1O4XA

Ternary complex of the dna binding domains of the oct1 and sox2 transcription factors with a 19mer oligonucleotide from the hoxb1 regulatory element
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
129
Chain Sequence
EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMAKLKPLLEKWLNDAESIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for synergistic transcriptional activation by Oct1 and Sox2 revealed from the solution structure of the 42-kDa Oct1.Sox2.Hoxb1-DNA ternary transcription factor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*GP*TP*CP*TP*TP*TP*GP*TP*CP*AP*TP*GP*CP*TP*AP*AP*TP*
total genus 41
structure length 129
sequence length 159
ec nomenclature
pdb deposition date 2003-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
A PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1o4xA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1o4xA01
3BTCA 1H88C 3OQMA 1WI3A 3OIOA 1ZKGA 5FKOA 3JRCA 1U9NA 4J1XA 1L1MA 1Y1VJ 1XG1A 4JYKA 1ETQA 3IV5A 2XCJA 2HXIA 2XPVA 4JX5A 2OPTA 4C2MJ 2AWIA 1DU0A 2DA6A 4W1UA 2BJCA 1VPWA 1HDDC 1ZR4A 3LSJA 5GP9A 4ABZA 4DYQA 2A6CA 2OR1L 3JRAA 2COBA 2CQXA 3MVPA 5E3OA 4DYRA 3FIWA 3RQIA 2AO9A 4A3IJ 2E2JJ 1XC5A 5FLVA 1RZRA 4D5FA 2YU9J 1RPWA 2DA2A 4MFEA 1CQTA 2LCVA 1TWGJ 4Z59A 2ME6A 2HI3A 2TCTA 2XGCA 2CRGA 2LD5A 2O7OA 2Y30A 1IG7A 1X2MA 2MG4A 4A3LJ 1LCDA 1QP0A 3ZQFA 3M4OJ 1K61A 2OF7A 2HSGA 2FJRA 1ZZ7A 4F8DA 2E2IJ 2GBYA 1X2NA 4FBIA 5J1UA 5JLWA 1ORKA 3C2BA 3JRGA 4JX4A 1OSLA 1Y1WJ 3GTMJ 4RDUA 1QP4A 2E19A 5IP7J 3HM5A 4X4GA 2DMPA 4X4HA 3FKIJ 3JRDA 1O4XA 1T56A 2LTPA 4A3JJ 2E1OA 4BXXJ 1RKTA 5M3FJ 3GTGJ 2DA7A 2HOSA 3S16J 2XGEA 2GRLA 3BD1A 3LISA 3VK0A 1ETYA 3NAUA 2O9LA 1B0NA 1RZRD 1LE8B 1X57A 5M3MJ 3BS3A 1U8BA 1YSEA 1WIZA 1JJ6C 5JLXA 2GM4A 3DCFA 1JKPC 2ICTA 4M6VA 2NVQJ 1HDPA 2H8RA 4I76A 3Q0UA 5K7HA 4I6UA 2KEJA 1TWCJ 2HYJA 2DA3A 3CROL 4M3BA 5EGOA 3OSFA 3G5GA 3GTJJ 2NVYJ 2L7MP 4IHVA 2H1KA 2Y9ZA 3I4MJ 3FISA 3K7AJ 5FKLA 2R5YA 1GVDA 1U78A 1ZQ3P 4AC0A 1MH4A 3CMYA 3UKGA 4YG4A 4IEJA 1MNMC 1VF9A 3WHBA 3M3YJ 2DA5A 2XB0X 3FMYA 3H0GJ 1SANA 2K9QA 3ZQIA 5IPAA 3BTLA 3OSGA 2L49A 5K7FA 2X9DA 2XJ3A 3PO2J 4Z5DA 1JJ8C 3BG9A 3BR2A 3LOCA 2KEKA 1GV2A 5F0HA 3ZKCA 4XRSG 1HLVA 2R92J 4QTRA 2LK2A 3BQZA 5M5YJ 2X48A 1F43A 1QQBA 5EZGA 2EQRA 3RZZA 2JA8J 1W0TA 2XPWA 3JRHA 4J19A 2P81A 2VPRA 4MLOA 1D5YA 1P7IA 4FN3A 1ETOA 3IH4A 4M3FA 4I8TA 1MBHA 2ELKA 4Z5HA 3JRFA 3CCYA 5E3LA 2AW6A 3LSRA 4DW6A 3GTOJ 3HOZJ 1DW9A 2DMNA 2DN0A 1R9TJ 3S8QA 3HOUJ 2JK3A 5GPAA 2Y2ZA 3QPSA 4I6ZA 2ICPA 2KPJA 1ZTRA 3IVPA 4J1WA 1B8IA 2D5VA 2AXUA 4MCXA 3PM1A 3BTJA 3GTLJ 3BTIA 3KXAA 2MW8A 5BNGA 2E2HJ 3PO3J 1POUA 4IHWA 2LP0A 4A3CJ 3KZ3A 3CECA 1MSEC 2G0EA 3TP0A 3GTKJ 1JUMA 4BY1J 1OJLA 1QVTA 1U9OA 2IAIA 2JVLA 3JREA 4I6TA 2MSYA 2JA7J 3QQAA 1PRUA 1R69A 2MGQA 2FJ1A 1G2HA 1IDYA 1X2LA 4YBAA 2N8GA 2EBYA 4PU4C 5C44J 2L7FP 5HODA 4MO7A 1PRVA 1PRAA 4Z58A 2HINA 5EGOB 1PUFA 2EZHA 2CUEA 3S15J 3JR9A 1JKRC 2LYPA 4B1RA 2EZLA 3JXDL 1EFAA 3W6VA 5EEAA 3HEFA 2DMUA 2EF8A 4A3EJ 1BL0A 2VKEA 4Z5CA 4JQDA 3E7LA 5IYCJ 3RKQA 4Y52J 2LYLA 3F6WA 3JRIA 3Q3SA 3ZOBA 4A3KJ 4YARA 1SFOJ 1GV5A 3OP9A 3DEWA 2ECBA 4D7NA 1A6IA 3R1FA 3HBLA 3NARA 4A93J 5F08A 3TW6A 2IVGA 2M2EA 3PXPA 4CYCB 4S0HB 3SCFA 3UFDA 4XK4A 1ETVA 3BG5A 3BR0A 4AUXA 2WB1N 3A01B 3L1PA 2HXOA 3WHCA 2JCGA 2JA6J 2M0CA 2PIJA 4A69C 1TC3C 3F52A 3LNQA 3LFPA 4MCTA 4QSHA 3SJMA 2DMTA 2CQQA 5EG0B 2BNMA 2EWTA 2NVXJ 3HDDA 2JWTA 1TWAJ 3FK7A 3SDGA 3K2AA 1WH5A 2XGDA 1BJZA 5M5WJ 5IYDJ 3TEDA 3A01A 2LYKA 4PU3C 1GDTA 4XIDA 2GLOA 1IUFA 4XRSA 1UXCA 5EYRA 1NERA 3G1OA 1OCTC 2CSFA 3QYXA 3S2HJ 4UUSB 1UXDA 2M34A 3ZHIA 3HOVJ 4X4EA 4G12A 4C3IJ 5FLMJ 2IVBA 4Y7NJ 4LOCA 1IC8A 4I6RA 1RKWA 2ECCA 2L8NA 2IU7A 5FKNA 2WAQN 1ETXA 4MIMA 3TW7A 1I6HJ 1CJGA 3OQOA 3BQYA 2QF7A 2MQKA 3JXCL 2XSDC 4JCYA 4X4BA 1Q1VA 5K7ZA 4FTHA 5E3NA 3QQ6A 3BG3A 2K9NA 1A5JA 2XI8A 2IUOA 1TWFJ 1LLIA 3GTQJ 1JGGA 1OCPA 4X1EA 4HNVA 3S1RJ 2B5AA 2XB5A 3GN5A 1OFCX 1UG2A 1NTCA 1FTTA 3HKZN 1MBKA 2YUSA 5E3MA 2L0KA 4GHJA 2EH3A 4M3EA 1NEQA 2JA5J 3ZQCA 3BR6A 2PUFA 3GTPJ 2KT0A 1AKHB 2HOTA 3OMTA 1MBEA 2LYQA 4X4CA 3ZQLA 4FE4A 5FKKA 1H89C 5A7LA 2EZIA 3S2DJ 2DA4A 9ANTA 1PNRA 3F51A 1FJLA 2XIUA 1LFBA 2LVSA 1ENHA 2RAEA 1RESA 2LFBA 3GN5B 4M3GA 3D1NI 3JRBA 2B63J 2O8KA 4NDWA 4O8BA 1ETWA 1ITYA 1B72B 1B8IB 4GFBA 3QWGA 1ZVVA 2FQ4A 2LLKA 2R0QC 2VKVA 4IHXA 2R5ZB 2LYSA 3ZQHA 5K98B 2PE5A 1ZAYA 5IOYA 3S1QJ 4EEFG 4B4CA 4X6AJ 2IV1A 1ETKA 3HOYJ 1EF4A 4A3BJ 2XRLA 4V2GA 2BNOA 2LYJA 2HOAA 5F0CA 1WGXA 1E3OC 1LQCA 1BW5A 1JFSA 3SCGA 1DU6A 1ZZCA 2R63A 2WIUB 2IVQA 4OB4A 3CQZJ 4MFDA 3IH3A 4A3FJ 1YRNB 2PPXA 5GPCA 2MEZA 1ZUGA 1XS9A 2HQ5A 4IHYA 2PUDA 2CU7A 1T33A 1FEXA 3MN2A 3LSPA 3EUSA 3OOUA 1QPIA 1QRYA 1QP7A 1JWLA 3GBGA 3CLCA 5J3LA 1GT0C 1B72A 1IDZA 3U3WA 2PUCA 4BBSJ 2OFYA 5F27A 2O49A 2ID3A 3G7DA 5F04A 1FIAA 3I4NJ 2Y0SN 2PUBA 1JTXA 4IWRA 1F36A 1UTXA 2ZB9A 4FISA 3ZHMA 1POGA 3MLFA 4IVZA 2Y9YA 1NK3P 2DA1A 3FYMA 1H8AC 1W0UA 2R1JL 1HOMA 4D7MA 2KDZA 3S1MJ 3S1NJ 2TRTA 3Q0WA 2XPUA 3HGYA 3O9XA 2W48A 5IP9J 1HF0A 1BDHA 4C3HJ 3HOWJ 1SQ8A 1XWRA 1I50J 2DJNA 2NS8A 5J1YA 5EF6A 1X58A 1ZZ6A 2GRMA 2LKXA 3TP3A 4JCXA 2X6OA 3S17J 2JJ7A 2QCOA 2CJJA 5FJ8J 4YG7B 3HOXJ 1JT0A 2R5ZA 4JX6A 1ZR2A 5FKMA 2BNNA 2LYRA 5M5XJ 1JTYA 2VUMJ 1ZPQA 1WPKA 1JFTA 2K40A 4BY7J 1WH7A 4L5EA 4XICA 2PUEA 4B3AA 1TWHJ 1JKOC 1ZZBA 5F1JA 3H3VK 1ZGWA 1IGNA 4JP0A 3HGGA 2NVTJ 1PUFB 4PU7A 2PUAA 3BR5A 3SFIA 1LCCA 3ZQGA 5EDNA 2KEIA 3F0CA 1PERL 3G1LA 4IA8A 3HB9A 5EZHA 2YS9A 3A03A 1BW6A 2Y31A 4V2FA 4DZPA 1AKHA 2O4AA 2VI6A 3O8GA 2GZUA 4DYCA 3BT9A 3JXBC 1LMB3 4UUSA 3B6CA 1ZZ8A 3HZIB 3IH2A 3H5TA 1ZZ9A 1BDIA 2PUGA 1ADRA 3Q0VA 5EG0A 3RZDJ 1LFUP 4UUTA 1MBFA 3TRBA 2PMZN 2L9RA 5DTDA 1Z77A 1RZSA 1WCMJ 2DTZA 1NK2P 1MBJA 4DZJA 2EBIA 3CDLA 1FIPA 4Y42A 1ZS4A 1RETA 4D5CA 3BDNA 2KZ8A 1I3QJ 2M9HA 2O38A 2JN6A 2DMQA 2JMWA 1MBGA 2ME0A 1YRNA 1QQAA 2LR8A 4A3DJ 2M8GX 1JKQC 4CYCA 1UHSA 1IJWC 1JUSA 3OQNA 5J1RA 1VI0A 3FK6A 4X4FA 1JH9A 2FD5A 2R93J 1MH3A 1IV6A 2K9SA 3A02A 1VNDA 2AXVA 1MSFC 5IYBJ 5C4JJ 1Y9QA 1QPZA 3BR3A 3S14J 1LE8A 2R7ZJ 1GUUA 5DS9A 4RBOA 1WH6A 4W97A 2CROA 1VFCA 4X4DA 1K83J 2NS7A 2WUSR 2AUWA 2AHQA 2WV1A 1WH8A 1WETA 4C3JJ 3FYAA 1APLC 1R63A 3KJXA 5F0FA 1Z0XA 1JT6A 5IP6A 3LSGA 3DNVB 3QPLA 3O8HA 4M3DA 3B6AA 4NDLA 5C3EJ 1AHDP 4FCYA 4QIWN 2R5YB 4FE7A 2IBDA 2FX0A 2HDDA 4A3GJ 1DWKA 3B7HA 5C4XJ 4YG1A 3MKLA 2EZKA 1RR7A 2ID6A 3GBFA 1RPEL 2CUFA 3SCHA 4PU8A 1S7EA 1HCRA 4AYBN 4XRMA 3G1MA 1QVUA 2LY9A 1FTZA 3VPRA 3QF3A 4GQMA 1BA5A 4BBRJ 2NOGA 2AXZA 4BKXA 2L7ZA 1ZK8A 1AU7A 1Y7YA 4A3MJ 5IOZA 2IEKA 1IRZA 3RZOJ 1RIOA 2I10A 1JUPA 1P7JA 1UMQA 3BR1A 4X4IA
chains in the Genus database with same CATH superfamily
3BTCA 3CO7C 2HYFA 4YFNF 1KA8A 1ZKGA 3DKYA 3ABKH 1MMNA 1Y1VJ 2YX7A 4P55A 2CW0F 1ETQA 3IV5A 1ZGJA 1OISA 1DU0A 2DA6A 4W1UA 3B02A 1YIJI 1G59A 3F9KA 1OQYA 2CQXA 3H9GA 4IF4A 4N0BA 3RQIA 1SVLA 2AO9A 2IVMA 2OZ6A 3K4KA 5DTQA 4D5FA 2JT1A 4PGHA 1G3WA 3E5UA 4MFEA 3QPTA 3M07A 2QQBA 1OCCH 5DD4A 4ZTFA 1SAXA 4WXCA 1EA3A 5AONA 3HRMA 3OYGA 4J00A 1WSUA 2MG4A 4PSWA 2DJIA 4GGGA 3W6JB 2NAZA 1J9IA 2HGCA 3BG7A 2LRDA 4RB1A 3WTWC 1TBXA 4IRIA 4FBIA 4YEJA 2J7UA 1Y1WJ 2R7WA 4YELA 1KZHA 4RDUA 5FLXZ 1QP4A 2XRNA 3I3LA 1X3WB 2DMPA 3FKIJ 2LTPA 3BP8A 4A3JJ 2E1OA 3GTGJ 1WI9A 3S16J 2R7XA 3KP7A 2O9LA 1RZRD 4FQGA 1R1UA 2WAQA 5L3FA 1U8BA 4NQWB 4NC6A 5JLXA 2ICTA 1XDSA 1FMVA 1IAWA 4RB3C 3G73A 4KICA 3CROL 4HSRA 3K4MA 2V79A 2O0YA 5GTHC 3GTJJ 4AIDA 3P5JA 2L7MP 4G9YA 4ENNA 2Y9ZA 2R7QA 2PXBA 4YIRX 3OYNA 1QQIA 3CJTB 1QZZA 5E1WA 1MH4A 1YX5A 1T0FC 3UKGA 2VEOA 4YG4A 1MNMC 2ZSIB 1VQMI 4L18B 3ZMVA 3M3YJ 1X1CA 1BBYA 2WAFA 3ECOA 2FFHA 5DRYA 2WBMA 3OSGA 5IPAA 1W5SA 5K7FA 1STZA 4ON0A 3HZJA 1JJ8C 3H9QA 2JA2A 1FSHA 4NNJA 1MDMA 3GUUA 2M30A 4I98B 2EILH 3ELKA 3B73A 3V4GA 3ZKCA 5F0HA 3CJNA 4LG0B 2CH0A 3KYLA 2LH9A 2XAUA 5M5YJ 4Y3OA 4IHSA 1T6SA 1R71A 1W0TA 1FYMA 2XPWA 1ULYA 2JA8J 1LDDA 2XKOA 1PP8F 3E1SA 2AQEA 3CESA 4DOZA 2ESNA 1JHFA 5L3BA 1MMSA 4NB5A 4FX4A 3IH4A 1O3QA 2IGMA 1MBHA 2ELKA 2Y75A 1ZG3A 3JRFA 1YW9A 2E7XA 3KP4A 3LSRA 3K70C 3HOZJ 2DMNA 5AIQA 1W5TA 3S8QA 5LLQA 2DFIA 2VBYA 3ABLH 3OR1C 1WWXA 2L9SA 2EFOA 3OV8A 1OR7A 3H3ZA 4ZZDA 3CCRI 3FBNB 3MKYB 3LMMA 3K0LA 2OUMA 1QZXA 4RAFA 1U6GA 1IN8A 3HOTA 3BTJA 3GTLJ 4OOIA 3KZIC 2F5CA 5BNGA 2EB7A 4BACA 2DW4A 3J80K 3V8LA 1MSEC 2HNHA 5KK1A 4CICA 3GTKJ 2IAIA 2R3SA 1J09A 2JA7J 3QQAA 1R69A 5K5OA 3I59B 4PZJA 1B6AA 1PJRA 2N8GA 2DQLA 2F5DA 1WJCA 4UHTA 5D6FA 2L7FP 5C44J 1FBUA 1PRAA 1MNEA 4Z58A 1PUFA 1BOAA 3OYHA 2FOWA 1S6LA 3JR9A 5GAHJ 1TT0A 2O3FA 1HBXG 1SMYF 2PI0A 1SMTA 2QVOA 3OL3A 3ZCOA 4G6DA 4OIQF 2YU3A 2PXVA 4A3EJ 1BL0A 5DRTA 5TGTA 3QWLA 3SDBA 4Z5CA 3F3XA 1TT5B 5IYCJ 3RKQA 4Y52J 3OL4A 3F6WA 1SFOJ 2BGCA 1LPQA 2BV6A 2FU4A 2GXGA 2MFZA 3CP8A 3V7CA 4D7NA 2JQEA 2P8TA 5EEGA 3GFMA 2KKOA 5GAEJ 3H1CA 1SVMA 1I5ZA 1FT9A 4CYCB 3JTHA 5DDGA 3PFIA 3M9LA 1ETVA 3FZVA 3BR0A 2KZVA 2RC4A 4CA0A 3BZ6A 2XVCA 2HXOA 1ON2A 3FXQA 2JA6J 1TZLA 2PIJA 5BPDA 4EATA 4IRHA 4QSHA 5IT9Z 2DI3A 2MLKA 1O7LA 2CQQA 2L4AA 4BE1A 3U9GA 4GCVA 4BQOA 4MTDA 4OMYA 2X6WA 3UNGC 3W3CA 3K2AA 2PXDA 4KA4A 1WH5A 1UZCA 3GEZA 2EIKH 4BU2A 4X0GA 3H3UA 1R4NB 3QFIA 3HSRA 3E0JB 3WTZA 1IUFA 1GDTA 5KVRA 1NERA 2M0MA 3S2HJ 3K4LA 2QKMB 4HX8A 3ZHIA 4KIBA 4X4EA 3KFWX 1YE9A 4HA8A 4LOCA 3A0BC 3H5AA 1D1AA 1T39A 1T38A 2IU7A 2IGOA 4N9HA 2BW3A 1YS7A 2WAQN 4Y33A 3NDBB 3RTRA 2QBYB 4KDPA 3RYRA 2DT6A 3JXCL 4JCYA 5DM6F 1Q1VA 2WWYA 3BG3A 5EEHA 1P9QC 2LKPA 2IUOA 2OAZA 1SFEA 2UXNA 2XI8A 2P0WA 1ZAOA 2XKPA 4X1EA 2YBDA 2XROA 4UB6C 4BH9A 1OFCX 3KP5A 4KUMA 1MBKA 2L0KA 3E6DA 2EH3A 4M3EA 2EINH 3BR6A 4PJJA 5HLGA 3K1NA 3GTPJ 3LQXA 1WVRA 2E1MB 4L5IA 2DO7A 4X4CA 5FKKA 1XMAA 2Z3YA 3MEJA 3OOPA 5A7LA 3S2DJ 2DA4A 4RA2A 2KPMA 1TQIA 1FJLA 3F51A 1WJFA 1LFBA 1R00A 2KP6A 3K4CA 2LFBA 2X1CA 1WJAA 3IRRA 2VKDA 5HDNA 3TELA 2O8KA 3KLNA 2OC6A 1MZBA 3F6VA 1X1PA 2VBXA 2ZXJA 1E3PA 3CC2I 2PFBA 4L5JA 2R0QC 5LEJA 2LYSA 2R5ZB 3FXRA 3G6EI 5K98B 2PE5A 5IOYA 3S1QJ 4I0BA 2FRHA 3MZ8A 2H6CA 1RUOA 5JFRA 2H1LA 1OYIA 4A0ZA 1BC7C 1EF4A 2XRLA 1L0OC 2HU9A 5F0CA 1WGXA 1E3OC 1LQCA 4HV6A 3DBLB 1ZG1A 1HSTA 3BOQA 2V9PA 1IN5A 3TKYA 5GAGi 4HDVA 4Z2YA 5IY5H 3I56I 4A3FJ 4G8XA 2PPXA 4EJUA 2IS2A 3TEPA 3GZNB 4F52A 3I4PA 2HQ5A 3D5SC 2PUDA 2DFHA 1FEXA 2KDOA 3LSPA 1VQ7I 3CUQA 1I3AA 2D2WA 3DXJF 4CCNA 3CLCA 3U3WA 4PJNA 3OS1A 3C2HA 2HCNA 2QGUA 2UXXA 2O49A 2ZMEB 2ZXHA 1FSEA 2ID3A 