1O57A

Crystal structure of the purine operon repressor of bacillus subtilis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
270
Chain Sequence
KFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Purine Repressor of Bacillus Subtilis: A Novel Combination of Domains Adapted for Transcription Regulation
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords PUR OPERON REPRESSOR
total genus 78
structure length 270
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
A PF09182 PuR_N Bacterial purine repressor, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o57A01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1o57A02
3F6VA 1Z6RA 3V8LA 1LNWA 3GUDA 2H07A 3ECHA 3I54A 2ZMEA 2LF8A 4WN3A 3ECOA 1QB8A 1JXSA 3I53A 1R22A 1XGOA 3MAJA 3FMSA 3F8CA 4YFNF 3KLOA 1O3TA 1ONVA 1JE8A 1P19A 2CQKA 4Q5SF 2MH9A 2PLYA 4GCVA 4M0KA 2DPDA 4HLXA 1CJBA 3WTVC 3RIRA 1LVAA 4OMZA 2Y48A 4PGGA 4LD5A 4RHXA 1J0RA 4XSXF 2EWNA 1Z91A 4DQ2A 2DU9A 4GYIA 1L1QA 5KAMA 3ACCA 5IAOA 5LEJA 4U7DA 3ZN0A 3T0YA 4G8XA 1S7OA 3TQNA 3P9KA 3JSOA 1MJ9A 1O3SA 4RAOA 2DY0A 3WGGA 3KP2A 4AIHA 3FF5A 1JLRA 1FP1D 5DD4A 3J80Z 1RUOA 2NNNA 3DKWA 1UCRA 3ZPLA 1O5OA 5HS9A 3HOSA 2P5VA 4EM1A 2BGCA 1Z6TA 3MEXA 2XGXA 4I02A 2PRYA 1FZPB 1Q1HA 4OMYA 4A0XA 4QLCU 2B0LA 5EEHA 1FBSA 4RHYA 2ZJ2A 5D4SA 4CXFA 5D8KB 3WU0A 2JPCA 5IT9K 4MEXF 1HKQA 1HW5A 3H3ZA 3L00A 4ZYGA 3I59B 2PS1A 2CO5A 1DBRA 2Q0OA 2HCRA 3HIFA 1NHAA 4HX7A 2BBYA 3GO5A 1T38A 2HKOA 5HKLA 5JHUA 3E5XA 1ON1A 3P9CA 1TQMA 1GRVA 3KFWX 2XVCA 2VC1A 3L9FA 4QRIA 3SXYA 4JBAA 1ON2A 3E6DA 1YQAA 1Y0BA 2IA2A 3CO7C 4A6DA 1QO0D 3TO7A 4IHSA 3DPTA 3SFZA 1EH7A 3MQ0A 2ELHA 4CO8A 1XGMA 2QQAA 2QM3A 1OPRA 3HSEA 3F6OA 4F7ZA 2VE9A 3QU6A 3RDIA 4XLNF 1VDMA 2L3DA 