;  3LNQ A;  4M6V A;  1ZR2 A;  1ZKG A;  4MFD A;  1B8I B;  1XG1 A;  3MN2 A;  3TRB A;  1Y7Y A;  2JA6 J;  4MCX A;  1WET A;  3G7D A;  4M3B A;  2CRO A;  2M0C A;  2JWT A;  1OCP A;  2MQK A;  1ZZ6 A;  5IYD J;  2NS7 A;  4Y52 J;  4JYK A;  1U78 A;  4DW6 A;  2O4A A;  1CQT A;  2GM4 A;  2PUA A;  4FN3 A;  3IVP A;  3HB9 A;  3MLF A;  1ZR4 A;  1JKP C;  1IRZ A;  4NDL A;  2XGD A;  2Y0S N;  4J19 A;  3A01 A;  4MFE A;  4D5F A;  3S1N J;  2AXU A;  1MBE A;  2AXV A;  5A7L A;  5E3O A;  3JRF A;  2BJC A;  1RZR D;  2XPU A;  1JJ8 C;  5E3M A;  1UHS A;  3S15 J;  3TP3 A;  2E2H J;  2O9L A;  3I4N J;  2KEI A;  1QQB A;  2EWT A;  2OR1 L;  2VPR A;  2EZI A;  1QQA A;  3FIW A;  2X9D A;  2EZL A;  1JTY A;  3JRA A;  2EQR A;  1LE8 B;  1X2N A;  3HZI B;  3QPL A;  1B8I A;  4X4E A;  2XI8 A;  4MCT A;  1JJ6 C;  2R7Z J;  4A3M J;  3KXA A;  1IG7 A;  2KZ8 A;  2X48 A;  2DMQ A;  1FIA A;  2E19 A;  2Y9Z A;  2O38 A;  2DA1 A;  1IJW C;  5F0H A;  2WIU B;  3S2D J;  1I3Q J;  1IDY A;  1QVU A;  2O8K A;  4Z5D A;  4PU3 C;  1IDZ A;  4Y7N J;  2DJN A;  1APL C;  3BTL A;  3SCH A;  2FX0 A;  1LFU P;  3HGG A;  1LFB A;  4CYC B;  2HOT A;  1PRA A;  2DTZ A;  3GTQ J;  5IYB J;  1WGX A;  3JXD L;  4I8T A;  2DA2 A;  3HOY J;  2H8R A;  1W0U A;  4AC0 A;  1LLI A;  3FMY A;  3CQZ J;  3GBG A;  3B7H A;  4JP0 A;  3K2A A;  2R93 J;  1TWH J;  4X4B A;  2OPT A;  2AXZ A;  1VFC A;  2VKE A;  3BTI A;  2EBY A;  2ICT A;  1Z77 A;  2CRG A;  2DMU A;  3IH3 A;  4JCY A;  3IH2 A;  1BA5 A;  4UUS B;  1WH7 A;  1QVT A;  2XRL A;  2LYL A;  2WUS R;  4M3E A;  2VKV A;  4W1U A;  1AU7 A;  1WI3 A;  1GDT A;  3M3Y J;  3GBF A;  1BL0 A;  4I6Z A;  3NAU A;  3HOV J;  1UG2 A;  4GFB A;  2YUS A;  5FKL A;  3HBL A;  3BQZ A;  1ZZC A;  1P7I A;  1HOM A;  1BW6 A;  1ETW A;  1OSL A;  3RZD J;  4Z5H A;  1MBJ A;  1R69 A;  4B4C A;  2HDD A;  1ZZB A;  1TWA J;  4PU8 A;  1LMB 3;  2LR8 A;  3FK7 A;  1WH8 A;  2ME0 A;  4Z59 A;  4CYC A;  3OQO A;  1JT0 A;  2YU9 J;  4X4G A;  1XC5 A;  3D1N I;  3S14 J;  4MLO A;  2BNM A;  1VI0 A;  3TP0 A;  2MW8 A;  4I6U A;  1ZAY A;  3ZHI A;  4XK4 A;  4DYC A;  1BJZ A;  2L7M P;  4X4C A;  3CLC A;  3UFD A;  3IV5 A;  3PO3 J;  1ZVV A;  3BTJ A;  4JX6 A;  4J1W A;  1JH9 A;  2X6O A;  1ZZ7 A;  1K83 J;  1X58 A;  1XWR A;  1UXD A;  2AWI A;  5EYR A;  1ETY A;  1Q1V A;  5GPA A;  1MBK A;  4DYR A;  1X57 A;  2N8G A;  1QRY A;  1WCM J;  4UUS A;  4X4D A;  2K40 A;  1POU A;  3Q0W A;  1HF0 A;  2LD5 A;  3EUS A;  2XIU A;  3JXB C;  1HLV A;  2DA6 A;  1R63 A;  3HOW J;  4I76 A;  2NS8 A;  4B3A A;  1W0T A;  1MNM C;  3BTC A;  2K9N A;  2LKX A;  5GP9 A;  1X2L A;  1T33 A;  3B6A A;  5IOY A;  1NEQ A;  3F51 A;  5BNG A;  2D5V A;  3GTP J;  1PNR A;  3BG9 A;  4FIS A;  3FYM A;  2E2I J;  2HOS A;  2KEJ A;  3GTJ J;  2LLK A;  4X4F A;  2MGQ A;  3TW6 A;  1JKR C;  2A6C A;  1ZZ8 A;  1DWK A;  4PU7 A;  2KDZ A;  4I6R A;  1YRN B;  3DNV B;  2YS9 A;  2HI3 A;  1UTX A;  1RKW A;  5IOZ A;  4XRS A;  2L0K A;  4A3C J;  2DMP A;  3S16 J;  3FK6 A;  2MG4 A;  2QF7 A;  4LOC A;  5FJ8 J;  4EEF G;  3TED A;  3HDD A;  1UMQ A;  1AHD P;  3LFP A;  5C44 J;  3F6W A;  5DS9 A;  2WAQ N;  1PRV A;  1IC8 A;  3BR1 A;  5K98 B;  4A3F J;  3HOX J;  4YBA A;  1F36 A;  2M34 A;  2PE5 A;  5M5X J;  1SQ8 A;  1AKH B;  2ECC A;  3MKL A;  4YAR A;  2GRL A;  3HEF A;  2M2E A;  4ABZ A;  4C3H J;  4MO7 A;  2XSD C;  1ETO A;  3A03 A;  4C3I J;  1QPI A;  3B6C A;  2AW6 A;  2LYS A;  5EZG A;  2B63 J;  1A6I A;  1A5J A;  4D7N A;  1ZTR A;  2LYP A;  1EFA A;  3S1Q J;  5FLM J;  1JGG A;  5J1Y A;  3RQI A;  4D7M A;  1JKQ C;  3I4M J;  1U8B A;  2XB0 X;  2BNN A;  4F8D A;  2DN0 A;  1VPW A;  4IWR A;  4GQM A;  2FJ1 A;  1ZQ3 P;  1YSE A;  1YRN A;  2GBY A;  5FKO A;  1G2H A;  1L1M A;  2VI6 A;  4IHX A;  1TWG J;  2R1J L;  4GHJ A;  1WIZ A;  5EZH A;  2AO9 A;  2LFB A;  2Y2Z A;  4V2G A;  1P7J A;  1HDP A;  5K7Z A;  1U9O A;  3OIO A;  1ADR A;  3RZO J;  1JKO C;  1FTZ A;  3S8Q A;  2Y31 A;  3G1O A;  3OQN A;  2O7O A;  1WH6 A;  1TWF J;  4A3J J;  1AKH A;  5EEA A;  4BY1 J;  1UXC A;  2IEK A;  4AUX A;  4V2F A;  1PUF B;  1JUM A;  2K9Q A;  3QF3 A;  4BY7 J;  4C2M J;  2PUE A;  2DMN A;  3K7A J;  3JRC A;  1MSF C;  1TC3 C;  1ORK A;  2CQQ A;  1LE8 A;  4O8B A;  1MBG A;  1E3O C;  4YG1 A;  4L5E A;  3BT9 A;  1I6H J;  2IVQ A;  1B0N A;  4A69 C;  1QP7 A;  2PUC A;  2FD5 A;  5IP9 J;  5DTD A;  2CU7 A;  2EZH A;  3L1P A;  2VUM J;  2FQ4 A;  2ID6 A;  1IGN A;  4G12 A;  1F43 A;  3O8G A;  5M3F J;  1JWL A;  1FTT A;  3DEW A;  3R1F A;  3HOZ J;  3JRE A;  2EZK A;  3H0G J;  3OSG A;  2GLO A;  4A3K J;  3W6V A;  4OB4 A;  3GTK J;  2JA5 J;  2HXI A;  3JRD A;  1O4X A;  3HKZ N;  2R0Q C;  1S7E A;  1OJL A;  2HYJ A;  1RKT A;  2M9H A;  4X6A J;  3KZ3 A;  4IVZ A;  2LCV A;  5F08 A;  2HIN A;  1RZR A;  1HCR A;  3JRH A;  1DU0 A;  3F52 A;  1QPZ A;  2P81 A;  3A02 A;  5F1J A;  2CSF A;  5M5W J;  3OP9 A;  5HOD A;  1XS9 A;  2ELK A;  2XPV A;  4DYQ A;  3QQA A;  3GTL J;  2IV1 A;  5M3M J;  1PUF A;  5JLW A;  2XJ3 A;  4JX5 A;  3LIS A;  2HOA A;  3MVP A;  2L49 A;  3UKG A;  1ETK A;  1JTX A;  1SAN A;  2KPJ A;  4B1R A;  3H3V K;  3BDN A;  2IVB A;  1ZPQ A;  1NK2 P;  2NVT J;  2PPX A;  2ZB9 A;  3NAR A;  2ID3 A;  4FBI A;  3ZKC A;  4M3F A;  1PER L;  1OCT C;  3HGY A;  3RKQ A;  2R92 J;  2B5A A;  2QCO A;  5FKN A;  5J3L A;  4HNV A;  4W97 A;  1DU6 A;  4BBR J;  1JFT A;  3OMT A;  3O8H A;  1CJG A;  3JR9 A;  1D5Y A;  2TCT A;  5K7F A;  1LCD A;  3G5G A;  2PUF A;  2KT0 A;  2EBI A;  4JQD A;  2PIJ A;  1DW9 A;  2ECB A;  1ITY A;  1FEX A;  2OF7 A;  2CUF A;  2MEZ A;  2JA8 J;  3RZZ A;  3OSF A;  3S17 J;  5C4X J;  5EG0 B;  4UUT A;  5IP6 A;  3WHB A;  1ETQ A;  5F27 A;  4FE4 A;  5E3L A;  3U3W A;  1TWC J;  5F0C A;  1JUS A;  1RES A;  2WV1 A;  1VND A;  3FIS A;  3OOU A;  4XRS G;  4JCX A;  4AYB N;  2OFY A;  2HQ5 A;  5EDN A;  2HXO A;  1IUF A;  4A93 J;  3ZOB A;  5IP7 J;  1RPW A;  4BKX A;  4YG7 B;  2Y30 A;  3BR0 A;  1QP4 A;  3CMY A;  3QPS A;  4JX4 A;  4XIC A;  2WB1 N;  4QTR A;  1MBF A;  3G1L A;  4YG4 A;  3IH4 A;  