3DPLC 2ZMEA 5F04A 2Y0SN 1JTXA 4IWRA 1SD4A 2XAJA 3U1DA 3G0TA 4ZJZA 2ZB9A 3MLFA 4BHCA 2Y9YA 1H8AC 3EYIA 5F6FA 2EA4A 1EH8A 1Y0UA 2W85A 3E6BA 2KDZA 3S1MJ 3S1NJ 1KQ8A 1ZRFA 2Z1DA 2HOEA 4U88A 3S8PA 3EUHC 2FMYA 2W48A 3WE3A 3QOWA 4C3HJ 2ZMEC 4BQAA 5J1YA 3OWTA 3M8FA 3TP3A 2X6OA 2F48A 3RKYA 4MEYF 2G7HA 1TQPA 3I71A 1B59A 2H8WA 4XKBA 1ZLJA 2CJJA 2IW5A 4ITVA 4YG7B 4HEA2 2PXUA 1YX3A 3GFIA 3KEYA 2CWEA 1UHMA 1JT0A 1ZHFA 1FOKA 1OMIA 1JTYA 1OPCA 3U2RA 2K40A 2LBFB 1F5TA 1QGPA 2X4HA 2XSJC 3CDHA 2VE8A 3GYHX 3PE5A 3T0YA 4JP0A 3DP7A 4HSTA 3CCLI 3R4KA 2NVTJ 2HZDA 4WX9A 2PMUA 1IZ1A 2LC2A 2DK5A 2PUAA 2DU9A 1U0JA 3BR5A 1LCCA 3ZQGA 2BW3B 5CYVA 5JR3A 2OJED 4L0YB 3G1LA 4IA8A 4JQFA 2A6HF 2YS9A 1BW6A 3A03A 4V2FA 4DZPA 2BVMA 3QOEA 2GZUA 3ABMH 4ZH4F 3P7NA 3HRSA 3PSFA 3FXJA 2BYVE 3DBHB 3GZDA 1LFUP 2AXLA 3TRBA 2PMZN 4G6TB 2DTZA 3FM5A 3H9JA 2H27A 1UAAA 3QOXA 1XD7A 2KIFA 2M9HA 3VB2A 4BDZA 2O38A 2DMQA 2JMWA 4Q47A 1P4XA 1TQMA 1YRNA 1P4AA 5LGUA 4CYCA 3K4JA 3OQNA 3WGHA 1Z3XA 4M9XA 4EKGA 1MW7A 2XDVA 3DPTA 4B43A 3EPZA 2F4IA 2CSOA 3T1BA 5ED4A 4U0YA 1IV6A 2K9SA 5E18F 1XCBA 1Z7LA 4E7ZA 2AXTC 1EV7A 5C4JJ 3BR3A 3V42A 3CF5F 3ZMUA 4DE8A 1GUUA 2ZJQF 4XOTA 2L7KA 2Q8KA 2QLZA 1K83J 3GLXA 2PX9A 4BYYA 2AUWA 2HFZA 1ZLKA 1C0WA 3HXLA 1SEUA 1WETA 3WGGA 4B47A 3CCJI 3KJXA 3FM3A 4JK1X 1RR8C 3PJRA 3E3VA 3DNVB 3HL2A 2VQLA 2KRFA 1S8NA 3OYDA 4EM2A 5HDKA 4QIWN 4I01A 2B9SA 2M4HA 4HG2A 3QYBA 2DXIA 4FE7A 2B0LA 2X85A 2WTEA 3HHGA 3IWFA 3H36A 2K3PA 4NHJA 1BOBA 2XUBA 1T8IA 4AYBN 2IJLA 4RM2A 4XRMA 3PIOF 3BLYA 1BA5A 3NQOA 4BBRJ 5F1RA 2NOGA 4XOPA 2LYCA 2RNJA 2VIXA 3WU0A 1ZK8A 3CJQB 3N97A 2WAEA 1AU7A 4B48A 2IT0A 4MTEA 3KETA 3F22A 1FYLA 5IOZA 1HQCA 4ESJA 2O6GE 1MFQC 2HTSA 4HW0A 1P7JA 3BR1A 4GYGA 3TO9A 2EFNA 1QB2A 5TJJA 1WI3A 2LOOA 3CTAA 1U9NA 2ZJPF 1L1MA 3QP6A 5FO5A 1XG1A 3W2AA 2J5PA 1IXRC 3L2UA 2XCJA 1F9NA 2BJCA 2OPTA 4C2MJ 1VPWA 2LREA 4A6DA 4XBFA 4ABZA 4DYQA 2OR1L 3DF8A 3RPUD 3JRAA 3MVPA 1LNWA 2NS0A 2OCEA 4IL6C 1L3LA 2QQ9A 2E2JJ 1RPWA 1LEBA 1ODDA 2WA0A 3K2ZA 4E7LA 2LCVA 2ME6A 2HI3A 2K5CA 2XGCA 2HS5A 2PJRA 2LD5A 2O7OA 4XKCA 1OR7C 1SVOA 4A3LJ 4UB8C 3ZQFA 3PFYA 3M4OJ 5CVRA 2OF7A 3ZQ7A 3LA3A 5DTMA 4CDGA 2CW7A 2ACJA 3VSKA 2L3DA 1X2NA 2CUZA 2KRCA 4UNOA 1OSLA 4JX4A 2QKLB 2VJ5A 3VDXA 2KRHA 2Z33A 3GTMJ 4OU0A 1MJBA 3PNTA 5IP7J 1DDNA 5D5XB 1O4XA 2RN7A 5M3FJ 2D1HA 3FWEA 3HRTA 2GRLA 3E5QA 1Z1DA 3E6CC 3IAM2 1UCRA 2IXSA 3GCMA 4C9YA 3PIPF 2W7NA 5JVGF 2MD5A 5M3MJ 4BJ6C 3FX3A 4HOBA 1RUNA 1WIZA 2ICWG 5E8IA 2LDUA 2GM4A 2VOPA 3DCFA 3HIFA 4M6VA 1HDPA 2IRFG 2VASA 1UELB 2H8RA 5E1XA 3V7SA 2KEJA 4IVNA 2HYJA 2DA3A 3EUAA 4F7ZA 5EGOA 2KIQA 3OSFA 2W1OA 2NVYJ 4A5MA 2H1KA 3I4MJ 5LGTA 4F92B 1FOXA 1U78A 4H0EA 1IRFA 3UR3C 2MLGA 4N4NB 5FD6A 4BQNA 5K5QA 3KEQA 4CUGA 4IEJA 2M87A 3WHBA 5J40A 3F21A 2DA5A 2XB0X 2DT5A 3H0GJ 1SANA 2VN2A 3SEQA 3T8TA 2ZNZA 3ZQIA 2L49A 2NVUB 1YTYA 2JVHA 5EJCA 2XJ3A 3PO2J 2VODA 4EGZA 1O3RA 2BXYA 1VQ8I 2R4GA 1HLVA 1DPUA 1FY7A 2Y0MA 4UXNA 4KMUX 1NW3A 1XSDA 2D1VA 2FE3A 2COMA 2FUG2 2X48A 5EZGA 1T2KA 1S72I 4XLEA 3RZZA 4BEHA 2O61A 4MLOA 1D5YA 2X0LA 2RVCA 2EV5A 3SQNA 4I8TA 4ENMA 4GDFA 5LHHA 4BHBA 3KPHA 5E3LA 2QA4I 2HPIA 3GTOJ 1DW9A 4BEHB 3HOUJ 2L5QA 1KU7A 2JK3A 1J2XA 2KMUA 3QPSA 3ML6A 4I6ZA 2ICPA 3MZHA 1ZTRA 1P2FA 2EFPA 1B8IA 3IP4B 1FP2A 1R1VA 2AXUA 4I99C 4ER5A 3PO3J 2E2HJ 3AL0C 4IHWA 2IS6A 2A3SA 2LP0A 2A68F 4A3CJ 3CECA 2XXAA 1JUMA 3F23A 4BY1J 3M9AA 4HLYA 1QVTA 4FHTA 2JVLA 2CYYA 3JREA 2MGQA 2FJ1A 1G2HA 2BY2A 3O3KA 3SZPA 1YO5C 2KZGA 1X2LA 4YBAA 4K2EA 1DGWY 4UVBA 2EBYA 1Z91A 1H9TA 3P9KA 5HODA 4WXDA 2HINA 4D1QA 3MMYB 1IRGA 2EZHA 1ZGAA 4A12A 4RGSA 1JKRC 4M74A 3DM5A 2MA3A 3ZN1A 2RQPA 4XR6A 5DUKA 3V7RA 3JXDL 2K4BA 2HYGD 3QU6A 3HEFA 3WTSC 3LA7A 4TV7A 4II2A 3QP5A 2LY2A 3J7AO 2OTJI 4JQDA 3TDUC 1Y0NA 2KLOA 3JRIA 1K78A 3F8BA 4YARA 3MFKA 1XPXA 3OP9A 3DEWA 4OAYA 4U7BA 3ZGKA 1A6IA 3HBLA 2K85A 3OIQA 1T98A 3CLOA 5F08A 2EPFA 3QU3A 3OMYA 4XK4A 5ICEA 3BG5A 1KU2A 2W82A 4AUXA 2WB1N 1A04A 2CGPA 1OCOH 3A0HC 2DOAA 4ER3A 4DNCA 5FRMA 4NBQA 1MD0A 5EG0B 2BNMA 1FMWA 2DFEA 1SC7A 5KNLA 2L2OA 3MKZA 1RI7A 3FK7A 1YJNI 1F1ZA 3F8NA 1O3TA 3HDDA 2HQRA 1G3SA 2HKXA 3CUQB 3IAS2 1R1TA 3FXMA 1EKEA 2XGDA 5M5WJ 6PAXA 1GXQA 2MABA 3A01A 2LYKA 2GLOA 4I02A 4Q48A 2STWA 3G1OA 1OCTC 3KP2A 2PEXA 3DLAA 2E5ZA 3ERED 3HOVJ 2X51A 2IVBA 4Y7NJ 2JRTA 1B9NA 1IC8A 1KQ9A 3SXYA 3RJPA 3NZLA 1ETXA 4EVIA 5GTIC 1FYKA 5ILUA 1QHHD 1Z6TA 1X4PA 1M1EB 1XGMA 2CW8A 1V4RA 3ZR8X 2VJJA 3J80Z 1D0XA 3QQ6A 5CVUA 1TWFJ 3FBIB 3REOA 4CXFA 4EGYA 2XB5A 2MBFA 2VQCA 2QBYA 1Z05A 2ZBKA 5BPIA 1UG2A 4Y15A 3HKZN 2HDCA 3OIPA 4GHJA 5HNHA 2JA5J 3ZQCA 2G7UA 2YR2A 4ANJA 1QZEA 1DUXC 1PYVA 3CCEI 1S29A 3GZ5A 1VQNI 5BS6A 3AFHA 1MGTA 4FE4A 4HRAA 3E5XA 5KAFC 3MAJA 4P96A 9ANTA 4YFKF 2E60A 3OY9A 3PNYA 2HZTA 4BS9A 4DGWB 3MWMA 3M1EA 1RESA 3KE2A 3TDZC 3K69A 4BE2A 2GQQA 2L4MA 4UVAA 3S2WA 2B63J 1HW5A 4O5VA 4NDWA 4O8BA 1ITYA 1B72B 4GFBA 2DT7B 2RDPA 1ZVVA 3J7AY 2VKVA 4IHXA 3ZQHA 4XM3A 4EEFG 1IUYA 3GF2A 1G3TA 5E17F 2DBBA 1ONVA 2JUCA 2VQGA 4P9FA 4A3BJ 3DU5A 3DQVC 4WWCA 2KL4A 1X19A 1DU6A 3X2QH 2F5FA 2JSPA 4CCKA 4OINF 2R63A 1OCRH 2WIUB 1MMAA 4MFDA 1UG0A 3I9V2 3I5UA 2XC7A 4DBRA 2MEZA 4LD5A 2VB6A 3RIRA 3L00A 4A2UA 2BVLA 2VL8A 3CUQC 1FX7A 2I8DA 2XF5A 1LFPA 2RQQA 4LLLA 1QRYA 4JOMA 1QP7A 2XAFA 1E2XA 3F72A 1JWLA 5L3EA 1GT0C 3OYFA 1IDZA 3M7GA 3LSMA 1A36A 3G7DA 2K3FA 3DFGA 2PUBA 1BIAA 4HYEA 3FMSA 3GXOA 4IQ4A 1LQ1A 3TFLA 2DCEA 2ZO4A 1F36A 4EJTA 5CVJA 4LK0F 2PLYA 3ZHMA 1J7KA 1HW2A 4IVZA 2ZFWA 4U0VA 2DA1A 4D0PA 3I59A 4WVLA 2R1JL 3R0JA 2DTRA 4L9VA 4C2TA 5IP9J 1HF0A 1YQAA 1SQ8A 1XWRA 1QZYA 3ME5A 1I50J 2DK8A 3HYIA 4XSXF 2GRMA 1BI1A 4KITB 5DT2A 2LKXA 4JCXA 4ASNA 1GVJA 3JSPA 2JJ7A 1IXCA 2R7SA 1HQ1A 1ERDA 2LBFA 3CO6C 3G4SI 2LG4A 1XN7A 5LBQA 4ER6A 1I1GA 2GAUA 5M5XJ 2VUMJ 1FC3A 1WPKA 4BY7J 2PUEA 5JHUA 1FOWA 1KYZA 3TOBA 4XICA 4B3AA 1H0MA 2CFOA 4XL9A 1JKOC 3BJ6A 4XLCA 3C18A 4YIIA 4M9SA 1YI2I 5LRRA 1ZGWA 1O57A 2Y48A 3MCZA 3LFKA 3DTKA 1I1SA 5ICGA 3Q5FA 3WTTC 1XMXA 1NG6A 3WG7H 3WODF 3ZQQA 2O4AA 3U21A 4AM3A 2FA5A 1DQUA 2LLWA 4XKWA 2VI6A 3OS0A 2L01A 3IHUA 4DYCA 3JXBC 1LMB3 3VYUB 3B6CA 1ZZ8A 5JUWA 4EJWA 1XSVA 4EKIA 4WK8F 2DOFA 1BDIA 2PUGA 1F4KA 1ADRA 2BHYA 2M5WA 3Q0VA 1R5HA 2RNGA 2L9RA 1PUEE 4KYWA 3K10A 3G71I 1NK2P 4DZJA 3F8MA 2EBIA 5D4RA 1FIPA 4Y42A 1ZS4A 1RETA 5DEQA 3ROUA 3BDNA 2L9VA 2X6YA 1IO2A 2V6EA 5A2QK 2QQAA 1JKQC 3LAPA 1JUSA 1MJ9A 2CQNA 3FK6A 1AWCA 3VFZA 4YFXF 2JQ7A 2FD5A 2X1EA 1LVAA 2JUGA 2AXVA 3DWLE 3HC7A 5IYBJ 5D5WB 2R7ZJ 4CYDA 1VFCA 4X4DA 2FBKA 5TRDA 3P9IA 2WUSR 1JGSA 2WV1A 3P9CA 1PVEA 4WCGA 1WH8A 2FF4A 3KEOA 3Q9SA 4RLQA 4ZYHA 5B3SH 2HVSA 2Z9OA 1P6RA 5F0FA 1JXSA 2PXKA 4ZYGA 2CV0A 3O8HA 4PUSA 4FCYA 4EZIA 4P9UA 5HVQC 2E34A 2R5YB 2IBDA 2FX0A 2HDDA 1Y8RB 2M45A 4A3GJ 1HA8A 1DWKA 4KJZA 4XMYA 5C4XJ 4MHGA 2EFWA 3PUBA 3GBFA 1R23A 3FXLA 1FBQA 4MQ9F 3C7JA 3FMRA 1V5FA 2LY9A 1FTZA 4P5OA 3QF3A 4GQMA 2FBHA 3I55I 3SHFA 1R7JA 1YHQI 2L7ZA 2BY3A 1FP1D 3KL4A 3I64A 3OR2C 1Y7YA 4ZDOA 4XSZF 5ILVA 2QSFX 4XKVA 1IRZA 3AG4H 3IUOA 1RIOA 4F55A 3GX4X 5LGNA 3WU1B 4X4IA 1H88C 3OQMA 1TP4A 4AVPA 4C2UA 3JRCA 4J1XA 4JYKA 2A07F 2K7LA 2ZFUA 1R5GA 3RDIA 1B4AA 4G94A 3K6GA 1YJ9I 2XPVA 4JX5A 2P5LC 1TLHB 2Y69H 3N05A 1VTNC 1ZR4A 3LSJA 2A6CA 2M4GA 3C1DA 5E3OA 4ZTJA 1TTYA 3FIWA 5FLVA 4B44A 1RZRA 1ZN2A 2YU9J 4KN4X 2E36A 1LKXA 4GXOA 2KIMA 2O5RA 2WB1A 3GWZA 1TWGJ 4PK4A 5HLHA 4LB6B 3AL0B 4PGGA 1E3HA 3GVAA 1J0RA 5LHGA 1QP0A 2V9VA 1GHCA 4KISA 2HSGA 3FXUA 4YRVA 2LMDA 1Y56A 3RYPA 2FJRA 1ZZ7A 2GBYA 2KFDA 3MQ0A 2CV2A 3AAFA 5J1UA 5JLWA 3C2BA 2X6XA 3JRGA 4A5NA 3TQNA 3TGNA 2E19A 3HM5A 3QODA 4GO1A 4KIFA 4BE0A 3SX0A 4X4GA 1Y39A 1T56A 2OU2A 1RKTA 5BMZA 3BD1A 3QRFF 3LISA 2L02A 1VZ0A 1QHGA 1ETYA 2DYRH 2IV1A 1YITI 1B0NA 3CCUI 5JHFA 3VYTB 2A61A 3RPQA 3CMAI 3BS3A 5D6EA 1YSEA 1Z9CA 1JJ6C 1V3FA 4FX0A 1Z6RA 1JKPC 5DV5A 2NVQJ 3JAMZ 2DYSH 1BJAA 4IPAA 4U0WA 4QWQA 4I6UA 4WXHA 4M3BA 1LUJB 1YLFA 5DCMB 2DOEA 3IKTA 4AIHA 3G5GA 4IHVA 1ZRDA 1GLNA 2FBIA 3FISA 1WHUA 5FKLA 1V5EA 2R5YA 5LRSA 2YPRA 1PP7U 3CMMA 3AG1H 3L2QA 1WJBA 1X1AA 4HX7A 3A4CA 1I27A 3LSIA 2AS5F 5HLTA 4KT5C 2K9QA 3DBRB 2X9DA 2I5UA 4UVCA 2CMPA 4LJZF 3LOCA 1LDKB 4BJ5C 4XRSG 1U3EM 5IT9K 3J81K 4E7HA 4QTRA 1BI2A 1XB4A 2CQ7A 2HDWA 4CCOA 2V1NA 3ABUA 1F43A 3HKZA 3LWFA 3SYTA 2FNPA 3JRHA 1D8JA 4J19A 2P81A 3K70D 2E1NA 1AOYA 3LL7A 3ULQB 4ER0A 2KISA 1P7IA 3OYAA 1ETOA 3KIOA 4MEXF 4FN3A 3F8FA 5CQGA 2VC0A 1KONA 4Z5HA 5CQEA 2QSHX 4ESBA 2IA2A 2GOMA 3VYSB 4DW6A 4ESFA 3LAJA 2NRAC 4AD9A 1IN7A 1KYWA 4YIFA 3D5RC 3FHZA 1W7PB 1JI8A 4PSXA 4AIKA 3ASNH 3QPHA 4ZC3A 4E7IA 4J1WA 2PXFA 2D5VA 1ZELA 5E1ZB 1MDMB 2MW8A 3KXAA 4HBLA 2LSOA 1OLTA 3KZ3A 2BY1A 2G0EA 2PXEA 2FSWA 1OJLA 1U9OA 2PQ8A 3PSIA 4HNTA 4CCJA 5FLXK 2MSYA 1R4MB 2CG4A 1DP3A 1PRUA 3BC8A 3HTUA 5B66C 4UUVA 4B3XA 1CF7A 3F8CA 4EK9A 4HPQA 2JTVA 3S32A 2KHMA 2RV8A 2V3CC 2A5WA 4PU4C 2NXNB 4IO9F 1J75A 1Z21A 3HPHA 4MO7A 4ETSA 1IN4A 1IW7F 1O3SA 3S15J 2CUEA 2HQNA 1XTAA 1SD6A 3VWBA 1USTA 2ZNYA 3O6BB 2P6TA 4XORA 1EFAA 3W6VA 5ILSA 1D3YA 3DKWA 1TW3A 4LITA 5E20A 2QZ8A 2EF8A 4PFOA 3OYCA 4RGXA 3E7LA 2PMZA 4A3KJ 4CH7A 1OYWA 2ECBA 4KIGA 4OIRF 1HC8A 3TW6A 3ZRGA 1Y8QB 2IVGA 2V1XA 2W84A 2M2EA 3COAC 3PXPA 4XLFA 4S0HB 2XHKA 3FHNA 1A35A 2HKOA 2GOXB 2VLAA 3GZCA 1VQ5I 4ZYAA 3V8KA 5HDGA 2JCGA 2M0CA 4BGDA 1J5YA 3LSTA 3F52A 3LNQA 2LF7A 1W1WE 4EV0A 3SJMA 2DMTA 1WRJA 2EWTA 2FMLA 2NVXJ 1BI0A 3SDGA 2D45A 2EIMH 3HUGA 1HSJA 2EK5A 5IYDJ 1WKMA 1V54H 5BOXA 3CC4I 3J7YJ 4PU3C 4XIDA 1R49A 3ZPXA 2E71A 1UXCA 3H5RA 2CSFA 2XXPA 3QYXA 2P7VB 5JI6A 1UXDA 3PNVA 2KJBA 4M71A 1MNDA 3M8JA 4N4OB 2Y0SA 5ERIA 4C3IJ 5FLMJ 1XX5A 2Q2EB 3HTSB 1RKWA 2H6BA 2ECCA 2ZSHB 3HSEA 2L8NA 4I6RA 5FKNA 3S3MA 1ZH5A 1D5VA 5GAHi 2QF7A 2MQKA 3LSHA 4IQJA 1HKSA 1E17A 2P5KA 4IZZA 4FTHA 5E3NA 1A5JA 4S05A 3WU2C 1LLIA 5A2QZ 3L2WA 1SD5A 3GTQJ 1OCPA 4HNVA 5D4SA 3S1RJ 1REPC 2W4SA 2E1CA 4CCMA 1FTTA 1BR1A 2YUSA 5E3MA 4XLAA 1S5LC 1MIJA 2VONA 4EQQA 3QYEA 3BPXA 3OYKA 4IX7A 4LK1F 4HZFA 2VBWA 2KT0A 1LB2A 4IHTA 3OMTA 2LYQA 3WTVC 2M3AA 1ZRCA 1S9HA 2Z5UA 1S3JA 2EZIA 2WY7Q 3PL8A 5HNFA 1PNRA 3HHHA 5KCMA 2XIUA 3A9YA 2LVSA 1ENHA 2RAEA 2OQGA 3GN5B 2GXBA 2IS1A 1NG7A 3GW2A 3JRBA 3A1YA 3LQQA 3LSKA 3BCBA 1WZ2A 3E97A 4HX4A 2FEZA 3CZ6A 1MKMA 4S04A 2HPMA 1LVKA 4AVZA 1VQ4I 4QPOA 3SEZA 3L2VA 2DAOA 3MKWB 3K1PA 4M6YA 1ETKA 2BNOA 4V2GA 1W4MA 4IJAA 3FDYA 4E4HA 4UY8I 5FROA 1KQ0A 2GXAA 2AQFA 1SFUA 4M73A 4XLNF 3HG9A 3WTYC 5J6XA 2P7CB 