2Y75A 4KUMA 1MKMA 4AD9A 1W5TA 1ZARA 4FHTA 4XSZF 1WKMA 3HTUA 3HUGA 1W7PA 4A0YA 1ODDA 3KP5A 4P82A 2P8TA 3DXJF 1YW7A 1U8RA 2O6GE 3QP5A 1FBQA 2JBHA 4LGWA 2OQRA 4EM2A 5ICGA 3LA2A 3NAGA 1GHCA 2OZUA 3V4GA 3T5XA 3NRVA 3HHHA 3CUQC 4ENJA 4TV7A 1V4RA 5IPFA 2NAZA 4FT8A 4QWQA 5J8FA 2G7UA 2DO7A 2QWWA 1IUYA 1G2QA 3IL2A 4G7ZF 2HTJA 2K4JA 2UXXA 5ICCA 1YFZA 1FYKA 2QVOA 4KDPA 5BOXA 3ZMDA 3GXOA 1QK4A 1MDMA 1BI2A 3V7CA 1P17A 2WWYA 4UNOA 1J59A 3G6WA 3Q5FA 2IW5A 3SZTA 5HIAA 5LHIA 5FFXA 3DP7A 4LK0F 4UVCA 4HW0A 3PQJA 3W6KB 4PDKA 2V1XA 5AIQA 5F1RA 2YZKA 1A96A 4LG0A 3WE2A 4OOIA 1ECJA 3CUQA 5HDNA 2KKOA 4HA8A 2FNAA 1FSGA 1EH6A 3QOPA 2IA0A 4RGSA 1T98A 1K6OA 3F21A 3JTHA 1BBYA 2RNJA 3VFZA 1I27A 4RB0A 2PMUA 5CVRA 2STTA 4NB5A 1USSA 2HR3A 3FX3A 4G9YA 3J80K 4UV9A 1IN8A 3ZMTA 3ZMSA 5E38A 5K5OA 1MGTA 1T0FA 3M8EA 2A6HF 2FBKA 1LB2A 2P5KA 2FMLA 5K51A 4BH9A 3J81K 1ZG3A 2GZWA 1E17A 4KMUX 3CUQB 4LB6B 2F5EA 2YSRA 4M9ZA 5JVTA 1SFUA 3DF8A 4IVNA 2RN7A 3F8NA 5D5XB 2FXAA 4AIJA 4ESFA 3WTUC 1IXCA 2WTEA 5K5RA 2RGVA 2FSWA 2ZMEB 3I59A 5ESXA 1I13A 3ABUA 2OBPA 2QENA 4MQVA 1SD6A 1QCCA 2XRNA 5DCMA 3EFHA 3REOA 1IZ1A 2GQQA 1VTNC 1T2KA 1F1ZA 1TQPA 1REPC 2MH2A 5A2QZ 4IRIA 2ACJA 2DAOA 2QBYA 1DP7P 5D4RA 5H20A 3FMQA 5BRNA 2IPQX 1B1BA 4P96A 2XROA 3K69A 1YFHA 4JITA 3QAHA 4ZZLA 3HTSB 3KETA 1D8JA 2K27A 4A6EA 5ED4A 2JPBA 2EFPA 1W30A 2H94A 1Z7GA 4L9JA 4WXDA 1HGXA 4D0PA 3T8RA 2ISYA 1QNTA 4O3MA 5K1YA 4PAWA 1R1TA 3LQQA 1QBJA 4P3KA 5DUKA 1IRGA 2KJBA 3MFKA 3EQLF 2A68F 1XCVA 4HX4A 4U0WA 3RPUA 2HQNA 1AOYA 4HF0A 1IF1A 2RKHA 3WTSC 1MJAA 2JKYA 4R1HA 1IW7F 2XKOA 2BEOA 4OIRF 5CYVA 3I5UA 2NS0A 3ZMVA 1I0IA 1IN4A 2RC4A 2P6TA 2ESNA 1G3TA 4HF1A 2GEBA 1RI7A 3FWEA 3DEZA 1P4AA 4M74A 4XLPF 5D5WB 2HWVA 5F64A 3JAMZ 2HTSA 3M7GA 