1O57A

Crystal structure of the purine operon repressor of bacillus subtilis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
270
Chain Sequence
KFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUR OPERON REPRESSOR
publication title The Purine Repressor of Bacillus Subtilis: A Novel Combination of Domains Adapted for Transcription Regulation
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 78
structure length 270
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
A PF09182 PuR_N Bacterial purine repressor, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o57A01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1o57A02
1LDKB 3RKXA 3R60A 1V3FA 2K27A 5IT9Z 2BV6A 1D6NA 4IXAA 4A5NA 2HZTA 1FSGA 3GGCA 4Z2YA 1S6LA 2PI0A 2KKOA 1G3WA 4PGHA 4RGRA 1BIAA 5E1XA 4RQBA 1G4DA 4WXHA 2L01A 4Q4ZF 4JQFA 3P9CA 4RB0A 3RTRA 3KLOA 2YSRA 1QB7A 4N9HA 3H3ZA 1Z6RA 2V1XA 3LPNA 3LSTA 2Z9OA 3D0SA 2OAZA 4KA4A 4P55A 2IPQX 1I27A 4QWQA 1O7FA 3AAFA 2YX7A 1XGNA 4LZOA 4R1HA 3WE2A 1Z7UA 2Z99A 1GHCA 5E38A 2DLLA 1Z7GA 1ZRDA 3MWMA 1TQMA 2QYOA 5FO5A 4BYYA 5HS7A 3HSEA 2GEBA 2EWNA 3O7MA 3FMRA 4CO8A 2ZNYA 2GXBA 5CLSA 4F8EA 1KQ9A 1RZ4A 3HOSA 2GIVA 4LJZF 4AIJA 1ZLKA 2RNJA 3V8KA 2V9VA 4HAMA 1TTYA 2WTEA 5ILVA 2M87A 1J75A 2L02A 4PGGA 3QP5A 3QAHA 3GW2A 5HLIA 2P5KA 4HX4A 4ZYGA 2BE5F 3ABTA 5H6QA 1OPCA 1PP7U 5DV5A 4FYMA 4ZH4F 4P81A 2A6HF 4HLYA 3BY6A 3C18A 3CO6C 5D6FA 3E5UA 3KB8A 2O0YA 4IJAA 3F6VA 4L9NA 4BH9A 3OZGA 2V1DA 2LF7A 2ZCWA 3L9FA 4I02A 2H06A 4P96A 1EV7A 3L2CA 2V79A 2P5VA 4M6XA 3E3VA 4FX0A 2VBZA 1G3YA 2E1CA 3ACDA 5HDGA 1BIBA 2H09A 2Y75A 3RPQA 3I59B 4Q47A 1G2QA 1U3EM 4YIFA 3G3ZA 3MAJA 4N0BA 3IKTA 5DD4A 3WGIA 4LG0B 4OHCA 2DFIA 5HS9A 1XTVA 3ULQB 2VT2A 1KQ8A 4IVNA 1FSHA 4AD9A 3HSFA 4JITA 2PMUA 4OMYA 2IGBA 1G3SA 2OBPA 4EM2A 4EQQA 1I5EA 4M0UA 3PQKA 3QPHA 3D5LA 4ENKA 1A98A 2FMYA 2JRTA 1FX7A 2VC0A 5L3CA 3P9IA 2YR2A 3HRUA 2K7LA 2ISZA 1QPMA 4I7HA 1XSXA 3TKYA 4YFNF 3RYRA 1JHFA 2YX4A 5H6RA 1YW9A 4CYDA 4U7BA 4O6JA 4UVBA 3K1NA 4AIHA 3HUGA 3ZN0A 5E1WA 2MC3A 3V7CA 3OV8A 1RUNA 2DW4A 2O6GE 1USTA 4OIOF 1J0RA 2F2EA 2P6SA 3BPXA 3T1BA 4Z1OA 1QCDA 4L9TA 3KP4A 4G6QA 2H07A 3Q9VA 5BQTA 2VOOA 3BJOA 1MKMA 3TO7A 2IVMA 1W4MA 5FFZA 4LFUA 3C3WA 2OQRA 2BYVE 2EFWA 3HTUA 4WF2A 4RAQA 2Y0MA 2MLKA 5AONA 1SFXA 1ZH5A 2JPCA 1DP7P 3KP7A 4EV0A 1OPRA 4HV6A 2L4AA 1VCHA 4XBFA 4GCVA 3TDZC 1T2KA 4MEYF 3RDIA 1D8JA 3W6JB 2XAJA 1TW2A 2MLGA 1QQIA 1GXPA 4P80A 1VSTA 1FBSA 2FBHA 1B9NA 3DFGA 3BDDA 4HOBA 1KU2A 1P92A 4DNCA 1TC2A 3MEXA 2IA0A 4EJVA 4O5VA 1A4XA 1BI3A 2D1VA 5FD5A 1JE8A 1SD4A 3ELKA 3J7AO 3F23A 3WTXC 1YFHA 1V9SA 4KDPA 2Q8KA 1W30A 1BOAA 1ZGAA 1QB8A 2CQKA 3DPLC 1K78B 2ZJ2A 4RQAA 4RGUA 4WMLA 1XZ8A 1FWZA 1XCBA 1SMTA 2PS1A 5D5UB 3ZMVA 1G2PA 1QZZA 4G7HF 2HCRA 4L0YB 2RDPA 2VXZA 5KK1A 1VTNC 1IW7F 5ESXA 1U5TB 3F3XA 1OYIA 1JHHA 4XLNF 2RQPA 3KP6A 3T5XA 1DPRA 2H6CA 2PMHA 5DCFA 1GXQA 1OMIA 2XKPA 4K2EA 5TRDA 1XDUA 3VFZA 1O7LA 3K0LA 2VODA 3KETA 1T6SA 1MZVA 4P83A 1XD7A 1AWCA 2LKPA 3TO9A 1FP1D 3CLOA 3JAMK 2EB7A 2V1UA 3HYIA 3R0AA 1DQPA 1OREA 3MFKA 3FMSA 2UXNA 3ROUA 4HF0A 2DPUA 3TOAA 2GQQA 3BPVA 2RC4A 5CVJA 1MDMB 3CUQC 4XRFA 4RV4A 5CYVA 2RVCA 3ISPA 3M8EA 3VODA 2CWEA 1O5OA 3F6OA 1U9YA 1S8NA 4OOIA 4NHJA 3FXUA 4HF2A 1T98A 3CDHA 4IHTA 3WTVC 1FOKA 1G3TA 2H08A 5LGNA 4IRIA 2UXXA 4U0WA 3KCCA 2COMA 4WXCA 3EETA 1ECFA 2GWRA 2IA2A 3HTSB 2W85A 4L9JA 5F64A 3LAPA 3EYYA 4M9XA 5LEKA 2KIFA 3M8FA 2HS5A 1DKRA 2PLYA 4OIRF 1S7OA 2VN2A 3O6BB 1HBXG 2PG4A 2IA1A 4LB6B 4M0PA 1EH7A 1ECJA 3EFHA 5JR3A 2E7XA 4GGGA 2DU9A 4KMUX 2JTVA 3LQQA 1WQ2A 1JGSA 3CUQA 4IRGA 2O8XA 2O03A 1HW2A 1QK4A 3MJDA 1OYYA 1F4KA 4M71A 3GXOA 2XAQA 2DO7A 3RKWA 5BMZA 2CFXA 2HTSA 3JTHA 1DBRA 4UV9A 1MJBA 1QO0D 2CYYA 3V4GA 1YS7A 4KIBA 2PRYA 2YZKA 1PUEE 5D4SA 5IAOA 1WRJA 3F8NA 2AEEA 1UHWA 1XDSA 5JI6A 2X4HA 2ZNZA 1MJ9A 3N2LA 4KN6A 3SZPA 2FEZA 5E20A 1W7PA 5DD8A 1BI1A 4S2UA 1U78A 4JBAA 2DT5A 2GZWA 1OKRA 3GF2A 4LZAA 3F8BA 3OOPA 4A6DA 3M9AA 3HHHA 5DUKA 5J6XA 1I6XA 1XMAA 4U0VA 3ZN1A 4BAYA 1J59A 1BD4A 3ZPLA 1FYLA 4MHGA 3ACBA 1Z05A 3SHFA 4P9FA 3PQJA 3LFKA 3LAJA 1USSA 3BOQA 4A0YA 1Z1DA 2QQAA 3Q9SA 5ILUA 3LA3A 4I0BA 4FX4A 2HEOA 3MZHA 1IN7A 2AS5F 3CTAA 1LJ9A 1K7AA 2OD5A 3V7RA 1FLIA 1VDMA 3O3KA 4KIFA 2XAFA 5DDGA 5FLXK 4RHTA 2M30A 2MA3A 3COAC 1XSDA 1UFMA 4ASNA 5TJJA 5CVRA 2UWMA 2KJCA 3DEZA 1STOA 4P5OA 2EFQA 4AWXB 1XTTA 1PP8F 5D8LB 1L3LA 1IN5A 2C4KA 3WE3A 2ELHA 2VBYA 3M1EA 4EM1A 3FHZA 2PFBA 2FU4A 5F6FA 3GUDA 4G6DA 1U8RA 2ADUA 4TV7A 5D8KB 1REPC 5BPIA 2DY0A 1LQ1A 1Z6TA 1XGOA 3I71A 1XB4A 3MCZA 2K02A 5JVTA 2XAGA 1U6GA 2P8TA 5HKLA 1O3TA 2DK8A 3JSPA 1KA8A 1BC8C 1YTYA 3WODF 4MEXF 2HTJA 5LGTA 3K2ZA 2R7DA 4IF4A 5KAPA 5JFRA 1CGPA 3KE2A 1FNNA 4L9VA 2K4BA 4I98B 4IHSA 3BP8A 2XUBA 2W84A 2XRNA 5HDKA 3S5JA 2FRHA 4KNYA 4RHXA 1XTUA 2DTRA 1D5VA 2RGVA 5FGMA 1EH6A 1T0FA 2PBIA 2WNSA 1Q1HA 5ILSA 1J2XA 1IN8A 1I0IA 1S7AA 2JT1A 3ML6A 5CJ9A 1UB9A 2F5FA 3E6DA 2HQRA 5L3DA 4EMSA 3G73A 4U0YA 1LB2A 1U2WA 1YW7A 1A96A 4PAWA 2JSCA 1WSUA 1ZG5A 5ED4A 5E8GA 3E6CC 4RS8A 4G9YA 5FB2A 4RAYA 4ZFNA 2P5LC 1I1SA 5BQOA 3F8MA 2BGCA 1MD0A 3PFIA 2PRZA 