3IH3A 3RI4A 5GPCA 4Y4RA 4BAYA 1ZUGA 3VSLA 5GADJ 1ZG5A 1XS9A 2IA1A 2IA0A 2YX4A 2CU7A 2X1DA 3VYRB 3EUSA 4A0YA 4Z6YA 3R60A 5H6RA 5L3DA 3GBGA 2WADA 5J3LA 2O8XA 2PUCA 3EUHA 4BBSJ 1VQLI 4KT6A 3ZMSA 2V7FA 1JHHA 1IN6A 3MD2A 1XSXA 1FIAA 3I4NJ 4L9JA 1DP7P 2EFQA 2PN6A 3HSFA 5CKTA 1UTXA 3ONQA 2ZJ2A 1POGA 1WFXA 3FYMA 1W0UA 3KP3A 4WF2A 2IS4A 3I53A 2ESHA 1Z67A 3Q0WA 2EV0A 3HGYA 3M1CA 2ODRD 1Y6IA 1BDHA 3HOWJ 2PXPA 2DJNA 2W24A 1YW8A 3NRVA 1X58A 1ZZ6A 4MNUA 2QUFA 2VKHA 1ZARA 1TW2A 3BY6A 1JE8A 3E6MA 1X3ZB 3ZPLA 3K4NA 3AG3H 5FJ8J 3H92A 1XGNA 5FFZA 4MGRA 4C30A 5H20A 2R5ZA 4JX6A 2BNNA 3DEUA 3BROA 5DUIA 2DLLA 2MYSA 3GFJA 1YJWI 2KQRA 4L5EA 3QAHA 2BY0A 1TWHJ 2VPLA 3DPUA 4CCLA 4BHPA 3H3VK 2ISYA 3HGGA 5TISC 4RGUA 4PU7A 1E0EA 1G4DA 2RGVA 4E70A 1N75A 2OZUA 2XF6A 2BEOA 3MEXA 3ZXSA 1FNNA 2MD0A 3U1KA 3CCVI 4OWRB 3K9TA 4LFUA 4HQMA 1YFHA 3O8GA 5B5EC 4HLXA 2J5OA 2XXQA 1Z7UA 3HZIB 3C3WA 3RKXA 3IH2A 3H5TA 1ZZ9A 1FBSA 1FPQA 5E79C 4BQQA 4UV9A 2HQAA 4E6KG 2G9WA 4UUTA 1O7FA 5DYMA 1XGOA 3IL2A 5DTDA 3IRQA 4PJMA 4F3QA 4XN0A 3OKZA 3CCQI 2K27A 3CDLA 1KU3A 4D5CA 3BJAA 1I3QJ 2KZ8A 2OD5A 4II3A 2A6TA 1FZPB 3R0AA 3CF2A 2L1PA 1MBGA 2HR3A 3SR4A 2CFXA 4OBMA 1QQAA 2LR8A 3MZYA 4UV8A 4G7HF 1G6NA 1UHSA 1H9GA 4LLNA 2IP2A 5J1RA 1S7AA 2F4OB 3I0TA 2L54A 3J81Z 2GIVA 5FRNA 2R93J 1KGSA 3A02A 1BR2A 1XCVA 1LE8A 5DS9A 4RBOA 1U5TB 3S3NA 4W97A 2CROA 3R61A 3DLLF 4XLHA 1UHWA 2W25A 5FB2A 2M7AA 4Y13A 2XAHA 2AHQA 3CMEI 2RREA 3IKVA 2PJPA 1W36D 4RLFA 3FYAA 4RB0A 3VWSA 1R63A 2Z2SB 1CF7B 3PQJA 1JT6A 4BNCA 5IP6A 4IOAF 4HAMA 4M3DA 3NXHA 4LGWA 4XNFA 1WJDA 1D1BA 3B7HA 1W5CC 3ASOH 2CQKA 4YG1A 3MKLA 2EZKA 2E1MC 1OYYA 3DKXA 3H0DA 1RPEL 3L9FA 2BZTA 3G1MA 4M72A 5GAGJ 5L3GA 1YG2A 4E7JA 2R7RA 5HS8A 4U7DA 2AXZA 4BKXA 5CLSA 4ER7A 2GWRA 3HOSA 2F4MB 1OKRA 1RIOH 2QEXI 4XN3A 2IEKA 2DFFA 2ISZA 1JUPA 2PXQA 2VOOA 3D0SA 2V26A 1Q1HA 4PDKA 2E5NA 2E35A 3OIOA 1K6YA 5FKOA 4HF0A 1K7AA 4HRIA 3KP6A 2MC4A 3BG6A 5ICFA 3ZN0A 4HF2A 4Q5SF 2HXIA 2DPUA 2AWIA 5J8CA 3A2KA 1HDDC 5GP9A 1X1BA 1P4WA 1XGSA 2COBA 2VQHA 3WG9A 4DYRA 4A3IJ 5HLIA 1XC5A 1QNTA 2GA2A 3NWSA 5HS9A 3QYFA 2DA2A 1VQKI 3I54A 2PJRB 1WJEA 5H6QA 3RPUA 4A6EA 3ZP5A 1CQTA 4Z59A 2TCTA 2CRGA 2QM3A 3GO5A 2Y30A 1IG7A 1X2MA 1W7PA 1LCDA 2M7BA 1BR4A 3R6SA 4B09A 2NYXA 1K61A 3CLQA 2QYOA 4LG3A 4F8DA 2IGNA 3JTGA 2E2IJ 1ORKA 1SFKA 1W7PD 2LNBA 2OV7A 2Q1ZB 3K4BA 5H2FC 4LB5A 4X4HA 2FQ3A 1U5TC 2VC1A 2VBZA 3JRDA 2NNYA 5K1YA 4BXXJ 5AIPA 2DA7A 2HOSA 2K4JA 2XGEA 3VK0A 1VQ6I 3H35A 3NAUA 1K78B 3SZTA 1LE8B 1X57A 3DTIA 3AG2H 4H4KC 3ERMA 2K86A 5D8LB 2LLVA 1U2WA 2FXAA 4O6JA 3EYYA 5IT3A 2MH2A 4CGZA 2A05A 4I76A 3Q0UA 5K7HA 1TWCJ 2W57A 4BL0B 1SFXA 4KNYA 4RAGA 4GRIA 4RM3A 1IXSB 1BM9A 3K7AJ 2GZWA 4BDYA 4B8XA 3A9XA 1GVDA 1ZQ3P 3EQLF 4AC0A 5J4VA 3CMYA 4XONA 4PFPA 2EJRA 3DEEA 3BZKA 4NC7A 5DCMA 4CZZA 1VF9A 2K02A 2XAGA 3FMYA 3I58A 1U5TA 3BTLA 3ZMZA 4HDUA 4Z5DA 3BG9A 5J47A 2XAQA 3G3ZA 3DTEA 3BR2A 1SAUA 3WTXC 2XF7A 2ETHA 1GV2A 2KIUA 3O2PE 4U87A 5KHDA 2R7TA 2KEKA 4DJAA 2R92J 5LHIA 3OYJA 2O03A 3LQRA 2LK2A 3BQZA 1QQBA 3C2GA 2EQRA 1QPMA 4P1WA 2K9LA 4XQFA 1MJAA 1GXPA 2HTJA 3FF5A 2VPRA 1K4SA 4M3FA 5L3CA 2A69F 3VODA 3PUFA 3L2RA 2AW6A 3CCYA 4L0ZB 1X3UA 1X4OA 1V5GA 2NOJB 1BIBA 2DN0A 2Z99A 5CVVA 1R9TJ 2M4KA 1USSA 3KZYA 2WV0A 4ENKA 2HVRA 5GPAA 2Q0OA 2H94A 4IRGA 1BI3A 2Y2ZA 2KPJA 3R09A 3IVPA 2DDAA 4Q2JA 4RAYA 3PM1A 4MCXA 3BTIA 3IWZA 4FETA 1POUA 2H09A 4RGRA 3LA2A 2CS3A 3VOEA 2A5YB 3RQ4A 3TP0A 1LEAA 2IPQX 4I6TA 1MMGA 4AU7A 2JVGA 4QPQA 4HF1A 1FLIA 1NHAA 2OA4A 3BPVA 4N9IA 1VQ9I 1IDYA 3TO6A 4E7SA 1QBJA 4CHUA 5D5UB 4KN7X 2ZJRF 4PJLA 1B1BA 4ZDLA 4Q4ZF 1PRVA 5K5RA 5EGOB 3LFUA 2LYPA 4DIQA 4B1RA 4KFCA 2EZLA 4XRFA 3M8EA 3JW4A 3UWPA 5EEAA 2DMUA 4LIUA 2VJ4A 1YOVB 2VKEA 5ICCA 1A6QA 1DULA 2EA2A 1D8KA 2LYLA 4PJ0C 3Q3SA 3ZOBA 2ZC2A 4IOCF 1LJ9A 2F5VA 1GV5A 3N4MA 1ACIA 2C6YA 4AIJA 1K6OA 4HNUA 5HOOA 2PMHA 2MH9A 4M6XA 2HEOA 4NC8A 2ELHA 1WJ5A 3NARA 2XV4S 4A93J 3R1FA 2VT2A 2CV1A 2V4JC 1RZ4A 2PBIA 2EWNA 4BXUA 1PDNC 2KJCA 2LF8A 2R7OA 4OAZA 3KCCA 3SCFA 3OYMA 3UFDA 1BN5A 2Z16A 1XMKA 4CSWA 1R6RA 2P6SA 1ZREA 3GLLA 2EV6A 5B1AH 3L1PA 3A01B 2ZXWH 3WHCA 5D8KB 4MCTA 2V6CA 4A69C 1G8XA 1TC3C 3LFPA 3V8JA 5HS7A 3OYBA 1YIOA 3BZCA 1TNTA 2JWTA 1TWAJ 1FOYA 1I39A 1V55H 5FD5A 1BJZA 2CUJA 1UB9A 3DU6A 2LNMA 2QWWA 3TEDA 3A9ZA 4XRSA 1OCZH 5EYRA 4AYBA 1J59A 1RRJA 3H5NA 3ECHA 3W2WA 4UUSB 2M1BA 2M34A 4OIOF 1BC8C 2ZXIA 3KLOA 4G12A 1K79A 2TDXA 4CO8A 3OYIA 3L09A 3SZGA 3KX2A 2ZKZA 3Q9VA 1P92A 4MIMA 3TW7A 1I6HJ 5DSXA 1CJGA 1RC9A 2EIJH 3ESWB 3OQOA 3NEUA 2J7WA 3BQYA 4EQZA 4OIPF 3DV8A 2XSDC 4X4BA 5K7ZA 3RKWA 2VT3A 3TL4X 2K9NA 2HFHA 1JGGA 3L2CA 2B5AA 1T0FA 2W00A 2OBPA 2QQ8A 1A31A 4F93B 3GN5A 3K1MA 2BHZA 1NTCA 3RSNA 3TBIA 1IV8A 1YS6A 4LMYA 1DPRA 5E8GA 1NEQA 1YYVA 2PUFA 3OWQA 2FOKA 1AKHB 2HOTA 1MBEA 5CPRB 3ZQLA 1H89C 2PXLA 5B1BH 4F91B 1ZYRF 2UZKA 2MC3A 3OYEA 1R5ID 2R7FA 3CDIA 3T5XA 3T8RA 1D1CA 4R8HA 2E7WA 2JZYA 2UWMA 4M3GA 3D1NI 4PCQA 1VQPI 3CD6I 2JPCA 4G7OF 4V19K 1ETWA 1AA7A 4DQ2A 3J7ZI 1B8IB 3VEPA 4ENJA 2P5VA 3QWGA 2FQ4A 1N78A 2LLKA 1ZAYA 1EJ9A 2QSGX 3PQKA 4NUBA 3CUOA 2V1UA 3WE2A 4G6QA 1UJ8A 4B4CA 4X6AJ 2F5EA 1R36A 3D5LA 3S93A 5BQTA 4IKFA 3HOYJ 2DPDA 3NROA 2LYJA 2L9NA 2HOAA 4EMSA 4BUPA 4ZZLA 2GA1A 3GZDC 1BW5A 1HW1A 1JFSA 3SCGA 4AWXB 1ZZCA 5D5VB 1EH6A 2M8EA 3CJRB 3CC7I 2IVQA 3CQZJ 5LD2C 4OB4A 2DODA 1YW7A 4HV5A 4EM0B 2Q2EA 4J01A 1YRNB 3F6OA 4LLGF 4I2OA 4IHYA 1CGPA 3BJOA 1T33A 3BCAA 3CCMI 3MN2A 3OOUA 1QPIA 3HUGB 2RKHA 3WTUC 4G7ZF 1B72A 2OFYA 3FKJA 4GYIA 4L9TA 1S7OA 2ZCWA 2V9KA 5DD8A 5F27A 3S3OA 4I09A 1R58A 4O3MA 2OCCH 3QOPA 4A0XA 3TOAA 3KYCB 4I0AA 4XLPF 4FISA 4EM1A 1NK3P 1U8RA 1HOMA 1T08B 3GFLA 5FFXA 4D7MA 2TRTA 1VQOI 2XPUA 4YG2F 5LFAA 3O9XA 2VJIA 4DBQA 2B7EA 3EETA 2NS8A 5EF6A 4FT8A 5CJ9A 2DDBA 3S17J 1EH7A 1SD7A 2QCOA 1Z3YA 2STTA 3BDDA 1G3YA 2WY8Q 3HOXJ 4BJTA 3JSOA 5LEKA 2LYRA 2UV1A 5FKMA 4HQEA 1ZR2A 2BOLA 1ZPQA 2ADUA 1JFTA 4KMFA 1B9MA 1WH7A 4E7KA 2F2EA 2A6EF 4LIVA 1ZZBA 2R7VA 5F1JA 1IGNA 4MQVA 1R22A 2HWVA 4BXFA 3HRUA 2JPBA 1PUFB 1QA6A 2P4WA 3KYDB 3SFZA 4RAZA 2PXTA 3SFIA 2VE9A 5EDNA 1D0YA 5KAIC 5DTRA 2KEIA 3F0CA 1PERL 3HB9A 5EZHA 2BXZA 2NNNA 2Y31A 1AKHA 4RB2C 2ELJA 1I6XA 2V1DA 3BT9A 4UUSA 3EUKL 3CP2A 1HKTA 3RCOA 3BWGA 4EJVA 3GUDA 5F64A 5EG0A 3ABTA 3RZDJ 4RMNA 3AKZA 1N77A 1MBFA 2WC2A 4R79A 1RZSA 1Z77A 5CVIA 3W6KB 5J8FA 1WCMJ 3FXOA 2VXZA 1MBJA 3JCUC 1LDJA 4QLCU 2XASA 2LY1A 5JVTA 1TNSA 1IF1A 2JSCA 3ISPA 3TO7A 2JN6A 3EDPA 4FASD 2JRMA 4D9JA 2ME0A 2GIZA 4RS8A 5DM7F 2K9MA 3TMOA 2XIGA 2M8GX 4A3DJ 2R7UA 2OTLI 3W2VA 1IJWC 1VI0A 2LKSA 4LG0A 2MXDA 4L9NA 4X4FA 3G2BA 5J4YA 1JH9A 2R7DA 1MH3A 3IC7A 1VNDA 4Y17A 1MSFC 4IXAA 1QPZA 3WGIA 1Y9QA 3S14J 1X1DA 2DQRA 1W36C 3CCSI 2PG4A 1RNLA 1WH6A 3HJEA 4I7HA 4DE9A 2NS7A 3GZ6A 2VXDA 2HCSA 4R1HA 3FXKA 1WQ2A 4CZCA 2UUZA 3OYLA 1U2ZA 4C3JJ 1HKQA 3L7WA 1QO0D 1APLC 2HVQA 4EJOA 1Z0XA 2XGXA 1NH3A 5FGMA 3LSGA 2F6CA 3QPLA 3JAMK 3B6AA 3HPGA 4NDLA 2CO5A 2FNAA 5C3EJ 1K4TA 1AHDP 4ZYEA 1XDUA 4ZDPA 2BE5F 2QENA 3FMQA 1N25A 1RR7A 2ID6A 4NQWA 3ZMDA 1D0ZA 2CUFA 3SCHA 1T95A 3GMEA 4PU8A 1KU9A 1S7EA 1HCRA 1IRXA 4M9ZA 1QVUA 3VPRA 1QU3A 2IGKA 1MMDA 1ON1A 1UFMA 3OS2A 3KZZA 2YSRA 3NWTA 1TL8A 4A3MJ 1DGRM 2BBYA 5DCFA 4OMZA 4ZYDA 4JBAA 3ZMTA 3RZOJ 2I10A 1HXDA 1FWZA 2OQRA 1UMQA
chains in the Genus database with same CATH topology
3BTCA 1H88C 3OQMA 1WI3A 3OIOA 1ZKGA 5FKOA 3JRCA 1U9NA 4J1XA 1L1MA 1Y1VJ 1XG1A 4JYKA 1ETQA 3IV5A 2XCJA 2HXIA 2XPVA 4JX5A 2OPTA 4C2MJ 2AWIA 1DU0A 2DA6A 4W1UA 2BJCA 1VPWA 1HDDC 1ZR4A 3LSJA 5GP9A 4ABZA 4DYQA 2A6CA 2OR1L 3JRAA 2COBA 2CQXA 3MVPA 5E3OA 4DYRA 3FIWA 3RQIA 2AO9A 4A3IJ 2E2JJ 1XC5A 5FLVA 1RZRA 4D5FA 2YU9J 1RPWA 2DA2A 4MFEA 1CQTA 2LCVA 1TWGJ 4Z59A 2ME6A 2HI3A 2TCTA 2XGCA 2CRGA 2LD5A 2O7OA 2Y30A 1IG7A 1X2MA 2MG4A 4A3LJ 1LCDA 1QP0A 3ZQFA 3M4OJ 1K61A 2OF7A 2HSGA 2FJRA 1ZZ7A 4F8DA 2E2IJ 2GBYA 1X2NA 4FBIA 5J1UA 5JLWA 1ORKA 3C2BA 3JRGA 4JX4A 1OSLA 1Y1WJ 3GTMJ 4RDUA 1QP4A 2E19A 5IP7J 3HM5A 4X4GA 2DMPA 4X4HA 3FKIJ 3JRDA 1O4XA 1T56A 2LTPA 4A3JJ 2E1OA 4BXXJ 1RKTA 5M3FJ 3GTGJ 2DA7A 2HOSA 3S16J 2XGEA 2GRLA 3BD1A 3LISA 3VK0A 1ETYA 3NAUA 2O9LA 1B0NA 1RZRD 1LE8B 1X57A 5M3MJ 3BS3A 1U8BA 1YSEA 1WIZA 1JJ6C 5JLXA 2GM4A 3DCFA 1JKPC 2ICTA 4M6VA 2NVQJ 1HDPA 2H8RA 4I76A 3Q0UA 5K7HA 4I6UA 2KEJA 1TWCJ 2HYJA 2DA3A 3CROL 4M3BA 5EGOA 3OSFA 3G5GA 3GTJJ 2NVYJ 2L7MP 4IHVA 2H1KA 2Y9ZA 3I4MJ 3FISA 3K7AJ 5FKLA 2R5YA 1GVDA 1U78A 1ZQ3P 4AC0A 1MH4A 3CMYA 3UKGA 4YG4A 4IEJA 1MNMC 1VF9A 3WHBA 3M3YJ 2DA5A 2XB0X 3FMYA 3H0GJ 1SANA 2K9QA 3ZQIA 5IPAA 3BTLA 3OSGA 2L49A 5K7FA 2X9DA 2XJ3A 3PO2J 4Z5DA 1JJ8C 3BG9A 3BR2A 3LOCA 2KEKA 1GV2A 5F0HA 3ZKCA 4XRSG 1HLVA 2R92J 4QTRA 2LK2A 3BQZA 5M5YJ 2X48A 1F43A 1QQBA 5EZGA 2EQRA 3RZZA 2JA8J 1W0TA 2XPWA 3JRHA 4J19A 2P81A 2VPRA 4MLOA 1D5YA 1P7IA 4FN3A 1ETOA 3IH4A 4M3FA 4I8TA 1MBHA 2ELKA 4Z5HA 3JRFA 3CCYA 5E3LA 2AW6A 3LSRA 4DW6A 3GTOJ 3HOZJ 1DW9A 2DMNA 2DN0A 1R9TJ 3S8QA 3HOUJ 2JK3A 5GPAA 2Y2ZA 3QPSA 4I6ZA 2ICPA 2KPJA 1ZTRA 3IVPA 4J1WA 1B8IA 2D5VA 2AXUA 4MCXA 3PM1A 3BTJA 3GTLJ 3BTIA 3KXAA 2MW8A 5BNGA 2E2HJ 3PO3J 1POUA 4IHWA 2LP0A 4A3CJ 3KZ3A 3CECA 1MSEC 2G0EA 3TP0A 3GTKJ 1JUMA 4BY1J 1OJLA 1QVTA 1U9OA 2IAIA 2JVLA 3JREA 4I6TA 2MSYA 2JA7J 3QQAA 1PRUA 1R69A 2MGQA 2FJ1A 1G2HA 1IDYA 1X2LA 4YBAA 2N8GA 2EBYA 4PU4C 5C44J 2L7FP 5HODA 4MO7A 1PRVA 1PRAA 4Z58A 2HINA 5EGOB 1PUFA 2EZHA 2CUEA 3S15J 3JR9A 1JKRC 2LYPA 4B1RA 2EZLA 3JXDL 1EFAA 3W6VA 5EEAA 3HEFA 2DMUA 2EF8A 4A3EJ 1BL0A 2VKEA 4Z5CA 4JQDA 3E7LA 5IYCJ 3RKQA 4Y52J 2LYLA 3F6WA 3JRIA 3Q3SA 3ZOBA 4A3KJ 4YARA 1SFOJ 1GV5A 3OP9A 3DEWA 2ECBA 4D7NA 1A6IA 3R1FA 3HBLA 3NARA 4A93J 5F08A 3TW6A 2IVGA 2M2EA 3PXPA 4CYCB 4S0HB 3SCFA 3UFDA 4XK4A 1ETVA 3BG5A 3BR0A 4AUXA 2WB1N 3A01B 3L1PA 2HXOA 3WHCA 2JCGA 2JA6J 2M0CA 2PIJA 4A69C 1TC3C 3F52A 3LNQA 3LFPA 4MCTA 4QSHA 3SJMA 2DMTA 2CQQA 5EG0B 2BNMA 2EWTA 2NVXJ 3HDDA 2JWTA 1TWAJ 3FK7A 3SDGA 3K2AA 1WH5A 2XGDA 1BJZA 5M5WJ 5IYDJ 3TEDA 3A01A 2LYKA 4PU3C 1GDTA 4XIDA 2GLOA 1IUFA 4XRSA 1UXCA 5EYRA 1NERA 3G1OA 1OCTC 2CSFA 3QYXA 3S2HJ 4UUSB 1UXDA 2M34A 3ZHIA 3HOVJ 4X4EA 4G12A 4C3IJ 5FLMJ 2IVBA 4Y7NJ 4LOCA 1IC8A 4I6RA 1RKWA 2ECCA 2L8NA 2IU7A 5FKNA 2WAQN 1ETXA 4MIMA 3TW7A 1I6HJ 1CJGA 3OQOA 3BQYA 2QF7A 2MQKA 3JXCL 2XSDC 4JCYA 4X4BA 1Q1VA 5K7ZA 4FTHA 5E3NA 3QQ6A 3BG3A 2K9NA 1A5JA 2XI8A 2IUOA 1TWFJ 1LLIA 3GTQJ 1JGGA 1OCPA 4X1EA 4HNVA 3S1RJ 2B5AA 2XB5A 3GN5A 1OFCX 1UG2A 1NTCA 1FTTA 3HKZN 1MBKA 2YUSA 