2WV0A 3KP7A 5E1WA 4DNCA 5D5VB 2CWEA 3Q9SA 1UB9A 4UVBA 4LLLA 3T1BA 1DUXC 3KEOA 1X3UA 2MBFA 2HKXA 1U5TB 2VFAA 4FYMA 4N0BA 1HKTA 3PQKA 4OHCA 2M45A 1TQIA 2ZFWA 1V3FA 3VB2A 2H08A 1LJ9A 3H3UA 3S5JA 2DQLA 1PUEE 4CHUA 5JSQA 5LGUA 2RQPA 4U88A 3CTAA 1O57A 4WK8F 1YW9A 4O5VA 3O3KA 2ZKZA 4KMFA 2M87A 1RZ4A 1IAWA 4LK1F 2MLKA 3ABTA 4KFCA 5ILVA 2ESHA 4P9UA 5BPDA 4M9SA 3HRSA 4RAZA 4FX0A 1HW2A 3JW4A 3FXQA 2HZTA 1FYLA 5KVRA 5CVIA 1PDNC 3B02A 2K7LA 2FE3A 4G6DA 3IWZA 2Q2EA 1ULYA 1I5EA 4LFUA 1P2FA 2V1DA 3F23A 3D0SA 4HYEA 4ENMA 1BIAA 4BNCA 5D6EA 3MJDA 2O61A 1MD0A 2C6YA 2ISZA 2G7HA 4EJTA 4MB6A 1G9TA 1XDUA 3VEPA 2FRHA 1EH8A 4L0YB 3R60A 1Z1DA 2CG4A 1HXDA 4L0ZB 1QZYA 3GGCA 1R5GA 1W7PD 4EMSA 4JK1X 1OMIA 1ZRDA 1I0LA 3D5LA 3BZ6A 2QYOA 2M5WA 4S04A 4LMYA 2FMYA 3FXUA 1K7AA 5H6RA 3K9TA 5E8GA 3WG9A 3FM5A 3RI4A 2D1HA 5EUCA 3B73A 2EV0A 3C7JA 3OV8A 5TRDA 3KP6A 5DV5A 4KNYA 1TNSA 4P81A 1I1SA 3KP3A 4RGUA 1U9ZA 3K0LA 1PP8F 1KU9A 3FZVA 3AAFA 4RANA 1E2XA 2P4WA 5D5UB 1SAXA 1FBUA 1AWCA 5JI6A 5A2QK 1A04A 4M0UA 1R23A 5F6FA 4EQQA 4PCQA 4H0EA 4RACA 2VBYA 3QU3A 2PMHA 3QPTA 1XTTA 1A4XA 1I6XA 4HQMA 1GXQA 3M3HA 3WGIA 4HBLA 5HLGA 3E6CC 2HS5A 1P92A 2HFHA 2XBUA 2IVMA 3TDUC 4RHUA 2GA2A 2ZNZA 2EFWA 2OAZA 3NEUA 2YPRA 4GGGA 4IHTA 2F5FA 4ZYEA 5L3GA 1G3YA 3P7NA 3CLOA 2ETHA 5FB2A 3GWZA 1FYMA 2W84A 1XSXA 1FPQA 2FXVA 1LEAA 3LSTA 2H6CA 4S2UA 1R5HA 4A0ZA 4EGYA 1BJAA 2PEXA 3E5QA 2EV6A 4RGXA 1JLSA 2IT0A 1CGPA 4M9XA 5FD5A 4HZFA 1K78A 5D6FA 2DW4A 5DD8A 3GYHX 4E70A 2P5LC 3F22A 2TDXA 4HV6A 1ZN7A 4WX9A 1KU3A 3MZYA 1R58A 2V79A 5DDGA 3K1PA 2PFBA 3FXRA 1XGSA 2H09A 3ZN1A 1SD4A 2LF7A 1ECBA 4Z1OA 1A3CA 1SFXA 4L18B 3JSPA 3WGHA 3SZPA 1O7FA 4P80A 4BHBA 4BHPA 1XD7A 4A5MA 4LZOA 3RKYA 1QB7A 2FOKA 1LDJA 1QQIA 2GWRA 