1ZK8 A;  3Q0U A;  3ZQH A;  4DZP A;  3BS3 A;  1ZGW A;  3BR2 A;  3LOC A;  3SCG A;  3DCF A;  2TRT A;  4MIM A;  2JCG A;  3JXC L;  2IU7 A;  2XPW A;  3QQ6 A;  2CJJ A;  5FLV A;  5EG0 A;  3BG5 A;  1JT6 A;  1HDD C;  4IHV A;  2GZU A;  3LSP A;  3QYX A;  5GPC A;  3BG3 A;  5EGO B;  2IUO A;  4D5C A;  3VPR A;  3CCY A;  3CDL A;  4DZJ A;  3S1M J;  3BR5 A;  5FKM A;  2FJR A;  2AUW A;  4FE7 A;  2M8G X;  3LSJ A;  2NVX J;  5IYC J;  3JRI A;  1RZS A;  1BW5 A;  2DMT A;  4A3D J;  1POG A;  1I50 J;  2LY9 A;  2LYQ A;  1RIO A;  1ZZ9 A;  2XB5 A;  2E2J J;  2W48 A;  3TW7 A;  2R5Y B;  2AHQ A;  3Q0V A;  4QSH A;  4Y42 A;  4M3D A;  3VK0 A;  1MH4 A;  2H1K A;  2MSY A;  1FIP A;  3BR3 A;  2JVL A;  5J1U A;  2LP0 A;  2L7F P;  4X4I A;  3LSG A;  4QIW N;  3SDG A;  2L8N A;  1ETX A;  4I6T A;  1Y9Q A;  2PUD A;  2COB A;  3ZQG A;  3PM1 A;  3H5T A;  1LCC A;  2RAE A;  4IHY A;  3BD1 A;  3CEC A;  1H89 C;  1RR7 A;  2PUB A;  2XGC A;  5FKK A;  3BR6 A;  2L7Z A;  2L9R A;  3HOU J;  5EF6 A;  1MBH A;  5EGO A;  1NTC A;  3ZQL A;  1IV6 A;  2NVQ J;  3LSR A;  2IVG A;  4RBO A;  1B72 B;  3S2H J;  3ZHM A;  3GTO J;  5J1R A;  3S1R J;  4XRM A;  3QWG A;  2Y9Y A;  1BDI A;  1WH5 A; 
#chains in the Genus database with same CATH topology
 2H09 A;  1LQC A;  2VT3 A;  4G6T B;  4Z5C A;  2HSG A;  3K4J A;  5HOO A;  2ME6 A;  2CW0 F;  2FE3 A;  3R6S A;  1GUU A;  3LQQ A;  2R5Y A;  2EA4 A;  2IT0 A;  2EIJ H;  3KPH A;  2E36 A;  2R5Z B;  3FM3 A;  1UG0 A;  1D1B A;  1U0J A;  5K7H A;  1RPE L;  2X6W A;  3K4N A;  2BY3 A;  2FUG 2;  4NC8 A;  4UNO A;  3ZMU A;  3O9X A;  2E60 A;  1DUL A;  4S04 A;  2R7F A;  2LKP A;  3J80 Z;  1G8X A;  2HU9 A;  1FYM A;  4UHT A;  1A36 A;  2IS6 A;  1JUP A;  1RIO H;  4I0A A;  4I7H A;  2LVS A;  1YS6 A;  3LSI A;  5F04 A;  5C4J J;  4A3B J;  1XCB A;  4BXX J;  3SJM A;  3JSP A;  2JMW A;  2DW4 A;  3U1K A;  2DA5 A;  2IW5 A;  2OA4 A;  4FCY A;  4MEX F;  3E7L A;  4LB6 B;  4Y15 A;  3I56 I;  1MJB A;  1U5T C;  4LB5 A;  2LYK A;  4XKB A;  1MMN A;  3T0Y A;  4BAC A;  2IBD A;  5FD6 A;  2XCJ A;  2L02 A;  4CO8 A;  1E0E A;  2PUG A;  2I8D A;  2QVO A;  4HPQ A;  4U0W A;  1A35 A;  2GXG A;  4C2T A;  2EV0 A;  1Y1V J;  5BS6 A;  2P6S A;  2CV0 A;  1KU9 A;  3HUG B;  2R7O A;  3L00 A;  2KIU A;  4M9Z A;  3ZQI A;  3Q3S A;  3OYF A;  1PP7 U;  1RET A;  2VJ4 A;  3EQL F;  1H8A C;  2CQX A;  4A3E J;  2R7V A;  1Y1W J;  4M71 A;  2A6E F;  2HYF A;  2QQ8 A;  3GN5 A;  3OYI A;  3GTG J;  2LY2 A;  4L18 B;  2KEK A;  4TV7 A;  4LK1 F;  5DDG A;  5B3S H;  3W2V A;  4BBS J;  1OCZ H;  1VQ5 I;  4IL6 C;  4OWR B;  2NVY J;  1HXD A;  3BQY A;  3I4P A;  3WTV C;  2VE9 A;  2VE8 A;  2IGM A;  2EK5 A;  4CCM A;  1LKX A;  2R7S A;  3EPZ A;  5L3D A;  3VOD A;  3WTY C;  4LG0 B;  4E7H A;  2XF5 A;  3GZC A;  3ASN H;  1ZRF A;  2LKS A;  2IS4 A;  2CRO A;  2JWT A;  4L9N A;  2JQE A;  3MKW B;  2LSO A;  2L1P A;  3WG9 A;  4D9J A;  2NS7 A;  1MFQ C;  2O4A A;  1CQT A;  1K4T A;  5DUK A;  3HB9 A;  1R6R A;  1CF7 A;  1MZB A;  3MLF A;  1IRZ A;  3V42 A;  5H2F C;  1B1B A;  2Y0S N;  3BJO A;  4PJJ A;  4D5F A;  3A01 A;  3M8J A;  1MBE A;  4KYW A;  3S1N J;  5DTQ A;  1Y0U A;  3KX2 A;  2ZJR F;  3JRF A;  3BLY A;  1RZR D;  3RKY A;  4ESB A;  4Y17 A;  4XN3 A;  4CSW A;  3I4N J;  4A5M A;  4L0Y B;  3CP8 A;  4F52 A;  1P92 A;  1QQA A;  2PQ8 A;  1RUO A;  1X2N A;  4OIN F;  2D45 A;  4JK1 X;  3KZY A;  3DPT A;  4X4E A;  3MAJ A;  2W24 A;  2DO7 A;  3ZMT A;  1W36 D;  4F92 B;  1IG7 A;  2E19 A;  3BWG A;  2XAS A;  2VKH A;  4UVB A;  1SFK A;  3FXJ A;  1QVU A;  1WJB A;  3ABU A;  4PU3 C;  5D8K B;  3MKZ A;  3FXM A;  2XAU A;  4LLN A;  1LFU P;  2VN2 A;  3HGG A;  3HRU A;  5ED4 A;  3RQ4 A;  4HA8 A;  2HOT A;  2PMH A;  3A9Y A;  3GTQ J;  4YRV A;  1WGX A;  3FHZ A;  4J01 A;  3CTA A;  2NVU B;  1FP2 A;  1LDK B;  3A1Y A;  2BW3 A;  2PXP A;  2XV4 S;  3NDB B;  2HZD A;  3QFI A;  2XHK A;  1EV7 A;  1MDM B;  4LLL A;  2TDX A;  2DYR H;  4NUB A;  2HNH A;  1VFC A;  3BTI A;  2EIN H;  3N4M A;  3CC7 I;  3NQO A;  3ASO H;  1I39 A;  4YFK F;  2CG4 A;  2KDO A;  1K79 A;  3BZC A;  1OKR A;  4M3E A;  2VKV A;  4W1U A;  2PN6 A;  3DP7 A;  3GBF A;  2JRM A;  4I6Z A;  4QWQ A;  1J7K A;  3NAU A;  1V54 H;  2FSW A;  1UG2 A;  3WU2 C;  5FKL A;  1OCO H;  2CSO A;  1ETW A;  3RZD J;  1MBJ A;  1ZG1 A;  4B4C A;  1BR4 A;  2DK8 A;  1TWA J;  1KU7 A;  2HDD A;  3SXY A;  4PU8 A;  2LR8 A;  1MMD A;  3FK7 A;  1ZRE A;  1WH8 A;  3LQR A;  1LEA A;  1G6N A;  5A2Q Z;  2NNY A;  2XGX A;  1L0O C;  3ZCO A;  3RPU A;  3KE2 A;  2ZME B;  4NC6 A;  5CLS A;  1F9N A;  1XGN A;  1XMX A;  2H27 A;  4XK4 A;  1U8R A;  2L7M P;  4BUP A;  2VAS A;  3VWB A;  5LGU A;  4IOA F;  3PO3 J;  1ZVV A;  3BTJ A;  3LSK A;  2V1U A;  4JX6 A;  4J1W A;  4IF4 A;  5HNF A;  4NQW B;  1XWR A;  3V7C A;  1MBK A;  3I59 B;  3OL4 A;  1BC7 C;  2BOL A;  2N8G A;  4X4D A;  4UB8 C;  4XLN F;  4UUS A;  1JI8 A;  1POU A;  3OS1 A;  2MYS A;  2W57 A;  2M4G A;  2HS5 A;  2XIU A;  1HLV A;  1SFE A;  2DLL A;  2NS8 A;  1ZAO A;  4WXC A;  1W0T A;  1MNM C;  2IP2 A;  2H8W A;  2VT2 A;  3H5A A;  3HIF A;  2HFZ A;  3NRO A;  2OBP A;  4DIQ A;  3F51 A;  3DBR B;  3IAM 2;  3OYK A;  1YTY A;  3V8J A;  3KP3 A;  4FIS A;  1HKT A;  2BHY A;  3L2R A;  4X4F A;  2MGQ A;  2W7N A;  4XKV A;  4A5N A;  5E17 F;  2F48 A;  1Z3X A;  1Z3Y A;  3H3Z A;  2KP6 A;  1T98 A;  4CUG A;  2BY2 A;  2YS9 A;  1XDU A;  3DXJ F;  4HST A;  1RKW A;  5K5O A;  4M6X A;  1SD7 A;  4XRS A;  3A0H C;  3QOD A;  4FET A;  2MG4 A;  2GQQ A;  5C44 J;  4YFN F;  1Z05 A;  2ECC A;  3MKL A;  2ESH A;  3DKY A;  2CV2 A;  4L9J A;  3MFK A;  1D1A A;  3A03 A;  5HDG A;  5D6E A;  4YEL A;  1I5Z A;  1IZ1 A;  5EZG A;  2V3C C;  1ZGA A;  1A6I A;  3OYE A;  4BJ6 C;  1UZC A;  1EFA A;  2K4J A;  3CUQ B;  1UEL B;  3V8K A;  5J1Y A;  2PXB A;  4D7M A;  3CCQ I;  1JKQ C;  4LG0 A;  3I4M J;  5LD2 C;  2ZNZ A;  1Z21 A;  2DN0 A;  4L5I A;  1S7A A;  5LEJ A;  1WJC A;  3L2W A;  5LBQ A;  4F8D A;  1VPW A;  2FJ1 A;  2OV7 A;  4RM2 A;  4FX0 A;  1YLF A;  1Y8Q B;  4DBQ A;  4XM3 