5E3MA 2L0KA 4GHJA 2EH3A 4M3EA 1NEQA 2JA5J 3ZQCA 3BR6A 2PUFA 3GTPJ 2KT0A 1AKHB 2HOTA 3OMTA 1MBEA 2LYQA 4X4CA 3ZQLA 4FE4A 5FKKA 1H89C 5A7LA 2EZIA 3S2DJ 2DA4A 9ANTA 1PNRA 3F51A 1FJLA 2XIUA 1LFBA 2LVSA 1ENHA 2RAEA 1RESA 2LFBA 3GN5B 4M3GA 3D1NI 3JRBA 2B63J 2O8KA 4NDWA 4O8BA 1ETWA 1ITYA 1B72B 1B8IB 4GFBA 3QWGA 1ZVVA 2FQ4A 2LLKA 2R0QC 2VKVA 4IHXA 2R5ZB 2LYSA 3ZQHA 5K98B 2PE5A 1ZAYA 5IOYA 3S1QJ 4EEFG 4B4CA 4X6AJ 2IV1A 1ETKA 3HOYJ 1EF4A 4A3BJ 2XRLA 4V2GA 2BNOA 2LYJA 2HOAA 5F0CA 1WGXA 1E3OC 1LQCA 1BW5A 1JFSA 3SCGA 1DU6A 1ZZCA 2R63A 2WIUB 2IVQA 4OB4A 3CQZJ 4MFDA 3IH3A 4A3FJ 1YRNB 2PPXA 5GPCA 2MEZA 1ZUGA 1XS9A 2HQ5A 4IHYA 2PUDA 2CU7A 1T33A 1FEXA 3MN2A 3LSPA 3EUSA 3OOUA 1QPIA 1QRYA 1QP7A 1JWLA 3GBGA 3CLCA 5J3LA 1GT0C 1B72A 1IDZA 3U3WA 2PUCA 4BBSJ 2OFYA 5F27A 2O49A 2ID3A 3G7DA 5F04A 1FIAA 3I4NJ 2Y0SN 2PUBA 1JTXA 4IWRA 1F36A 1UTXA 2ZB9A 4FISA 3ZHMA 1POGA 3MLFA 4IVZA 2Y9YA 1NK3P 2DA1A 3FYMA 1H8AC 1W0UA 2R1JL 1HOMA 4D7MA 2KDZA 3S1MJ 3S1NJ 2TRTA 3Q0WA 2XPUA 3HGYA 3O9XA 2W48A 5IP9J 1HF0A 1BDHA 4C3HJ 3HOWJ 1SQ8A 1XWRA 1I50J 2DJNA 2NS8A 5J1YA 5EF6A 1X58A 1ZZ6A 2GRMA 2LKXA 3TP3A 4JCXA 2X6OA 3S17J 2JJ7A 2QCOA 2CJJA 5FJ8J 4YG7B 3HOXJ 1JT0A 2R5ZA 4JX6A 1ZR2A 5FKMA 2BNNA 2LYRA 5M5XJ 1JTYA 2VUMJ 1ZPQA 1WPKA 1JFTA 2K40A 4BY7J 1WH7A 4L5EA 4XICA 2PUEA 4B3AA 1TWHJ 1JKOC 1ZZBA 5F1JA 3H3VK 1ZGWA 1IGNA 4JP0A 3HGGA 2NVTJ 1PUFB 4PU7A 2PUAA 3BR5A 3SFIA 1LCCA 3ZQGA 5EDNA 2KEIA 3F0CA 1PERL 3G1LA 4IA8A 3HB9A 5EZHA 2YS9A 3A03A 1BW6A 2Y31A 4V2FA 4DZPA 1AKHA 2O4AA 2VI6A 3O8GA 2GZUA 4DYCA 3BT9A 3JXBC 1LMB3 4UUSA 3B6CA 1ZZ8A 3HZIB 3IH2A 3H5TA 1ZZ9A 1BDIA 2PUGA 1ADRA 3Q0VA 5EG0A 3RZDJ 1LFUP 4UUTA 1MBFA 3TRBA 2PMZN 2L9RA 5DTDA 1Z77A 1RZSA 1WCMJ 2DTZA 1NK2P 1MBJA 4DZJA 2EBIA 3CDLA 1FIPA 4Y42A 1ZS4A 1RETA 4D5CA 3BDNA 2KZ8A 1I3QJ 2M9HA 2O38A 2JN6A 2DMQA 2JMWA 1MBGA 2ME0A 1YRNA 1QQAA 2LR8A 4A3DJ 2M8GX 1JKQC 4CYCA 1UHSA 1IJWC 1JUSA 3OQNA 5J1RA 1VI0A 3FK6A 4X4FA 1JH9A 2FD5A 2R93J 1MH3A 1IV6A 2K9SA 3A02A 1VNDA 2AXVA 1MSFC 5IYBJ 5C4JJ 1Y9QA 1QPZA 3BR3A 3S14J 1LE8A 2R7ZJ 1GUUA 5DS9A 4RBOA 1WH6A 4W97A 2CROA 1VFCA 4X4DA 1K83J 2NS7A 2WUSR 2AUWA 2AHQA 2WV1A 1WH8A 1WETA 4C3JJ 3FYAA 1APLC 1R63A 3KJXA 5F0FA 1Z0XA 1JT6A 5IP6A 3LSGA 3DNVB 3QPLA 3O8HA 4M3DA 3B6AA 4NDLA 5C3EJ 1AHDP 4FCYA 4QIWN 2R5YB 4FE7A 2IBDA 2FX0A 2HDDA 4A3GJ 1DWKA 3B7HA 5C4XJ 4YG1A 3MKLA 2EZKA 1RR7A 2ID6A 3GBFA 1RPEL 2CUFA 3SCHA 4PU8A 1S7EA 1HCRA 4AYBN 4XRMA 3G1MA 1QVUA 2LY9A 1FTZA 3VPRA 3QF3A 4GQMA 1BA5A 4BBRJ 2NOGA 2AXZA 4BKXA 2L7ZA 1ZK8A 1AU7A 1Y7YA 4A3MJ 5IOZA 2IEKA 1IRZA 3RZOJ 1RIOA 2I10A 1JUPA 1P7JA 1UMQA 3BR1A 4X4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BTC A;  1H88 C;  3OQM A;  1WI3 A;  3OIO A;  1ZKG A;  5FKO A;  3JRC A;  1U9N A;  4J1X A;  1L1M A;  1Y1V J;  1XG1 A;  4JYK A;  1ETQ A;  3IV5 A;  2XCJ A;  2HXI A;  2XPV A;  4JX5 A;  2OPT A;  4C2M J;  2AWI A;  1DU0 A;  2DA6 A;  4W1U A;  2BJC A;  1VPW A;  1HDD C;  1ZR4 A;  3LSJ A;  5GP9 A;  4ABZ A;  4DYQ A;  2A6C A;  2OR1 L;  3JRA A;  2COB A;  2CQX A;  3MVP A;  5E3O A;  4DYR A;  3FIW A;  3RQI A;  2AO9 A;  4A3I J;  2E2J J;  1XC5 A;  5FLV A;  1RZR A;  4D5F A;  2YU9 J;  1RPW A;  2DA2 A;  4MFE A;  1CQT A;  2LCV A;  1TWG J;  4Z59 A;  2ME6 A;  2HI3 A;  2TCT A;  2XGC A;  2CRG A;  2LD5 A;  2O7O A;  2Y30 A;  1IG7 A;  1X2M A;  2MG4 A;  4A3L J;  1LCD A;  1QP0 A;  3ZQF A;  3M4O J;  1K61 A;  2OF7 A;  2HSG A;  2FJR A;  1ZZ7 A;  4F8D A;  2E2I J;  2GBY A;  1X2N A;  4FBI A;  5J1U A;  5JLW A;  1ORK A;  3C2B A;  3JRG A;  4JX4 A;  1OSL A;  1Y1W J;  3GTM J;  4RDU A;  1QP4 A;  2E19 A;  5IP7 J;  3HM5 A;  4X4G A;  2DMP A;  4X4H A;  3FKI J;  3JRD A;  1O4X A;  1T56 A;  2LTP A;  4A3J J;  2E1O A;  4BXX J;  1RKT A;  5M3F J;  3GTG J;  2DA7 A;  2HOS A;  3S16 J;  2XGE A;  2GRL A;  3BD1 A;  3LIS A;  3VK0 A;  1ETY A;  3NAU A;  2O9L A;  1B0N A;  1RZR D;  1LE8 B;  1X57 A;  5M3M J;  3BS3 A;  1U8B A;  1YSE A;  1WIZ A;  1JJ6 C;  5JLX A;  2GM4 A;  3DCF A;  1JKP C;  2ICT A;  4M6V A;  2NVQ J;  1HDP A;  2H8R A;  4I76 A;  3Q0U A;  5K7H A;  4I6U A;  2KEJ A;  1TWC J;  2HYJ A;  2DA3 A;  3CRO L;  4M3B A;  5EGO A;  3OSF A;  3G5G A;  3GTJ J;  2NVY J;  2L7M P;  4IHV A;  2H1K A;  2Y9Z A;  3I4M J;  3FIS A;  3K7A J;  5FKL A;  2R5Y A;  1GVD A;  1U78 A;  1ZQ3 P;  4AC0 A;  1MH4 A;  3CMY A;  3UKG A;  4YG4 A;  4IEJ A;  1MNM C;  1VF9 A;  3WHB A;  3M3Y J;  2DA5 A;  2XB0 X;  3FMY A;  3H0G J;  1SAN A;  2K9Q A;  3ZQI A;  5IPA A;  3BTL A;  3OSG A;  2L49 A;  5K7F A;  2X9D A;  2XJ3 A;  3PO2 J;  4Z5D A;  1JJ8 C;  3BG9 A;  3BR2 A;  3LOC A;  2KEK A;  1GV2 A;  5F0H A;  3ZKC A;  4XRS G;  1HLV A;  2R92 J;  4QTR A;  2LK2 A;  3BQZ A;  5M5Y J;  2X48 A;  1F43 A;  1QQB A;  5EZG A;  2EQR A;  3RZZ A;  2JA8 J;  1W0T A;  2XPW A;  3JRH A;  4J19 A;  2P81 A;  2VPR A;  4MLO A;  1D5Y A;  1P7I A;  4FN3 A;  1ETO A;  3IH4 A;  4M3F A;  4I8T A;  1MBH A;  2ELK A;  4Z5H A;  3JRF A;  3CCY A;  5E3L A;  2AW6 A;  3LSR A;  4DW6 A;  3GTO J;  3HOZ J;  1DW9 A;  2DMN A;  2DN0 A;  1R9T J;  3S8Q A;  3HOU J;  2JK3 A;  5GPA A;  2Y2Z A;  3QPS A;  4I6Z A;  2ICP A;  2KPJ A;  1ZTR A;  3IVP A;  4J1W A;  1B8I A;  2D5V A;  2AXU A;  4MCX A;  3PM1 A;  3BTJ A;  3GTL J;  3BTI A;  3KXA A;  2MW8 A;  5BNG A;  2E2H J;  3PO3 J;  1POU A;  4IHW A;  2LP0 A;  4A3C J;  3KZ3 A;  3CEC A;  1MSE C;  2G0E A;  3TP0 A;  3GTK J;  1JUM A;  4BY1 J;  1OJL A;  1QVT A;  1U9O A;  2IAI A;  2JVL A;  3JRE A;  4I6T A;  2MSY A;  2JA7 J;  3QQA A;  1PRU A;  1R69 A;  2MGQ A;  2FJ1 A;  1G2H A;  1IDY A;  1X2L A;  4YBA A;  2N8G A;  2EBY A;  4PU4 C;  5C44 J;  2L7F P;  5HOD A;  4MO7 A;  1PRV A;  1PRA A;  4Z58 A;  2HIN A;  5EGO B;  1PUF A;  2EZH A;  2CUE A;  3S15 J;  3JR9 A;  1JKR C;  2LYP A;  4B1R A;  2EZL A;  3JXD L;  1EFA A;  3W6V A;  5EEA A;  3HEF A;  2DMU A;  2EF8 A;  4A3E J;  1BL0 A;  2VKE A;  4Z5C A;  4JQD A;  3E7L A;  5IYC J;  3RKQ A;  4Y52 J;  2LYL A;  3F6W A;  3JRI A;  3Q3S A;  3ZOB A;  4A3K J;  4YAR A;  1SFO J;  1GV5 A;  3OP9 A;  3DEW A;  2ECB A;  4D7N A;  1A6I A;  3R1F A;  3HBL A;  3NAR A;  4A93 J;  5F08 A;  3TW6 A;  2IVG A;  2M2E A;  3PXP A;  4CYC B;  4S0H B;  3SCF A;  3UFD A;  4XK4 A;  1ETV A;  3BG5 A;  3BR0 A;  4AUX A;  2WB1 N;  3A01 B;  3L1P A;  2HXO A;  3WHC A;  2JCG A;  2JA6 J;  2M0C A;  2PIJ A;  4A69 C;  1TC3 C;  3F52 A;  3LNQ A;  3LFP A;  4MCT A;  4QSH A;  3SJM A;  2DMT A;  2CQQ A;  5EG0 B;  2BNM A;  2EWT A;  2NVX J;  3HDD A;  2JWT A;  1TWA J;  3FK7 A;  3SDG A;  3K2A A;  1WH5 A;  2XGD A;  1BJZ A;  5M5W J;  5IYD J;  3TED A;  3A01 A;  2LYK A;  4PU3 C;  1GDT A;  4XID A;  2GLO A;  1IUF A;  4XRS A;  1UXC A;  5EYR A;  1NER A;  3G1O A;  1OCT C;  2CSF A;  3QYX A;  3S2H J;  4UUS B;  1UXD A;  2M34 A;  3ZHI A;  3HOV J;  4X4E A;  4G12 A;  4C3I J;  5FLM J;  2IVB A;  4Y7N J;  4LOC A;  1IC8 A;  4I6R A;  1RKW A;  2ECC A;  2L8N A;  2IU7 A;  5FKN A;  2WAQ N;  1ETX A;  4MIM A;  3TW7 A;  1I6H J;  1CJG A;  3OQO A;  3BQY A;  2QF7 A;  2MQK A;  3JXC L;  2XSD C;  4JCY A;  4X4B A;  1Q1V A;  5K7Z A;  4FTH A;  5E3N A;  3QQ6 A;  3BG3 A;  2K9N A;  1A5J A;  2XI8 A;  2IUO A;  1TWF J;  1LLI A;  3GTQ J;  1JGG A;  1OCP A;  4X1E A;  4HNV A;  3S1R J;  2B5A A;  2XB5 A;  3GN5 A;  1OFC X;  1UG2 A;  1NTC A;  1FTT A;  3HKZ N;  1MBK A;  2YUS A;  5E3M A;  2L0K A;  4GHJ A;  2EH3 A;  4M3E A;  1NEQ A;  2JA5 J;  3ZQC A;  3BR6 A;  2PUF A;  3GTP J;  2KT0 A;  1AKH B;  2HOT A;  3OMT A;  1MBE A;  2LYQ A;  4X4C A;  3ZQL A;  4FE4 A;  5FKK A;  1H89 C;  5A7L A;  2EZI A;  3S2D J;  2DA4 A;  9ANT A;  1PNR A;  3F51 A;  1FJL A;  2XIU A;  1LFB A;  2LVS A;  1ENH A;  2RAE A;  1RES A;  2LFB A;  3GN5 B;  4M3G A;  3D1N I;  3JRB A;  2B63 J;  2O8K A;  4NDW A;  4O8B A;  1ETW A;  1ITY A;  1B72 B;  1B8I B;  4GFB A;  3QWG A;  1ZVV A;  2FQ4 A;  2LLK A;  2R0Q C;  2VKV A;  4IHX A;  2R5Z B;  2LYS A;  3ZQH A;  5K98 B;  2PE5 A;  1ZAY A;  5IOY A;  3S1Q J;  4EEF G;  4B4C A;  4X6A J;  2IV1 A;  1ETK A;  3HOY J;  1EF4 A;  4A3B J;  2XRL A;  4V2G A;  2BNO A;  2LYJ A;  2HOA A;  5F0C A;  1WGX A;  1E3O C;  1LQC A;  1BW5 A;  1JFS A;  3SCG A;  1DU6 A;  1ZZC A;  2R63 A;  2WIU B;  2IVQ A;  4OB4 A;  3CQZ J;  4MFD A;  3IH3 A;  4A3F J;  1YRN B;  2PPX A;  5GPC A;  2MEZ A;  1ZUG A;  1XS9 A;  2HQ5 A;  4IHY A;  2PUD A;  2CU7 A;  1T33 A;  1FEX A;  3MN2 A;  3LSP A;  3EUS A;  3OOU A;  1QPI A;  1QRY A;  1QP7 A;  1JWL A;  3GBG A;  3CLC A;  5J3L A;  1GT0 C;  1B72 A;  1IDZ A;  3U3W A;  2PUC A;  4BBS J;  2OFY A;  5F27 A;  2O49 A;  2ID3 A;  3G7D A;  5F04 A;  1FIA A;  3I4N J;  2Y0S N;  2PUB A;  1JTX A;  4IWR A;  1F36 A;  1UTX A;  2ZB9 A;  4FIS A;  3ZHM A;  1POG A;  3MLF A;  4IVZ A;  2Y9Y A;  1NK3 P;  2DA1 A;  3FYM A;  1H8A C;  1W0U A;  2R1J L;  1HOM A;  4D7M A;  2KDZ A;  3S1M J;  3S1N J;  2TRT A;  3Q0W A;  2XPU A;  3HGY A;  3O9X A;  2W48 A;  5IP9 J;  1HF0 A;  1BDH A;  4C3H J;  3HOW J;  1SQ8 A;  1XWR A;  1I50 J;  2DJN A;  2NS8 A;  5J1Y A;  5EF6 A;  1X58 A;  1ZZ6 A;  2GRM A;  2LKX A;  3TP3 A;  4JCX A;  2X6O A;  3S17 J;  2JJ7 A;  2QCO A;  2CJJ A;  5FJ8 J;  4YG7 B;  3HOX J;  1JT0 A;  2R5Z A;  4JX6 A;  1ZR2 A;  5FKM A;  2BNN A;  2LYR A;  5M5X J;  1JTY A;  2VUM J;  1ZPQ A;  1WPK A;  1JFT A;  2K40 A;  4BY7 J;  1WH7 A;  4L5E A;  4XIC A;  2PUE A;  4B3A A;  1TWH J;  1JKO C;  1ZZB A;  5F1J A;  3H3V K;  1ZGW A;  1IGN A;  4JP0 A;  3HGG A;  2NVT J;  1PUF B;  4PU7 A;  2PUA A;  3BR5 A;  3SFI A;  1LCC A;  3ZQG A;  5EDN A;  2KEI A;  3F0C A;  1PER L;  3G1L A;  4IA8 A;  3HB9 A;  5EZH A;  2YS9 A;  3A03 A;  1BW6 A;  2Y31 A;  4V2F A;  4DZP A;  1AKH A;  2O4A A;  2VI6 A;  3O8G A;  2GZU A;  4DYC A;  3BT9 A;  3JXB C;  1LMB 3;  4UUS A;  3B6C A;  1ZZ8 A;  3HZI B;  3IH2 A;  3H5T A;  1ZZ9 A;  1BDI A;  2PUG A;  1ADR A;  3Q0V A;  5EG0 A;  3RZD J;  1LFU P;  4UUT A;  1MBF A;  3TRB A;  2PMZ N;  2L9R A;  5DTD A;  1Z77 A;  1RZS A;  1WCM J;  2DTZ A;  1NK2 P;  1MBJ A;  4DZJ A;  2EBI A;  3CDL A;  1FIP A;  4Y42 A;  1ZS4 A;  1RET A;  4D5C A;  3BDN A;  2KZ8 A;  1I3Q J;  2M9H A;  2O38 A;  2JN6 A;  2DMQ A;  2JMW A;  1MBG A;  2ME0 A;  1YRN A;  1QQA A;  2LR8 A;  4A3D J;  2M8G X;  1JKQ C;  4CYC A;  1UHS A;  1IJW C;  1JUS A;  3OQN A;  5J1R A;  1VI0 A;  3FK6 A;  4X4F A;  1JH9 A;  2FD5 A;  2R93 J;  1MH3 A;  1IV6 A;  2K9S A;  3A02 A;  1VND A;  2AXV A;  1MSF C;  5IYB J;  5C4J J;  1Y9Q A;  1QPZ A;  3BR3 A;  3S14 J;  1LE8 A;  2R7Z J;  1GUU A;  5DS9 A;  4RBO A;  1WH6 A;  4W97 A;  2CRO A;  1VFC A;  4X4D A;  1K83 J;  2NS7 A;  2WUS R;  2AUW A;  2AHQ A;  2WV1 A;  1WH8 A;  1WET A;  4C3J J;  3FYA A;  1APL C;  1R63 A;  3KJX A;  5F0F A;  1Z0X A;  1JT6 A;  5IP6 A;  3LSG A;  3DNV B;  3QPL A;  3O8H A;  4M3D A;  3B6A A;  4NDL A;  5C3E J;  1AHD P;  4FCY A;  4QIW N;  2R5Y B;  4FE7 A;  2IBD A;  2FX0 A;  2HDD A;  4A3G J;  1DWK A;  3B7H A;  5C4X J;  4YG1 A;  3MKL A;  2EZK A;  1RR7 A;  2ID6 A;  3GBF A;  1RPE L;  2CUF A;  3SCH A;  4PU8 A;  1S7E A;  1HCR A;  4AYB N;  4XRM A;  3G1M A;  1QVU A;  2LY9 A;  1FTZ A;  3VPR A;  3QF3 A;  4GQM A;  1BA5 A;  4BBR J;  2NOG A;  2AXZ A;  4BKX A;  2L7Z A;  1ZK8 A;  1AU7 A;  1Y7Y A;  4A3M J;  5IOZ A;  2IEK A;  1IRZ A;  3RZO J;  1RIO A;  2I10 A;  1JUP A;  1P7J A;  1UMQ A;  3BR1 A;  4X4I A; 