5CVUA 3N2LA 3IHUA 2H06A 2FQ3A 3ACBA 5CVVA 3J7AO 2NYXA 2XIGA 3C3WA 2H6BA 3NQOA 1TC1A 3K2ZA 1CF7A 4X44A 3R61A 2C4KA 1OYYA 2HQRA 2DT5A 1P18A 1ZLJA 3GLXA 4I98B 3GGJA 1MDMB 3L7WA 3RKXA 5HLHA 2MA3A 2KJCA 1KQ0A 2IA1A 4RADA 2L4MA 1CF7B 1S6LA 4X45A 2KIMA 1QPMA 4A5NA 4L9NA 2XUBA 3LAPA 2A07F 4Y17A 2JT1A 3JTGA 2AXLA 4XBFA 1QGPA 4M72A 5CVJA 1VSTA 2YX4A 1HSJA 4KA4A 1D6NA 2GAUA 3HYIA 4WWCA 2VBZA 4UHTA 4OIOF 3LPNA 5L3EA 2NRAC 5LGNA 3TDZC 2JI4A 1H9GA 1HBXG 1YIOA 4M73A 3WTTC 1F4KA 3QRFF 1BC8C 4CGZA 3RJPA 4IRGA 5K5QA 4LB5A 3MBIA 1G2PA 3QW4B 1FWZA 2ADUA 2V1UA 4A2UA 4LG0B 2O03A 1B6AA 5TJJA 3LWFA 4G7HF 3GFIA 2LSOA 3L2CA 4IJQA 3HRMA 5LRSA 4P9FA 3TGNA 2W57A 4OINF 1FY7A 4QYIA 3WU1B 4L5JA 2AEEA 3TOAA 3KZYA 4WXHA 4R79A 2VONA 1ZLKA 3G73A 3QP6A 1BI3A 2E1CA 3U9GA 2D2WA 3G3ZA 4KN7X 1R36A 1S3JA 4GXOA 1FLIA 2DFIA 1UPFA 3ROUA 2OZ6A 1FX7A 3F3XA 5L3CA 5ILSA 3U2RA 1J7KA 2P7CB 4AWXB 1OKRA 2O8XA 4RS8A 3RTRA 4KICA 2PI0A 5FLXZ 5DEQA 2D1VA 3Q9VA 3E5UA 1YTYA 4HLYA 2A3SA 4ZYDA 4Y13A 3IRQA 1Z9CA 5HS8A 2GA1A 1S7AA 4RQBA 3CO6C 1XCBA 4ENKA 4RQAA 5L3BA 1ZN9A 4LYGA 1MZBA 2W85A 1J7JA 2CW0F 1W7PB 5L3DA 2KRFA 3EYYA 5E1XA 4U7BA 2W24A 4UUVA 2XV4S 1KGSA 4R8HA 2PBIA 5DCFA 2YX7A 2GXBA 1OYWA 5FGMA 3JAMK 1G3SA 3GF2A 4YG2F 3BPXA 4G7OF 3V7RA 2FBHA 4KIFA 1STZA 5J6XA 4Q48A 2RV8A 2OA4A 2NNYA 2EB7A 4NHJA 3KZZA 5CLSA 3ERED 4HQEA 3VODA 3IWFA 1JHHA 2EFQA 1TLHB 2XAQA 1S8NA 5E1ZB 1LQ1A 1IN6A 1ZGJA 1USTA 1ZH5A 1H9TA 2EFOA 3GX4X 1XMAA 3BY6A 2O0YA 1UFRA 5J8CA 1DPUA 2PN6A 2VC0A 1LH0A 2E1NA 4RB1A 1U6GA 3H92A 1UFMA 2AS5F 2BE5F 3O2PE 3GEZA 2F5CA 1I5ZA 2X4HA 4Q47A 1R1VA 3M9AA 1YO5C 2UXNA 1D3YA 1OYIA 2JKZA 1XN7A 1ZRFA 2FEZA 1U5TC 1G6NA 1IXSB 1DDNA 2Z33A 4BQAA 4RGRA 1DQNA 4RB3C 3RKWA 2GIVA 1IN5A 3ZMUA 1O3RA 1YYVA 