A;  2AO9 A;  2NS0 A;  4V2G A;  3ERE D;  2IA0 A;  1WQ2 A;  3RZO J;  3LA3 A;  1SC7 A;  2Y31 A;  4BE1 A;  1BI2 A;  2R7W A;  1SMY F;  3VDX A;  4BY1 J;  1OR7 A;  2F5E A;  3JTH A;  3PIP F;  4EM1 A;  2YSR A;  1JUM A;  4C2M J;  3FBN B;  2FML A;  5GTI C;  1J0R A;  3H1C A;  2AS5 F;  1JE8 A;  4L5E A;  3BT9 A;  1J2X A;  2FMY A;  2OQG A;  4A6D A;  4IZZ A;  5IP9 J;  1FSH A;  5BQT A;  1Z7U A;  2CMP A;  3DEE A;  5L3G A;  5IY5 H;  5M3F J;  3R0A A;  3S32 A;  3R1F A;  3H0G J;  2X0L A;  4A3K J;  2K85 A;  5ILS A;  3GTK J;  2CS3 A;  3KZ3 A;  3E5U A;  1S7E A;  3OYL A;  1FBS A;  4YII A;  2NXN B;  3NWT A;  1VQ9 I;  2A5W A;  2YPR A;  2M7B A;  2DT7 B;  1W36 C;  3F52 A;  3NRV A;  3JW4 A;  4BNC A;  5M5W J;  2IV1 A;  4A2U A;  2HZT A;  5FFX A;  1IN5 A;  2XJ3 A;  3BZK A;  2HOA A;  3UKG A;  1J09 A;  3CJN A;  4EV0 A;  4EGY A;  1ZPQ A;  5LFA A;  5B1A H;  3MKY B;  4XLE A;  3NAR A;  4FBI A;  1ON2 A;  1OCT C;  3HGY A;  3ZMV A;  1TQM A;  4XOR A;  1P4W A;  5B1B H;  1R49 A;  2QCO A;  5CVV A;  2VQC A;  4P1W A;  2KL4 A;  4BJT A;  5IT3 A;  4G7Z F;  1DU6 A;  1JFT A;  4EVI A;  1LCD A;  3O8H A;  1CJG A;  2PUF A;  2FF4 A;  5K7F A;  2VQL A;  4BDZ A;  2KIF A;  3KEO A;  3SZT A;  3CO6 C;  1FEX A;  2MEZ A;  3KP7 A;  3OSF A;  3CLO A;  2BVM A;  1N77 A;  2VC1 A;  5EG0 B;  5E20 A;  2HFH A;  2GXB A;  3WHB A;  2QSF X;  4FE4 A;  3H5N A;  2VQH A;  1KQ8 A;  1LDJ A;  2VOP A;  4PGH A;  2MD5 A;  5B66 C;  3WU1 B;  3ZMD A;  5LLQ A;  2WV1 A;  5LRS A;  1VND A;  2Z16 A;  3PFY A;  3JTG A;  2OFY A;  4X0G A;  1EH7 A;  1IUF A;  2XF6 A;  1LFP A;  3VWS A;  5DCM B;  3FXO A;  3ZOB A;  1FOW A;  5IP7 J;  4BL0 B;  1RPW A;  2BZT A;  1WHU A;  2X1D A;  1QP4 A;  1VQM I;  3QPS A;  1SVM A;  4JX4 A;  4Q48 A;  3TDZ C;  5GAG J;  4BXU A;  5J4Y A;  2J7W A;  1MBF A;  3UWP A;  4YG4 A;  1ZK8 A;  4HNT A;  4ER3 A;  3VYT B;  3ABL H;  2KLO A;  2TRT A;  2JCG A;  2O3F A;  3JXC L;  1WJ5 A;  2VXZ A;  2XPW A;  3DU6 A;  2LMD A;  1R5I D;  5ILV A;  2R7T A;  1QPM A;  2RGV A;  1FZP B;  4LK0 F;  1JT6 A;  4XRF A;  1HDD C;  3LSP A;  3BG3 A;  1J9I A;  4G94 A;  1G3W A;  1LJ9 A;  1ZAR A;  4KIC A;  2K9M A;  2CYY A;  3CCY A;  2CH0 A;  3P9C A;  4A0Z A;  3BR5 A;  5FKM A;  2FJR A;  2VBY A;  3LSJ A;  1EJ9 A;  3VYR B;  2Y0M A;  5DCF A;  2WB1 A;  3JRI A;  1L3L A;  2JUG A;  2R7D A;  3M1C A;  3WGH A;  2LNB A;  2DMT A;  3J7A O;  4EKI A;  1I50 J;  5FO5 A;  2LLW A;  1RIO A;  1ZRD A;  3EET A;  1ZZ9 A;  4XBF A;  2EIM H;  2W48 A;  3TW7 A;  2R5Y B;  1DPU A;  2P4W A;  1HSJ A;  2JVL A;  5J1U A;  2BXZ A;  2Y0S A;  4AU7 A;  1D1C A;  4I98 B;  3SDG A;  2L8N A;  4F7Z A;  3PM1 A;  3E1S A;  3ABM H;  4JQF A;  3CUQ A;  3BP8 A;  1H89 C;  1RR7 A;  2GXA A;  4B44 A;  4CHU A;  5EGO A;  3IUO A;  1GHC A;  1M1E B;  4ZYG A;  5ERI A;  3LSR A;  2IVG A;  2KRC A;  5ICE A;  4BE2 A;  1T38 A;  3WU0 A;  2X1C A;  2ZXW H;  1BDI A;  3GEZ A;  3PO2 J;  1UHW A;  3ROU A;  2NOG A;  2LG4 A;  3DF8 A;  4IRG A;  1VZ0 A;  4PCQ A;  1OYY A;  3GME A;  3SCF A;  2XAF A;  4NDW A;  3A2K A;  4DBR A;  2X4H A;  5H6R A;  2LK2 A;  4Y3O A;  1X1B A;  4CYD A;  4N9I A;  1WPK A;  4PZJ A;  1XTA A;  2O8X A;  2MLG A;  2W84 A;  2ZC2 A;  2EFO A;  4WWC A;  2QEN A;  2GA2 A;  2HOE A;  3IKT A;  3CRO L;  3GN5 B;  2W1O A;  1GV5 A;  2ZCW A;  4OIP F;  1K61 A;  1XGS A;  5KVR A;  3ZRG A;  4PJL A;  5LGT A;  1U9N A;  2OTJ I;  2W00 A;  4PJN A;  1YIO A;  4BXF A;  1ZLK A;  2QKL B;  1QGP A;  2MC3 A;  1Z0X A;  2K5C A;  3DBH B;  2KJB A;  3G3Z A;  3SFZ A;  2JUC A;  3ZMS A;  1JXS A;  4J1X A;  4XL9 A;  4XMY A;  1IN7 A;  1IRF A;  2UXN A;  4XR6 A;  3HM5 A;  5HLT A;  4ER7 A;  2M1B A;  1ONV A;  1EH6 A;  5HNH A;  1OLT A;  2O0Y A;  2K9L A;  1SFO J;  1GVD A;  4C9Y A;  4ZZL A;  2ISZ A;  1XMA A;  4PU4 C;  4IQJ A;  2PMU A;  2D1H A;  4BJ5 C;  2AXT C;  3CMA I;  4A12 A;  1CF7 B;  4M72 A;  4ZTF A;  2JN6 A;  1J59 A;  3A01 B;  2XF7 A;  3AL0 B;  1U2W A;  2ZME C;  2VLA A;  4IHW A;  3PSF A;  4ZC3 A;  5HVQ C;  4ZDL A;  2KJC A;  9ANT A;  5FB2 A;  3I58 A;  1U5T A;  3K1P A;  5KAI C;  3C2B A;  3TO7 A;  1QP0 A;  1NER A;  1WVR A;  3ECO A;  1GT0 C;  1ETV A;  2AQE A;  5J8F A;  5M5Y J;  1AA7 A;  4IEJ A;  3SFI A;  4A3L J;  1YX3 A;  1NK3 P;  2F5V A;  3QP6 A;  1DUX C;  2DJI A;  3QOP A;  2K9S A;  2JJ7 A;  2UV1 A;  2IAI A;  2HVQ A;  1N25 A;  1T39 A;  3OWQ A;  3FYA A;  2VJ5 A;  4S0H B;  3FXK A;  5DT2 A;  1FPQ A;  3KZZ A;  3DTK A;  4MFD A;  3GZ6 A;  1XG1 A;  4IX7 A;  4WF2 A;  1MW7 A;  2F4O B;  3L09 A;  1BOB A;  4KT6 A;  4M3B A;  2MQK A;  4UVA A;  2PXU A;  2KMU A;  2DFH A;  5ICG A;  3V7R A;  1ZR4 A;  3M07 A;  1MJA A;  2AXU A;  4MFE A;  4OAZ A;  5A7L A;  3KYL A;  2Q2E A;  5GAH i;  3WTW C;  3GVA A;  2A68 F;  1IAW A;  4RM3 A;  2BW3 B;  1MNE A;  3PFI A;  3R61 A;  5JI6 A;  1UHS A;  2O9L A;  2KEI A;  4RB0 A;  2HQN A;  5DTR A;  3SYT A;  2VPR A;  1R36 A;  2A05 A;  2HVR A;  4L0Z B;  3CP2 A;  4YEJ A;  2CV1 A;  1OIS A;  2X9D A;  1JTY A;  3C3W A;  2HCS A;  4WVL A;  1QA6 A;  4XON A;  4DJA A;  3S3O A;  3K9T A;  4ASN A;  3WTU C;  2XI8 A;  2L9V A;  4ER5 A;  4A3M J;  2CQN A;  4NBQ A;  4AVZ A;  2Y9Z A;  1Y0N A;  2MAB A;  2DA1 A;  5EEG A;  1SEU A;  1I3Q J;  2IVM A;  1Y39 A;  4IHS A;  2YX4 A;  4HQE A;  3FM5 A;  4Y7N J;  4AIK A;  2DJN A;  1QO0 D;  2OU2 A;  2DT5 A;  3I3L A;  1LFB A;  1ZRC A;  1HBX G;  1Z9C A;  3K4C A;  1Y8R B;  3JXD L;  3I55 I;  3W6J B;  1E3P A;  2VBX A;  1LLI A;  1W7P A;  4XN0 A;  3GBG A;  3B7H A;  3COA C;  1X1P A;  3K2A A;  2DXI A;  3L2Q A;  3GO5 A;  2BEO A;  2FOW A;  4MTE A;  2LF7 A;  4EJT A;  3RJP A;  2GOX B;  2OPT A;  3S3N A;  2VKE A;  4CZC A;  4ENM A;  1WSU A;  1UST A;  3EUA A;  2EBY A;  1SD5 A;  2F4M B;  3F23 A;  2CRG A;  3C1D A;  2ACJ A;  2M8E A;  2DMU A;  3IH3 A;  3DPU A;  5L3E A;  3L2U A;  1YW8 A;  1H0M A;  4UUS B;  1BA5 A;  3CZ6 A;  2XRL A;  2J5P A;  4HW0 A;  2WUS R;  2YU3 A;  5HS7 A;  4QLC U;  3M3Y J;  3HOV J;  3FBI B;  4YIF A;  3LST A;  1KU2 A;  1DPR A;  4OU0 A;  3HBL A;  