#chains in the Genus database with same CATH topology
 3BTC A;  3CO7 C;  2HYF A;  4YFN F;  1KA8 A;  1ZKG A;  3DKY A;  3ABK H;  1MMN A;  1Y1V J;  2YX7 A;  4P55 A;  2CW0 F;  1ETQ A;  3IV5 A;  1ZGJ A;  1OIS A;  1DU0 A;  2DA6 A;  4W1U A;  3B02 A;  1YIJ I;  1G59 A;  3F9K A;  1OQY A;  2CQX A;  3H9G A;  4IF4 A;  4N0B A;  3RQI A;  1SVL A;  2AO9 A;  2IVM A;  2OZ6 A;  3K4K A;  5DTQ A;  4D5F A;  2JT1 A;  4PGH A;  1G3W A;  3E5U A;  4MFE A;  3QPT A;  3M07 A;  2QQB A;  1OCC H;  5DD4 A;  4ZTF A;  1SAX A;  4WXC A;  1EA3 A;  5AON A;  3HRM A;  3OYG A;  4J00 A;  1WSU A;  2MG4 A;  4PSW A;  2DJI A;  4GGG A;  3W6J B;  2NAZ A;  1J9I A;  2HGC A;  3BG7 A;  2LRD A;  4RB1 A;  3WTW C;  1TBX A;  4IRI A;  4FBI A;  4YEJ A;  2J7U A;  1Y1W J;  2R7W A;  4YEL A;  1KZH A;  4RDU A;  5FLX Z;  1QP4 A;  2XRN A;  3I3L A;  1X3W B;  2DMP A;  3FKI J;  2LTP A;  3BP8 A;  4A3J J;  2E1O A;  3GTG J;  1WI9 A;  3S16 J;  2R7X A;  3KP7 A;  2O9L A;  1RZR D;  4FQG A;  1R1U A;  2WAQ A;  5L3F A;  1U8B A;  4NQW B;  4NC6 A;  5JLX A;  2ICT A;  1XDS A;  1FMV A;  1IAW A;  4RB3 C;  3G73 A;  4KIC A;  3CRO L;  4HSR A;  3K4M A;  2V79 A;  2O0Y A;  5GTH C;  3GTJ J;  4AID A;  3P5J A;  2L7M P;  4G9Y A;  4ENN A;  2Y9Z A;  2R7Q A;  2PXB A;  4YIR X;  3OYN A;  1QQI A;  3CJT B;  1QZZ A;  5E1W A;  1MH4 A;  1YX5 A;  1T0F C;  3UKG A;  2VEO A;  4YG4 A;  1MNM C;  2ZSI B;  1VQM I;  4L18 B;  3ZMV A;  3M3Y J;  1X1C A;  1BBY A;  2WAF A;  3ECO A;  2FFH A;  5DRY A;  2WBM A;  3OSG A;  5IPA A;  1W5S A;  5K7F A;  1STZ A;  4ON0 A;  3HZJ A;  1JJ8 C;  3H9Q A;  2JA2 A;  1FSH A;  4NNJ A;  1MDM A;  3GUU A;  2M30 A;  4I98 B;  2EIL H;  3ELK A;  3B73 A;  3V4G A;  3ZKC A;  5F0H A;  3CJN A;  4LG0 B;  2CH0 A;  3KYL A;  2LH9 A;  2XAU A;  5M5Y J;  4Y3O A;  4IHS A;  1T6S A;  1R71 A;  1W0T A;  1FYM A;  2XPW A;  1ULY A;  2JA8 J;  1LDD A;  2XKO A;  1PP8 F;  3E1S A;  2AQE A;  3CES A;  4DOZ A;  2ESN A;  1JHF A;  5L3B A;  1MMS A;  4NB5 A;  4FX4 A;  3IH4 A;  1O3Q A;  2IGM A;  1MBH A;  2ELK A;  2Y75 A;  1ZG3 A;  3JRF A;  1YW9 A;  2E7X A;  3KP4 A;  3LSR A;  3K70 C;  3HOZ J;  2DMN A;  5AIQ A;  1W5T A;  3S8Q A;  5LLQ A;  2DFI A;  2VBY A;  3ABL H;  3OR1 C;  1WWX A;  2L9S A;  2EFO A;  3OV8 A;  1OR7 A;  3H3Z A;  4ZZD A;  3CCR I;  3FBN B;  3MKY B;  3LMM A;  3K0L A;  2OUM A;  1QZX A;  4RAF A;  1U6G A;  1IN8 A;  3HOT A;  3BTJ A;  3GTL J;  4OOI A;  3KZI C;  2F5C A;  5BNG A;  2EB7 A;  4BAC A;  2DW4 A;  3J80 K;  3V8L A;  1MSE C;  2HNH A;  5KK1 A;  4CIC A;  3GTK J;  2IAI A;  2R3S A;  1J09 A;  2JA7 J;  3QQA A;  1R69 A;  5K5O A;  3I59 B;  4PZJ A;  1B6A A;  1PJR A;  2N8G A;  2DQL A;  2F5D A;  1WJC A;  4UHT A;  5D6F A;  2L7F P;  5C44 J;  1FBU A;  1PRA A;  1MNE A;  4Z58 A;  1PUF A;  1BOA A;  3OYH A;  2FOW A;  1S6L A;  3JR9 A;  5GAH J;  1TT0 A;  2O3F A;  1HBX G;  1SMY F;  2PI0 A;  1SMT A;  2QVO A;  3OL3 A;  3ZCO A;  4G6D A;  4OIQ F;  2YU3 A;  2PXV A;  4A3E J;  1BL0 A;  5DRT A;  5TGT A;  3QWL A;  3SDB A;  4Z5C A;  3F3X A;  1TT5 B;  5IYC J;  3RKQ A;  4Y52 J;  3OL4 A;  3F6W A;  1SFO J;  2BGC A;  1LPQ A;  2BV6 A;  2FU4 A;  2GXG A;  2MFZ A;  3CP8 A;  3V7C A;  4D7N A;  2JQE A;  2P8T A;  5EEG A;  3GFM A;  2KKO A;  5GAE J;  3H1C A;  1SVM A;  1I5Z A;  1FT9 A;  4CYC B;  3JTH A;  5DDG A;  3PFI A;  3M9L A;  1ETV A;  3FZV A;  3BR0 A;  2KZV A;  2RC4 A;  4CA0 A;  3BZ6 A;  2XVC A;  2HXO A;  1ON2 A;  3FXQ A;  2JA6 J;  1TZL A;  2PIJ A;  5BPD A;  4EAT A;  4IRH A;  4QSH A;  5IT9 Z;  2DI3 A;  2MLK A;  1O7L A;  2CQQ A;  2L4A A;  4BE1 A;  3U9G A;  4GCV A;  4BQO A;  4MTD A;  4OMY A;  2X6W A;  3UNG C;  3W3C A;  3K2A A;  2PXD A;  4KA4 A;  1WH5 A;  1UZC A;  3GEZ A;  2EIK H;  4BU2 A;  4X0G A;  3H3U A;  1R4N B;  3QFI A;  3HSR A;  3E0J B;  3WTZ A;  1IUF A;  1GDT A;  5KVR A;  1NER A;  2M0M A;  3S2H J;  3K4L A;  2QKM B;  4HX8 A;  3ZHI A;  4KIB A;  4X4E A;  3KFW X;  1YE9 A;  4HA8 A;  4LOC A;  3A0B C;  3H5A A;  1D1A A;  1T39 A;  1T38 A;  2IU7 A;  2IGO A;  4N9H A;  2BW3 A;  1YS7 A;  2WAQ N;  4Y33 A;  3NDB B;  3RTR A;  2QBY B;  4KDP A;  3RYR A;  2DT6 A;  3JXC L;  4JCY A;  5DM6 F;  1Q1V A;  2WWY A;  3BG3 A;  5EEH A;  1P9Q C;  2LKP A;  2IUO A;  2OAZ A;  1SFE A;  2UXN A;  2XI8 A;  2P0W A;  1ZAO A;  2XKP A;  4X1E A;  2YBD A;  2XRO A;  4UB6 C;  4BH9 A;  1OFC X;  3KP5 A;  4KUM A;  1MBK A;  2L0K A;  3E6D A;  2EH3 A;  4M3E A;  2EIN H;  3BR6 A;  4PJJ A;  5HLG A;  3K1N A;  3GTP J;  3LQX A;  1WVR A;  2E1M B;  4L5I A;  2DO7 A;  4X4C A;  5FKK A;  1XMA A;  2Z3Y A;  3MEJ A;  3OOP A;  5A7L A;  3S2D J;  2DA4 A;  4RA2 A;  2KPM A;  1TQI A;  1FJL A;  3F51 A;  1WJF A;  1LFB A;  1R00 A;  2KP6 A;  3K4C A;  2LFB A;  2X1C A;  1WJA A;  3IRR A;  2VKD A;  5HDN A;  3TEL A;  2O8K A;  3KLN A;  2OC6 A;  1MZB A;  3F6V A;  1X1P A;  2VBX A;  2ZXJ A;  1E3P A;  3CC2 I;  2PFB A;  4L5J A;  2R0Q C;  5LEJ A;  2LYS A;  2R5Z B;  3FXR A;  3G6E I;  5K98 B;  2PE5 A;  5IOY A;  3S1Q J;  4I0B A;  2FRH A;  3MZ8 A;  2H6C A;  1RUO A;  5JFR A;  2H1L A;  1OYI A;  4A0Z A;  1BC7 C;  1EF4 A;  2XRL A;  1L0O C;  2HU9 A;  5F0C A;  1WGX A;  1E3O C;  1LQC A;  4HV6 A;  3DBL B;  1ZG1 A;  1HST A;  3BOQ A;  2V9P A;  1IN5 A;  3TKY A;  5GAG i;  4HDV A;  4Z2Y A;  5IY5 H;  3I56 I;  4A3F J;  4G8X A;  2PPX A;  4EJU A;  2IS2 A;  3TEP A;  3GZN B;  4F52 A;  3I4P A;  2HQ5 A;  3D5S C;  2PUD A;  2DFH A;  1FEX A;  2KDO A;  3LSP A;  1VQ7 I;  3CUQ A;  1I3A A;  2D2W A;  3DXJ F;  4CCN A;  3CLC A;  3U3W A;  4PJN A;  3OS1 A;  3C2H A;  2HCN A;  2QGU A;  2UXX A;  2O49 A;  2ZME B;  2ZXH A;  1FSE A;  2ID3 A;  3DPL C;  2ZME A;  5F04 A;  2Y0S N;  1JTX A;  4IWR A;  1SD4 A;  2XAJ A;  3U1D A;  3G0T A;  4ZJZ A;  2ZB9 A;  3MLF A;  4BHC A;  2Y9Y A;  1H8A C;  3EYI A;  5F6F A;  2EA4 A;  1EH8 A;  1Y0U A;  2W85 A;  3E6B A;  2KDZ A;  3S1M J;  3S1N J;  1KQ8 A;  1ZRF A;  2Z1D A;  2HOE A;  4U88 A;  3S8P A;  3EUH C;  2FMY A;  2W48 A;  3WE3 A;  3QOW A;  4C3H J;  2ZME C;  4BQA A;  5J1Y A;  3OWT A;  3M8F A;  3TP3 A;  2X6O A;  2F48 A;  3RKY A;  4MEY F;  2G7H A;  1TQP A;  3I71 A;  1B59 A;  2H8W A;  4XKB A;  1ZLJ A;  2CJJ A;  2IW5 A;  4ITV A;  4YG7 B;  4HEA 2;  2PXU A;  1YX3 A;  3GFI A;  3KEY A;  2CWE A;  1UHM A;  1JT0 A;  1ZHF A;  1FOK A;  1OMI A;  1JTY A;  1OPC A;  3U2R A;  2K40 A;  2LBF B;  1F5T A;  1QGP A;  2X4H A;  2XSJ C;  3CDH A;  2VE8 A;  3GYH X;  3PE5 A;  3T0Y A;  4JP0 A;  3DP7 A;  4HST A;  3CCL I;  3R4K A;  2NVT J;  2HZD A;  4WX9 A;  2PMU A;  1IZ1 A;  2LC2 A;  2DK5 A;  2PUA A;  2DU9 A;  1U0J A;  3BR5 A;  1LCC A;  3ZQG A;  2BW3 B;  5CYV A;  5JR3 A;  2OJE D;  4L0Y B;  3G1L A;  4IA8 A;  4JQF A;  2A6H F;  2YS9 A;  1BW6 A;  3A03 A;  4V2F A;  4DZP A;  2BVM A;  3QOE A;  2GZU A;  3ABM H;  4ZH4 F;  3P7N A;  3HRS A;  3PSF A;  3FXJ A;  2BYV E;  3DBH B;  3GZD A;  1LFU P;  2AXL A;  3TRB A;  2PMZ N;  4G6T B;  2DTZ A;  3FM5 A;  3H9J A;  2H27 A;  1UAA A;  3QOX A;  1XD7 A;  2KIF A;  2M9H A;  3VB2 A;  4BDZ A;  2O38 A;  2DMQ A;  2JMW A;  4Q47 A;  1P4X A;  1TQM A;  1YRN A;  1P4A A;  5LGU A;  4CYC A;  3K4J A;  3OQN A;  3WGH A;  1Z3X A;  4M9X A;  4EKG A;  1MW7 A;  2XDV A;  3DPT A;  4B43 A;  3EPZ A;  2F4I A;  2CSO A;  3T1B A;  5ED4 A;  4U0Y A;  1IV6 A;  2K9S A;  5E18 F;  1XCB A;  1Z7L A;  4E7Z A;  2AXT C;  1EV7 A;  5C4J J;  3BR3 A;  3V42 A;  3CF5 F;  3ZMU A;  4DE8 A;  1GUU A;  2ZJQ F;  4XOT A;  2L7K A;  2Q8K A;  2QLZ A;  1K83 J;  3GLX A;  2PX9 A;  4BYY A;  2AUW A;  2HFZ A;  1ZLK A;  1C0W A;  3HXL A;  1SEU A;  1WET A;  3WGG A;  4B47 A;  3CCJ I;  3KJX A;  3FM3 A;  4JK1 X;  1RR8 C;  3PJR A;  3E3V A;  3DNV B;  3HL2 A;  2VQL A;  2KRF A;  1S8N A;  3OYD A;  4EM2 A;  5HDK A;  4QIW N;  4I01 A;  2B9S A;  2M4H A;  4HG2 A;  3QYB A;  2DXI A;  4FE7 A;  2B0L A;  2X85 A;  2WTE A;  3HHG A;  3IWF A;  3H36 A;  2K3P A;  4NHJ A;  1BOB A;  2XUB A;  1T8I A;  4AYB N;  2IJL A;  4RM2 A;  4XRM A;  3PIO F;  3BLY A;  1BA5 A;  3NQO A;  4BBR J;  5F1R A;  2NOG A;  4XOP A;  2LYC A;  2RNJ A;  2VIX A;  3WU0 A;  1ZK8 A;  3CJQ B;  3N97 A;  2WAE A;  1AU7 A;  4B48 A;  2IT0 A;  4MTE A;  3KET A;  3F22 A;  1FYL A;  5IOZ A;  1HQC A;  4ESJ A;  2O6G E;  1MFQ C;  2HTS A;  4HW0 A;  1P7J A;  3BR1 A;  4GYG A;  3TO9 A;  2EFN A;  1QB2 A;  5TJJ A;  1WI3 A;  2LOO A;  3CTA A;  1U9N A;  2ZJP F;  1L1M A;  3QP6 A;  5FO5 A;  1XG1 A;  3W2A A;  2J5P A;  1IXR C;  3L2U A;  2XCJ A;  1F9N A;  2BJC A;  2OPT A;  4C2M J;  1VPW A;  2LRE A;  4A6D A;  4XBF A;  4ABZ A;  4DYQ A;  2OR1 L;  3DF8 A;  3RPU D;  3JRA A;  3MVP A;  1LNW A;  2NS0 A;  2OCE A;  4IL6 C;  1L3L A;  2QQ9 A;  2E2J J;  1RPW A;  1LEB A;  1ODD A;  2WA0 A;  3K2Z A;  4E7L A;  2LCV A;  2ME6 A;  2HI3 A;  2K5C A;  2XGC A;  2HS5 A;  2PJR A;  2LD5 A;  2O7O A;  4XKC A;  1OR7 C;  1SVO A;  4A3L J;  4UB8 C;  3ZQF A;  3PFY A;  3M4O J;  5CVR A;  2OF7 A;  3ZQ7 A;  3LA3 A;  5DTM A;  4CDG A;  2CW7 A;  2ACJ A;  3VSK A;  2L3D A;  1X2N A;  2CUZ A;  2KRC A;  4UNO A;  1OSL A;  4JX4 A;  2QKL B;  2VJ5 A;  3VDX A;  2KRH A;  2Z33 A;  3GTM J;  4OU0 A;  1MJB A;  3PNT A;  5IP7 J;  1DDN A;  5D5X B;  1O4X A;  2RN7 A;  5M3F J;  2D1H A;  3FWE A;  3HRT A;  2GRL A;  3E5Q A;  1Z1D A;  3E6C C;  3IAM 2;  1UCR A;  2IXS A;  3GCM A;  4C9Y A;  3PIP F;  2W7N A;  5JVG F;  2MD5 A;  5M3M J;  4BJ6 C;  3FX3 A;  4HOB A;  1RUN A;  1WIZ A;  2ICW G;  5E8I A;  2LDU A;  2GM4 A;  2VOP A;  3DCF A;  3HIF A;  4M6V A;  1HDP A;  2IRF G;  2VAS A;  1UEL B;  2H8R A;  5E1X A;  3V7S A;  2KEJ A;  4IVN A;  2HYJ A;  2DA3 A;  3EUA A;  4F7Z A;  5EGO A;  2KIQ A;  3OSF A;  2W1O A;  