4L5IA 4RHUA 1L0OC 1P4XA 3RI4A 1P19A 4L0ZB 2VONA 3BJAA 3IKVA 1XGMA 1XZNA 2FBIA 4LLGF 5A2QK 5LHHA 4QLCU 3O2PE 3GGJA 3EDPA 5CVUA 2O61A 4Y17A 3WTSC 2ZKZA 3F8FA 3F72A 1MZBA 1LEAA 2AXLA 3LQRA 5IT9K 2D45A 3EYIA 2HDCA 3KLNA 4RANA 1R36A 2OZ6A 1ECBA 2ZMEA 3FM3A 4BQAA 5L3EA 3HSRA 4LGWA 3FM5A 1QBJA 3F8CA 2XGXA 5DCMA 3B73A 2K86A 3ZMTA 1WKMA 2R3SA 2XVCA 2LDUA 4LYGA 4CICA 3OHPA 1SD6A 3NQOA 4G8XA 4YFXF 2IT0A 4OIQF 1FPQA 4A0ZA 4X45A 4QRIA 2TDXA 4A2UA 5LHIA 2FXAA 4HQMA 2EJRA 3KP3A 2HWVA 1ODDA 3TO6A 2DQRA 2ACJA 5BPDA 1FYMA 3ZP5A 2A61A 6PAXA 3L7WA 5JV5A 4XSZF 1HSJA 2FF4A 3DF8A 2MD5A 2CG4A 1I1GA 3U2RA 4R79A 3G6WA 3JTGA 4IPAA 5KAMA 2L3DA 2D1HA 4CHUA 4TWBA 3U1DA 1KQ0A 2G7HA 2EFNA 1J9IA 4QYIB 2W57A 2QLZA 1ULYA 2J5OA 1I13A 2DBBA 4RAOA 1HKSA 3HIFA 4G7ZF 1ZRCA 4KYWA 5BOXA 4CXFA 3WTWC 2FBKA 2P1ZA 1ON1A 2M8EA 1D8KA 2ISYA 3W6KB 1A95A 4BHPA 2HYFA 3BJ6A 2M45A 3CUQB 4RB3C 5L3GA 2XROA 3E97A 5HDNA 3WTUC 5K51A 4F7ZA 4KIGA 4GO1A 5CVVA 1P6RA 3GEZA 2MH9A 1B4AA 4RACA 4ENJA 2Z3YA 2JZYA 3IHUA 2STTA 1B59A 4MB6A 2JKZA 3DKWA 4IRHA 1R1VA 2QBYA 3QP6A 3TQNA 3RJPA 2PQ8A 5K5RA 3S2WA 1KGSA 1BM9A 4ESFA 2YU3A 1STZA 1W7PB 2W24A 4JLSA 4I2OA 3GFJA 4KFCA 1QCCA 4LLLA 2A6EF 4BNCA 3NRVA 1K79A 3T8RA 2F5DA 4A5MA 4BHCA 1QGPA 3ECHA 4HQEA 1SD5A 5AIQA 3SFZA 4A6EA 4ZYDA 5EUCA 2O3FA 4GXOA 3GFIA 3NAGA 2GXGA 1IN4A 2QM3A 3WGGA 5BQPA 1OR7A 2HKXA 1TC1A 1KU9A 4RB2C 3ZMDA 1ZN2A 5JHUA 3QU6A 1YQAA 3DXJF 4LMYA 2JPBA 1Y0UA 1FC3A 1KYWA 1R1UA 2FQ3A 2L4MA 3R0JA 4HZFA 4KN7X 1CJBA 3GZ6A 2BBYA 4HBLA 3V8LA 4MGRA 1RIOH 3R6SA 1XSVA 1BC7C 1O3QA 2XBUA 3VOEA 1LH0A 1ZN7A 3GX4X 1ZREA 1F1ZA 2P6TA 1IXCA 3ZMZA 4DQ2A 3SQNA 3LWFA 3E5XA 2XIGA 2M5WA 3QU3A 1RI7A 1ZHFA 2OQGA 3HRSA 1DQNA 1O3RA 1IZ1A 1W7PD 1IRGA 1JLSA 4HA8A 1WWXA 1ZN8A 3V8JA 1RNLA 4M73A 2HYGD 5D6EA 2W25A 5L3FA 3N97A 2WC2A 1LVAA 1F5TA 1TLHB 1PDNC 4LD5A 1I5ZA 1ECCA 2RN7A 4ZZLA 3WG9A 2P7CB 4ZZDA 3I53A 1HW1A 4RB1A 2ESHA 1B1BA 3T8TA 3IL2A 1ZARA 2IRFG 1R3UA 4EJWA 5FD6A 5HS8A 5D4RA 5HLHA 1SD7A 3GYHX 5DEQA 1QNTA 4KN4X 2A3SA 2NNNA 2Y48A 1Y0BA 4XSXF 3HRTA 4PDKA 2RKHA 3J81Z 1T39A 2EA4A 5E1ZB 4X44A 4EJOA 5IPFA 2KJBA 4M0KA 1RUOA 1CF7A 1QZYA 1NHAA 2KIMA 3B02A 1Z91A 3K69A 2CGPA 1HQCA 3CUOA 2NRAC 5HOOA 4I0AA 2QWWA 2QUFA 1L1RA 1WD5A 4ZYHA 1TNTA 4FHTA 3GVAA 2A5YB 2A69F 4UV8A 4HX7A 3R61A 1DDNA 1H0MA 1KU7A 1X3UA 3DAHA 5LEJA 1R5GA 4RGXA 2HKOA 4N9IA 3K9TA 2K4JA 1YS6A 3FF5A 4GYIA 2HGCA 2M1BA 3OZFA 2H94A 5E17F 1TQIA 1Z9CA 1ZRFA 3FX3A 3M7GA 5ESWA 3IRQA 2DQLA 2Z33A 4ZYEA 3FZVA 1MDMA 5CVIA 1MGTA 2ZXJA 4M72A 4YIIA 4RGSA 5EEGA 2D2WA 3NEUA 2EV6A 3RYPA 4GYGA 2FA5A 1BI2A 3BWGA 4Q48A 4I09A 4HDUA 1R58A 1DUXC 4KUMA 1TQPA 2WV0A 2JKYA 2DAOA 3GO5A 2ZMEB 1SFUA 4NB5A 1TNSA 2VT3A 2DK5A 4PZJA 3QOPA 2XAHA 4MQ9F 1R23A 5DCMB 5LLQA 1XGSA 3VB2A 2ESNA 2DPDA 1E2XA 3H3UA 4UXNA 3Q5FA 5HIAA 3KEOA 4IJQA 2HR3A 4P84A 2RV8A 1YYVA 4O3MA 4CGZA 4WN3A 2R7FA 3IRRA 1BN5A 3CJNA 3L09A 2Z5UA 1FBUA 4PCQA 4R8HA 3TDUC 5EEHA 4M9SA 3MBIA 4BHBA 2H27A 3IWZA 3I4PA 5H20A 2JBHA 3N4MA 1E17A 3WGHA 4ESBA 3GFLA 1HMPA 4PFQA 2QZ8A 3HRMA 4NQWA 4UNOA 4P82A 4B09A 1LDDA 1A3CA 4HLXA 1KU3A 1L1QA 3CO7C 5BSKA 2E1NA 4U7DA 3IC7A 3ACCA 3P9KA 4A12A 4UVAA 3I64A 3BROA 3GFMA 4ETSA 1ZG3A 3H92A 1I0LA 2LSOA 4OIPF 4E70A 1FY7A 1JXSA 4EGYA 2NYXA 3DQVC 1YO5C 1EH8A 5BRNA 3WTYC 2FOKA 4MTEA 4HF1A 2L54A 4P86A 1BJAA 1MJAA 4KMFA 2PEXA 2FSWA 3GWZA 2F5EA 3WTZA 3FXRA 3U9GA 3K1PA 4EJUA 5K1YA 4AVPA 4ON0A 2VBXA 3LRTA 3J81K 3BZ6A 4L5JA 2EFPA 4S04A 1NONA 1U9ZA 1ECGA 2IP2A 1TBXA 2QQ9A 4MTDA 1G9SA 2QBYB 3ZMSA 1P4WA 1TW3A 3JAMZ 1ONVA 2NNYA 1UPUA 2CW0F 1R00A 5ICFA 3FXQA 1YLFA 3ERED 1ZGJA 3TGNA 4CDGA 2P7VB 5FFXA 2C6YA 1UCRA 2FNAA 4CZZA 1H9GA 4G94A 3EQLF 4EM0B 2VE9A 3F22A 1WI9A 2VE8A 3KP5A 3I58A 1FP2A 2DI3A 1HKTA 1XN7A 3SXYA 3EUHA 2ETHA 4WCGA 1LEBA 1KYZA 5L3BA 3QW4B 1A04A 2EHJA 3V7SA 2GA2A 2ZBKA 3WU1B 1XMKA 5K5OA 3E6MA 1W5TA 3DMPA 1J5YA 4ENNA 3JSOA 2NS0A 5LGUA 1UPFA 2LNBA 1YW8A 5KVRA 1UFRA 2NAZA 3LA7A 1T38A 2XHKA 5ICEA 4LB5A 3KZYA 4L18B 1YFZA 2JI4A 1C0WA 1IXRC 2QVOA 2YPRA 1H9TA 1P18A 3RPUA 1O3SA 4S05A 3HOTA 1ZYRF 1G6NA 4HV5A 3QRFF 1ON2A 3R4KA 2H6BA 2MH2A 1IF1A 3SZTA 2XASA 1B6AA 5F1RA 3DPTA 1IN6A 4M74A 1F9NA 2XV4S 4RABA 1IXSB 1IAWA 1FBQA 4ESJA 2UZKA 1I14A 4RHYA 3KFWX 4H0EA 4MNUA 3JW4A 1K6OA 1GVJA 4UHTA 1J7KA 1LNWA 3H83A 2VC1A 2HFHA 2Q2EA 2VOPA 4LYYA 3GEPA 1HKQA 3MQ0A 3KZZA 2VFAA 1UHMA 2Q0OA 5D5WB 3ZMUA 3J80Z 4Y15A 1ZAOA 2EA2A 3I59A 5AIPA 4M6YA 3I0TA 1HGXA 1P17A 2ZO4A 4HX8A 1P2FA 2KIUA 4LG0A 4RAZA 1HXDA 3P7NA 1ZN9A 4LK1F 4LZNA 2HQNA 4HW0A 3GLXA 2A07F 3ECOA 5LBQA 1LDJA 5J8CA 3MZYA 4UUVA 2EFOA 1CF7B 1W5SA 3TOBA 5DUIA 5JSQA 2IJLA 1J7JA 4AIKA 2BEOA 2GA1A 4Q5SF 1BZYA 5ICCA 1BI0A 2F5CA 5DYMA 2E7WA 1D3YA 2XKOA 1S3JA 4WWCA 4WXDA 1JLRA 1YIOA 5HVQC 1R1TA 3F21A 5FLXZ 4RADA 1AO0A 4G7OF 3DV8A 4YG2F 1IUYA 3IWFA 2VBWA 4I01A 4WK8F 3KP2A 4LLNA 3E6BA 4JK1X 1GPH1 4P3KA 1A97A 4UVCA 5E18F 1IBSA 2EV5A 2OA4A 1FT9A 2PJPA 1SFEA 2CO5A 4HYEA 2LF8A 1B9MA 3LA2A 2OZUA 3GZ5A 2X0LA 2GAUA 3ABUA 4XLPF 3FMQA 1P4AA 2B0LA 4U88A 4OU0A 3DEUA 1AOYA 1O57A 3DP7A 4ENMA 3KEQA 1GRVA 3L00A 5J8FA 1S29A 1SAXA 2J5PA 4OMZA 3C1DA 1BBYA 1ZG1A 1R22A 2G7UA 3T0YA 5IT3A 4BXUA 5ICGA 5D5XB 5K5QA 1V4RA 3FWEA 4P9UA 2FE3A 1FZPB 3I5UA 3HHGA 1SMYF 3WTTC 1DPUA 4MQVA 5HLGA 4EGZA 4OINF 1U5TC 5LRRA 2EV0A 3M3HA 1XCVA 2G9WA 4QYIA 1YG2A 1OYWA 3RIRA 4A0XA 2QQBA 1HW5A 3REOA 1IRFA 4WX9A 2MBFA 5BS6A 1QK3A 4B8XA 3WU0A 5LRSA 3QPTA 3E5QA 2ZFWA 2OU2A 4Y13A 1FYKA 3C7JA 1R7JA 5D5VB 4D0PA 4HDVA 4FT8A 4KT5C 4M9ZA 2PN6A 1HSTA 3I54A 1BD3A 1K78A 1NULA 2KRFA 2IW5A 1DKUA 3VEPA 2V6CA 2FNPA 2FXVA 3RKYA 5LHGA 1QK5A 5ERIA 2WWYA 2A68F 2FMLA 2E55A 5E8IA 1PZMA 2CSOA 2STWA 2EK5A 2HOEA 1R5HA 4YFKF 1G9TA 4KICA 3ZQ7A 1OROA 1U5TA 3HVUA 5A2QZ 4LK0F 3J80K 4EJTA 3K1MA 2P4WA 1ZLJA 2QENA 1FSEA 4EVIA