5JV5A 4MTEA 4YFXF 1F5TA 3J81Z 2LNBA 1IBSA 2HOEA 1IN7A 2GXGA 2QQBA 4BHCA 1G3WA 4EGZA 1XZ8A 1Z7UA 2L4AA 3R6SA 5AIPA 4AIKA 3F72A 3DFGA 5HLIA 1W4MA 1G4DA 1D8KA 2EHJA 4ESJA 4LLGF 1W5SA 3OHPA 1TBXA 1JGSA 1I14A 1KYZA 3V8KA 2RVCA 3TOBA 1KA8A 1U5TA 2M30A 2J5OA 2A6EF 2Z9OA 2OQGA 5D8LB 4U0VA 3LQRA 1R3UA 1UPUA 1FC3A 3F8MA 1TTYA 3BDDA 3BOQA 1O7LA 1ZAOA 4B8XA 1L1RA 2A61A 2FNPA 1FSEA 1P4WA 1HQCA 4PGHA 3WODF 4UXNA 1SD5A 1L0OC 1A98A 3C1DA 4IJAA 3OZGA 1QZZA 1U2WA 1BD4A 2DPUA 3BJAA 2HYFA 3BWGA 3K1MA 2F2EA 2PRZA 3HVUA 5DUIA 4LZAA 3IC7A 4RAYA 2K02A 4WXCA 4ZH4F 5LHGA 2VT3A 4MTDA 5E17F 4KIGA 4Q4ZF 1Y0UA 3E3VA 1WQ2A 2EV5A 4LYYA 2FBIA 3ELKA 1I1GA 4CICA 3EYIA 2XKPA 3RYPA 1SD7A 2W25A 5LLQA 1UHMA 2Z3YA 4M71A 2WC2A 2F5DA 4K2EA 2EFNA 4KN4X 2QQ9A 4U0YA 2QUFA 2MLGA 1U9YA 4M0PA 2COMA 1MZVA 1L3LA 3FMRA 2BV6A 4JQFA 2UWMA 2VODA 4IXAA 5HDKA 4S05A 3BPVA 1B4AA 3E6MA 1YW8A 1QK3A 3W6JB 1PZMA 2XAGA 2IP2A 1ZYRF 3WTWC 2QZ8A 4KIBA 4ZYHA 2VXZA 2EA4A 4OIQF 1XTVA 1GPH1 1D5VA 1T39A 1BOAA 3DMPA 4ZZDA 4TWBA 4ENNA 2V6CA 4NQWA 1BZYA 1XTUA 5FD6A 1STOA 4IPAA 3T8TA 2QLZA 2YU3A 1DPRA 4HOBA 2E7WA 2HEOA 3GFLA 5LBQA 1O3QA 1J9IA 1JHFA 1J5YA 2M1BA 3GEPA 2VBXA 3WTYC 2WNSA 5BSKA 2CGPA 1VCHA 1J2XA 1XSVA 3ZMZA 4M6XA 1FNNA 1YLFA 2P7VB 1TNTA 5ERIA 2M8EA 1BN5A 1MJBA 4UVAA 2ZXJA 3CDHA 5FLXK 3KB8A 2OD5A 1TC2A 3ISPA 5EEGA 5LHHA 3M1EA 5L3FA 2XAHA 4CYDA 5ICEA 3E97A 1TW2A 2VN2A 1BM9A 4BAYA 1KU2A 4HF2A 1LDDA 5HS7A 2JZYA 3O7MA 1KQ9A 4ASNA 3LAJA 5FFZA 4I01A 1LEBA 4BYYA 3ML6A 4MNUA 3CJNA 3FM3A 2HGCA 1OPCA 5ILUA 4G6QA 1RNLA 1FOKA 1EV7A 1DQPA 4I7HA 4N9IA 2STWA 4P86A 1F9NA 2Q8KA 4CZZA 3DQVC 4IF4A 1YS7A 3FHZA 1WD5A 2VOPA 4YIIA 2DK8A 4OIPF 1TW3A 4ESBA 2P1ZA 1XDSA 4QYIB 2E7XA 5E8IA 3HOTA 1R7JA 4UV8A 2MC3A 2DTRA 