2NVY J;  4A5M A;  2H1K A;  3I4M J;  5LGT A;  4F92 B;  1FOX A;  1U78 A;  4H0E A;  1IRF A;  3UR3 C;  2MLG A;  4N4N B;  5FD6 A;  4BQN A;  5K5Q A;  3KEQ A;  4CUG A;  4IEJ A;  2M87 A;  3WHB A;  5J40 A;  3F21 A;  2DA5 A;  2XB0 X;  2DT5 A;  3H0G J;  1SAN A;  2VN2 A;  3SEQ A;  3T8T A;  2ZNZ A;  3ZQI A;  2L49 A;  2NVU B;  1YTY A;  2JVH A;  5EJC A;  2XJ3 A;  3PO2 J;  2VOD A;  4EGZ A;  1O3R A;  2BXY A;  1VQ8 I;  2R4G A;  1HLV A;  1DPU A;  1FY7 A;  2Y0M A;  4UXN A;  4KMU X;  1NW3 A;  1XSD A;  2D1V A;  2FE3 A;  2COM A;  2FUG 2;  2X48 A;  5EZG A;  1T2K A;  1S72 I;  4XLE A;  3RZZ A;  4BEH A;  2O61 A;  4MLO A;  1D5Y A;  2X0L A;  2RVC A;  2EV5 A;  3SQN A;  4I8T A;  4ENM A;  4GDF A;  5LHH A;  4BHB A;  3KPH A;  5E3L A;  2QA4 I;  2HPI A;  3GTO J;  1DW9 A;  4BEH B;  3HOU J;  2L5Q A;  1KU7 A;  2JK3 A;  1J2X A;  2KMU A;  3QPS A;  3ML6 A;  4I6Z A;  2ICP A;  3MZH A;  1ZTR A;  1P2F A;  2EFP A;  1B8I A;  3IP4 B;  1FP2 A;  1R1V A;  2AXU A;  4I99 C;  4ER5 A;  3PO3 J;  2E2H J;  3AL0 C;  4IHW A;  2IS6 A;  2A3S A;  2LP0 A;  2A68 F;  4A3C J;  3CEC A;  2XXA A;  1JUM A;  3F23 A;  4BY1 J;  3M9A A;  4HLY A;  1QVT A;  4FHT A;  2JVL A;  2CYY A;  3JRE A;  2MGQ A;  2FJ1 A;  1G2H A;  2BY2 A;  3O3K A;  3SZP A;  1YO5 C;  2KZG A;  1X2L A;  4YBA A;  4K2E A;  1DGW Y;  4UVB A;  2EBY A;  1Z91 A;  1H9T A;  3P9K A;  5HOD A;  4WXD A;  2HIN A;  4D1Q A;  3MMY B;  1IRG A;  2EZH A;  1ZGA A;  4A12 A;  4RGS A;  1JKR C;  4M74 A;  3DM5 A;  2MA3 A;  3ZN1 A;  2RQP A;  4XR6 A;  5DUK A;  3V7R A;  3JXD L;  2K4B A;  2HYG D;  3QU6 A;  3HEF A;  3WTS C;  3LA7 A;  4TV7 A;  4II2 A;  3QP5 A;  2LY2 A;  3J7A O;  2OTJ I;  4JQD A;  3TDU C;  1Y0N A;  2KLO A;  3JRI A;  1K78 A;  3F8B A;  4YAR A;  3MFK A;  1XPX A;  3OP9 A;  3DEW A;  4OAY A;  4U7B A;  3ZGK A;  1A6I A;  3HBL A;  2K85 A;  3OIQ A;  1T98 A;  3CLO A;  5F08 A;  2EPF A;  3QU3 A;  3OMY A;  4XK4 A;  5ICE A;  3BG5 A;  1KU2 A;  2W82 A;  4AUX A;  2WB1 N;  1A04 A;  2CGP A;  1OCO H;  3A0H C;  2DOA A;  4ER3 A;  4DNC A;  5FRM A;  4NBQ A;  1MD0 A;  5EG0 B;  2BNM A;  1FMW A;  2DFE A;  1SC7 A;  5KNL A;  2L2O A;  3MKZ A;  1RI7 A;  3FK7 A;  1YJN I;  1F1Z A;  3F8N A;  1O3T A;  3HDD A;  2HQR A;  1G3S A;  2HKX A;  3CUQ B;  3IAS 2;  1R1T A;  3FXM A;  1EKE A;  2XGD A;  5M5W J;  6PAX A;  1GXQ A;  2MAB A;  3A01 A;  2LYK A;  2GLO A;  4I02 A;  4Q48 A;  2STW A;  3G1O A;  1OCT C;  3KP2 A;  2PEX A;  3DLA A;  2E5Z A;  3ERE D;  3HOV J;  2X51 A;  2IVB A;  4Y7N J;  2JRT A;  1B9N A;  1IC8 A;  1KQ9 A;  3SXY A;  3RJP A;  3NZL A;  1ETX A;  4EVI A;  5GTI C;  1FYK A;  5ILU A;  1QHH D;  1Z6T A;  1X4P A;  1M1E B;  1XGM A;  2CW8 A;  1V4R A;  3ZR8 X;  2VJJ A;  3J80 Z;  1D0X A;  3QQ6 A;  5CVU A;  1TWF J;  3FBI B;  3REO A;  4CXF A;  4EGY A;  2XB5 A;  2MBF A;  2VQC A;  2QBY A;  1Z05 A;  2ZBK A;  5BPI A;  1UG2 A;  4Y15 A;  3HKZ N;  2HDC A;  3OIP A;  4GHJ A;  5HNH A;  2JA5 J;  3ZQC A;  2G7U A;  2YR2 A;  4ANJ A;  1QZE A;  1DUX C;  1PYV A;  3CCE I;  1S29 A;  3GZ5 A;  1VQN I;  5BS6 A;  3AFH A;  1MGT A;  4FE4 A;  4HRA A;  3E5X A;  5KAF C;  3MAJ A;  4P96 A;  9ANT A;  4YFK F;  2E60 A;  3OY9 A;  3PNY A;  2HZT A;  4BS9 A;  4DGW B;  3MWM A;  3M1E A;  1RES A;  3KE2 A;  3TDZ C;  3K69 A;  4BE2 A;  2GQQ A;  2L4M A;  4UVA A;  3S2W A;  2B63 J;  1HW5 A;  4O5V A;  4NDW A;  4O8B A;  1ITY A;  1B72 B;  4GFB A;  2DT7 B;  2RDP A;  1ZVV A;  3J7A Y;  2VKV A;  4IHX A;  3ZQH A;  4XM3 A;  4EEF G;  1IUY A;  3GF2 A;  1G3T A;  5E17 F;  2DBB A;  1ONV A;  2JUC A;  2VQG A;  4P9F A;  4A3B J;  3DU5 A;  3DQV C;  4WWC A;  2KL4 A;  1X19 A;  1DU6 A;  3X2Q H;  2F5F A;  2JSP A;  4CCK A;  4OIN F;  2R63 A;  1OCR H;  2WIU B;  1MMA A;  4MFD A;  1UG0 A;  3I9V 2;  3I5U A;  2XC7 A;  4DBR A;  2MEZ A;  4LD5 A;  2VB6 A;  3RIR A;  3L00 A;  4A2U A;  2BVL A;  2VL8 A;  3CUQ C;  1FX7 A;  2I8D A;  2XF5 A;  1LFP A;  2RQQ A;  4LLL A;  1QRY A;  4JOM A;  1QP7 A;  2XAF A;  1E2X A;  3F72 A;  1JWL A;  5L3E A;  1GT0 C;  3OYF A;  1IDZ A;  3M7G A;  3LSM A;  1A36 A;  3G7D A;  2K3F A;  3DFG A;  2PUB A;  1BIA A;  4HYE A;  3FMS A;  3GXO A;  4IQ4 A;  1LQ1 A;  3TFL A;  2DCE A;  2ZO4 A;  1F36 A;  4EJT A;  5CVJ A;  4LK0 F;  2PLY A;  3ZHM A;  1J7K A;  1HW2 A;  4IVZ A;  2ZFW A;  4U0V A;  2DA1 A;  4D0P A;  3I59 A;  4WVL A;  2R1J L;  3R0J A;  2DTR A;  4L9V A;  4C2T A;  5IP9 J;  1HF0 A;  1YQA A;  1SQ8 A;  1XWR A;  1QZY A;  3ME5 A;  1I50 J;  2DK8 A;  3HYI A;  4XSX F;  2GRM A;  1BI1 A;  4KIT B;  5DT2 A;  2LKX A;  4JCX A;  4ASN A;  1GVJ A;  3JSP A;  2JJ7 A;  1IXC A;  2R7S A;  1HQ1 A;  1ERD A;  2LBF A;  3CO6 C;  3G4S I;  2LG4 A;  1XN7 A;  5LBQ A;  4ER6 A;  1I1G A;  2GAU A;  5M5X J;  2VUM J;  1FC3 A;  1WPK A;  4BY7 J;  2PUE A;  5JHU A;  1FOW A;  1KYZ A;  3TOB A;  4XIC A;  4B3A A;  1H0M A;  2CFO A;  4XL9 A;  1JKO C;  3BJ6 A;  4XLC A;  3C18 A;  4YII A;  4M9S A;  1YI2 I;  5LRR A;  1ZGW A;  1O57 A;  2Y48 A;  3MCZ A;  3LFK A;  3DTK A;  1I1S A;  5ICG A;  3Q5F A;  3WTT C;  1XMX A;  1NG6 A;  3WG7 H;  3WOD F;  3ZQQ A;  2O4A A;  3U21 A;  4AM3 A;  2FA5 A;  1DQU A;  2LLW A;  4XKW A;  2VI6 A;  3OS0 A;  2L01 A;  3IHU A;  4DYC A;  3JXB C;  1LMB 3;  3VYU B;  3B6C A;  1ZZ8 A;  5JUW A;  4EJW A;  1XSV A;  4EKI A;  4WK8 F;  2DOF A;  1BDI A;  2PUG A;  1F4K A;  1ADR A;  2BHY A;  2M5W A;  3Q0V A;  1R5H A;  2RNG A;  2L9R A;  1PUE E;  4KYW A;  3K10 A;  3G71 I;  1NK2 P;  4DZJ A;  3F8M A;  2EBI A;  5D4R A;  1FIP A;  4Y42 A;  1ZS4 A;  1RET A;  5DEQ A;  3ROU A;  3BDN A;  2L9V A;  2X6Y A;  1IO2 A;  2V6E A;  5A2Q K;  2QQA A;  1JKQ C;  3LAP A;  1JUS A;  1MJ9 A;  2CQN A;  3FK6 A;  1AWC A;  3VFZ A;  4YFX F;  2JQ7 A;  2FD5 A;  2X1E A;  1LVA A;  2JUG A;  2AXV A;  3DWL E;  3HC7 A;  5IYB J;  5D5W B;  2R7Z J;  4CYD A;  1VFC A;  4X4D A;  2FBK A;  5TRD A;  3P9I A;  2WUS R;  1JGS A;  2WV1 A;  3P9C A;  1PVE A;  4WCG A;  1WH8 A;  2FF4 A;  3KEO A;  3Q9S A;  4RLQ A;  4ZYH A;  5B3S H;  2HVS A;  2Z9O A;  1P6R A;  5F0F A;  1JXS A;  2PXK A;  4ZYG A;  2CV0 A;  3O8H A;  4PUS A;  4FCY A;  4EZI A;  4P9U A;  5HVQ C;  2E34 A;  2R5Y B;  2IBD A;  2FX0 A;  2HDD A;  1Y8R B;  2M45 A;  4A3G J;  1HA8 A;  1DWK A;  4KJZ A;  4XMY A;  5C4X J;  4MHG A;  2EFW A;  3PUB A;  3GBF A;  1R23 A;  3FXL A;  1FBQ A;  4MQ9 F;  3C7J A;  3FMR A;  1V5F A;  2LY9 A;  1FTZ A;  4P5O A;  3QF3 A;  4GQM A;  2FBH A;  3I55 I;  3SHF A;  1R7J A;  1YHQ I;  2L7Z A;  2BY3 A;  1FP1 D;  3KL4 A;  3I64 A;  3OR2 C;  1Y7Y A;  4ZDO A;  4XSZ F;  5ILV A;  2QSF X;  4XKV A;  1IRZ A;  3AG4 H;  3IUO A;  1RIO A;  4F55 A;  3GX4 X;  5LGN A;  3WU1 B;  4X4I A;  1H88 C;  3OQM A;  1TP4 A;  4AVP A;  4C2U A;  3JRC A;  4J1X A;  4JYK A;  2A07 F;  2K7L A;  2ZFU A;  1R5G A;  3RDI A;  1B4A A;  4G94 A;  3K6G A;  1YJ9 I;  2XPV A;  4JX5 A;  2P5L C;  1TLH B;  2Y69 H;  3N05 A;  1VTN C;  1ZR4 A;  3LSJ A;  2A6C A;  2M4G A;  3C1D A;  5E3O A;  4ZTJ A;  1TTY A;  3FIW A;  5FLV A;  4B44 A;  1RZR A;  1ZN2 A;  2YU9 J;  4KN4 X;  2E36 A;  1LKX A;  4GXO A;  2KIM A;  2O5R A;  2WB1 A;  3GWZ A;  1TWG J;  4PK4 A;  5HLH A;  4LB6 B;  3AL0 B;  4PGG A;  1E3H A;  3GVA A;  1J0R A;  5LHG A;  1QP0 A;  2V9V A;  1GHC A;  4KIS A;  2HSG A;  3FXU A;  4YRV A;  2LMD A;  1Y56 A;  3RYP A;  2FJR A;  1ZZ7 A;  2GBY A;  2KFD A;  3MQ0 A;  2CV2 A;  3AAF A;  5J1U A;  5JLW A;  3C2B A;  2X6X A;  3JRG A;  4A5N A;  3TQN A;  3TGN A;  2E19 A;  3HM5 A;  3QOD A;  4GO1 A;  4KIF A;  4BE0 A;  3SX0 A;  4X4G A;  1Y39 A;  1T56 A;  2OU2 A;  1RKT A;  5BMZ A;  3BD1 A;  3QRF F;  3LIS A;  2L02 A;  1VZ0 A;  1QHG A;  1ETY A;  2DYR H;  2IV1 A;  1YIT I;  1B0N A;  3CCU I;  5JHF A;  3VYT B;  2A61 A;  3RPQ A;  3CMA I;  3BS3 A;  5D6E A;  1YSE A;  1Z9C A;  1JJ6 C;  1V3F A;  4FX0 A;  1Z6R A;  1JKP C;  5DV5 A;  2NVQ J;  3JAM Z;  2DYS H;  1BJA A;  4IPA A;  4U0W A;  4QWQ A;  4I6U A;  4WXH A;  4M3B A;  1LUJ B;  1YLF A;  5DCM B;  2DOE A;  3IKT A;  4AIH A;  3G5G A;  4IHV A;  1ZRD A;  1GLN A;  2FBI A;  3FIS A;  1WHU A;  5FKL A;  1V5E A;  2R5Y A;  5LRS A;  2YPR A;  1PP7 U;  3CMM A;  3AG1 H;  3L2Q A;  1WJB A;  1X1A A;  4HX7 A;  3A4C A;  1I27 A;  3LSI A;  2AS5 F;  5HLT A;  4KT5 C;  2K9Q A;  3DBR B;  2X9D A;  2I5U A;  4UVC A;  2CMP A;  4LJZ F;  3LOC A;  1LDK B;  4BJ5 C;  4XRS G;  1U3E M;  5IT9 K;  3J81 K;  4E7H A;  4QTR A;  1BI2 A;  1XB4 A;  2CQ7 A;  2HDW A;  4CCO A;  2V1N A;  3ABU A;  1F43 A;  3HKZ A;  3LWF A;  3SYT A;  2FNP A;  3JRH A;  1D8J A;  4J19 A;  2P81 A;  3K70 D;  2E1N A;  1AOY A;  3LL7 A;  3ULQ B;  4ER0 A;  2KIS A;  1P7I A;  3OYA A;  1ETO A;  3KIO A;  4MEX F;  4FN3 A;  3F8F A;  5CQG A;  2VC0 A;  1KON A;  4Z5H A;  5CQE A;  2QSH X;  4ESB A;  2IA2 A;  2GOM A;  3VYS B;  4DW6 A;  4ESF A;  3LAJ A;  2NRA C;  4AD9 A;  1IN7 A;  1KYW A;  4YIF A;  3D5R C;  3FHZ A;  1W7P B;  1JI8 A;  4PSX A;  4AIK A;  3ASN H;  3QPH A;  4ZC3 A;  4E7I A;  4J1W A;  2PXF A;  2D5V A;  1ZEL A;  5E1Z B;  1MDM B;  2MW8 A;  3KXA A;  4HBL A;  2LSO A;  1OLT A;  3KZ3 A;  2BY1 A;  2G0E A;  2PXE A;  2FSW A;  1OJL A;  1U9O A;  2PQ8 A;  3PSI A;  4HNT A;  4CCJ A;  5FLX K;  2MSY A;  1R4M B;  2CG4 A;  1DP3 A;  1PRU A;  3BC8 A;  3HTU A;  5B66 C;  4UUV A;  4B3X A;  1CF7 A;  3F8C A;  4EK9 A;  4HPQ A;  2JTV A;  3S32 A;  2KHM A;  2RV8 A;  2V3C C;  2A5W A;  4PU4 C;  2NXN B;  4IO9 F;  1J75 A;  1Z21 A;  3HPH A;  4MO7 A;  4ETS A;  1IN4 A;  1IW7 F;  1O3S A;  3S15 J;  2CUE A;  2HQN A;  1XTA A;  1SD6 A;  3VWB A;  1UST A;  2ZNY A;  3O6B B;  2P6T A;  4XOR A;  1EFA A;  3W6V A;  5ILS A;  1D3Y A;  3DKW A;  1TW3 A;  4LIT A;  5E20 A;  2QZ8 A;  2EF8 A;  4PFO A;  3OYC A;  4RGX A;  3E7L A;  2PMZ A;  4A3K J;  4CH7 A;  1OYW A;  2ECB A;  4KIG A;  4OIR F;  1HC8 A;  3TW6 A;  3ZRG A;  1Y8Q B;  2IVG A;  2V1X A;  2W84 A;  2M2E A;  3COA C;  3PXP A;  4XLF A;  4S0H B;  2XHK A;  3FHN A;  1A35 A;  2HKO A;  2GOX B;  2VLA A;  3GZC A;  1VQ5 I;  4ZYA A;  3V8K A;  5HDG A;  2JCG A;  2M0C A;  4BGD A;  1J5Y A;  3LST A;  3F52 A;  3LNQ A;  2LF7 A;  1W1W E;  4EV0 A;  3SJM A;  2DMT A;  1WRJ A;  2EWT A;  2FML A;  2NVX J;  1BI0 A;  3SDG A;  2D45 A;  2EIM H;  3HUG A;  1HSJ A;  2EK5 A;  5IYD J;  1WKM A;  1V54 H;  5BOX A;  3CC4 I;  3J7Y J;  4PU3 C;  4XID A;  1R49 A;  3ZPX A;  2E71 A;  1UXC A;  3H5R A;  2CSF A;  2XXP A;  3QYX A;  2P7V B;  5JI6 A;  1UXD A;  3PNV A;  2KJB A;  4M71 A;  1MND A;  3M8J A;  4N4O B;  2Y0S A;  5ERI A;  4C3I J;  