chains in the Genus database with same CATH superfamily
2J9FB 4Y9UA 5CA0A 4S1PA 3F1LA 2BV6A 1L1EA 3OQIA 4UCXA 4C0AC 4B81A 3P2OA 3RSHA 3LKDA 4W9RA 2QNIA 2KKOA 1H9BA 1KZHA 2DB3A 4YDSA 1W34A 1QFJA 2JAQA 3RIXA 4D3XA 2YUTA 3RS9A 2TYSB 4QBIA 4PQGA 3C70A 4LVUA 2P7HA 3UKGA 1RQPA 4EYQA 5JPIA 1K3TA 3BE4A 1QHEA 1Z2CA 2Z9OA 4YRRA 2OAZA 4I8XA 1DEHA 3EEFA 4FZJA 2W58A 2K87A 1VGVA 5DSZA 5J2UA 2YX7A 1PDVA 2BW3B 2XTZA 4QOGA 3PJGA 3NTRA 1TYAE 5E38A 5CA1F 3T7TA 1TQMA 2DFEA 5FO5A 2HT6A 5HGJA 2FW6A 2XF8A 3O7MA 1RKQA 5H3HA 2XQGA 4FEEA 2ZNYA 2CNKA 2CE2X 4JP5A 4PZAA 3HUDA 2BL4A 1COZA 1OCCH 2E36A 3G1TA 2HTEA 1QGED 3QHQA 2PX6A 2AG1A 3RK1A 1IZ8A 1YRWA 1W44A 3VZBA 4HX4A 2BSQA 2HHHB 4MRNA 3DZJA 3LZDA 4UM9B 1A9ZA 3OS2A 4QOEA 3A6GA 4Q1DA 2BTQB 5DNUA 5AVZA 1T10A 4Y67A 4IQ8A 5B30A 2Y1DA 5M04A 3T3NA 1Y56A 3LH5A 4XNFA 1JALA 2X19A 4HLNA 1T29A 3BD9A 3B1YA 2EZKA 2Q2EB 3K5PA 1DIGA 2ZETA 4XOIA 2EG5A 1MAAA 1NVXQ 3Q3CA 2Y69H 1JFLA 4Y2YA 3GT3A 3DO8A 3G3ZA 4I3GA 4N0BA 4FK8A 4BJ6C 4N18A 3LDHA 3DS8A 3MINA 2NXCA 4RMGA 2LREA 1U1CA 1E96A 5CFNA 4KP7A 2R7OA 4DKJA 2E1PA 2A4KA 2O2IA 3LUBA 2VUHB 1E4VA 3VJKA 5CFZA 1E79A 2DX7A 2JLXA 1T2UA 2XZDA 4Y2UA 3T9BA 3HLTA 2WM2A 1SHLA 3TKYA 4YFNF 2PKYX 1P6UA 3E0XA 2YX4A 4OFWA 4RM3A 3E9EA 3WO1A 1I3MA 3HI6A 1VHTA 3ZN0A 1T8UA 3TVYA 4D4JA 1Y1WJ 1U81A 3GBSA 5BN4B 2CFRA 2O6GE 3U3ZA 1J6UA 5CLIA 1RAFA 4L9TA 1V4VA 4G6QA 4BQSA 5JLWA 2ZBEA 2AOVA 4JODA 2P2ZA 3W05A 5FUXA 4FQ7A 4U4AA 4JCOA 1KVTA 1OI7A 3H75A 3TFOA 5FUVA 4A91A 2R2AA 4O3FA 4A1FA 1PQUA 4I5DA 3BFXA 2Y0MA 1ODTC 1ZNZA 3ZWQA 3VSKA 2V74B 3O1LA 2JPCA 4KIWA 4EV0A 2ONYA 1HDZA 1I2DA 3KPUA 2OYRA 2BEJA 1R6UA 3TGWA 4OUKX 4ABZA 2R8YA 1D8JA 3W6JB 3MFYA 3MT8A 2C84A 3BZKA 1Z82A 5CKTA 4K3VA 2HQ5A 4D5EA 5JY1A 3ES9A 3IYLW 2CW7A 3QPSA 4NE7A 5AHXA 1DRUA 3WRVA 4OHWA 1TC2A 4KXUA 3VKUA 2R5ZB 5KMGA 2PAFA 1ZD1A 4OQYA 1ITYA 5CK5A 3CW8X 3KSMA 3ZI4A 1XZCA 5JWHA 2ZSHA 2CEKA 3AG2H 4PANA 5EZYB 2Q8KA 3HDQA 1F4VA 3MMSA 2ZRGA 1RQXA 3HL0A 2EX4A 5E2AA 1RBYA 4LVNA 3DT8A 1E7QA 3HNOA 1K98A 4EKYA 4GI7A 3TIGA 4UFNA 5CVTA 1UKVY 1YS2X 2JHPA 1E1QA 3SXPA 3U3MA 4Q9DA 4C4OA 1G64A 3H9BA 5EHZA 5AVTA 2RDPA 2CH0A 1N6RA 5AP9A 1EX9A 3PQ5A 1RWXA 5ESXA 1U5TB 5ENVA 2WHXA 1JHHA 4XLNF 3IQXA 4KUEA 2C2HA 3K9HA 1DQUA 5DCFA 3WC4A 3K72B 4D4KA 1C8BA 1RPWA 3TB6A 1SVNA 4C05A 1WKCA 4TRMA 4ZC1A 4HHEA 3PIDA 3SIRA 2GNOA 2UXNA 3BWVA 4BLRA 5KVCA 3NAUA 2ZI7A 5AXCA 3CMMA 2OP1A 4ZCMA 4EA6A 5KPJA 4HPJB 1W25A 5KJ1A 2VYVA 5FPSA 1YZQA 1U28A 3M8EA 4ALNA 5JH7F 1NASA 5FLVA 5FLYA 3WHPA 2CUTA 3IXMA 1IWOA 3CCLI 3UENA 2QSHX 4MFDA 3K2QA 3ORHA 3EA0A 1MAWA 2ATEA 3DOFA 5JZOA 1NYTA 1DJOA 3LHFA 4ALMA 3EETA 2AOUB 3ROFA 5J40A 4V38A 2XV1A 3OX1A 5EP3A 2OZVA 4UEKA 5C8ZA 2HQSA 4CMHA 4AJNA 4EHNA 3KJZA 2IA1A 1EH7A 3DKKA 4KUHA 1H2XA 1ILEA 4NCAA 1T2FA 3TP0A 3LSIA 3KOYA 4GMXA 1ADCA 2EL7A 4TXJA 1JGSA 2QW8A 5C3EJ 2ZI6A 2RBKA 2O03A 4P1ZA 3JQDA 1CDOA 1QLJA 4M71A 5DULA 1PYVA 3IILA 2VHJA 1FTZA 1X1TA 2D06A 3ZV4A 1KDPA 1MJBA 2GDZA 3H1TA 2OM2A 2VDNB 1N6LA 1M5UA 2HU5A 5EY5B 4ZPXA 3P2KA 4RK4A 4JQYA 4Y2TA 1I6WA 121PA 2J9XB 3BGSA 1KO4A 1TJ4A 3U17A 2ZTMA 1ZK4A 2IGOA 3HFSA 1JKMA 5C1DA 2V9KA 1PS8A 1JUMA 1E3JA 4MUYA 2MR6A 3E3LA 2AD5A 5AQEA 3OZDA 4R1MA 4U0VA 2PAAA 3NUZA 1GTG1 3FUUA 4FFSA 1E5TA 3SS7X 4O4LA 4A0YA 1AOXA 2KB0A 3CP2A 2OB1A 4NP6A 3OMWA 4FEGA 3FROA 1TPZA 2XITA 4BVBA 2IYYA 2HEOA 1TQ4A 3SLKA 4NRDA 1KYXA 4YXWA 2OD5A 4BU2A 5CQGA 1DXYA 1JR3E 3UMFA 4FNMA 3G8CA 4PFKA 5TQ0B 1XSDA 1Z56C 3QXGA 1MORA 2CL5A 1KETA 1NVWQ 1OXTA 2W22A 2EIKH 1STOA 3AW9A 5FLMJ 3UJ6A 3WJ7A 4HDNB 4H4CA 1EHCA 1FFYA 4IOAF 2NTYC 2BGLA 4WAUA 2QG4A 2PFBA 2YH2A 3Q2IA 5E7IA 3PQDA 1Z7EA 1E59A 2FR1A 5LIRA 5BPIA 1SBQA 2LIVA 3SGLA 5K3FB 2JBWA 4POAA 5IASA 1JHXA 3MYRA 2IRWA 3EFEA 1KA8A 2X8BA 3IXLA 5K6TA 1AGRA 1A31A 4XB2A 3BAZA 3WODF 1YZYA 2HTJA 3GLGB 3BCRA 2CS3A 1V26A 3AJ9A 3RGWS 1TM7E 1DRKA 1VJGA 3LWBA 1DUVG 4BNWA 4XZ3A 5MFPA 3EMVA 1FQOA 3OH8A 2WNSA 1NG6A 1J39A 1MC8A 3JX9A 2E48A 1A9RA 1F8XA 1VKJA 3ML6A 5ALXA 4N82A 1IMOA 2HJVA 3AJAA 2ZJPF 2VR1A 4LJ4A 5CJJA 3G73A 4A3DJ 3VNVA 1RYZA 1VE7A 4G4GA 3GBVA 4EJ0A 4CYCB 3NWTA 4UDNA 2H31A 5AUNB 5C31A 4Z6YA 4PYMA 3OZXA 3K70B 3OBIA 5BYKA 3DOIA 3GNQA 1U8AA 2PGAA 1X8LA 3NALA 2RK3A 5AKJA 3DL2A 1HQYE 3PRJA 2IOFK 1KDOA 2VSFA 5L3RA 4L0ZB 4DSZA 2QV0A 5IU6A 1PLKA 1LKXA 2WAQN 1XKTA 4GGPA 3PPIA 3OC0A 3VZCA 1V7QA 1JIIA 2ZATA 5E4TA 3O2PE 1XKQA 2P2CA 4BO3A 1G38A 2E5LB 2ZM6B 3NP7A 4MDHA 5A6SA 2Z9BA 3H2IA 4DLKA 3SP1A 4BQIA 1LPPA 4O5AA 