1QBJ A;  1P7I A;  3K0L A;  1T95 A;  2PI0 A;  1DP3 A;  1OSL A;  4G9Y A;  1X19 A;  1KON A;  1STZ A;  3IRR A;  1R69 A;  5FRM A;  1IF1 A;  1LMB 3;  2DU9 A;  3BRO A;  4E6K G;  1AOY A;  3OS2 A;  2ICW G;  1HA8 A;  2YU9 J;  4X4G A;  1MJ9 A;  3CCR I;  1XC5 A;  3D1N I;  1VI0 A;  1TNS A;  3HJE A;  4ZH4 F;  1ZAY A;  3K6G A;  3E5X A;  5FLX K;  2PXT A;  1GVJ A;  4BHC A;  2X6O A;  1K83 J;  1W5S A;  1X58 A;  3SDB A;  4KJZ A;  5D8L B;  3F8M A;  3N05 A;  4RLF A;  2Z3Y A;  3S3M A;  2O61 A;  3CCJ I;  2K40 A;  3EUH A;  3Q0W A;  4RA2 A;  1HF0 A;  4IKF A;  2IA1 A;  2HPI A;  2HQA A;  1R63 A;  3H9G A;  3HOW J;  3PE5 A;  4I76 A;  4RS8 A;  4KMF A;  2AQF A;  2PG4 A;  3DKW A;  4ANJ A;  2HEO A;  1FWZ A;  4ESF A;  2QUF A;  3BTC A;  1V5G A;  3ZP5 A;  2LKX A;  3HPH A;  1X2L A;  1SVO A;  2DOA A;  4XLA A;  3KFW X;  3X2Q H;  2D5V A;  1HW1 A;  3FXR A;  1WWX A;  3BG9 A;  1VTN C;  4AWX B;  3UNG C;  1FOY A;  5LHI A;  2HOS A;  4UY8 I;  3GCM A;  1JKR C;  2LYC A;  2A6C A;  1HC8 A;  3AG1 H;  1FMV A;  2L3D A;  5B5E C;  4A0Y A;  3BJ6 A;  1Z1D A;  3QPT A;  4PU7 A;  2NNN A;  3DNV B;  2QSH X;  1UTX A;  5IOZ A;  1IRX A;  2Q8K A;  2WY7 Q;  2VQG A;  6PAX A;  3KP4 A;  2QF7 A;  3TED A;  2STT A;  2IRF G;  4BQO A;  3HDD A;  2CFO A;  2KPM A;  3QOX A;  2WAQ N;  4U7D A;  3BR1 A;  1O3Q A;  3OKZ A;  3PL8 A;  3HOX J;  1F36 A;  2F5C A;  3ZMZ A;  2PE5 A;  3I9V 2;  3HSF A;  1HW5 A;  1IV8 A;  3GZD C;  2GRL A;  4BH9 A;  3F3X A;  4MO7 A;  2XSD C;  2COM A;  3HRS A;  2FEZ A;  1O57 A;  3KEQ A;  2UWM A;  2IS1 A;  2MA3 A;  5K5R A;  2AW6 A;  1YOV B;  2G9W A;  3D5S C;  3GXO A;  3BPX A;  4GCV A;  4MHG A;  2LYP A;  1ZTR A;  1RUN A;  5K1Y A;  3W3C A;  1FP1 D;  3CF2 A;  3EUK L;  2Z5U A;  1YRN A;  3RPU D;  1YYV A;  5FKO A;  4IHX A;  2R1J L;  2DK5 A;  1D3Y A;  1SVL A;  5EZH A;  1HW2 A;  1HDP A;  1TNT A;  2M5W A;  4I09 A;  4CCK A;  2HDC A;  3OIO A;  2E5Z A;  3JAM K;  1YW7 A;  5E8G A;  3OQN A;  3K1N A;  3WOD F;  5IT9 Z;  3M1E A;  2KRH A;  1TZL A;  1UXC A;  5CQE A;  2IEK A;  3CD6 I;  4AUX A;  5KNL A;  3F6O A;  2QEX I;  1TQI A;  4CCJ A;  3ABK H;  4P5O A;  5E1W A;  2DDA A;  1VQ4 I;  4ZDP A;  3L2V A;  1LDD A;  3K7A J;  4KIB A;  4PJM A;  3DLL F;  1TC3 C;  1ORK A;  3DV8 A;  3U1D A;  3N97 A;  1ZG5 A;  2LRD A;  1A6Q A;  4EJW A;  1B0N A;  3AG2 H;  4A6E A;  2QM3 A;  3ELK A;  2R7X A;  4U0V A;  5HLG A;  3BJA A;  1YHQ I;  1I1S A;  1D0Y A;  3L1P A;  2FA5 A;  2ID6 A;  1YO5 C;  1F43 A;  3O8G A;  4KA4 A;  3DEW A;  5ILU A;  3G71 I;  3CES A;  2EZK A;  2GLO A;  1G3Y A;  2Z99 A;  2PXL A;  2JSC A;  1MKM A;  3JRD A;  3HKZ N;  2R0Q C;  1OJL A;  1KU3 A;  4X6A J;  4ZYA A;  1UJ8 A;  5E8I A;  4Q4Z F;  3SZP A;  1RZR A;  1HCR A;  1WZ2 A;  2X6X A;  1QPZ A;  4Z6Y A;  2PBI A;  2CSF A;  3L2C A;  2ETH A;  2DTR A;  2IA2 A;  2ELK A;  2VKD A;  3QQA A;  4R1H A;  3LIS A;  2UXX A;  5E1Z B;  4I01 A;  5HLH A;  1R1T A;  4UVC A;  1ETK A;  1SAN A;  2KPJ A;  3FWE A;  4B1R A;  3BDN A;  1YJ9 I;  2A6T A;  1TL8 A;  2ISY A;  1O7L A;  1DP7 P;  5AON A;  4RAZ A;  3HHH A;  5DYM A;  3PNY A;  1PER L;  3RKQ A;  2FNA A;  2R92 J;  1IUY A;  3ZXS A;  2B5A A;  4RMN A;  2V9K A;  2KKO A;  4ER6 A;  1QHH D;  2QYO A;  5CPR B;  5J3L A;  3GLX A;  1OMI A;  1D0X A;  3I71 A;  1WJD A;  5GTH C;  3H9Q A;  2EWN A;  2XKO A;  2TCT A;  2BY0 A;  2ZSH B;  3I54 A;  1ZH5 A;  1OCC H;  1FOX A;  2HR3 A;  1QZE A;  2CW8 A;  2ECB A;  3J7Z I;  2CQ7 A;  5JVG F;  1ITY A;  5EJC A;  3RZZ A;  1UB9 A;  3S17 J;  3VFZ A;  1UHM A;  3BC8 A;  3AAF A;  4UUT A;  4BQQ A;  5IP6 A;  4E7Z A;  1ZGJ A;  1TWC J;  2YX7 A;  4GXO A;  1JHH A;  3TKY A;  1JUS A;  1RES A;  4BHP A;  1SD6 A;  4JCX A;  5DUI A;  3K4K A;  3LMM A;  5JVT A;  2BV6 A;  2I5U A;  1BM9 A;  1NW3 A;  1W1W E;  1EH8 A;  2CO5 A;  2QA4 I;  2EFP A;  2KFD A;  4EJO A;  3VOE A;  4PDK A;  2X85 A;  3AL0 C;  3BR0 A;  3NEU A;  3E3V A;  3IH4 A;  3Q0U A;  4O3M A;  3BR2 A;  3LOC A;  3QYF A;  3SCG A;  3H5R A;  3OYB A;  3SZG A;  3ESW B;  5JHF A;  3E6B A;  3WE3 A;  2K7L A;  2Y48 A;  4B43 A;  4E7I A;  1B59 A;  4UV8 A;  5GPC A;  5EGO B;  5D5W B;  2L9S A;  1BI3 A;  1WRJ A;  2DBB A;  3CDL A;  4B8X A;  1S8N A;  4DZJ A;  3S1M J;  5DD8 A;  3MZ8 A;  2LRE A;  2M8G X;  3HTS B;  2ZSI B;  1RZS A;  1BW5 A;  4A3D J;  1POG A;  2P5K A;  2LY9 A;  3T5X A;  2ODR D;  4AM3 A;  2BXY A;  1SFX A;  4QPO A;  4Y42 A;  2AHQ A;  4QSH A;  4P55 A;  4P96 A;  2EIK H;  2JRT A;  1BI1 A;  2QWW A;  3BR3 A;  3ML6 A;  4MNU A;  3CDH A;  1FT9 A;  3TDU C;  1O3S A;  3LSG A;  2E5N A;  1V55 H;  2JSP A;  3PUF A;  2QSG X;  2FXA A;  1R00 A;  4E4H A;  2ZJ2 A;  4II2 A;  3WTT C;  4I6T A;  2PUD A;  1Y9Q A;  2COB A;  1R4N B;  2XAH A;  2A69 F;  4Y13 A;  1SAX A;  1XCV A;  3H5T A;  4GYG A;  3MZH A;  5L3C A;  3BD1 A;  3WGI A;  4IVN A;  2PUB A;  2ELJ A;  2XGC A;  2L7Z A;  2L9R A;  2HYG D;  3ZQL A;  1NTC A;  2NVQ J;  1D5V A;  2P7V B;  3CCM I;  3R09 A;  2ZXH A;  3ABT A;  3HRM A;  3GUD A;  5J1R A;  3ZHM A;  3S1R J;  4XRM A;  4EM2 A;  1IXC A;  2K3P A;  1WH5 A;  4I99 C;  4BU2 A;  5JLX A;  4I02 A;  4RDU A;  4A3G J;  2BNO A;  1R9T J;  2PJR A;  3PUB A;  1FNN A;  1R58 A;  4UXN A;  4IA8 A;  2GRM A;  2L01 A;  5H20 A;  2GZW A;  1MH3 A;  2CUE A;  2O49 A;  2LYR A;  1VF9 A;  2L5Q A;  1VQ7 I;  2EF8 A;  3FXQ A;  1DGR M;  3OY9 A;  3JRG A;  3CCU I;  1F5T A;  2DOD A;  2ZBK A;  1U5T B;  4HRI A;  3I0T A;  3GTM J;  2M0M A;  2XGE A;  2J5O A;  3E0J B;  5F0F A;  2EH3 A;  3KIO A;  5K5Q A;  1XSD A;  4Z58 A;  2ZKZ A;  3LL7 A;  1WJA A;  1OFC X;  4F93 B;  4X1E A;  2LOO A;  2PEX A;  3L7W A;  4WX9 A;  2Y69 H;  4E7S A;  1LVK A;  1B72 A;  1X2M A;  4CXF A;  2XRN A;  1GV2 A;  2HQR A;  1BJA A;  2M4K A;  4XSZ F;  3DWL E;  4C3J J;  5BMZ A;  2W82 A;  4Y33 A;  5C3E J;  2DI3 A;  3RPQ A;  4XID A;  1I3A A;  1TW2 A;  2F4I A;  4IPA A;  4HYE A;  1P9Q C;  5F6F A;  1OPC A;  3OQM A;  1ZUG A;  2RQQ A;  2R63 A;  2PMZ N;  3UR3 C;  1GLN A;  3GFM A;  3F0C A;  3CUO A;  2E1O A;  2JA7 J;  3GUU