5FLM J;  1XX5 A;  2Q2E B;  3HTS B;  1RKW A;  2H6B A;  2ECC A;  2ZSH B;  3HSE A;  2L8N A;  4I6R A;  5FKN A;  3S3M A;  1ZH5 A;  1D5V A;  5GAH i;  2QF7 A;  2MQK A;  3LSH A;  4IQJ A;  1HKS A;  1E17 A;  2P5K A;  4IZZ A;  4FTH A;  5E3N A;  1A5J A;  4S05 A;  3WU2 C;  1LLI A;  5A2Q Z;  3L2W A;  1SD5 A;  3GTQ J;  1OCP A;  4HNV A;  5D4S A;  3S1R J;  1REP C;  2W4S A;  2E1C A;  4CCM A;  1FTT A;  1BR1 A;  2YUS A;  5E3M A;  4XLA A;  1S5L C;  1MIJ A;  2VON A;  4EQQ A;  3QYE A;  3BPX A;  3OYK A;  4IX7 A;  4LK1 F;  4HZF A;  2VBW A;  2KT0 A;  1LB2 A;  4IHT A;  3OMT A;  2LYQ A;  3WTV C;  2M3A A;  1ZRC A;  1S9H A;  2Z5U A;  1S3J A;  2EZI A;  2WY7 Q;  3PL8 A;  5HNF A;  1PNR A;  3HHH A;  5KCM A;  2XIU A;  3A9Y A;  2LVS A;  1ENH A;  2RAE A;  2OQG A;  3GN5 B;  2GXB A;  2IS1 A;  1NG7 A;  3GW2 A;  3JRB A;  3A1Y A;  3LQQ A;  3LSK A;  3BCB A;  1WZ2 A;  3E97 A;  4HX4 A;  2FEZ A;  3CZ6 A;  1MKM A;  4S04 A;  2HPM A;  1LVK A;  4AVZ A;  1VQ4 I;  4QPO A;  3SEZ A;  3L2V A;  2DAO A;  3MKW B;  3K1P A;  4M6Y A;  1ETK A;  2BNO A;  4V2G A;  1W4M A;  4IJA A;  3FDY A;  4E4H A;  4UY8 I;  5FRO A;  1KQ0 A;  2GXA A;  2AQF A;  1SFU A;  4M73 A;  4XLN F;  3HG9 A;  3WTY C;  5J6X A;  2P7C B;  3IH3 A;  3RI4 A;  5GPC A;  4Y4R A;  4BAY A;  1ZUG A;  3VSL A;  5GAD J;  1ZG5 A;  1XS9 A;  2IA1 A;  2IA0 A;  2YX4 A;  2CU7 A;  2X1D A;  3VYR B;  3EUS A;  4A0Y A;  4Z6Y A;  3R60 A;  5H6R A;  5L3D A;  3GBG A;  2WAD A;  5J3L A;  2O8X A;  2PUC A;  3EUH A;  4BBS J;  1VQL I;  4KT6 A;  3ZMS A;  2V7F A;  1JHH A;  1IN6 A;  3MD2 A;  1XSX A;  1FIA A;  3I4N J;  4L9J A;  1DP7 P;  2EFQ A;  2PN6 A;  3HSF A;  5CKT A;  1UTX A;  3ONQ A;  2ZJ2 A;  1POG A;  1WFX A;  3FYM A;  1W0U A;  3KP3 A;  4WF2 A;  2IS4 A;  3I53 A;  2ESH A;  1Z67 A;  3Q0W A;  2EV0 A;  3HGY A;  3M1C A;  2ODR D;  1Y6I A;  1BDH A;  3HOW J;  2PXP A;  2DJN A;  2W24 A;  1YW8 A;  3NRV A;  1X58 A;  1ZZ6 A;  4MNU A;  2QUF A;  2VKH A;  1ZAR A;  1TW2 A;  3BY6 A;  1JE8 A;  3E6M A;  1X3Z B;  3ZPL A;  3K4N A;  3AG3 H;  5FJ8 J;  3H92 A;  1XGN A;  5FFZ A;  4MGR A;  4C30 A;  5H20 A;  2R5Z A;  4JX6 A;  2BNN A;  3DEU A;  3BRO A;  5DUI A;  2DLL A;  2MYS A;  3GFJ A;  1YJW I;  2KQR A;  4L5E A;  3QAH A;  2BY0 A;  1TWH J;  2VPL A;  3DPU A;  4CCL A;  4BHP A;  3H3V K;  2ISY A;  3HGG A;  5TIS C;  4RGU A;  4PU7 A;  1E0E A;  1G4D A;  2RGV A;  4E70 A;  1N75 A;  2OZU A;  2XF6 A;  2BEO A;  3MEX A;  3ZXS A;  1FNN A;  2MD0 A;  3U1K A;  3CCV I;  4OWR B;  3K9T A;  4LFU A;  4HQM A;  1YFH A;  3O8G A;  5B5E C;  4HLX A;  2J5O A;  2XXQ A;  1Z7U A;  3HZI B;  3C3W A;  3RKX A;  3IH2 A;  3H5T A;  1ZZ9 A;  1FBS A;  1FPQ A;  5E79 C;  4BQQ A;  4UV9 A;  2HQA A;  4E6K G;  2G9W A;  4UUT A;  1O7F A;  5DYM A;  1XGO A;  3IL2 A;  5DTD A;  3IRQ A;  4PJM A;  4F3Q A;  4XN0 A;  3OKZ A;  3CCQ I;  2K27 A;  3CDL A;  1KU3 A;  4D5C A;  3BJA A;  1I3Q J;  2KZ8 A;  2OD5 A;  4II3 A;  2A6T A;  1FZP B;  3R0A A;  3CF2 A;  2L1P A;  1MBG A;  2HR3 A;  3SR4 A;  2CFX A;  4OBM A;  1QQA A;  2LR8 A;  3MZY A;  4UV8 A;  4G7H F;  1G6N A;  1UHS A;  1H9G A;  4LLN A;  2IP2 A;  5J1R A;  1S7A A;  2F4O B;  3I0T A;  2L54 A;  3J81 Z;  2GIV A;  5FRN A;  2R93 J;  1KGS A;  3A02 A;  1BR2 A;  1XCV A;  1LE8 A;  5DS9 A;  4RBO A;  1U5T B;  3S3N A;  4W97 A;  2CRO A;  3R61 A;  3DLL F;  4XLH A;  1UHW A;  2W25 A;  5FB2 A;  2M7A A;  4Y13 A;  2XAH A;  2AHQ A;  3CME I;  2RRE A;  3IKV A;  2PJP A;  1W36 D;  4RLF A;  3FYA A;  4RB0 A;  3VWS A;  1R63 A;  2Z2S B;  1CF7 B;  3PQJ A;  1JT6 A;  4BNC A;  5IP6 A;  4IOA F;  4HAM A;  4M3D A;  3NXH A;  4LGW A;  4XNF A;  1WJD A;  1D1B A;  3B7H A;  1W5C C;  3ASO H;  2CQK A;  4YG1 A;  3MKL A;  2EZK A;  2E1M C;  1OYY A;  3DKX A;  3H0D A;  1RPE L;  3L9F A;  2BZT A;  3G1M A;  4M72 A;  5GAG J;  5L3G A;  1YG2 A;  4E7J A;  2R7R A;  5HS8 A;  4U7D A;  2AXZ A;  4BKX A;  5CLS A;  4ER7 A;  2GWR A;  3HOS A;  2F4M B;  1OKR A;  1RIO H;  2QEX I;  4XN3 A;  2IEK A;  2DFF A;  2ISZ A;  1JUP A;  2PXQ A;  2VOO A;  3D0S A;  2V26 A;  1Q1H A;  4PDK A;  2E5N A;  2E35 A;  3OIO A;  1K6Y A;  5FKO A;  4HF0 A;  1K7A A;  4HRI A;  3KP6 A;  2MC4 A;  3BG6 A;  5ICF A;  3ZN0 A;  4HF2 A;  4Q5S F;  2HXI A;  2DPU A;  2AWI A;  5J8C A;  3A2K A;  1HDD C;  5GP9 A;  1X1B A;  1P4W A;  1XGS A;  2COB A;  2VQH A;  3WG9 A;  4DYR A;  4A3I J;  5HLI A;  1XC5 A;  1QNT A;  2GA2 A;  3NWS A;  5HS9 A;  3QYF A;  2DA2 A;  1VQK I;  3I54 A;  2PJR B;  1WJE A;  5H6Q A;  3RPU A;  4A6E A;  3ZP5 A;  1CQT A;  4Z59 A;  2TCT A;  2CRG A;  2QM3 A;  3GO5 A;  2Y30 A;  1IG7 A;  1X2M A;  1W7P A;  1LCD A;  2M7B A;  1BR4 A;  3R6S A;  4B09 A;  2NYX A;  1K61 A;  3CLQ A;  2QYO A;  4LG3 A;  4F8D A;  2IGN A;  3JTG A;  2E2I J;  1ORK A;  1SFK A;  1W7P D;  2LNB A;  2OV7 A;  2Q1Z B;  3K4B A;  5H2F C;  4LB5 A;  4X4H A;  2FQ3 A;  1U5T C;  2VC1 A;  2VBZ A;  3JRD A;  2NNY A;  5K1Y A;  4BXX J;  5AIP A;  2DA7 A;  2HOS A;  2K4J A;  2XGE A;  3VK0 A;  1VQ6 I;  3H35 A;  3NAU A;  1K78 B;  3SZT A;  1LE8 B;  1X57 A;  3DTI A;  3AG2 H;  4H4K C;  3ERM A;  2K86 A;  5D8L B;  2LLV A;  1U2W A;  2FXA A;  4O6J A;  3EYY A;  5IT3 A;  2MH2 A;  4CGZ A;  2A05 A;  4I76 A;  3Q0U A;  5K7H A;  1TWC J;  2W57 A;  4BL0 B;  1SFX A;  4KNY A;  4RAG A;  4GRI A;  4RM3 A;  1IXS B;  1BM9 A;  3K7A J;  2GZW A;  4BDY A;  4B8X A;  3A9X A;  1GVD A;  1ZQ3 P;  3EQL F;  4AC0 A;  5J4V A;  3CMY A;  4XON A;  4PFP A;  2EJR A;  3DEE A;  3BZK A;  4NC7 A;  5DCM A;  4CZZ A;  1VF9 A;  2K02 A;  2XAG A;  3FMY A;  3I58 A;  1U5T A;  3BTL A;  3ZMZ A;  4HDU A;  4Z5D A;  3BG9 A;  5J47 A;  2XAQ A;  3G3Z A;  3DTE A;  3BR2 A;  1SAU A;  3WTX C;  2XF7 A;  2ETH A;  1GV2 A;  2KIU A;  3O2P E;  4U87 A;  5KHD A;  2R7T A;  2KEK A;  4DJA A;  2R92 J;  5LHI A;  3OYJ A;  2O03 A;  3LQR A;  2LK2 A;  3BQZ A;  1QQB A;  3C2G A;  2EQR A;  1QPM A;  4P1W A;  2K9L A;  4XQF A;  1MJA A;  1GXP A;  2HTJ A;  3FF5 A;  2VPR A;  1K4S A;  4M3F A;  5L3C A;  2A69 F;  3VOD A;  3PUF A;  3L2R A;  2AW6 A;  3CCY A;  4L0Z B;  1X3U A;  1X4O A;  1V5G A;  2NOJ B;  1BIB A;  2DN0 A;  2Z99 A;  5CVV A;  1R9T J;  2M4K A;  1USS A;  3KZY A;  2WV0 A;  4ENK A;  2HVR A;  5GPA A;  2Q0O A;  2H94 A;  4IRG A;  1BI3 A;  2Y2Z A;  2KPJ A;  3R09 A;  3IVP A;  2DDA A;  4Q2J A;  4RAY A;  3PM1 A;  4MCX A;  3BTI A;  3IWZ A;  4FET A;  1POU A;  2H09 A;  4RGR A;  3LA2 A;  2CS3 A;  3VOE A;  2A5Y B;  3RQ4 A;  3TP0 A;  1LEA A;  2IPQ X;  4I6T A;  1MMG A;  4AU7 A;  2JVG A;  4QPQ A;  4HF1 A;  1FLI A;  1NHA A;  2OA4 A;  3BPV A;  4N9I A;  1VQ9 I;  1IDY A;  3TO6 A;  4E7S A;  1QBJ A;  4CHU A;  5D5U B;  4KN7 X;  2ZJR F;  4PJL A;  1B1B A;  4ZDL A;  4Q4Z F;  1PRV A;  5K5R A;  5EGO B;  3LFU A;  2LYP A;  4DIQ A;  4B1R A;  4KFC A;  2EZL A;  4XRF A;  3M8E A;  3JW4 A;  3UWP A;  5EEA A;  2DMU A;  4LIU A;  2VJ4 A;  1YOV B;  2VKE A;  5ICC A;  1A6Q A;  1DUL A;  2EA2 A;  1D8K A;  2LYL A;  4PJ0 C;  3Q3S A;  3ZOB A;  2ZC2 A;  4IOC F;  1LJ9 A;  2F5V A;  1GV5 A;  3N4M A;  1ACI A;  2C6Y A;  4AIJ A;  1K6O A;  4HNU A;  5HOO A;  2PMH A;  2MH9 A;  4M6X A;  2HEO A;  4NC8 A;  2ELH A;  1WJ5 A;  3NAR A;  2XV4 S;  4A93 J;  3R1F A;  2VT2 A;  2CV1 A;  2V4J C;  1RZ4 A;  2PBI A;  2EWN A;  4BXU A;  1PDN C;  2KJC A;  2LF8 A;  2R7O A;  4OAZ A;  3KCC A;  3SCF A;  3OYM A;  3UFD A;  1BN5 A;  2Z16 A;  1XMK A;  4CSW A;  1R6R A;  2P6S A;  1ZRE A;  3GLL A;  2EV6 A;  5B1A H;  3L1P A;  3A01 B;  2ZXW H;  3WHC A;  5D8K B;  4MCT A;  2V6C A;  4A69 C;  1G8X A;  1TC3 C;  3LFP A;  3V8J A;  5HS7 A;  3OYB A;  1YIO A;  3BZC A;  1TNT A;  2JWT A;  1TWA J;  1FOY A;  1I39 A;  1V55 H;  5FD5 A;  1BJZ A;  2CUJ A;  1UB9 A;  3DU6 A;  2LNM A;  2QWW A;  3TED A;  3A9Z A;  4XRS A;  1OCZ H;  5EYR A;  4AYB A;  1J59 A;  1RRJ A;  3H5N A;  3ECH A;  3W2W A;  4UUS B;  2M1B A;  2M34 A;  4OIO F;  1BC8 C;  2ZXI A;  3KLO A;  4G12 A;  1K79 A;  2TDX A;  4CO8 A;  3OYI A;  3L09 A;  3SZG A;  3KX2 A;  2ZKZ A;  3Q9V A;  1P92 A;  4MIM A;  3TW7 A;  1I6H J;  5DSX A;  1CJG A;  1RC9 A;  2EIJ H;  3ESW B;  3OQO A;  3NEU A;  2J7W A;  3BQY A;  4EQZ A;  4OIP F;  3DV8 A;  2XSD C;  4X4B A;  5K7Z A;  3RKW A;  2VT3 A;  3TL4 X;  2K9N A;  2HFH A;  1JGG A;  3L2C A;  2B5A A;  1T0F A;  2W00 A;  2OBP A;  2QQ8 A;  1A31 A;  4F93 B;  3GN5 A;  3K1M A;  2BHZ A;  1NTC A;  3RSN A;  3TBI A;  1IV8 A;  1YS6 A;  4LMY A;  1DPR A;  5E8G A;  1NEQ A;  1YYV A;  2PUF A;  3OWQ A;  2FOK A;  1AKH B;  2HOT A;  1MBE A;  5CPR B;  3ZQL A;  1H89 C;  2PXL A;  5B1B H;  4F91 B;  1ZYR F;  2UZK A;  2MC3 A;  3OYE A;  1R5I D;  2R7F A;  3CDI A;  3T5X A;  3T8R A;  1D1C A;  4R8H A;  2E7W A;  2JZY A;  2UWM A;  4M3G A;  3D1N I;  4PCQ A;  1VQP I;  3CD6 I;  2JPC A;  4G7O F;  4V19 K;  1ETW A;  1AA7 A;  4DQ2 A;  3J7Z I;  1B8I B;  3VEP A;  4ENJ A;  2P5V A;  3QWG A;  2FQ4 A;  1N78 A;  2LLK A;  1ZAY A;  1EJ9 A;  2QSG X;  3PQK A;  4NUB A;  3CUO A;  2V1U A;  3WE2 A;  4G6Q A;  1UJ8 A;  4B4C A;  4X6A J;  2F5E A;  1R36 A;  3D5L A;  3S93 A;  5BQT A;  4IKF A;  3HOY J;  2DPD A;  3NRO A;  2LYJ A;  2L9N A;  2HOA A;  4EMS A;  4BUP A;  4ZZL A;  2GA1 A;  3GZD C;  1BW5 A;  1HW1 A;  1JFS A;  3SCG A;  4AWX B;  1ZZC A;  5D5V B;  1EH6 A;  2M8E A;  3CJR B;  3CC7 I;  2IVQ A;  3CQZ J;  5LD2 C;  4OB4 A;  2DOD A;  1YW7 A;  4HV5 A;  4EM0 B;  2Q2E A;  4J01 A;  1YRN B;  3F6O A;  4LLG F;  4I2O A;  4IHY A;  1CGP A;  3BJO A;  1T33 A;  3BCA A;  3CCM I;  3MN2 A;  3OOU A;  1QPI A;  3HUG B;  2RKH A;  3WTU C;  4G7Z F;  1B72 A;  2OFY A;  3FKJ A;  4GYI A;  4L9T A;  1S7O A;  2ZCW A;  2V9K A;  5DD8 A;  5F27 A;  3S3O A;  4I09 A;  1R58 A;  4O3M A;  2OCC H;  3QOP A;  4A0X A;  3TOA A;  3KYC B;  4I0A A;  4XLP F;  4FIS A;  4EM1 A;  1NK3 P;  1U8R A;  1HOM A;  1T08 B;  3GFL A;  5FFX A;  4D7M A;  2TRT A;  1VQO I;  2XPU A;  4YG2 F;  5LFA A;  3O9X A;  2VJI A;  4DBQ A;  2B7E A;  3EET A;  2NS8 A;  5EF6 A;  4FT8 A;  5CJ9 A;  2DDB A;  3S17 J;  1EH7 A;  1SD7 A;  2QCO A;  1Z3Y A;  2STT A;  3BDD A;  1G3Y A;  2WY8 Q;  3HOX J;  4BJT A;  3JSO A;  5LEK A;  2LYR A;  2UV1 A;  5FKM A;  4HQE A;  1ZR2 A;  2BOL A;  1ZPQ A;  2ADU A;  1JFT A;  4KMF A;  1B9M A;  1WH7 A;  4E7K A;  2F2E A;  2A6E F;  4LIV A;  1ZZB A;  2R7V A;  5F1J A;  1IGN A;  4MQV A;  1R22 A;  2HWV A;  4BXF A;  3HRU A;  2JPB A;  1PUF B;  1QA6 A;  2P4W A;  3KYD B;  3SFZ A;  4RAZ A;  2PXT A;  3SFI A;  2VE9 A;  5EDN A;  1D0Y A;  5KAI C;  5DTR A;  2KEI A;  3F0C