3ABLH 1UMCB 2OFPA 4QVKA 1UL1X 1N33B 3MA0A 1R36A 3GBPA 5IKMA 5EJ6A 4WXEA 2OJED 4UUNA 4V0LA 1VHJA 3B73A 2R3SA 2VJCA 1Z75A 4YRGA 1Z08A 1NV8A 1F9EA 3UYKA 3EXAA 4XEUA 4M8IA 2RHLA 3K70C 1SU8A 5J5AA 3ET4A 3WGLA 4A0ZA 4CSWA 4L9AA 1G60A 2DSNA 4B43A 4GI2A 4RK7A 3RAFC 1N3IA 1JHUA 2BMJA 2QUKA 5JV5A 1I0ZA 3F1KA 3NQ41 4FU0A 2MD5A 3O8QA 3T5BA 1P3DA 3QLVC 4LN1A 1U1IA 4G2TA 1HCRA 4R2LA 2L3DA 2A33A 4MWCA 3H99A 3QLUA 4L0CA 2EW8A 1U6JA 2CL0X 1W7AA 4B9AA 1DWOA 2MHCA 2CJJA 1W4RA 3T12A 3JYQA 4YJ2A 2G0EA 4HRYA 3CC8A 4HO1X 3N0XA 4MQBA 3AI7A 5AVOA 4DJ5X 2IKQA 2VL7A 3WYFA 5DDIP 3IJPA 5HCNA 5K7SA 1OX6A 1DAIA 2PIAA 3ODGA 4LVOA 1NXVA 4GO1A 1VJTA 2WFAA 2MH9A 3W2GA 2V98A 4DMCA 4MCJA 1W8DA 1TTQB 5K8LA 3ZQ6A 4M49A 4MDEA 5K3EA 3AM4A 5M3MJ 3DU5A 5TRTA 1ARZA 4WSOA 5LOVB 4JX5A 5AUPB 2DRIA 2HMSA 5E1OA 3R8CA 1JNYA 1S7EA 1N7IA 4G89A 2HDNB 1R4NB 3T8RA 5JAZA 2ZXHA 1G20B 1I7LA 3HS3A 4XYEA 1MJFA 3BILA 2JLWA 3H13A 5ED0A 5T5QA 4G9GA 3TN7A 1GGHA 1QG2A 4BY1J 2HU7A 3WLKX 4YT8A 4I1YA 4RS3A 1E4YA 4QUDA 4KQKA 2CLHB 2B7EA 4AN0A 2ZRFA 3TZBA 5A4MS 1H6AA 3TLBA 1BCRA 4HQFA 1UBMS 1D4FA 1I24A 3RSFA 2ZXFA 5AI6A 3VV2A 3IEVA 1OWPA 4XVHA 4XB1A 3EQ2A 4LYDA 1V48A 2AI3A 4PLCA 1SKQA 5DM0A 3VNSA 3E5XA 1R8XA 2QA5A 4HDMB 3AOEC 1PVVA 2OQGA 3DE2X 2AXEA 2I2WA 1B1AA 1YA6A 1JLSA 3IKMB 4FQ8A 2NZWA 4GQAA 5BYJA 1F5TA 3O31A 3WG9A 3W5SA 1WF6A 1ZAYA 5GM2A 1QBGA 2QRKA 2JD1A 1R3UA 4EJWA 4W1SA 5HS8A 1ADGA 4Y2GA 3N87A 1ZLXA 1S89A 2IT1A 3EIEA 1Y0BA 4Z86A 1TO6A 4DJJA 3PJRA 4FQGA 2C96A 1GCAA 1XZKA 2PUBA 3UAVA 1B72B 2Z09A 3TS1A 1LVHA 4C3OB 2G72A 3AUXA 1HSZA 4HLDA 4UHJA 5D7NA 1QZYA 5I5GA 4NC6A 1L8QA 4MDYA 2B8JA 2MDTA 2O2DA 3LT5A 1BRMA 421PA 4NPAA 1LV8A 2VJ4A 1MW8X 1QX4A 2C54A 2DA5A 4FHTA 4DNOA 1Y1QA 1Z0SA 5IBQA 3PDCA 1V95A 4GPAA 1QGOA 3B5EA 3CKMA 2FP3A 1R5GA 2LY1A 3EGOA 2D5VA 3OZFA 4IHWA 2IZ1A 1PJSA 4GXTA 5BMVF 1D1PA 1JHRA 4NZOA 4BQPA 2A3NA 3HYRA 4INJA 2Q0QA 4FHGA 3THXB 3WIVA 4IKFA 5AH0A 2VPYA 4OP2A 4RTPA 4PSXA 3SPXA 2PU5A 5FO0A 2W83A 1SFUA 1QIKA 4KR3A 1QKKA 2ORYA 2NSJA 3EPRA 3VZSA 4QJ3A 4RFSA 2ZJYA 4BP8A 1SBHA 1HNWB 2DLCX 1NOIA 4MJXA 3EUWA 2R7FA 2GPAA 5WRFA 2GLOA 3QVOA 1SOAA 4RBOA 3AP1A 3BL8A 1F9AA 2OTJI 2Q0HA 1P77A 4G1FA 2FEKA 4J3JA 3TCKA 3HRMA 2VDMB 4UNOA 2C5AA 2FZ4A 4G0WA 1EX6A 2CW8A 1WNFA 3V80A 4UFPA 1XEAA 2XZLA 3I64A 2DWPA 3QELA 3GFMA 2CUEA 3T35A 2RIPA 1FNMA 1HT0A 4OIPF 4ZT3A 1E6WA 4OEHA 4E5YA 4B6EA 2JIRA 3DDZX 1GPKA 4TMVA 5DCYA 2WD9A 1ZM4A 1NF3A 4B4KA 3EW9A 4LHSA 1EUCA 5CPBA 2CJFA 1RYEA 4ZCLA 2HHCA 1Y4ZA 2OGZA 4ON0A 4LW8A 1LW6E 1E2NA 3S7TA 4Q7QA 2IP2A 1ZY2A 1XZDA 3K8QA 4MTDA 4LYFA 3ASUA 1TW3A 3JAMZ 3K1AB 3F5SA 1U7WA 5B7PA 3JWHA 4OV6B 4ND2A 3CUKA 3OJXA 2CJYA 4IQGA 1YQUA 5FYQA 2VT7A 2QVBA 3HV2A 3ZTWA 5BPHA 3EXFB 3CW9A 3FLMA 2VP3A 3GXBA 3JY6A 4MTLA 1B8IB 1T5HX 1D2NA 2VDJA 1Y63A 3Q1LA 5JZSA 1CJTC 2GF0A 5I7UA 4J1NA 3J7AC 4D9NA 2Y9MB 1G8YA 1JG7A 4EFMA 4XQEA 5KJFA 4J29A 4YRVA 5EIBD 4S0HB 2ZBKA 3PUYA 1ZM9A 2RGDA 1KI2A 2EQRA 2X14A 5J43A 5E0OA 4A2WA 2GEJA 3C15C 4B3CA 4PS0A 1EINA 3G5AA 1D3AA 3IDFA 1N75A 2IXSA 2ORIA 4EUSA 5FHQA 3MUFA 1J2TA 3KZYA 1BHQ1 4B6GA 2B92A 1BRTA 1RJEA 1GFIA 2ZIUB 1P18A 4N0MA 3PITA 5AKKA 4WKPA 4GE3A 2GAOA 4REQB 3PSIA 2YCLA 4N01A 3ZQJA 4DIEA 4JLBA 4G0UA 1YL6A 4I50A 3T1HB 2Q1YA 3E7LA 2IOQA 2UUZA 1FS4A 2GLUA 4Y1RA 1N3YA 1K4TA 3PKJA 3GLUA 3DPTA 5CDYA 3WMXA 4D9MA 4WJZA 2KWIA 1I14A 1T4CA 2GYWA 1OLTA 4H0EA 1GYPA 1T3TA 2I78A 2WICA 3OM8A 3PGA1 3FCUB 1XSEA 3RJZA 4FFMA 1XRSB 4UAVA 5DV9A 3FJ1A 5FL7A 3OOWA 1YASA 3IE1A 2XSZA 1O97C 2QRVA 2BFEA 1G63A 2VK2A 3PVSA 1AU9A 1P2FA 1R7RA 3P7NA 1FYXA 3PIRA 3HXPA 4OOEA 4YAJA 4ZEOA 2O2JA 3RS4A 5EUMA 1OX5A 1NBMA 4S24A 3HC7A 1QWSA 1OCEA 3T6KA 2ZPUA 5E79C 2I8LA 2JFHA 1U65A 5KNCD 4IJUA 1M7HA 4FE7A 4F92B 3TGPA 4IYRA 2I1WA 3F73A 1HX7A 5LYJA 3VQTA 3LDUA 3CCFA 5FBLB 2I7CA 2FPGB 3PM1A 2K2QB 1A2KC 1PNTA 4LLNA 5LQUA 3HP1A 5HXAA 1T3SA 2UDPA 5C1OA 3DDCA 3MCTA 1UOEA 3CVOA 1HYHA 2GJKA 3ESXA 3HCDA 4EEZA 2VH5R 2FWJA 3CWCA 5B7GA 3HCFA 1AOYA 3FRJA 2QROA 1VPTA 3ORFA 4ENMA 4YP5A 2X1MA 2JIOA 2AWOA 4MKXA 1FQKA 1A7UA 2J0UA 5H16A 2FE3A 1GRRA 4D97A 4HZIA 2G0NA 3WTTC 1DPUA 1P62B 4BLSA 2F7SA 2I6QA 5LRRA 2MMGA 1JIKA 3G5MA 1V5EA 3W6UA 3BF8A 5DK6A 1YNSA 1JHYA 1SCNE 3KBOA 2V7UA 1P72A 4N3NA 4OXKA 4OMDA 3CKKA 3PX3A 1VL6A 1KORA 1TRKA 5K0ZA 2G5CA 5EZSA 2YDXA 4QGSA 2ZJAA 2HMTA 4H7HA 5ITSA 4D0NA 4D0PA 2NZ8A 2HVSA 4HGPA 4PU0A 4HWKA 1QIIA 1YRNB 1VQOI 4TX1A 1OE0A 3RKYA 1XQWA 4HKTA 3NEJA 3UA3A 2X1VA 2E55A 3H1PA 4QTRA 3CMEI 1M73E 1HNNA 1X1AA 1R5HA 1IQUA 1ZZGA 2GBCA 3HVUA 3L8MA 1PL8A 2YN2A 3V9AA 1IDOA 3ZQIA 1KEEB 3KO8A 1T3LA 2X9QA 4URXR 4GI1A 2XPWA 3LVQE 4RTSA 2ME0A 4G5RA 1HFKA 5K8TA 2GERA 3R3WA 1MX3A 3IURA 4XOTA 4FYHA 5CVEA 2XWSA 3DCNA 2M2EA 1G19A 2L7ZA 3PO3J 2O07A 2OSVA 5C4JJ 2YJ5A 5DYYA 4KCGA 4IMIB 3OR2C 1TK9A 2Z6QA 1Z6RA 1NYLA 1JSCA 4KA4A 3L79A 4LAFA 4OSEA 5LXTB 2HLDA 4QOJA 2IPQX 3JRDA 2IOHA 1IZYA 3H0CA 1O03A 3W5BA 2ZIFA 5FDFA 4ZKDA 1N8TA 2L0XA 5K2OA 5BV1A 5AXDA 5C46F 4TKZA 4OVKA 5IAAA 1W6UA 3L84A 4UREA 2UZ1A 2GAFA 4P4NA 4HAMA 1FTSA 1A7AA 4G0YA 4PICA 3EUEA 2M87A 2PQ6A 3I5XA 5T6BA 4B6FA 3IUJA 2CFCA 4XDGA 2GT1A 4A0FA 3N2IA 1DDOA 