A;  2Q2E B;  4RGX A;  2LTP A;  1S7O A;  2I10 A;  2DA4 A;  3K69 A;  4XSX F;  2G0E A;  5E18 F;  3BZ6 A;  1RR8 C;  4LLG F;  2VL8 A;  3GZ5 A;  4YG2 F;  4UB6 C;  4XLP F;  3CC2 I;  4FTH A;  1F4K A;  3TEP A;  4PSX A;  4RLQ A;  2JK3 A;  4EZI A;  2DFE A;  2E71 A;  4ZYH A;  1HST A;  3TRB A;  3F72 A;  3HYI A;  1GXP A;  3G7D A;  1P4X A;  2GA1 A;  3CCE I;  2E35 A;  3DU5 A;  1AWC A;  3HRT A;  5IYD J;  1D0Z A;  5FFZ A;  1U78 A;  4Y52 J;  4DW6 A;  5JR3 A;  1K7A A;  1VQ6 I;  4FN3 A;  3IVP A;  2E34 A;  2JPB A;  4I2O A;  1XSV A;  2XGD A;  2R3S A;  3K4L A;  2V6C A;  3WTS C;  4J19 A;  1ACI A;  2AXV A;  3NZL A;  3FMR A;  5E3O A;  1ZG3 A;  3H9J A;  1QHG A;  1JJ8 C;  3GF2 A;  2QLZ A;  1W7P B;  1R5H A;  2B0L A;  5E79 C;  5E3M A;  3J80 K;  3S15 J;  3TP3 A;  2E2H J;  2DT6 A;  4AD9 A;  2M7A A;  3C18 A;  2OR1 L;  3G4S I;  2LY1 A;  2JQ7 A;  2VOD A;  4LD5 A;  2LLV A;  1LEB A;  2D2W A;  3HG9 A;  2DQR A;  1B9M A;  2LC2 A;  1HKS A;  1B8I A;  4GRI A;  4MCT A;  1HQC A;  1JJ6 C;  3KXA A;  3BCA A;  2PJP A;  2KZ8 A;  2XIG A;  2X48 A;  1FIA A;  2YR2 A;  2DQL A;  3HZI B;  1IJW C;  1OR7 C;  3S2D J;  2K02 A;  1IDY A;  4Z5D A;  2O8K A;  1B6A A;  2X51 A;  3ZN0 A;  1BC8 C;  4MGR A;  1IDZ A;  1VQN I;  2X6Y A;  1LVA A;  3BTL A;  2FX0 A;  4XLC A;  3U2R A;  3SCH A;  2ZFU A;  3LFK A;  4OIQ F;  2DTZ A;  2UUZ A;  4KN7 X;  4C30 A;  4F91 B;  4AVP A;  2QZ8 A;  2DA2 A;  2EIL H;  5CVI A;  1G3T A;  1W0U A;  4AC0 A;  3OYH A;  1X3Z B;  1Y6I A;  2RV8 A;  4IHT A;  4JP0 A;  1K6O A;  2HTS A;  3M7G A;  2R93 J;  1TWH J;  5LEK A;  4KIG A;  5CVJ A;  3LAJ A;  2AXZ A;  4X4B A;  4E70 A;  5FD5 A;  2ICT A;  1Z77 A;  2XDV A;  4PFP A;  1WH7 A;  1QVT A;  3I53 A;  5H6Q A;  2LYL A;  2WV0 A;  1VQO I;  3H0D A;  3DBL B;  2OZ6 A;  4ER0 A;  2FU4 A;  3ME5 A;  4XOT A;  3C2G A;  2YUS A;  4PJ0 C;  3OV8 A;  1ZZC A;  3SHF A;  4LIV A;  4CCL A;  1IXS B;  1BW6 A;  2XXP A;  4Z5H A;  1MGT A;  4V19 K;  2WY8 Q;  3Q9S A;  1ZZB A;  2IPQ X;  2OJE D;  3M8F A;  3MMY B;  3B73 A;  3GFI A;  4Z59 A;  2ME0 A;  2KHM A;  4CYC A;  3OQO A;  4OOI A;  4XKW A;  1K78 A;  2KZG A;  1X4P A;  3S14 J;  2Z1D A;  2BHZ A;  3REO A;  4HX8 A;  2MW8 A;  4I6U A;  1MMA A;  3GWZ A;  5HDN A;  3HSE A;  4DYC A;  1BJZ A;  1QB2 A;  3UFD A;  1YE9 A;  2OCE A;  1W4M A;  4RAG A;  3IWF A;  2V7F A;  1UXD A;  3WGG A;  2AWI A;  4AIJ A;  1ETY A;  1Q1V A;  1TLH B;  5GPA A;  5LGN A;  1A04 A;  2H1L A;  4C2U A;  1QRY A;  1WCM J;  3M9L A;  5FRO A;  3HKZ A;  3A0B C;  3EUS A;  3JXB C;  4XLH A;  2KZV A;  2FQ3 A;  3OIP A;  1UAA A;  1MD0 A;  3OYA A;  1YI2 I;  1JGS A;  2DPU A;  2E1C A;  4HG2 A;  5CQG A;  2A07 F;  2IS2 A;  2DOF A;  2J7U A;  3GTP J;  4O5V A;  2DYS H;  1MIJ A;  1YJW I;  2PXK A;  2H94 A;  5CYV A;  3OWT A;  3MWM A;  4K2E A;  3W2A A;  4MQ9 F;  3GTJ J;  2LLK A;  2K86 A;  4UV9 A;  3QOW A;  3FKJ A;  5JHU A;  1LQ1 A;  1Z6T A;  1KGS A;  1ZZ8 A;  1XSX A;  2BE5 F;  3CJR B;  1T6S A;  5D5U B;  1DWK A;  2MD0 A;  3HPG A;  3J81 K;  4U7B A;  4I6R A;  5DV5 A;  1H9T A;  1YRN B;  4OBM A;  4DE9 A;  1T0F C;  2EFN A;  2HI3 A;  2B7E A;  3TMO A;  3P9I A;  1W7P D;  2DMP A;  1TTY A;  3S16 J;  1ZLJ A;  4LOC A;  4EEF G;  1AHD P;  4QPQ A;  3LFP A;  3F6W A;  4FAS D;  5DS9 A;  1B9N A;  1PRV A;  1IC8 A;  4A3F J;  1KZH A;  1KQ0 A;  4CA0 A;  2M34 A;  4CDG A;  3DPL C;  2ZNY A;  3F9K A;  1TP4 A;  2EA2 A;  2M2E A;  1V5F A;  4ABZ A;  3I64 A;  4C3H J;  5A2Q K;  1ETO A;  2F5D A;  2VON A;  1QPI A;  3B6C A;  3ISP A;  3OYJ A;  2VBW A;  2MFZ A;  3HSR A;  1QZX A;  2LYS A;  2RKH A;  2JT1 A;  4I0B A;  4B3X A;  5TJJ A;  3D5L A;  1A5J A;  2H6B A;  5CKT A;  2PXQ A;  5FLM J;  4EQZ A;  1I27 A;  3KYD B;  3RQI A;  1U8B A;  4EK9 A;  3LSM A;  4L9V A;  3GZD A;  2OUM A;  4IWR A;  2ELH A;  4GQM A;  1XDS A;  1ZQ3 P;  1YSE A;  2GBY A;  2V1D A;  2MC4 A;  4B47 A;  2VI6 A;  4CIC A;  1WIZ A;  3KYC B;  2Y2Z A;  5HLI A;  3E6M A;  5K7Z A;  1JKO C;  3CUQ C;  2XRO A;  1LB2 A;  3G1O A;  2QQB A;  2O7O A;  4HDU A;  1TWF J;  4A3J J;  1AKH A;  2L7K A;  1BIB A;  2A3S A;  2HWV A;  5GAE J;  4V2F A;  3OYC A;  2K9Q A;  3O6B B;  4LGW A;  4BY7 J;  1TQP A;  1O3T A;  3ZGK A;  2DMN A;  3JRC A;  3RI4 A;  3R0J A;  3R4K A;  3MEJ A;  1FLI A;  4KN4 X;  2CW7 A;  2V9P A;  3E5Q A;  4N4N B;  1E3O C;  3R60 A;  2IVQ A;  2V1X A;  1S72 I;  4A69 C;  2PUC A;  2IXS A;  1G4D A;  2FD5 A;  3C2H A;  2M45 A;  3KLO A;  2EZH A;  4CCO A;  3RYR A;  2VUM J;  3FF5 A;  1IGN A;  1JWL A;  2P7C B;  2OQR A;  4M73 A;  3P5J A;  2VIX A;  4U87 A;  4OB4 A;  3QOE A;  1PUE E;  1V4R A;  4R8H A;  1XGO A;  2HXI A;  3AG4 H;  4M74 A;  1O4X A;  2KQR A;  4PFO A;  3BS3 A;  2HYJ A;  4IVZ A;  1PVE A;  3KP6 A;  4BQA A;  2LCV A;  4A0X A;  5F08 A;  2HIN A;  3JRH A;  4CZZ A;  1QU3 A;  2V6E A;  3H35 A;  2UZK A;  1TT0 A;  3GFL A;  5F1J A;  4ZZD A;  4KUM A;  1XS9 A;  1ZN2 A;  2RQP A;  2XPV A;  5AIQ A;  4DYQ A;  4HV6 A;  5M3M J;  1PUF A;  5JLW A;  2G7U A;  2FBI A;  3ULQ B;  2L49 A;  4ZJZ A;  1QQI A;  2IGK A;  4M6Y A;  2GIZ A;  2VOO A;  2LH9 A;  3U9G A;  1NK2 P;  2Q0O A;  1QNT A;  3JCU C;  4KIT B;  2ID3 A;  2KRF A;  1LUJ B;  4II3 A;  3D0S A;  2STW A;  3ZKC A;  1IN6 A;  3HZJ A;  3K2Z A;  5D6F A;  1EKE A;  4HX7 A;  4HNV A;  3CJT B;  2M87 A;  2EPF A;  2BYV E;  3ZQQ A;  4BBR J;  4KIF A;  3OMT A;  2VBZ A;  3F21 A;  2DOE A;  3QRF F;  2PX9 A;  2OAZ A;  4BAY A;  1PP8 F;  2R7Q A;  2PIJ A;  5ICC A;  3C7J A;  5DD4 A;  1TT5 B;  2OF7 A;  2CUF A;  1GXQ A;  4GGG A;  2JA8 J;  4JBA A;  4LIU A;  5C4X J;  1S3J A;  1ETQ A;  5F27 A;  2MXD A;  1NH3 A;  1QZY A;  2LBF A;  1FYK A;  1NHA A;  3U3W A;  5F0C A;  1NG6 A;  3NXH A;  4OAY A;  3BG6 A;  3U21 A;  1G59 A;  3OOU A;  3FIS A;  4MQV A;  4XRS G;  2EB7 A;  4AYB N;  2HQ5 A;  1P6R A;  2VJI A;  2WAF A;  2NAZ A;  4A93 J;  1FBU A;  2R7R A;  1U3E M;  3MD2 A;  4BQN A;  4HDV A;  2FFH A;  4YG7 B;  3CMY A;  4XIC A;  4OMY A;  1D8K A;  2WB1 N;  3PQJ A;  2V1N A;  2Z9O A;  2L54 A;  3HTU A;  3ZQH A;  