3LA3A 1WRJA 2A69F 5E18F 1A97A 1Z05A 1ECGA 5H6QA 3I4PA 2L01A 3U1DA 5JR3A 1BC7C 3ZQ7A 3IRRA 1ZHFA 2JTVA 3E6BA 1IRFA 3LFKA 4CDGA 1ZG5A 4I0BA 2DLLA 5ICFA 5BQTA 2L54A 4EJWA 4EJVA 4WMLA 2X0LA 3BJOA 3TO9A 2ZNYA 2O3FA 1SFEA 1NULA 3COAC 3N97A 3F8BA 1WI9A 3KE2A 2YR2A 3S2WA 1K78B 4LLNA 4ZFNA 4EM0B 3GZ6A 3GVAA 3HRTA 1QCDA 2CSOA 1BD3A 1HW1A 1HMPA 3DAHA 4FX4A 1OR7A 3VOEA 1ZG1A 2J5PA 4LJZF 2JSCA 5HVQC 5LRRA 3HRUA 3MWMA 2VT2A 2XASA 1BIBA 3H83A 3HSRA 4I2OA 3F8FA 1YG2A 4KN6A 2QBYB 5IT9Z 5DYMA 1AO0A 3K1NA 1OROA 5JFRA 3MCZA 4B09A 1KQ8A 3I71A 3BP8A 2RDPA 5CJ9A 2JRTA 2H27A 1SMYF 3TKYA 5BS6A 1NONA 1LDKB 2KIUA 4GO1A 1XB4A 3SHFA 2LKPA 4I09A 3LRTA 1FSHA 5HOOA 2OU2A 1WWXA 2XAJA 1DKRA 3LA7A 1KU7A 4A12A 4MHGA 3V8JA 4HDUA 4P84A 3RYRA 2P6SA 2UZKA 3I0TA 2R7DA 2VBWA 2IRFG 4GYGA 2L02A 2Z5UA 3ULQB 5KAPA 1KYWA 3KCCA 5E20A 1ZREA 1C0WA 4WF2A 3IKVA 4EV0A 3EETA 4EJUA 3HHGA 3MZHA 3WE3A 1XSDA 2HYGD 3OOPA 3EUHA 3R0JA 4PZJA 3QPHA 2DBBA 3DV8A 2KIFA 2DK5A 2CYYA 1HSTA 4RB2C 1GVJA 5ESWA 4BXUA 4RAQA 4HAMA 3O6BB 4Z2YA 1B59A 4PFQA 3CUOA 4ON0A 4YFKF 2G9WA 4N9HA 4M6YA 2K86A 4L9VA 3RPQA 2VE8A 1P4XA 4L5IA 5KK1A 2VOOA 5IT3A 1GXPA 4LZNA 5DCMB 3GZ5A 4MGRA 3GFMA 2IGBA 2A5YB 5LEKA 1K79A 1SMTA 4G94A 5FO5A 3DEUA 3ZP5A 4OU0A 1ZGAA 1A95A 3KEQA 1V9SA 1DKUA 3KP4A 1UHWA 1BI0A 3L09A 1ECCA 1HKSA 2CFXA 2IJLA 1XMKA 5HDGA 2EK5A 4HV5A 3M8FA 2R3SA 3EDPA 4RV4A 1B9MA 2DQRA 1IXRC 3R4KA 5BMZA 4EJOA 4ETSA 4XRFA 4HDVA 3GFJA 3P9IA 1U78A 4RHTA 5LGTA 2Z99A 5AONA 4AVPA 2XHKA 3HSFA 1S29A 1ZN2A 1QK5A 1ECFA 1WSUA 3R0AA 3KLNA 1H0MA 1ZRCA 1T6SA 3ACDA 2K4BA 1FT9A 4I0AA 4Y15A 4P83A 3I58A 1RUNA 1YS6A 4MEYF 2XAFA 4P55A 2V9VA 3N4MA 2Y0MA 2ZCWA 4L9TA 2E55A 1G9SA 2LDUA 4HX8A 2DI3A 1PP7U 4WCGA 3C18A 4JLSA 1XZNA 2PJPA 1U3EM 