A;  1PER L;  3HB9 A;  5EZH A;  2BXZ A;  2NNN A;  2Y31 A;  1AKH A;  4RB2 C;  2ELJ A;  1I6X A;  2V1D A;  3BT9 A;  4UUS A;  3EUK L;  3CP2 A;  1HKT A;  3RCO A;  3BWG A;  4EJV A;  3GUD A;  5F64 A;  5EG0 A;  3ABT A;  3RZD J;  4RMN A;  3AKZ A;  1N77 A;  1MBF A;  2WC2 A;  4R79 A;  1RZS A;  1Z77 A;  5CVI A;  3W6K B;  5J8F A;  1WCM J;  3FXO A;  2VXZ A;  1MBJ A;  3JCU C;  1LDJ A;  4QLC U;  2XAS A;  2LY1 A;  5JVT A;  1TNS A;  1IF1 A;  2JSC A;  3ISP A;  3TO7 A;  2JN6 A;  3EDP A;  4FAS D;  2JRM A;  4D9J A;  2ME0 A;  2GIZ A;  4RS8 A;  5DM7 F;  2K9M A;  3TMO A;  2XIG A;  2M8G X;  4A3D J;  2R7U A;  2OTL I;  3W2V A;  1IJW C;  1VI0 A;  2LKS A;  4LG0 A;  2MXD A;  4L9N A;  4X4F A;  3G2B A;  5J4Y A;  1JH9 A;  2R7D A;  1MH3 A;  3IC7 A;  1VND A;  4Y17 A;  1MSF C;  4IXA A;  1QPZ A;  3WGI A;  1Y9Q A;  3S14 J;  1X1D A;  2DQR A;  1W36 C;  3CCS I;  2PG4 A;  1RNL A;  1WH6 A;  3HJE A;  4I7H A;  4DE9 A;  2NS7 A;  3GZ6 A;  2VXD A;  2HCS A;  4R1H A;  3FXK A;  1WQ2 A;  4CZC A;  2UUZ A;  3OYL A;  1U2Z A;  4C3J J;  1HKQ A;  3L7W A;  1QO0 D;  1APL C;  2HVQ A;  4EJO A;  1Z0X A;  2XGX A;  1NH3 A;  5FGM A;  3LSG A;  2F6C A;  3QPL A;  3JAM K;  3B6A A;  3HPG A;  4NDL A;  2CO5 A;  2FNA A;  5C3E J;  1K4T A;  1AHD P;  4ZYE A;  1XDU A;  4ZDP A;  2BE5 F;  2QEN A;  3FMQ A;  1N25 A;  1RR7 A;  2ID6 A;  4NQW A;  3ZMD A;  1D0Z A;  2CUF A;  3SCH A;  1T95 A;  3GME A;  4PU8 A;  1KU9 A;  1S7E A;  1HCR A;  1IRX A;  4M9Z A;  1QVU A;  3VPR A;  1QU3 A;  2IGK A;  1MMD A;  1ON1 A;  1UFM A;  3OS2 A;  3KZZ A;  2YSR A;  3NWT A;  1TL8 A;  4A3M J;  1DGR M;  2BBY A;  5DCF A;  4OMZ A;  4ZYD A;  4JBA A;  3ZMT A;  3RZO J;  2I10 A;  1HXD A;  1FWZ A;  2OQR A;  1UMQ A; 
#chains in the Genus database with same CATH homology
 3BTC A;  1H88 C;  3OQM A;  1WI3 A;  3OIO A;  1ZKG A;  5FKO A;  3JRC A;  1U9N A;  4J1X A;  1L1M A;  1Y1V J;  1XG1 A;  4JYK A;  1ETQ A;  3IV5 A;  2XCJ A;  2HXI A;  2XPV A;  4JX5 A;  2OPT A;  4C2M J;  2AWI A;  1DU0 A;  2DA6 A;  4W1U A;  2BJC A;  1VPW A;  1HDD C;  1ZR4 A;  3LSJ A;  5GP9 A;  4ABZ A;  4DYQ A;  2A6C A;  2OR1 L;  3JRA A;  2COB A;  2CQX A;  3MVP A;  5E3O A;  4DYR A;  3FIW A;  3RQI A;  2AO9 A;  4A3I J;  2E2J J;  1XC5 A;  5FLV A;  1RZR A;  4D5F A;  2YU9 J;  1RPW A;  2DA2 A;  4MFE A;  1CQT A;  2LCV A;  1TWG J;  4Z59 A;  2ME6 A;  2HI3 A;  2TCT A;  2XGC A;  2CRG A;  2LD5 A;  2O7O A;  2Y30 A;  1IG7 A;  1X2M A;  2MG4 A;  4A3L J;  1LCD A;  1QP0 A;  3ZQF A;  3M4O J;  1K61 A;  2OF7 A;  2HSG A;  2FJR A;  1ZZ7 A;  4F8D A;  2E2I J;  2GBY A;  1X2N A;  4FBI A;  5J1U A;  5JLW A;  1ORK A;  3C2B A;  3JRG A;  4JX4 A;  1OSL A;  1Y1W J;  3GTM J;  4RDU A;  1QP4 A;  2E19 A;  5IP7 J;  3HM5 A;  4X4G A;  2DMP A;  4X4H A;  3FKI J;  3JRD A;  1O4X A;  1T56 A;  2LTP A;  4A3J J;  2E1O A;  4BXX J;  1RKT A;  5M3F J;  3GTG J;  2DA7 A;  2HOS A;  3S16 J;  2XGE A;  2GRL A;  3BD1 A;  3LIS A;  3VK0 A;  1ETY A;  3NAU A;  2O9L A;  1B0N A;  1RZR D;  1LE8 B;  1X57 A;  5M3M J;  3BS3 A;  1U8B A;  1YSE A;  1WIZ A;  1JJ6 C;  5JLX A;  2GM4 A;  3DCF A;  1JKP C;  2ICT A;  4M6V A;  2NVQ J;  1HDP A;  2H8R A;  4I76 A;  3Q0U A;  5K7H A;  4I6U A;  2KEJ A;  1TWC J;  2HYJ A;  2DA3 A;  3CRO L;  4M3B A;  5EGO A;  3OSF A;  3G5G A;  3GTJ J;  2NVY J;  2L7M P;  4IHV A;  2H1K A;  2Y9Z A;  3I4M J;  3FIS A;  3K7A J;  5FKL A;  2R5Y A;  1GVD A;  1U78 A;  1ZQ3 P;  4AC0 A;  1MH4 A;  3CMY A;  3UKG A;  4YG4 A;  4IEJ A;  1MNM C;  1VF9 A;  3WHB A;  3M3Y J;  2DA5 A;  2XB0 X;  3FMY A;  3H0G J;  1SAN A;  2K9Q A;  3ZQI A;  5IPA A;  3BTL A;  3OSG A;  2L49 A;  5K7F A;  2X9D A;  2XJ3 A;  3PO2 J;  4Z5D A;  1JJ8 C;  3BG9 A;  3BR2 A;  3LOC A;  2KEK A;  1GV2 A;  5F0H A;  3ZKC A;  4XRS G;  1HLV A;  2R92 J;  4QTR A;  2LK2 A;  3BQZ A;  5M5Y J;  2X48 A;  1F43 A;  1QQB A;  5EZG A;  2EQR A;  3RZZ A;  2JA8 J;  1W0T A;  2XPW A;  3JRH A;  4J19 A;  2P81 A;  2VPR A;  4MLO A;  1D5Y A;  1P7I A;  4FN3 A;  1ETO A;  3IH4 A;  4M3F A;  4I8T A;  1MBH A;  2ELK A;  4Z5H A;  3JRF A;  3CCY A;  5E3L A;  2AW6 A;  3LSR A;  4DW6 A;  3GTO J;  3HOZ J;  1DW9 A;  2DMN A;  2DN0 A;  1R9T J;  3S8Q A;  3HOU J;  2JK3 A;  5GPA A;  2Y2Z A;  3QPS A;  4I6Z A;  2ICP A;  2KPJ A;  1ZTR A;  3IVP A;  4J1W A;  1B8I A;  2D5V A;  2AXU A;  4MCX A;  3PM1 A;  3BTJ A;  3GTL J;  3BTI A;  3KXA A;  2MW8 A;  5BNG A;  2E2H J;  3PO3 J;  1POU A;  4IHW A;  2LP0 A;  4A3C J;  3KZ3 A;  3CEC A;  1MSE C;  2G0E A;  3TP0 A;  3GTK J;  1JUM A;  4BY1 J;  1OJL A;  1QVT A;  1U9O A;  2IAI A;  2JVL A;  3JRE A;  4I6T A;  2MSY A;  2JA7 J;  3QQA A;  1PRU A;  1R69 A;  2MGQ A;  2FJ1 A;  1G2H A;  1IDY A;  1X2L A;  4YBA A;  2N8G A;  2EBY A;  4PU4 C;  5C44 J;  2L7F P;  5HOD A;  4MO7 A;  1PRV A;  1PRA A;  4Z58 A;  2HIN A;  5EGO B;  1PUF A;  2EZH A;  2CUE A;  3S15 J;  3JR9 A;  1JKR C;  2LYP A;  4B1R A;  2EZL A;  3JXD L;  1EFA A;  3W6V A;  5EEA A;  3HEF A;  2DMU A;  2EF8 A;  4A3E J;  1BL0 A;  2VKE A;  4Z5C A;  4JQD A;  3E7L A;  5IYC J;  3RKQ A;  4Y52 J;  2LYL A;  3F6W A;  3JRI A;  3Q3S A;  3ZOB A;  4A3K J;  4YAR A;  1SFO J;  1GV5 A;  3OP9 A;  3DEW A;  2ECB A;  4D7N A;  1A6I A;  3R1F A;  3HBL A;  3NAR A;  4A93 J;  5F08 A;  3TW6 A;  2IVG A;  2M2E A;  3PXP A;  4CYC B;  4S0H B;  3SCF A;  3UFD A;  4XK4 A;  1ETV A;  3BG5 A;  3BR0 A;  4AUX A;  2WB1 N;  3A01 B;  3L1P A;  2HXO A;  3WHC A;  2JCG A;  2JA6 J;  2M0C A;  2PIJ A;  4A69 C;  1TC3 C;  3F52 A;  3LNQ A;  3LFP A;  4MCT A;  4QSH A;  3SJM A;  2DMT A;  2CQQ A;  5EG0 B;  2BNM A;  2EWT A;  2NVX J;  3HDD A;  2JWT A;  1TWA J;  3FK7 A;  3SDG A;  3K2A A;  1WH5 A;  2XGD A;  1BJZ A;  5M5W J;  5IYD J;  3TED A;  3A01 A;  2LYK A;  4PU3 C;  1GDT A;  4XID A;  2GLO A;  1IUF A;  4XRS A;  1UXC A;  5EYR A;  1NER A;  3G1O A;  1OCT C;  2CSF A;  3QYX A;  3S2H J;  4UUS B;  1UXD A;  2M34 A;  3ZHI A;  3HOV J;  4X4E A;  4G12 A;  4C3I J;  5FLM J;  2IVB A;  4Y7N J;  4LOC A;  1IC8 A;  4I6R A;  1RKW A;  2ECC A;  2L8N A;  2IU7 A;  5FKN A;  2WAQ N;  1ETX A;  4MIM A;  3TW7 A;  1I6H J;  1CJG A;  3OQO A;  3BQY A;  2QF7 A;  2MQK A;  3JXC L;  2XSD C;  4JCY A;  4X4B A;  1Q1V A;  5K7Z A;  4FTH A;  5E3N A;  3QQ6 A;  3BG3 A;  2K9N A;  1A5J A;  2XI8 A;  2IUO A;  1TWF J;  1LLI A;  3GTQ J;  1JGG A;  1OCP A;  4X1E A;  4HNV A;  3S1R J;  2B5A A;  2XB5 A;  3GN5 A;  1OFC X;  1UG2 A;  1NTC A;  1FTT A;  3HKZ N;  1MBK A;  2YUS A;  5E3M A;  2L0K A;  4GHJ A;  2EH3 A;  4M3E A;  1NEQ A;  2JA5 J;  3ZQC A;  3BR6 A;  2PUF A;  3GTP J;  2KT0 A;  1AKH B;  2HOT A;  3OMT A;  1MBE A;  2LYQ A;  4X4C A;  3ZQL A;  4FE4 A;  5FKK A;  1H89 C;  5A7L A;  2EZI A;  3S2D J;  2DA4 A;  9ANT A;  1PNR A;  3F51 A;  1FJL A;  2XIU A;  1LFB A;  2LVS A;  1ENH A;  2RAE A;  1RES A;  2LFB A;  3GN5 B;  4M3G A;  3D1N I;  3JRB A;  2B63 J;  2O8K A;  4NDW A;  4O8B A;  1ETW A;  1ITY A;  1B72 B;  1B8I B;  4GFB A;  3QWG A;  1ZVV A;  2FQ4 A;  2LLK A;  2R0Q C;  2VKV A;  4IHX A;  2R5Z B;  2LYS A;  3ZQH A;  5K98 B;  2PE5 A;  1ZAY A;  5IOY A;  3S1Q J;  4EEF G;  4B4C A;  4X6A J;  2IV1 A;  1ETK A;  3HOY J;  1EF4 A;  4A3B J;  2XRL A;  4V2G A;  2BNO A;  2LYJ A;  2HOA A;  5F0C A;  1WGX A;  1E3O C;  1LQC A;  1BW5 A;  1JFS A;  3SCG A;  1DU6 A;  1ZZC A;  2R63 A;  2WIU B;  2IVQ A;  4OB4 A;  3CQZ J;  4MFD A;  3IH3 A;  4A3F J;  1YRN B;  2PPX A;  5GPC A;  2MEZ A;  1ZUG A;  1XS9 A;  2HQ5 A;  4IHY A;  2PUD A;  2CU7 A;  1T33 A;  1FEX A;  3MN2 A;  3LSP A;  3EUS A;  3OOU A;  1QPI A;  1QRY A;  1QP7 A;  1JWL A;  3GBG A;  3CLC A;  5J3L A;  1GT0 C;  1B72 A;  1IDZ A;  3U3W A;  2PUC A;  4BBS J;  2OFY A;  5F27 A;  2O49 A;  2ID3 A;  3G7D A;  5F04 A;  1FIA A;  3I4N J;  2Y0S N;  2PUB A;  1JTX A;  4IWR A;  1F36 A;  1UTX A;  2ZB9 A;  4FIS A;  3ZHM A;  1POG A;  3MLF A;  4IVZ A;  2Y9Y A;  1NK3 P;  2DA1 A;  3FYM A;  1H8A C;  1W0U A;  2R1J L;  1HOM A;  4D7M A;  2KDZ A;  3S1M J;  3S1N J;  2TRT A;  3Q0W A;  2XPU A;  3HGY A;  3O9X A;  2W48 A;  5IP9 J;  1HF0 A;  1BDH A;  4C3H J;  3HOW J;  1SQ8 A;  1XWR A;  1I50 J;  2DJN A;  2NS8 A;  5J1Y A;  5EF6 A;  1X58 A;  1ZZ6 A;  2GRM A;  2LKX A;  3TP3 A;  4JCX A;  2X6O A;  3S17 J;  2JJ7 A;  2QCO A;  2CJJ A;  5FJ8 J;  4YG7 B;  3HOX J;  1JT0 A;  2R5Z A;  4JX6 A;  1ZR2 A;  5FKM A;  2BNN A;  2LYR A;  5M5X J;  1JTY A;  2VUM J;  1ZPQ A;  1WPK A;  1JFT A;  2K40 A;  4BY7 J;  1WH7 A;  4L5E A;  4XIC A;  2PUE A;  4B3A A;  1TWH J;  1JKO C;  1ZZB A;  5F1J A;  3H3V K;  1ZGW A;  1IGN A;  4JP0 A;  3HGG A;  2NVT J;  1PUF B;  4PU7 A;  2PUA A;  3BR5 A;  3SFI A;  1LCC A;  3ZQG A;  5EDN A;  2KEI A;  3F0C A;  1PER L;  3G1L A;  4IA8 A;  3HB9 A;  5EZH A;  2YS9 A;  3A03 A;  1BW6 A;  2Y31 A;  4V2F A;  4DZP A;  1AKH A;  2O4A A;  2VI6 A;  3O8G A;  2GZU A;  4DYC A;  3BT9 A;  3JXB C;  1LMB 3;  4UUS A;  3B6C A;  1ZZ8 A;  3HZI B;  3IH2 A;  3H5T A;  1ZZ9 A;  1BDI A;  2PUG A;  1ADR A;  3Q0V A;  5EG0 A;  3RZD J;  1LFU P;  4UUT A;  1MBF A;  3TRB A;  2PMZ N;  2L9R A;  5DTD A;  1Z77 A;  1RZS A;  1WCM J;  2DTZ A;  1NK2 P;  1MBJ A;  4DZJ A;  2EBI A;  3CDL A;  1FIP A;  4Y42 A;  1ZS4 A;  1RET A;  4D5C A;  3BDN A;  2KZ8 A;  1I3Q J;  2M9H A;  2O38 A;  2JN6 A;  2DMQ A;  2JMW A;  1MBG A;  2ME0 A;  1YRN A;  1QQA A;  2LR8 A;  4A3D J;  2M8G X;  1JKQ C;  4CYC A;  1UHS A;  1IJW C;  1JUS A;  3OQN A;  5J1R A;  1VI0 A;  3FK6 A;  4X4F A;  1JH9 A;  2FD5 A;  2R93 J;  1MH3 A;  1IV6 A;  2K9S A;  3A02 A;  1VND A;  2AXV A;  1MSF C;  5IYB J;  5C4J J;  1Y9Q A;  1QPZ A;  3BR3 A;  3S14 J;  1LE8 A;  2R7Z J;  1GUU A;  5DS9 A;  4RBO A;  1WH6 A;  4W97 A;  2CRO A;  1VFC A;  4X4D A;  1K83 J;  2NS7 A;  2WUS R;  2AUW A;  2AHQ A;  2WV1 A;  1WH8 A;  1WET A;  4C3J J;  3FYA A;  1APL C;  1R63 A;  3KJX A;  5F0F A;  1Z0X A;  1JT6 A;  5IP6 A;  3LSG A;  3DNV B;  3QPL A;  3O8H A;  4M3D A;  3B6A A;  4NDL A;  5C3E J;  1AHD P;  4FCY A;  4QIW N;  2R5Y B;  4FE7 A;  2IBD A;  2FX0 A;  2HDD A;  4A3G J;  1DWK A;  3B7H A;  5C4X J;  4YG1 A;  3MKL A;  2EZK A;  1RR7 A;  2ID6 A;  3GBF A;  1RPE L;  2CUF A;  3SCH A;  4PU8 A;  1S7E A;  1HCR A;  4AYB N;  4XRM A;  3G1M A;  1QVU A;  2LY9 A;  1FTZ A;  3VPR A;  3QF3 A;  4GQM A;  1BA5 A;  4BBR J;  2NOG A;  2AXZ A;  4BKX A;  2L7Z A;  1ZK8 A;  1AU7 A;  1Y7Y A;  4A3M J;  5IOZ A;  2IEK A;  1IRZ A;  3RZO J;  1RIO A;  2I10 A;  1JUP A;  1P7J A;  1UMQ A;  3BR1 A;  4X4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...