4DZP A;  2PMZ A;  3DCF A;  2LDU A;  3QU6 A;  2E7X A;  1XPX A;  1UFM A;  3CDI A;  2IU7 A;  3QQ6 A;  4KFC A;  3WE2 A;  2CJJ A;  3PSI A;  5TGT A;  1WI9 A;  4JOM A;  4BEH A;  3E97 A;  3K4M A;  3MEX A;  4LJZ F;  3QYX A;  4D5C A;  2W85 A;  3QP5 A;  4M9S A;  4N4O B;  4R79 A;  2K3F A;  3P7N A;  4ZDO A;  2MH9 A;  3TO6 A;  4ENK A;  1PJR A;  3VSK A;  2QBY B;  1FYL A;  2K27 A;  3T1B A;  3IAS 2;  3G0T A;  3CCV I;  1O7F A;  2NVX J;  2ZO4 A;  2PJR B;  1BIA A;  2DPD A;  2XAG A;  4HLX A;  2Z2S B;  3KCC A;  4ENN A;  4KDP A;  2ZXJ A;  3SEZ A;  2XB5 A;  1RNL A;  3VK0 A;  2E1M B;  2BGC A;  2H1K A;  1E17 A;  1FIP A;  4X4I A;  2LP0 A;  2L7F P;  3PQK A;  4DNC A;  4Q5S F;  4IOC F;  4RGU A;  1ETX A;  4HAM A;  4D0P A;  3NWS A;  3ZQG A;  4FX4 A;  3MCZ A;  2CQK A;  2VC0 A;  2WAE A;  2RAE A;  4IHY A;  1MMS A;  3PNT A;  3KEY A;  4F55 A;  1Z91 A;  1I6X A;  5D5V B;  2WBM A;  5FKK A;  4RB2 C;  3DKX A;  3BR6 A;  3HOU J;  5EF6 A;  1MBH A;  1YIJ I;  1RRJ A;  4N9H A;  2L2O A;  4BS9 A;  4RBO A;  1B72 B;  3S2H J;  1X4O A;  2HVS A;  3BPV A;  3OYN A;  3QWG A;  4WCG A;  2Y9Y A;  2QQ9 A;  4HEA 2;  3IHU A;  3DQV C;  1F1Z A;  3ECH A;  3TBI A;  4ENJ A;  4XQF A;  2F6C A;  3JRB A;  3L9F A;  2JVH A;  3QYE A;  3J81 Z;  2DFI A;  4MEY F;  2LNM A;  1REP C;  5E1X A;  2YBD A;  4XLF A;  3OR1 C;  1ZS4 A;  1OCR H;  2PFB A;  2ICP A;  4ZYD A;  1XGM A;  2WA0 A;  2CGP A;  1T56 A;  2O03 A;  4DGW B;  1JFS A;  4IO9 F;  1BDH A;  4HQM A;  2HGC A;  3E6C C;  1X1D A;  1R7J A;  3Q9V A;  2DA7 A;  4B48 A;  4U0Y A;  2Z33 A;  2IJL A;  3S8P A;  4HF2 A;  1PRU A;  2WAD A;  4HRA A;  4DE8 A;  1J75 A;  3KZI C;  3EUH C;  5CVU A;  1EF4 A;  3GFJ A;  3H3U A;  4M3G A;  3WG7 H;  2OCC H;  2VEO A;  1FSE A;  3PXP A;  3ZQC A;  5JFR A;  2P5V A;  4AID A;  4A3I J;  4Z2Y A;  1MSE C;  4ITV A;  2HTJ A;  3EYY A;  2KIQ A;  4WXH A;  1TW3 A;  1XB4 A;  1BR2 A;  3FKI J;  3VEP A;  5BPD A;  3OS0 A;  3WHC A;  3HOT A;  1LNW A;  2M4H A;  2ESN A;  1LPQ A;  2QKM B;  1FJL A;  1T8I A;  1CGP A;  4LFU A;  1BOA A;  4RB1 A;  3KJX A;  5LHH A;  1H88 C;  2DA3 A;  3V7S A;  1X3W B;  4ETS A;  1ENH A;  4Q47 A;  1SD4 A;  1W5T A;  1ZHF A;  3VYU B;  2R5Z A;  2KIS A;  4M9X A;  2B9S A;  2OZU A;  1T2K A;  3ONQ A;  1FX7 A;  3ZQF A;  2CFX A;  3G1M A;  5E3N A;  4X4H A;  4P9F A;  2EV6 A;  3P9K A;  5HDK A;  4CH7 A;  3F6V A;  3CME I;  2FNP A;  4E7J A;  4KNY A;  3M4O J;  2LYJ A;  1X1A A;  2O5R A;  3V8L A;  3OYG A;  5IPA A;  1SFU A;  3LNQ A;  4M6V A;  3SR4 A;  1ZR2 A;  1ZKG A;  1B8I B;  3MN2 A;  2FBK A;  1Y7Y A;  2FBH A;  2JA6 J;  1ERD A;  3VB2 A;  1U2Z A;  4MCX A;  1WET A;  3OR2 C;  1HQ1 A;  2M0C A;  4ON0 A;  1OCP A;  1ZYR F;  4CGZ A;  1ZZ6 A;  1BR1 A;  4XNF A;  3FZV A;  2QGU A;  2IGO A;  4JYK A;  2NRA C;  1RC9 A;  1TBX A;  2GM4 A;  2PUA A;  2X1E A;  5KCM A;  1YIT I;  2EFQ A;  4S05 A;  3QU3 A;  4NDL A;  2P5L C;  4B09 A;  1K4S A;  1JKP C;  2R7U A;  2PXD A;  3FX3 A;  3HUG A;  4XOP A;  4YFX F;  2BJC A;  1N78 A;  2XPU A;  3DTE A;  2DDB A;  4G8X A;  2ZXI A;  4ZYE A;  3T8T A;  1D8J A;  1YW9 A;  2RDP A;  1QQB A;  1P4A A;  4G7O F;  2EWT A;  1XN7 A;  2EZI A;  4PK4 A;  5FLX Z;  3OYM A;  4HLY A;  3FIW A;  3ZQ7 A;  2XXQ A;  2EZL A;  3JRA A;  2EQR A;  1LE8 B;  3CCS I;  4MTD A;  1DGW Y;  1JHF A;  4Y4R A;  3QPL A;  3GW2 A;  5J6X A;  1O3R A;  1VQL I;  2R7Z J;  2ZJP F;  2O6G E;  2XAJ A;  3TL4 X;  3AKZ A;  3SX0 A;  2DMQ A;  2O38 A;  1XX5 A;  2WIU B;  1KYW A;  1FC3 A;  2BVL A;  3ZR8 X;  5F0H A;  2MBF A;  4RAY A;  1S29 A;  2CWE A;  3S2W A;  3RKX A;  2BY1 A;  1V5E A;  5EEH A;  4GYI A;  3TGN A;  2RNJ A;  1APL C;  3F8B A;  3O2P E;  3BOQ A;  3RDI A;  1OYW A;  3JSO A;  3FXU A;  1C0W A;  3RTR A;  4CYC B;  1PRA A;  4WXD A;  5IYB J;  1K78 B;  3FXL A;  1B4A A;  4I8T A;  2LF8 A;  1RI7 A;  3MZY A;  3HOY J;  2H8R A;  1VQ8 I;  1XMK A;  1MND A;  2WTE A;  4PSW A;  5DEQ A;  3FMY A;  2A6H F;  3CQZ J;  4NB5 A;  5TIS C;  2QBY A;  3IWZ A;  3PNV A;  4IRH A;  3HXL A;  1A31 A;  3SQN A;  3GX4 X;  3KLN A;  2PLY A;  1BI0 A;  2CUZ A;  3S93 A;  1SMT A;  4JCY A;  3IH2 A;  1EA3 A;  4EJV A;  1ULY A;  5HS9 A;  1J5Y A;  2XC7 A;  3TFL A;  1AU7 A;  1WI3 A;  1GDT A;  3IRQ A;  1BL0 A;  3ERM A;  4XKC A;  4EJU A;  1V3F A;  4GFB A;  4GO1 A;  3BQZ A;  1DDN A;  1HOM A;  2PXE A;  1T08 B;  3RYP A;  1VQK I;  3A9X A;  3BDD A;  4OIR F;  2PXV A;  1JT0 A;  2RVC A;  3E6D A;  3F8N A;  2BNM A;  4RB3 C;  4MLO A;  4ZTJ A;  2V26 A;  1S9H A;  3TP0 A;  4N0B A;  2XAQ A;  3K70 D;  3ZHI A;  2ADU A;  1KYZ A;  3WTX C;  3CLC A;  2OC6 A;  4X4C A;  3IV5 A;  3W2W A;  2XUB A;  1IO2 A;  1R1U A;  1YQA A;  1MDM A;  5BOX A;  3QAH A;  1JH9 A;  1ZZ7 A;  4G6Q A;  1N75 A;  1DQU A;  5EYR A;  1X57 A;  4DOZ A;  4DYR A;  3G2B A;  3K1M A;  4BHB A;  4DQ2 A;  5DSX A;  2ZJQ F;  2A5Y B;  2LD5 A;  3Q5F A;  4G6D A;  4J00 A;  4HSR A;  2DA6 A;  4IRI A;  1BN5 A;  4KMU X;  2EJR A;  4HX4 A;  4B3A A;  2FRH A;  2OTL I;  3JAM Z;  1RZ4 A;  2P8T A;  2K9N A;  3VSL A;  5GP9 A;  1QZZ A;  1T33 A;  2VJJ A;  3B6A A;  3TO9 A;  1S5L C;  2GOM A;  2RC4 A;  5IOY A;  5BNG A;  5J4V A;  1NEQ A;  3CC4 I;  4UUV A;  1PNR A;  3TQN A;  2W25 A;  3OL3 A;  3FYM A;  1FMW A;  2E2I J;  2RN7 A;  2KEJ A;  2ZME A;  3GYH X;  3CO7 C;  2JA2 A;  3TW6 A;  5GAD J;  5J8C A;  5LHG A;  2JTV A;  1R1V A;  5BPI A;  3OIQ A;  3F8C A;  2KDZ A;  4AIH A;  4E7L A;  4NQW A;  2HDW A;  2L0K A;  2V4J C;  4A3C J;  3I59 A;  5F64 A;  4EAT A;  2K4B A;  3FK6 A;  4RGR A;  5FJ8 J;  1G3S A;  3DTI A;  2V9V A;  1YFH A;  3EYI A;  1UMQ A;  3KP2 A;  4OMZ A;  4NNJ A;  5CJ9 A;  5KAF C;  1WJF A;  1IXR C;  2DAO A;  5K98 B;  4HNU A;  4YBA A;  5M5X J;  1SQ8 A;  1AKH B;  3DFG A;  4YAR A;  5L3B A;  3HEF A;  1WKM A;  3EDP A;  2M3A A;  3A4C A;  1Z7L A;  1T0F A;  2EV5 A;  4C3I J;  4L9T A;  2QQA A;  3PIO F;  2XVC A;  2B63 J;  4GDF A;  4D7N A;  5JUW A;  3TOA A;  1YS7 A;  3S1Q J;  2F5F A;  2OD5 A;  1JGG A;  2NOJ B;  2BNN A;  4E7K A;  2XB0 X;  5HS8 A;  1OQY