2M9MA 2QEQA 3F6BX 3NVAA 3REGA 5AKIA 3N2KA 4QUAA 4OF4A 3IPAA 1XV5A 2EQBA 4HDSA 4JS0A 3JQAA 3HDVA 5KQMA 2BY0A 3F6VA 1R0KA 3FSGA 3CC2I 4L9NA 1U31A 3OZGA 2WA1A 4QARA 4H4EA 3CVWA 3L9FA 4LDQA 1T4BA 3M8KA 1OB2A 4GE0A 2ZKLA 1WJ5A 2FI1A 1YV9A 4J9UE 4QXQA 2VTBA 4PFSA 4L9RA 3N0VA 1COWA 3VR6D 3KEYA 3KJIA 4MKHA 2MTBA 3DAYA 1BE8A 2EQ5A 2QVZX 2Y1EA 1EWVA 4IVNA 2ZT6A 3TAXA 1Z3YA 2VQDA 5TJHA 3ABSB 5L4NA 2R00A 4EQQA 3PB3A 1EB8A 3PLNA 4MWTA 3E22A 4L5YA 3OWHA 5AW4A 4DXDA 3GF4A 4Q34A 1BCSA 4AKSA 3QU2A 4C4SA 4DDVA 4Z7JA 1UMDB 1GNVA 4UM9D 2YYYA 1UXOA 1LXCA 4O6JA 4LQDA 3MGAA 2D5BA 4I14A 2FUG2 1NQOA 4AYBN 1USTA 1T9DA 2X4LA 4PC3A 5EJAA 3NHKA 4PG6A 4LXXA 2V4MA 3CCRI 5IBPA 4GPEA 1X7GA 1FNDA 1WMAA 1Z17A 3H16A 1H2EA 2OD7A 4NDAA 5H9WA 1I3AA 4WBNB 3C3WA 3HDTA 4NJOA 5KVVA 4EY6A 2VDWA 4JLUA 4BTEA 2CLSA 2HSEA 3KP7A 4MV7A 4UXHA 4EMBA 2X7XA 4NENA 4Z1MA 1VCHA 4OHMA 1UBTS 2EWVA 3WMRA 4MEYF 4Z4HA 3F7MA 3EVTA 3QEAZ 4CLXA 2YQ5A 4W8GA 1JUDA 4CQLB 1BFUA 1BDHA 4A3IJ 2IIBA 3PQCA 4BO1A 3LSKA 5TMBA 2R7TA 1CVLA 2WSIA 4U2FA 2XWPA 1EKEA 5DU2A 4DQKA 3I0MA 1NR7A 2DFTA 1JJ7A 1CZOA 1XWFA 2HR1A 1A1VA 3JRFA 4MJ3A 3KNZA 5B1SA 4AL4A 4B44A 4ZO8A 1UKEA 2XGEA 4CF7A 4DM3A 4ZAFA 1R5NA 2OV7A 4Y9RA 2ZJ2A 4RGUA 2RHTA 3PEWA 2FMKA 4JOSA 5D5PA 5DRTA 1JHZA 4XB6B 2MINB 3IQGX 3RRMA 4HWTA 2PUHA 3HXTA 2VXZA 1PW5A 2C0CA 3L6UA 4UZFA 1VTNC 1EDDA 3P52A 1V9CA 1QNFA 5GZ1A 1AMOA 4BO9A 3UMVA 1GTJ1 5KX5B 5AI5A 2FOXA 3KHTA 4LF8B 3G2OA 4Z7OB 2XGOA 1OOEA 3KETA 4AMYA 1FYDA 1W2WB 4HQNA 1IVSA 2AT1A 2AKAB 4CR7A 1TVEA 5HIJA 3UUEA 1ZVKA 5KVQA 2D00A 5CTJA 4X95A 1OREA 3HHPA 5DLPA 2B5VA 3NP9A 3CM0A 4LNAA 2W0MA 1TKAA 1T3HA 3R41A 2KT0A 1SIBE 2I10A 1E9AA 2K2WA 1NNEA 3QW2A 3NAMA 4IIGA 4GMHA 5C0OE 4ZCQA 1U9YA 1ENYA 4ZQHA 1X7ZA 1ZH2A 4CDNA 1WCYA 3OQ6A 4UTZA 4TT3D 4EJ2A 2CL7X 1RI4A 2DWUA 4US0R 2X7JA 4YALA 1N0WA 5B58T 3MOSA 4FYYA 1DKRA 2QTBA 1M83A 1U3FA 2HRDA 3E9RA 2JZCA 2JAXA 4I9NA 3S2ZA 4DMFA 1BW5A 3MLBA 1JIVA 3JZMA 2YFQA 3WLMA 3B1VA 5EPUA 4XYGA 8OHMA 3MTGA 1WDLA 5G1NA 4HAWA 4M9QA 3RKWA 4AECA 3R9XA 3KTFA 3RUPA 3HKEB 4MVJI 1DLIA 1H6DA 2NXEA 1XPRA 1NDQA 2K3FA 4JKYA 3ANNA 4KQXA 1E3WB 1JDNA 2EKLA 4B84A 4BX8A 1HO3A 4H6VA 5KDOA 2CUNA 3MMXA 4DEYA 1E32A 4P4GA 2BGKA 2VZ8A 1XTRA 3JW8A 2HUPA 2XB6A 2JVIA 4HUQB 4ZZIA 1JJBA 1W88A 3IT3A 3Q7IA 4MUMA 3FGZA 1V8PA 1X7XB 2QYTA 1O6GA 2VHTA 3TZLA 3SHTA 5FNVA 3PQJA 4E5UA 3H36A 3BOQA 1EAMA 3QVMA 3ZW8A 3BULA 3IEUA 3L7CA 5EDNA 1VJ1A 1VLQA 3L04A 5I7RA 3OIWA 1XZBA 2DH5A 1FOXA 4O2LA 4BX3A 4I55B 4YCCA 1WZCA 5HOEA 4D9BA 1J70A 4RPLA 3BHMA 1Z5UA 4IV5A 3HSSA 1E2IA 4EBFA 1IN5A 1OCOH 2OCLA 3SG0A 3AETA 3UCXA 5HWSA 3T7RA 4TV7A 1VJRA 4YYEA 5EWJA 1SAUA 2ASEA 1NVEA 1WQ3A 3E58A 1OV4A 2OZPA 5JAUA 3L5OA 5HKLA 4ZI2A 1HYEA 2QSYA 4TGLA 1YTYA 4JBNA 2GRAA 2J45A 1Q44A 1L5QA 4D9EA 4F2DA 3QM1A 2HCFA 1ZOLA 1LLUA 4UPEA 1K6EA 1PJTA 5GJVC 4EJSC 4DLXA 3ROZA 4G3XA 3Q7EA 2W84A 1RWOA 4Q16A 2Q6VA 2FRHA 3BFJA 2CCKA 1GRNA 5FGMA 4BXXJ 3S32A 2V0NA 3LKVA 1AHPA 2C2WA 1RHJA 3DVAB 4Q03A 1KEZA 1A7KA 4JY7A 4A9AA 3W8RA 1FYEA 2JI9A 5CJ9A 1NP7A 3DL0A 3COZA 2R5YA 3BB4A 3EBPA 2CLMB 2YY5A 1AX9A 4UMFA 2WINI 4JOMA 3GJ4A 4MP8A 1IBKB 2XKBA 2F4OB 1JL3A 2XI4A 3DC2A 1YHZA 4QJ4A 1WSUA 1HSOA 3DV0A 2PGLA 1LDMA 2G3YA 1E7YA 4X00A 5GGXA 4RS8A 4MDFA 2PZEA 1PX0A 4H7DA 1A8IA 4MYTA 3TD9A 3HE3A 5BQ5A 5LLSA 4JX6A 1V6SA 3S99A 4AKEA 4D57A 3WQSB 4TTPA 5LHHA 4U9IS 4J4TA 5LL6P 1Y5LA 3RT1A 3THWB 2QX4A 1NRXA 2VCHA 3A1YA 2RHWA 3DJFA 3PNSA 4AJLA 2APJA 2IZ6A 4Z3OA 2EIHA 1G66A 2FQYA 1A1SA 3QUAA 5HUHA 1NLZA 3KAQA 1G18A 5EIBC 5JWRA 1S2GA 4PLPA 3H9CA 4G25A 4KWHA 2HEIA 2B9EA 2P2YA 4E5KA 1T6NA 5DM4A 4C08A 1AKHB 2I3DA 1GAJA 2I2XB 2ENUA 2GEKA 3JV7A 4G8XA 1U63A 1XDBA 3IDAA 4CL3A 3ZQCA 1OFGA 3SHVA 5LHIA 1S5PA 4CMGA 3K70D 2D2VA 4YYZA 4KWEA 4BMDA 4V0NA 3L7JA 3KQYA 4GC5A 2XMBA 3S27A 3SMQA 5CFLA 3G4SI 2A5LA 3DKYA 521PA 3R4CA 1N34B 2FEOA 5CCBA 1ATZA 1RBQA 2RJOA 2R11A 5EIAA 2A9JA 2W57A 4U2KA 4QLAA 3ZKWA 1I13A 2DJIA 2HNHA 4WVFA 2MYTA 1FOEB 1Y80A 2C57A 4NBTA 2Q41A 4ZGWA 1E6CA 5LKAA 2WHRA 1OCPA 9ATCA 4NBRA 1Z2EA 3A26A 2JEYA 1EM8B 3D2CA 3GG2A 4UUOA 3DFIA 4GXNA 2NSLA 3I2FA 4HRVA 5DX1A 5GOTA 3VX3A 3GDFA 4D8YA 4XYLA 2JJMA 4RCZA 1XRQA 4UHKA 1HLGA 3F46A 2BE9A 1H6CA 2R8EA 2PQ8A 3LHDA 4E09A 3GFGA 3SWWA 1V4NA 1OH7A 4JLSA 3GFJA 1FDWA 3UPDA 1EE9A 3MJRA 2GQ0A 2WAOA 4C29A 1XRLA 4XSHA 5BSRA 3E61A 3L06A 3AG6A 5DBFA 2GXGA 1ITZA 3BCHA 1MV8A 5FWXA 1UQUA 3AEYA 1KU9A 5AVXA 3IO3A 3SQDA 5JHUA 3QU6A 5H59A 1QSGA 3ZVLA 1MA0A 3ZHUA 4KVFA 4V0SA 2FZGA 3TL2A 2P62A 2D1SA 1TCBA 4QYSA 3QYFA 2BTEA 3SC2A 1RAIA 5IZCA 4DS3A 4MGRA 1N2EA 1XN1A 1BC7C 4I9HA 3HZOA 3LPAA 3R0QA 1ZN7A 1JSXA 3CPHA 4TWAA 2HLNA 1NW6A 3HDGA 3P2JA 5JYEA 4UMDA 2VKTA 3FPHA 4GXQA 2I6FA 3MWDB 3F2IA 3P4UA 3MGKA 4LPKA 4M73A 3QVGB 4MUAA 1EUDB 5J2UF 5I9MA 3OF5A 3ZLJA 5L3FA 3N97A 1XQYA 2ZBPA 3ZDDA 3IQWA 2JLVA 1VTKA 3PE4A 3WKEA 5TVKA 1UBOS 1SBCA 1M34B 5IARA 1AF4A 3D2BA 1KNXA 1M8FA 5M34A 3LVFO 3SKYA 2Q2NA 1K2WA 2A3SA 3A25A 1F17A 4TQUS 1CNFA 4RF2A 3FZGA 2CBZA 1T39A 3JD0A 1ABBA 1MSEC 4LK2A 5L3ZA 2IPOA 5IK2A 4U2GA 2CXXA 2AMYA 3OHSX 1A5ZA 2QQ0A 4O6VA 5IP6A 3BH7A 2VC2B 1OQYA 1MO5A 3GLIE 