A;  4AYB A;  4P9U A;  2AXL A;  4H0E A;  3MQ0 A;  4HBL A;  1G2H A;  2WAQ A;  1L1M A;  2D1V A;  1TWG J;  2Y75 A;  3H92 A;  5J40 A;  4GHJ A;  4RGS A;  1R4M B;  3LWF A;  2LFB A;  4FT8 A;  1IN4 A;  5CVR A;  3WTZ A;  2P0W A;  4F3Q A;  1P7J A;  4FQG A;  1U9O A;  1ADR A;  3BCB A;  4LMY A;  2M30 A;  1FTZ A;  3S8Q A;  1WH6 A;  3AFH A;  3RCO A;  5AIP A;  3FDY A;  5EEA A;  3FMQ A;  3I5U A;  3SEQ A;  1PUF B;  3QF3 A;  4U88 A;  2PUE A;  1MSF C;  5DTM A;  3DEU A;  3M8E A;  2CQQ A;  5GAH J;  2E7W A;  2JVG A;  1LE8 A;  4O8B A;  1MBG A;  4YG1 A;  4ESJ A;  1I6H J;  2W4S A;  1QP7 A;  4HZF A;  2HCN A;  2VB6 A;  5DTD A;  2CU7 A;  3GZN B;  2DFF A;  5TRD A;  2C6Y A;  2FQ4 A;  4G12 A;  1PDN C;  1FTT A;  2E1M C;  3HOZ J;  4HF0 A;  3JRE A;  3OSG A;  3W6V A;  3IP4 B;  1Z67 A;  3AG3 H;  5J47 A;  2JA5 J;  1OYI A;  4WK8 F;  4G7H F;  2M9H A;  1RKT A;  2XKP A;  1W5C C;  3ZPX A;  4NHJ A;  2GAU A;  3F8F A;  1KA8 A;  1PYV A;  1DU0 A;  3A9Z A;  2P81 A;  3A02 A;  3OOP A;  4H4K C;  3CCL I;  3OP9 A;  1USS A;  5HOD A;  2VPL A;  1IN8 A;  2JPC A;  3GTL J;  3DLA A;  2LBF B;  1FY7 A;  1Y56 A;  4EMS A;  4JX5 A;  1X3U A;  3MVP A;  3J7Y J;  1JTX A;  3QWL A;  2Q1Z B;  5GAG i;  2MH2 A;  3W6K B;  3H3V K;  2IVB A;  3IC7 A;  2MLK A;  3LQX A;  2NVT J;  4PGG A;  2IGN A;  2ZFW A;  2PPX A;  2HKX A;  3CMM A;  2ZB9 A;  2E1N A;  4M3F A;  1E2X A;  5D5X B;  1X1C A;  1Q1H A;  2L4A A;  5ICF A;  1R22 A;  5FKN A;  3RSN A;  1YJN I;  5DRY A;  1ODD A;  2WC2 A;  4W97 A;  4HOB A;  2EFW A;  3HHG A;  3KL4 A;  3JR9 A;  1D5Y A;  4LIT A;  5FRN A;  3G5G A;  1K6Y A;  4Q2J A;  3RIR A;  2KT0 A;  3G73 A;  2BBY A;  2EBI A;  3T8R A;  5IT9 K;  3VYS B;  4JQD A;  1DW9 A;  1BBY A;  3FMS A;  1WFX A;  3KET A;  1P2F A;  3TEL A;  3DM5 A;  3HL2 A;  4EQQ A;  1NG7 A;  4BEH B;  4KT5 C;  1R5G A;  2GWR A;  5E3L A;  1H9G A;  3KP5 A;  2F2E A;  3FHN A;  2RNG A;  2G7H A;  4L5J A;  2KIM A;  5DM7 F;  2RRE A;  3TOB A;  3K4B A;  3RKW A;  3K10 A;  1HKQ A;  3K70 C;  2WWY A;  5EDN A;  2HXO A;  3OYD A;  1R71 A;  2HPM A;  1IRG A;  1FBQ A;  4IJA A;  3CF5 F;  4BKX A;  3LA2 A;  4EKG A;  2Y30 A;  3J7A Y;  3LA7 A;  3ZN1 A;  3HOS A;  2XSJ C;  4LG3 A;  4QTR A;  3G6E I;  3G1L A;  2XXA A;  4CCN A;  3ZPL A;  2HKO A;  4HV5 A;  5KK1 A;  1ZGW A;  4BE0 A;  5L3F A;  5F1R A;  1U6G A;  4EGZ A;  4EM0 B;  1R23 A;  4MIM A;  3IL2 A;  4BGD A;  3QYB A;  1UCR A;  3LSH A;  1MMG A;  3D5R C;  3CLQ A;  5EG0 A;  5FLV A;  1FOK A;  3BG5 A;  2PXF A;  4D1Q A;  4IHV A;  4YIR X;  2GZU A;  2P6T A;  2IUO A;  3VPR A;  5D4R A;  2FOK A;  2L4M A;  2V79 A;  3GLL A;  3CJQ B;  1XD7 A;  4FHT A;  4NC7 A;  1S6L A;  1IW7 F;  4KIS A;  1YG2 A;  3LAP A;  2VXD A;  2NYX A;  4FE7 A;  2AUW A;  5IYC J;  1YX5 A;  2H6C A;  3BY6 A;  4PUS A;  3LFU A;  4IQ4 A;  2LYQ A;  5LRR A;  5DCM A;  5KHD A;  3PJR A;  5D4S A;  1Z6R A;  3H36 A;  2E2J J;  3M9A A;  3Q0V A;  4M3D A;  4O6J A;  1MH4 A;  3HC7 A;  2MSY A;  3B02 A;  4BDY A;  1SAU A;  2GIV A;  3V4G A;  2R4G A;  4QIW N;  1ON1 A;  1E3H A;  3QPH A;  5DM6 F;  2A61 A;  1WJE A;  1LCC A;  1ZEL A;  2CUJ A;  3CEC A;  4OIO F;  4HF1 A;  1VQP I;  1KQ9 A;  4RAF A;  2DCE A;  3BG7 A;  3IKV A;  3O3K A;  5FGM A;  3OMY A;  1IV6 A;  3F22 A;  4IXA A;  4BYY A;  3GTO J;  2JZY A;  5DRT A;  1I1G A;  2L9N A; 
#chains in the Genus database with same CATH homology
 3PO2 J;  1LQC A;  5JLX A;  2NOG A;  4RDU A;  4A3G J;  2BNO A;  2HSG A;  1R9T J;  4Z5C A;  3JRB A;  3SCF A;  2ME6 A;  4IA8 A;  2GRM A;  4NDW A;  1MH3 A;  2CUE A;  2O49 A;  2LK2 A;  2LYR A;  1VF9 A;  1GUU A;  1WPK A;  2R5Y A;  2EF8 A;  1ZS4 A;  2R5Z B;  2ICP A;  5K7H A;  1RPE L;  3JRG A;  1JFS A;  1BDH A;  1T56 A;  3CRO L;  3GTM J;  2XGE A;  3GN5 B;  5F0F A;  1GV5 A;  2EH3 A;  3O9X A;  1K61 A;  2DA7 A;  4Z58 A;  1U9N A;  1PRU A;  1JUP A;  4BXX J;  2LVS A;  5F04 A;  5C4J J;  4A3B J;  1Z0X A;  1EF4 A;  1OFC X;  3SJM A;  4X1E A;  4J1X A;  2JMW A;  4FCY A;  2DA5 A;  4M3G A;  1B72 A;  3E7L A;  1X2M A;  3PXP A;  3ZQC A;  1GV2 A;  4A3I J;  3HM5 A;  1MSE C;  1SFO J;  2LYK A;  4C3J J;  4PU4 C;  1GVD A;  3FKI J;  5C3E J;  3WHC A;  4XID A;  2IBD A;  2XCJ A;  1FJL A;  2PUG A;  3KJX A;  2JN6 A;  1Y1V J;  1ZUG A;  1H88 C;  2PMZ N;  2DA3 A;  3A01 B;  2R63 A;  3OQM A;  3F0C A;  1ENH A;  2JA7 J;  2E1O A;  4IHW A;  3ZQI A;  2R5Z A;  3Q3S A;  1RET A;  2LTP A;  1H8A C;  9ANT A;  2CQX A;  4A3E J;  1Y1W J;  2I10 A;  2DA4 A;  3C2B A;  2G0E A;  3GTG J;  1NER A;  3GN5 A;  2KEK A;  1QP0 A;  1GT0 C;  1ETV A;  3ZQF A;  5M5Y J;  3G1M A;  5E3N A;  4IEJ A;  4A3L J;  3SFI A;  4X4H A;  1NK3 P;  4BBS J;  2K9S A;  2JJ7 A;  4FTH A;  2LYJ A;  2IAI A;  3M4O J;  2JK3 A;  3FYA A;  4S0H B;  2NVY J;  5IPA A;  3BQY A;  3LNQ A;  4M6V A;  1ZR2 A;  1ZKG A;  4MFD A;  1B8I B;  1XG1 A;  3MN2 A;  3TRB A;  1Y7Y A;  2JA6 J;  4MCX A;  1WET A;  3G7D A;  4M3B A;  2CRO A;  2M0C A;  2JWT A;  1OCP A;  2MQK A;  1ZZ6 A;  5IYD J;  2NS7 A;  4Y52 J;  4JYK A;  1U78 A;  4DW6 A;  2O4A A;  1CQT A;  2GM4 A;  2PUA A;  4FN3 A;  3IVP A;  3HB9 A;  3MLF A;  1ZR4 A;  1JKP C;  1IRZ A;  4NDL A;  2XGD A;  2Y0S N;  4J19 A;  3A01 A;  4MFE A;  4D5F A;  3S1N J;  2AXU A;  1MBE A;  2AXV A;  5A7L A;  5E3O A;  3JRF A;  2BJC A;  1RZR D;  2XPU A;  1JJ8 C;  5E3M A;  1UHS A;  3S15 J;  3TP3 A;  2E2H J;  2O9L A;  3I4N J;  2KEI A;  1QQB A;  2EWT A;  2OR1 L;  2VPR A;  2EZI A;  1QQA A;  3FIW A;  2X9D A;  2EZL A;  1JTY A;  3JRA A;  2EQR A;  1LE8 B;  1X2N A;  3HZI B;  3QPL A;  1B8I A;  4X4E A;  2XI8 A;  4MCT A;  1JJ6 C;  2R7Z J;  4A3M J;  3KXA A;  1IG7 A;  2KZ8 A;  2X48 A;  2DMQ A;  1FIA A;  2E19 A;  2Y9Z A;  2O38 A;  2DA1 A;  1IJW C;  5F0H A;  2WIU B;  3S2D J;  1I3Q J;  1IDY A;  1QVU A;  2O8K A;  4Z5D A;  4PU3 C;  1IDZ A;  4Y7N J;  2DJN A;  1APL C;  3BTL A;  3SCH A;  2FX0 A;  1LFU P;  3HGG A;  1LFB A;  4CYC B;  2HOT A;  1PRA A;  2DTZ A;  3GTQ J;  5IYB J;  1WGX A;  3JXD L;  4I8T A;  2DA2 A;  3HOY J;  2H8R A;  1W0U A;  