4AUXA 2BCEA 3WI7A 1UFOA 2QUFA 2QEXI 3UT6A 1P33A 1PR9A 1LTHR 2GZHA 2FXIA 2A5YB 1SCDA 2Q4OA 4TSFA 3ZCQA 2C4TA 3G8DA 3UAYA 2WU1A 3IQFA 5J2TB 1UWCA 1YO6A 4I1IA 1LS6A 3EYAA 2AO9A 4UUQA 4B3JA 4CM7A 2R751 1AA6A 1N5OX 1SOWA 3FZVA 3AF1A 1V54H 4ZJUA 5BW4A 2EFCB 4WADA 3KZXA 4IVRA 4UNRA 4C4PA 3IAM6 4K26A 1XGKA 2DBRA 2XCIA 3EGWA 4TTTS 3D7NA 1JKPC 2B37A 4I1RA 3GOQA 4FFLA 2I0FA 2FX3A 3WLNA 2IXFA 4NWIA 2ATIA 5DCMB 1QWOA 5H82A 4IJQA 2RV8A 1U3GA 4ZEMA 1YQ9A 1MT3A 4HWSA 3AM5A 3E7XA 3ZHSA 1FBUA 1F2DA 3TDUC 4HH1A 1DKNA 1PTJC 2JARA 4JK3A 3INNA 5KHOC 3C8DA 1ONPA 3HB9A 1SJ9A 2F8SA 1QH9A 4E0BA 3SQLA 3ABMH 3M1IA 5E3JA 2GNPA 3BORA 2RHOA 3M9WA 2O0JA 1Z0JA 3ZLTA 5BSMA 3L4KA 4L5AA 2Y31A 1RU3A 3BROA 2MYNA 2JMWA 1I94B 2CCJA 3OYJA 1R0ZA 4YRBA 1BNCA 3OCZA 1JXSA 4N1AA 3EVEA 3FPSA 5FI0B 2NXNB 1AE1A 4MTEA 1WB4A 4LE1A 3AILA 3EVZA 1MJAA 2PJRB 3I9JA 3A6ZA 4UMEA 3RFTA 1CUGA 3DB1A 1E3EA 4NZYA 4UD2A 1UDWA 3WGVA 3R3JA 1KE2A 2CXUA 5KNBA 1A8UA 2QKLB 3BWEA 3PHBE 3ZTYA 4AVPA 2HADA 3L05A 2RH5A 3N0RA 2UZ3A 5I45A 3UJ9A 4KE9A 1IUNA 3ANTA 4DNPA 2NNYA 5A9SA 1ZGJA 3WMFA 4DF3A 3MHTA 1K75A 4IX7A 1YDFA 3GDOA 3VJLA 2X5XA 2GEFA 3LCRA 3G3EA 3C8MA 4IXMA 4RTQA 1FRVA 3HCPA 4Y6SA 5JS8A 4KLNA 3FWNA 4ABYA 3G2LA 4YP1A 4MRPA 1FFHA 1Y8RB 4AQDA 4BNFA 4TS9A 3QG5A 3LJKA 2KRHA 5K5EA 3H4MA 2JLSA 3ZIAA 2OOKA 3H1CA 1QIDA 3E6MA 4DYVA 3OSGA 4TVKA 4KO1S 5DWVA 2Q3BA 1AZTA 4ALJA 2DWOA 5JD6A 4PZCA 5E6UA 2DPLA 4B1FA 1TO1E 3VYTB 1O3SA 3HOTA 2Q0XA 2AL7A 1KI7A 3VR6H 2M3AA 1ON2A 5TPZD 1LI7A 3RF7A 3OS1A 1VRWA 2XV4S 1IXSB 1IAWA 2AYYA 3IVXA 5CCDA 3GCWA 3SSMA 1REQA 2A86A 1T2AA 3JW4A 4QPCA 3DP9A 5CG2A 2ZRJA 5GPCA 2YVLA 3LFUA 4CTOA 1V47A 2Y0PA 3PHCA 2FH5B 2J08A 2KM1A 3PXDA 1PGQA 2QG9A 4ER7A 4KBFA 4W6ZA 3DVLA 1OKKA 5FOQA 1ZN9A 4JBIA 4B8ZA 3NIGB 1AGNA 4YFVA 1O97D 5EJEA 1Y3AA 4Q3DA 3PUFA 2R8PA 2O8DA 2QL9A 1FZQA 1Q7BA 3D8TA 4J2OA 2OO5C 1ZQ3P 1SWVA 2XNKA 3L18A 1LPOA 4Q1BA 4PCAA 3QKRB 2GTIA 4N39A 3GHHA 3FCXA 3RRBA 3KTAA 3PQ6A 1GZSA 7ADHA 3ZHCA 4C0KA 5A1JA 4LX8A 1R74A 4QDTA 3MTDA 3FFAA 4G7OF 2Z6UA 2I80A 2GYUA 2CLLB 4YCDA 5F4BA 3R0ZA 3HTXA 4FT4A 4AJ1A 3FAZA 3PXEA 1DCMA 1SQSA 5C1IA 2HF7A 4QUGA 1DCKA 3WOHA 1V96A 3CJQA 2HJRA 4HF7A 2CO5A 2ZAGA 2CKMA 1JPNA 5LDHA 3MSXA 4EBBA 2J4FA 2NYAA 4GRDA 5TC4A 2XUHA 4PLFA 3GZNB 1ZG1A 1TM4E 2BGRA 4GPTA 5LBUA 4MYUA 4YRJA 2DFVA 4TLEA 4DLAA 1RKXA 4NNJA 1YULA 4GEKA 3S8PA 2XT0A 1ZK0A 1CXZA 1U5TC 4YRAA 1KMNA 3CSDA 4BNHA 3IULA 4FNGA 1QRAA 1Z18A 2HC9A 3VO1A 3RRJA 4GC9A 4YCSA 4EM6A 1OJ7A 3RIRA 5C4GB 2E4UA 1R16A 1G41A 3CRW1 4DIKA 2V3CC 3GUYA 3QI7A 3K32A 4FS3A 2MBFA 5BS6A 2JWTA 4E88A 1I32A 1KMCA 3T95A 1YBAA 1LC0A 4OXIA 1DJQA 2H48A 2ZFWA 3FNFA 4PRLA 4J0GA 1R7JA 4Z4IA 4KT5C 3MHPA 4MMXB 4CPDA 4EYSA 3PYMA 2IPXA 3PI7A 4YR9A 4OHVA 4RJTA 3OUUA 4YAGA 3O9VA 3OWOA 1NXXA 1QK5A 3OPVA 2A68F 3CJRA 3VAAA 5SICE 4YELA 2AF3C 4KLZA 4C0JA 4EJTA 1H5NA 2JL1A 5IS2A 4OGFA 4R3NA 2BP7B 4I8DA 1AH2A 4HEA6 1R66A 3QITA 3O1HB 2JIZA 4PSWA 5HIKA 1RYNA 4W5OA 3AHJA 1ETQA 1UPTA 4Z4CA 3VR3D 1NNI1 2X3UA 2LBFA 3NHLA 3WZLA 1OWMA 4PGHA 2IZ5A 3ZU3A 2FU5C 3UGQA 2D3WA 2BFBB 3JWEA 4TXHA 3Q0IA 4A8TA 3GAFA 2MABA 4GM0A 3VRHA 1L7OA 3OOSA 3T0IA 3KCNA 5CDSA 3SVZA 2M32A 4HSRA 4OTZA 3D2LA 3LNQA 1WOYA 3F6YA 3IJEB 4B48A 2W37A 3GV0A 4R01A 1QPGA 4LKRA 4H6PA 4Y6QA 3MN1A 1YCHA 3ZWAA 1Z12A 3U19A 3L0DA 3QEMB 3ZVRA 3ORSA 3LVBA 1WV0A 2H1KA 4N12A 3AEZA 1J75A 1UMBA 3NKLA 2PWAA 1J00A 1DELA 3IP8A 1CUYA 4TKUB 5EG0B 1EYZA 1GZ4A 1U1FA 1BDMA 5DV5A 4ZH4F 4P81A 5EXXA 4YONB 3P9NA 3GMDA 5BN3B 1GPLA 4UEJA 3GH3A 4FILA 1SVWA 4DB4A 3OTQA 4IJAA 2G1UA 2DP4E 5K45A 3TDNA 3U3OA 3QXJA 2I6UA 3L2CA 3T0GA 5CJ2A 1PSWA 1EP3B 5BV8A 1RKVA 3W4IA 1PW7A 4BFCA 1LZLA 5J9FA 3L7MA 1XFAA 4P0PB 3A70A 3HOYJ 4OHCA 1E61A 2DFIA 4YJ2F 4F8JA 3FISA 2V59A 4HGQA 1RFLA 2F4MB 3PFFA 4B73A 1MMAA 2VF2A 2WYHA 1V11A 3T3EA 2P4QA 3PFCA 1O6BA 4JJZA 4AP9A 4KO2S 1M3SA 3KZIC 4OSPA 3GJ8A 4FMDF 4D43A 4R68A 4MITA 2FVYA 2I4MA 2K7LA 4E22A 2AJTA 5C8DA 1GQSA 4A0HA 1TMYA 3QLTA 2AQEA 4CYDA 3MKLA 4MB2A 1NX6A 1CWUA 4UVBA 1QH0A 2XSDC 3GT4A 4LRWA 1Z2PX 2OC9A 3G8YA 3BQ9A 4QXMA 5T3YA 3T1BA 4XORA 3VTKA 1MNQA 1YONA 3CF6R 2XF2A 1W0TA 3NVDA 5BQTA 2R6ZA 2ILTA 3R7FA 3QF4A 4LFUA 2IC5A 1RWVA 3ROEA 1ZJ5A 5FOTA 3IHWA 3WMEA 4ISCA 1HL3A 3J81k 3JQPA 1ZI6A 2WIGA 1KSJA 4P33A 2L4AA 1FSFA 3AC0A 4OMFG 4I6ZA 4EPVA 2Q6OA 2FWNA 1G8MA 1Y81A 7AT1A 3G2MA 3U3JA 2I1VB 2HFKA 1IC8A 1WMBA 2O50A 1UG0A 5DHPA 3B3GA 3L6EA 2JVJA 4EG0A 1YWGO 3SYNA 5GTIC 3WRXA 3ZV3A 1W6RA 3M07A 1T35A 2J7PD 4C01A 4O4HB 3KPJA 1RETA 5D86A 3H5LA 5KVSA 1TKRA 1EUYA 1OLXB 2ON6A 4U7HA 3UMBA 1N5RA 1EFAA 3EUAA 3LDGA 4HTFB 2JDIA 3FK6A 2AN3A 1XCBA 1SMTA 3RS0A 4AMBA 5DNCA 4IDQA 3F3XA 1XQ1A 1TCCA 2PMHA 4YMHA 4OH1A 4P2GA 4E7PA 4K2EA 3H8JA 4K8OA 2H51A 2IEZA 1T6SA 2I6GA 2J4DA 3HB7A 5KOHA 3TO9A 1LRJA 3V2GA 4YV7A 2AHQA 5L4LA 1GSOA 1U7DA 3FMSA 3T5MA 5KC9A 4PLVA 3DBLA 4A4DA 3IAUA 3VHLB 4GH5A 3NFYA 2OFXA 3C6ZA 2P9FA 2MC4A 3PHHA 5JAIA 1VL5A 1JA0A 4JH0A 1EESA 1RPNA 1CUEA 2VDQB 1IZ9A 3UAOA 2XAAA 3QSGA 2C78A 2ZP1A 3W6OA 3M8FA 1D8TA 5TMDA 5GAGJ 2QN2A 3UJPA 1FFCA 2QRHA 1X19A 4LB6B 1RYHA 1ECJA 1WW2A 2ZIVB 2XF5A 4UM8B 3PWZA 3QVJA 