4AC0 A;  1LLI A;  3FMY A;  3CQZ J;  3GBG A;  3B7H A;  4JP0 A;  3K2A A;  2R93 J;  1TWH J;  4X4B A;  2OPT A;  2AXZ A;  1VFC A;  2VKE A;  3BTI A;  2EBY A;  2ICT A;  1Z77 A;  2CRG A;  2DMU A;  3IH3 A;  4JCY A;  3IH2 A;  1BA5 A;  4UUS B;  1WH7 A;  1QVT A;  2XRL A;  2LYL A;  2WUS R;  4M3E A;  2VKV A;  4W1U A;  1AU7 A;  1WI3 A;  1GDT A;  3M3Y J;  3GBF A;  1BL0 A;  4I6Z A;  3NAU A;  3HOV J;  1UG2 A;  4GFB A;  2YUS A;  5FKL A;  3HBL A;  3BQZ A;  1ZZC A;  1P7I A;  1HOM A;  1BW6 A;  1ETW A;  1OSL A;  3RZD J;  4Z5H A;  1MBJ A;  1R69 A;  4B4C A;  2HDD A;  1ZZB A;  1TWA J;  4PU8 A;  1LMB 3;  2LR8 A;  3FK7 A;  1WH8 A;  2ME0 A;  4Z59 A;  4CYC A;  3OQO A;  1JT0 A;  2YU9 J;  4X4G A;  1XC5 A;  3D1N I;  3S14 J;  4MLO A;  2BNM A;  1VI0 A;  3TP0 A;  2MW8 A;  4I6U A;  1ZAY A;  3ZHI A;  4XK4 A;  4DYC A;  1BJZ A;  2L7M P;  4X4C A;  3CLC A;  3UFD A;  3IV5 A;  3PO3 J;  1ZVV A;  3BTJ A;  4JX6 A;  4J1W A;  1JH9 A;  2X6O A;  1ZZ7 A;  1K83 J;  1X58 A;  1XWR A;  1UXD A;  2AWI A;  5EYR A;  1ETY A;  1Q1V A;  5GPA A;  1MBK A;  4DYR A;  1X57 A;  2N8G A;  1QRY A;  1WCM J;  4UUS A;  4X4D A;  2K40 A;  1POU A;  3Q0W A;  1HF0 A;  2LD5 A;  3EUS A;  2XIU A;  3JXB C;  1HLV A;  2DA6 A;  1R63 A;  3HOW J;  4I76 A;  2NS8 A;  4B3A A;  1W0T A;  1MNM C;  3BTC A;  2K9N A;  2LKX A;  5GP9 A;  1X2L A;  1T33 A;  3B6A A;  5IOY A;  1NEQ A;  3F51 A;  5BNG A;  2D5V A;  3GTP J;  1PNR A;  3BG9 A;  4FIS A;  3FYM A;  2E2I J;  2HOS A;  2KEJ A;  3GTJ J;  2LLK A;  4X4F A;  2MGQ A;  3TW6 A;  1JKR C;  2A6C A;  1ZZ8 A;  1DWK A;  4PU7 A;  2KDZ A;  4I6R A;  1YRN B;  3DNV B;  2YS9 A;  2HI3 A;  1UTX A;  1RKW A;  5IOZ A;  4XRS A;  2L0K A;  4A3C J;  2DMP A;  3S16 J;  3FK6 A;  2MG4 A;  2QF7 A;  4LOC A;  5FJ8 J;  4EEF G;  3TED A;  3HDD A;  1UMQ A;  1AHD P;  3LFP A;  5C44 J;  3F6W A;  5DS9 A;  2WAQ N;  1PRV A;  1IC8 A;  3BR1 A;  5K98 B;  4A3F J;  3HOX J;  4YBA A;  1F36 A;  2M34 A;  2PE5 A;  5M5X J;  1SQ8 A;  1AKH B;  2ECC A;  3MKL A;  4YAR A;  2GRL A;  3HEF A;  2M2E A;  4ABZ A;  4C3H J;  4MO7 A;  2XSD C;  1ETO A;  3A03 A;  4C3I J;  1QPI A;  3B6C A;  2AW6 A;  2LYS A;  5EZG A;  2B63 J;  1A6I A;  1A5J A;  4D7N A;  1ZTR A;  2LYP A;  1EFA A;  3S1Q J;  5FLM J;  1JGG A;  5J1Y A;  3RQI A;  4D7M A;  1JKQ C;  3I4M J;  1U8B A;  2XB0 X;  2BNN A;  4F8D A;  2DN0 A;  1VPW A;  4IWR A;  4GQM A;  2FJ1 A;  1ZQ3 P;  1YSE A;  1YRN A;  2GBY A;  5FKO A;  1G2H A;  1L1M A;  2VI6 A;  4IHX A;  1TWG J;  2R1J L;  4GHJ A;  1WIZ A;  5EZH A;  2AO9 A;  2LFB A;  2Y2Z A;  4V2G A;  1P7J A;  1HDP A;  5K7Z A;  1U9O A;  3OIO A;  1ADR A;  3RZO J;  1JKO C;  1FTZ A;  3S8Q A;  2Y31 A;  3G1O A;  3OQN A;  2O7O A;  1WH6 A;  1TWF J;  4A3J J;  1AKH A;  5EEA A;  4BY1 J;  1UXC A;  2IEK A;  4AUX A;  4V2F A;  1PUF B;  1JUM A;  2K9Q A;  3QF3 A;  4BY7 J;  4C2M J;  2PUE A;  2DMN A;  3K7A J;  3JRC A;  1MSF C;  1TC3 C;  1ORK A;  2CQQ A;  1LE8 A;  4O8B A;  1MBG A;  1E3O C;  4YG1 A;  4L5E A;  3BT9 A;  1I6H J;  2IVQ A;  1B0N A;  4A69 C;  1QP7 A;  2PUC A;  2FD5 A;  5IP9 J;  5DTD A;  2CU7 A;  2EZH A;  3L1P A;  2VUM J;  2FQ4 A;  2ID6 A;  1IGN A;  4G12 A;  1F43 A;  3O8G A;  5M3F J;  1JWL A;  1FTT A;  3DEW A;  3R1F A;  3HOZ J;  3JRE A;  2EZK A;  3H0G J;  3OSG A;  2GLO A;  4A3K J;  3W6V A;  4OB4 A;  3GTK J;  2JA5 J;  2HXI A;  3JRD A;  1O4X A;  3HKZ N;  2R0Q C;  1S7E A;  1OJL A;  2HYJ A;  1RKT A;  2M9H A;  4X6A J;  3KZ3 A;  4IVZ A;  2LCV A;  5F08 A;  2HIN A;  1RZR A;  1HCR A;  3JRH A;  1DU0 A;  3F52 A;  1QPZ A;  2P81 A;  3A02 A;  5F1J A;  2CSF A;  5M5W J;  3OP9 A;  5HOD A;  1XS9 A;  2ELK A;  2XPV A;  4DYQ A;  3QQA A;  3GTL J;  2IV1 A;  5M3M J;  1PUF A;  5JLW A;  2XJ3 A;  4JX5 A;  3LIS A;  2HOA A;  3MVP A;  2L49 A;  3UKG A;  1ETK A;  1JTX A;  1SAN A;  2KPJ A;  4B1R A;  3H3V K;  3BDN A;  2IVB A;  1ZPQ A;  1NK2 P;  2NVT J;  2PPX A;  2ZB9 A;  3NAR A;  2ID3 A;  4FBI A;  3ZKC A;  4M3F A;  1PER L;  1OCT C;  3HGY A;  3RKQ A;  2R92 J;  2B5A A;  2QCO A;  5FKN A;  5J3L A;  4HNV A;  4W97 A;  1DU6 A;  4BBR J;  1JFT A;  3OMT A;  3O8H A;  1CJG A;  3JR9 A;  1D5Y A;  2TCT A;  5K7F A;  1LCD A;  3G5G A;  2PUF A;  2KT0 A;  2EBI A;  4JQD A;  2PIJ A;  1DW9 A;  2ECB A;  1ITY A;  1FEX A;  2OF7 A;  2CUF A;  2MEZ A;  2JA8 J;  3RZZ A;  3OSF A;  3S17 J;  5C4X J;  5EG0 B;  4UUT A;  5IP6 A;  3WHB A;  1ETQ A;  5F27 A;  4FE4 A;  5E3L A;  3U3W A;  1TWC J;  5F0C A;  1JUS A;  1RES A;  2WV1 A;  1VND A;  3FIS A;  3OOU A;  4XRS G;  4JCX A;  4AYB N;  2OFY A;  2HQ5 A;  5EDN A;  2HXO A;  1IUF A;  4A93 J;  3ZOB A;  5IP7 J;  1RPW A;  4BKX A;  4YG7 B;  2Y30 A;  3BR0 A;  1QP4 A;  3CMY A;  3QPS A;  4JX4 A;  4XIC A;  2WB1 N;  4QTR A;  1MBF A;  3G1L A;  4YG4 A;  3IH4 A;  1ZK8 A;  3Q0U A;  3ZQH A;  4DZP A;  3BS3 A;  1ZGW A;  3BR2 A;  3LOC A;  3SCG A;  3DCF A;  2TRT A;  4MIM A;  2JCG A;  3JXC L;  2IU7 A;  2XPW A;  3QQ6 A;  2CJJ A;  5FLV A;  5EG0 A;  3BG5 A;  1JT6 A;  1HDD C;  4IHV A;  2GZU A;  3LSP A;  3QYX A;  5GPC A;  3BG3 A;  5EGO B;  2IUO A;  4D5C A;  3VPR A;  3CCY A;  3CDL A;  4DZJ A;  3S1M J;  3BR5 A;  5FKM A;  2FJR A;  2AUW A;  4FE7 A;  2M8G X;  3LSJ A;  2NVX J;  5IYC J;  3JRI A;  1RZS A;  1BW5 A;  2DMT A;  4A3D J;  1POG A;  1I50 J;  2LY9 A;  2LYQ A;  1RIO A;  1ZZ9 A;  2XB5 A;  2E2J J;  2W48 A;  3TW7 A;  2R5Y B;  2AHQ A;  3Q0V A;  4QSH A;  4Y42 A;  4M3D A;  3VK0 A;  1MH4 A;  2H1K A;  2MSY A;  1FIP A;  3BR3 A;  2JVL A;  5J1U A;  2LP0 A;  2L7F P;  4X4I A;  3LSG A;  4QIW N;  3SDG A;  2L8N A;  1ETX A;  4I6T A;  1Y9Q A;  2PUD A;  2COB A;  3ZQG A;  3PM1 A;  3H5T A;  1LCC A;  2RAE A;  4IHY A;  3BD1 A;  3CEC A;  1H89 C;  1RR7 A;  2PUB A;  2XGC A;  5FKK A;  3BR6 A;  2L7Z A;  2L9R A;  3HOU J;  5EF6 A;  1MBH A;  5EGO A;  1NTC A;  3ZQL A;  1IV6 A;  2NVQ J;  3LSR A;  2IVG A;  4RBO A;  1B72 B;  3S2H J;  3ZHM A;  3GTO J;  5J1R A;  3S1R J;  4XRM A;  3QWG A;  2Y9Y A;  1BDI A;  1WH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...