1CUIA 4H7EA 1QP8A 4KE7A 4GGGA 2AN5A 2DU9A 3WGYA 3K16A 1O3YA 7REQB 1WQ2A 2BW0A 3U7IA 1E1RD 4C9BA 1VMKA 2CNWD 3SLGA 1U2GA 4C4ZA 2X6WA 2KDOA 1TL7C 3FVVA 5K0JA 4TOIA 3DXYA 1QO0D 2BXZA 3BJMA 3R40A 1O8BA 4P3YA 4DPKA 2JIPA 4TXMA 4MNTA 2A9OA 1XDSA 2P2DA 2RGYA 1I1NA 1MJ9A 1AXGA 2WJZB 2WD7B 5BR1A 5CVCA 3VPCA 5E20A 4LC1A 1IJEA 1U4NA 1W4LA 1B6RA 1MG0A 2Q5LA 4B85A 5GTDA 2LG4A 3BPSA 4DVGA 4MWDA 2IXAA 1XMAA 4ENQA 2CMHA 1MJNA 3VFDA 1FOYA 4ETIA 4RKRA 1BR4A 4MA5A 1Z21A 5LP1A 2W6PA 3MS2A 4CUGA 1Z0FA 4XGIA 4ZU1X 4M0DA 2MGQA 2XY4A 1AUVA 1SKAA 2GCOA 2BOLA 3JQFA 4HD8A 1AHNA 3BMNA 3L9XA 3RVSA 4IRMA 3RRXA 2AYZA 5CDGA 1NYRA 3R3HA 4DLYA 1YRQA 2OEPA 3ORYA 5K03A 1UM8A 2NMVA 2ETVA 1EWYA 1MMFB 3SN6A 3WDKA 4FI3C 4RLHA 5DHRA 4PC7A 1RKTA 4IHXA 1NG1A 1M8KA 4KX3A 3WHLA 3ZXXA 1TL8A 4MP6A 3MXTA 1Q57A 2F1IA 4AM3A 3KQNA 2QSFX 4B83A 3FSJX 3DD5A 2CNBA 3KPWA 4D02A 5FAXA 4QT4A 4X92A 4RELA 5ELLA 2GKOA 3O8OB 1T3GA 3ZVKA 5GINE 1MFPA 2V7PA 3HGQA 4ZVUA 3VO8A 1VL8A 2AWNA 1W1UA 2ZB9A 4QUJA 3Q3JB 3DZ8A 1UQTA 4A7PA 4B4CA 1RRVA 1A6QA 4MIMA 2I4OA 3EMDA 4MHTA 2DTRA 4M3DA 1T0FA 3T1VA 2VAMA 4L07A 1SBZA 2C98A 2NW6A 4B4WA 5L3DA 2PRJA 1JFSA 4I50F 5JVGF 3N2GA 3BKXA 3I52A 2DWQA 3B36A 1Y1PA 3OY2A 2IY8A 2JLUA 1U0RA 2JEOA 5A05A 3AXSA 3GRKA 4XJTA 3MJSA 4YJFB 1Y5NA 2H1WA 2Q4DA 2JIQA 3J7TA 4J7XA 4NBKA 2GAIA 3OTHA 2IEAA 1P4XA 5M5XJ 1K5DA 3BJAA 2LCFA 4GP9A 1K9SA 1VI2A 1XZNA 3WHKA 3S1NJ 5DCWA 3JAWA 5JECA 4UVDA 1C9NA 2WLTA 2DMUA 2FFHA 3EDPA 5EE1A 2D1QA 1L5FA 5I8PA 4BQFA 3PFYA 1MN6A 4RC9A 4AURA 3MD9A 1YZHA 1J22A 2X2EA 2VSOA 2FFAA 1U8XX 4EIWA 4D1QA 2ZMEA 1RM4A 3VTZA 4XICA 1Z63A 3HSRA 3FM5A 3VYVA 1K4KA 2J0SA 5AICA 3PEFA 1JG2A 1ETKA 1RMTA 3VDNB 4ZAVA 1H4VB 1KMHA 4JP1A 1LLFA 3OE7A 5LYJF 3DONA 3CO5A 5THQA 4EDHA 3PX2A 4X91A 2OTCA 4HSEA 5JFGA 1FFBA 1N4AA 5JNVA 4M7OA 3TGLA 4E6EA 1MFZA 2QX6A 1OI4A 4L85A 5EAIA 1K66A 4XSZF 2J6IA 1M76A 1CZLA 4M4SA 4MKIA 3R7DA 4BJ3A 2FN7A 3BERA 1TM2A 1N1MA 1KVQA 2O2HA 1ZQ1A 3W8EA 3HUUA 3JQ7A 4M37A 2ENWA 3PTZA 3UA4A 4NU6A 1OIXA 4ZOEA 2C2YA 5HHTA 2CNOA 1FNCA 2BVNA 2Z3VA 3VZPA 2PZBA 4O02B 1XF9A 5FTLA 3N07A 4DQLA 5D8DA 2C5LA 1A95A 2QK4A 4R40A 3NMUF 2ERCA 3CKYA 4BV2A 3E97A 2ZBGA 1MIOA 4KKVA 3I9FA 3WTUC 4FBLA 4L8GA 5IUNC 2BDUA 3GEZA 3IXQA 4BO7A 4CF4A 2JZYA 3W6VA 1Z7LA 1BDJA 2DECA 5EMLA 3AF3A 4KXYA 4AKIA 1RAHA 1MO4A 2NU7B 5EKXA 5JS1A 1U3TA 2VPWA 3P32A 4YACA 4K6GA 2W6IA 2KLOA 4KC0A 3S2WA 4ESFA 2YU3A 5F27A 2PLFA 2JCVA 1RI1A 2F3RA 1QM5A 4ZHQB 3VSLA 5E3OA 1NP6A 4MUJA 1C7FA 3C1AA 4FYWA 4R69A 1CZRA 1YI2I 1KY5A 4AIIA 4MGIR 2HTFA 3CQ9A 3HABA 3ND5A 2O5VA 4IICA 3IBGA 1K4YA 2BT4A 1C1DB 2C9YA 5KDDA 3FTDA 4RB2C 5FTKA 1WDTA 1ZN2A 4Z0TA 1NBEA 4B6QA 4KN9S 4A3LJ 1O4WA 2W70A 2WB1N 3PR1A 3KSBC 4HGZA 4UQOA 4V0MA 4FD2A 4ZVVA 4KN7X 1CJBA 4RGYA 2H1OA 2C7RA 2PXHA 1T6ZA 2IUTA 2MSCB 1E2KA 3GX4X 3SC6A 2RC5A 1TZ2A 4XFJA 1Z2NX 4DQ2A 4TUYA 5JQWA 4NCBA 2ZU6A 1QAOA 1K6YA 2I2CA 3CCQI 3HJHA 1V1JA 1RNLA 2Y68A 3IBSA 2BKXA 2VF5X 3HI4A 2F59A 1QVZA 4XVQA 3T3PB 2XXAA 3JWIA 1K8XB 1WGXA 2GXAA 5AJXA 2ESHA 3ITDA 4R2HA 4BFYA 3KSAC 1XQVA 4KN4X 5DYWA 4ZIRB 3T8YA 1P9QC 1E3TA 4DBVO 2XDQA 3RVQA 4X44A 2KJBA 4JYBA 1QVRA 1AN9A 2ZPTX 4BMZA 2KIMA 4F7WA 1YU6A 5DTRA 1HQCA 5GPBA 3UR3C 3I1FA 5HOOA 4E5SA 1DSSG 4NAUA 5IWCA 3NC1C 4N48A 4UHBA 3BICA 1RS0A 1OWLA 5KYXB 5H70A 1E58A 4BQQA 5IEBA 4CH7A 5REQB 1DIRA 4E13A 3R61A 1R9MA 2IHVA 1OTHA 1QQ5A 3ZY6A 2VLIA 4F3QA 1OBCA 3AR2A 3KS9A 3MOIA 1A2QA 4ZC3A 3RBZA 4JVMA 1WULS 3QYPA 4AYXA 3C4QA 5LWHA 4PC2A 4ZV7A 4U0KA 5FUMA 3M7GA 2LXNA 1HT1E 4XIGS 2ZXJA 5EEGA 4YIIA 4I2NA 5ALVA 1O1YA 1N0HA 4MVJD 5KZMB 2EV6A 4NKRA 1Y3IA 2EZHA 4Q48A 4ZAZA 1EFRD 3OA2A 3FNRA 4KMRA 5GPAA 4H6WA 5JLXA 1GL3A 3L8EA 2LP4Y 2QPTA 4DMHA 2M8GX 3DWGA 1PR3A 3I4MJ 1XGSA 3BQYA 4CKEA 3JARB 5BW8A 1BROA 5JVDA 1QLWA 4F3RA 2PSHA 2JNWA 1K83J 4U2CA 1O87A 3NDRA 1RWMA 3UNGC 3ICPA 1IXYA 1MOZA 2HM7A 4NI5A 3BS4A 3KIOA 2WIDA 3OQ1A 3PYXA 2RGAA 1KU3A 5IKPA 3GUHA 2QT0A 3AFGA 3CO7C 4OXRA 3G17A 4WUTA 1ZH6A 2IH4A 1UBKS 4A12A 2CV2A 3WIUA 3NETA 3M2TA 1VBMA 3I73A 2RARA 2Z9CA 1ZM7A 4DJTA 3ZY3A 4QEZA 2DA1A 4C87A 1P0MA 4EGYA 4KGZA 5F0HA 5IN5A 1BJAA 2NN3C 4A5SA 4KMFA 2P3SA 4R2JA 2NYRA 1CDEA 2Z8XA 1KQ3A 2BEUA 3DHWC 1SA0B 3RIGA 4CMJA 5KJCA 3OD1A 2WW8A 3K1PA 4B3XA 1KQFA 2PWBA 3R7BA 3B8HA 1GZUA 2Q7DA 3D4LA 1ECGA 1SGWA 3C5WP 4DZJA 3L6RA 2AX3A 1IHDA 5EQFA 1VP3A 4JJGA 3TGNA 3NTUA 3GELA 1O94D 2WHPA 4NULA 4QJ5A 1QYVA 1B8PA 2VE9A 1GQOA 3K9WA 2ZRNA 2W2TA 3FETA 3RRZA 5KTPA 3A1FA 2IW3A 4UZEA 1R8JA 2FEAA 3L0IB 2Y1GA 3O38A 5E6RA 2QRQA 3H17A 4XOPA 1A5JA 2IHBA 4ZYZA 1D6SA 1O54A 4LY0A 4JEIA 5F2EA 1KAGA 3FMOB 3FDZA 1YW8A 1R0BA 4WKBA 2ODEA 3QKWA 2SICE 3I3SR 4L18B 2SKDA 3MWFA 2H4JA 3NUGA 5FP0A 3B7WA 3TL4X 3U0BA 5IW8A 4BL5A 5CYGA 5FO1A 3H5TA 3CG0A 5DLEA 2CVHA 4FEAA 2DHCA 2NXWA 4PM4A 4Y0AA 3ZQHA 3W78A 1SC1A 3I28A 1H6BA 4EHDA 1WKBA 5CU7A 1Z34A 2XMPA 4ZK6A 2EFDB 3U4QA 2Y2UA 3BIJA 3EB9A 1VFNA 1GVJA 1LNWA 5HR5A 2GOYA 2R5WA 1F4PA 2ZJ8A 2BUCA 2HRBA 3MQ0A 1M7GA 4ECEA 1AO3A 3ENVA 3IGFA 2G5TA 4B2PA 3EH2A 2XUFA 5GZ3A 5FTJA 1XLTC 3ZWKA 4ZDJA 2SECE 3L8CA 3PF8A 4EZEA 3RV3A 2DR3A 2ZJ3A 3HBAA 1CQPA 1OGYA 3G88A 4BDTA 4LIUA 2EFOA 2F67A 2F3QA 3R5HA 4OL9A 4DJEC 4Q93A 4K86A 5C2JB 2VQ3A 4M0EA 1WQ1R 1JIUA 4BJ5C 4RORA 1LB1B 1IDN1 1XA4A 3RKQA 1CEYA 2V6IA 3RFVA 3UXYA 3HFGA 2R85A 4U6NA 4F6RB 4FYXA 3WNZA 2VO1A 4RZSA 3V4OA 4MR7A 3ZZTA 2ZDGA 3F0TA 3OOHA 4BGVA 1FT9A 1XMOB 2PMCA 1D4AA 2PEZA 4UJ3A 2FUKA 3CZ5A 4ZMBA 2DHEA 5FNVF 4HYQA 5GM1A 4OU0A 5BR8B 1BA2A 4FP9A 4CQJA 1FDRA 4C04A 1W47A 2E60A 1NK3P 3DDOA 3ULKA 3R6LA 4HVCA 4JX8A 1YA8A 2EVWX 4KKXB 2XRFA 1CYEA 5D5XB 5ALZA 2GB4A 1ZOOA 3FWEA 3RARA 4UQPA 1Q77A 3FD8A 1FZPB 3V32A 3I5UA 2AIRA 3HHGA 5COAA 2LV8A 5HLGA 4OINF 3N70A 1O4VA 2HX1A 4AN4A 1D2CA 1JBQA 1ND6A 3DZDA 3ZHBA 2VUUA 1IV8A 1BXRA 1MB2A 3UJCA 4WLNA 4ONEA 3W9UA 3AKEA 1T5LA 3BTJA 2JFXA 2GHIA 3E5QA 2H65A 4OI1A 1QS0B 4C5AA 3OECA 1NULA 1EGVB 2HA3A 4IDFA 4EG6A 2IXBA 4HRAA 1NU6A 1VKRA 1EFUA 2I87A 2ALJA 3AF4A 4D8WA 3V1UA 1K1EA 1JTXA 4YFKF 1G9TA 4TVSA 2VZLA 4UUTA 2R7UA 2IKSA 4X3CA 3LQ4A 3PEEA 4HLUC 4G5OA 2R8ZA 2ZSFA 3MGGA 2H8RA 2BBSA 3E15A 1LDKB 3DH0A 3GRYA 1WZIA 4RL4A 5EGNA 4DT1A 1RQ2A 4GPD1 4X3OA 5IT5A 2HFJA 1I6KA 2BBOA 3GWGA 1KZ7B 4GVPA 1XCOA 3QU5A 1M33A 1LI5A 1Z73A 3ZK7A 3W1WA 1JDTA 4HOYA 1F5NA 3C14C 3UFXA 3ZI7A 2QZSA 3RPEA 4PZPA 2Q7OE 3L7DA 2C5BA 2YWDA 1AM4D 4KJZA 4H3HB 4AX4A 4NESA 3ETNA 2Z99A 2R96A 1Z7GA 3FHJA 4DLNA 1TVMA 2QZZA 3HCWA 4C7BA 3HSEA 1DXOA 2E71A 2N3ZA 5CLSA 4JYAB 1OCZH 2OA0A 5FNZA 2WFZA 4MPTA 3UT5A 1JSRA 2DYSH 3PNPA 2I3ZA 3BH0A 2ZG6A 3SZMA 3IP4B 1EVZA 1QO7A 2B3DA 1V1MA 1KBQA 1B2RA 3UWOA 2XUJA 3BXOA 2ATCA 5LNK1 1CZHA 4RQTA 3EBOA 2JN6A 2BR5A 2A6HF 1E3HA 1S3GA 4RK0A 4M53A 3NATA 4IDBA 3E5UA 4QDOA 1F06A 4FE4A 3NVKI 4ESHA 1C7QA 4DUPA 4AZ0A 1YI8A 3LX4A 1P39A 3TZHA 1VHLA 1UK8A 5H4GA 4A26A 1QYDA 3TPFA 1MTZA 1DZIA 4GX2A 4M3BA 4QO7A 5AJVB 4HPWA 3H4IA 3CUYA 4II2A 4ZAYA 1YQWA 2QRGA 4JI0B 3HU3A 3A4VA 3GDGA 3BG7A 3CZAA 1P5HA 2IGBA 4BKQA 2FV8A 1OZGA 4L78A 3BTSA 4YHBA 5EA2A 1RPJA 4P34A 1JV2B 2B4AA 4EW1A 2OBXA 1P8JA 3T4UA 4C0WA 4NABA 3HCCA 3TQTA 1JHFA 4RGBA 3VJMA 5AXAA 3OEYA 5IC6A 5H6RA 2EBUA 3U1BA 4CBVA 5DCUA 5EL0A 4AWXA 5EKUA 2HYDA 4EUNA 3R3ZA 3EIFA 5AIBA 1RUNA 2DW4A 1H05A 1WOMA 3E81A 4RJJA 4ZV9A 3GLTA 1AZWA 5KPDA 5F1OA 3QFFA 3QY9A 2VAXA 2G76A 1GP2A 2O06A 2OLJA 3NYQA 2O8CB 4P7FA 3TO7A 3QWLA 3SXJA 2G25A 1ODJA 2UU9B 3RK0A 3WKAA 2HXOA 1RHMA 4FIDA 2TRSB 4MS4B 4ZZ0A 4CCWA 4OGWA 1MO3A 1IBLB 1ZH5A 1UEJA 2WAQA 1EGQA 5T4HA 4NONA 4FB4A 3H2YA 4J1QA 5BSUA 1GPUA 1QQIA 1VQ1A 1CULC 2BH9A 4WQMA 3VH2A 3KVYA 3RYFB 4HEHA 3DFGA 3UATA 2B36A 1K5GA 4KUGA 1P92A 2IDJA 3GMIA 4CI0B 2CDAA 2W2VA 5AI8A 5KNLA 5JSHA 2JPDA 3VPDA 4S35A 3ZDXB 2REQA 4JQCA 1FSPA 4Y52J 1M1NA 2AJDA 4Z7NB 2ZJOA 5CFMA 3C43A 1T5OA 1TT5A 2XB9A 4P2BA 3WGZA 4ZGBA 5SY4A 2ZREA 1UMKA 2NO7A 3EJWA 5F1JA 2P77A 3QUCA 3ZGNA 2ZDQA 4EEKA 1FQJA 1FVFA 1PUFB 4G1BA 2QTWB 3GQBB 3VI4B 5AK6A 3ADDA 3AVPA 3DBRB 1NSFA 3EVFA 3A0UA 1DOAA 2L82A 4QHYA 2VODA 3U3KA 2V5UA 3FFXA 3S1AB 2PWPA 4A3CJ 2QLFA 1MB4A 1Z25A 1FP1D 3I56I 2HIHA 4UULA 3JWJA 1RESA 3Q8LA 1RWQA 4Q4JB 3KIPA 3QFTA 3GGSA 3TOAA 3OCWA 2DDAA 4QUHA 2IYRA 4E5MA 1MDMB 2WM3A 1TVKA 4JUFA 4TYNA 4FWIB 4MGHA 5CA0F 2XGCA 2ZI5A 1PLJA 1ZK2A 2NSYA 3SZUA 2ARKA 3L93A 4C76A 1UBJS 3FDXA 2VBIA 4CCSA 4GWKA 5DM1A 1I7NA 1VQ6I 4IRIA 4WXCA 4YCJA 3H3VK 2E1RA 4OUDA 4ESVA 2CQNA 3HTSB 2QRJA 5DF1A 4RMHA 1RRFA 3C41J 2FR8A 4HR7A 3PPWA 1OAOC 1SY7A 2YYAA 2GS9A 1XS9A 1U0BB 5JR3A 5E7JA 4HPXB 1I4DD 3RYIB 4J43A 2PQ2A 3NW9A 4WNIA 3CDLA 3MLEA 5IJ0B 1F4KA 5KNCH 1Z4KA 1M67A 3TQRA 5EOVA 1YS7A 5AIAA 3FCSB 1J8MF 2IWHA 1E60A 3P5SA 2PX4A 2JS7A 5IAEA 2JRMA 3W9SA 3EDOA 4FT2A 1NE7A 2I67A 3OYIA 2ONJA 1XG5A 5DD8A 1BI1A 4S2UA 3FWYA 2ZI3A 5T4FA 1KRWA 4GOXA 1GGNA 3AZOA 2P0YA 5ILOA 2Z57A 3CNLA 4KRGA 3CF2A 5HNHA 2V5VA 1FYLA 3V4RA 4YAWA 3K05A 2QD5A 1F2UB 3AIOA 4MB0A 1H69A 4PRYA 4D4HA 1HUQA 3KHUA 3TXXA 3ABRB 4QWMA 3VISA 3JQGA 3OYCA 2C07A 5FLXK 3OX3A 2EAUA 2IBMA 3N39C 4X0EA 3R7WB 4R51A 1WJDA 2NP7A 3OTIA 4RY2A 5IP7J 1QRUA 1NZDA 5KYWB 3BT9A 2V7QD 1E4EA 3KELA 3ML1A 1G6KA 4IEJA 5F1PA 2ZIZA 3MGBA 4F91B 2AJ8A 2XODA 5HODA 1USWA 5IY5H 1CQWA 3FMFA 3RTAA 1VQLI 1AQYA 4YPFA 3RSGA 2RHMA 1IJWC 2DKFA 2XAGA 2HCBA 3SEFA 3KJHA 2OM6A 4Z9AA 5U4QA 1C3JA 1J42A 1WSBA 3GDWA 5A5FA 1KAMA 4DQXA 1JW9B 4FR5A 4IZOA 3MKZA 1TK3A 4QECA 3IDQA 2FPUA 4I19A 2VXBA 4BVAA 3ZS8A 2Z56A 4PCLA 2K4BA 2DOEA 1QC5A 2Q3LA 1NT2A 1A9XA 3J7AY 4IJVA 3KUCA 1NW8A 3KYDA 4AD8A 1J2XA 4I4LA 3AF0A 2F5FA 4BNXA 5I9SA 2O2SA 3G8BA 2XDWA 2ID8A 1YCGA 1IXKA 1XWIA 3OM0A 2GUGA 1YW7A 3HCOA 1JG4A 4CLDA 2XCSB 3R7SA 2P5LC 4DLRA 2X23A 4RVNA 4B5LA 3TLEA 1RQNA 2P0AA 5EHIA 2FN4A 3I1JA 4WLVA 1QZ3A 2IOFA 3G0GA 1KO8A 1P19A 3M70A 5TQ2B 2MG4A 1HETA 2NYVA 1UT8A 2VONA 4ZAGA 5EFOA 1O94C 3T54A 3QVKA 4EABA 1V8FA 1ZNQO 3PUZA 4YBRA 3D59A 5CBKA 4J0HA 1NC3A 4JI8B 5HIMA 3H2BA 2BF7A 2C4UA 2Z2JA 2V65A 3MCAA 4O1MA 1QPZA 2PUVA 1TWHJ 3GEHA 4IDEA 4PRKA 5G0UA 5KCZA 1MIHA 2V7XA 1XBTA 2P6OA 1PZEA 2A1UB 1L8LA 1RLUA 1JT6A 2PGNA 1UXKA 1J20A 1SXQA 4P58A 3MILA 2EJRA 4BJTA 4N6NA 1Y89A 4WZAB 4JFAA 1FYMA 5B1IA 2RHJA 4TZTA 3JQ9A 2Q99A 2FF4A 4TKMA 3DWEX 5DVZA 1C9DB 3MWGA 3ON5A 1PG0A 2DYRH 4UJ5A 4MPJA 5DHQA 4NJEB 4B6RA 3DFMA 4CHUA 1KI8A 5JDCC 1N3BA 1G8SA 4E2FA 3EC2A