1OREA 1XGNA 1FP2A 2FF4A 1BI1A 2PQ8A 4O6JA 3WTZA 6PAXA 2HDCA 4EVIA 2R7FA 3I64A 3BJ6A 2FU4A 2EA2A 2D45A 5BQOA 4MQ9F 3OZFA 3DPLC 2MD5A 4IRHA 1P6RA 5BQPA 2ZO4A 4KT5C 2PG4A 1B9NA 2EJRA 2ZBKA 1R1UA 1ZN8A 1R00A 3TO6A 3IKTA 4F8EA 3V7SA 3BROA 4P5OA 1J75A 5BPIA 3PFIA 3SQNA 4YIFA 2FA5A 4KYWA 2BYVE 4RABA 3WTXC 3GW2A 1RIOH
chains in the Genus database with same CATH superfamily
2LR0A 5E6RA 4LV5B 2BSXA 4Y6LA 3F6VA 3B38A 1Z6RA 5LCXA 3GUDA 2H07A 2HQ5A 2IDZA 2I29A 1VHTA 2B3DA 3GJSA 3ICVA 1NM5C 3LC2O 4KLRA 4OBXA 5ALWA 4PAOA 4G4IA 1DXHA 3PCRB 4DLVA 2GYWA 4QGBA 2LF8A 3FXLA 2NTEA 3PQ3A 4NC9A 5JAOA 5MFZA 4R7ZA 2Y9MB 1NVEA 4PCUA 3ECOA 4Q3OA 2YN0A 3HN7A 3OO1A 3JQAD 4HAIA 1MG5A 1JSRA 4BBJA 4IR7A 4C0SA 4O4LB 1ZIYA 3PDIB 4YCNA 2L2QA 3R0IA 1BA5A 2DHCA 4GOOD 1PR3A 2OV3A 4ZDLA 4J0DA 4UEWA 5HMLA 2WHQA 1G8HA 2JLUA 3M82A 4GMHA 3K4PA 2OHIA 1OI2A 4CKXA 1P19A 5DLQC 4EM6A 3GFRA 2CQKA 1OA0A 1YRHA 4BLQA 5DNEA 4E31A 5IASA 1X1BA 4AAYA 5HR5A 4AROA 1EA7A 3BGVA 3DNPA 3MLBA 2EWVA 2YR0A 3G2QA 5CXXA 2IEGA 4A6XA 4YREA 4QJ4A 1L5KA 2VAMA 4XOTA 3PRKE 4GC5A 4XB2A 4Y6SA 3WTVC 4GSYA 1ETVA 3BT9A 5K3CA 5JMOA 3RIRA 2Y3IA 3MJSA 2Q49A 1AT1A 2H5LA 3B53X 3FETA 4RHXA 4UMEA 1UDWA 4ZMSA 1J0RA 1MBGA 3B1WA 1KK2A 3OYJA 1PP4A 2J85A 4JXXA 2MSNA 3FUXA 1I4OA 4DQ2A 4X1YB 1XCLA 5A0FA 4F4FA 7AT1A 1JDVA 1GZ6A 1U7PA 1E2KA 2Q5CA 5ERYA 1XELA 1L1QA 3K2BA 4MQLA 2W0MA 1LRJA 3CLVA 5KAMA 2WFLA 1O9HA 1DKMA 4HG2A 1D5CA 1QVZA 1UXKA 1HRKA 3NP9A 5IAOA 5IT5A 1DOAA 4C7OB 1DRKA 4OB6A 1ZK2A 2VOJA 4NBVA 1HYQA 4Y33A 1CUEA 1Z6AA 3OSUA 3R3ZA 1JKXA 3C45A 3SCZA 3GPIA 4QGSA 5C3EJ 2W90A 1S4QA 2G8NA 4B46A 1IOWA 2Z5LA 3NZEA 4BS9A 1GGVA 4FTHA 2QLTA 5C52B 5JQGA 1S7OA 1U2QA 1XSEA 1F38A 4BLWA 3CWZA 1XR3A 2GETA 4EFMA 1XU4A 3AR7A 4YWHA 1PD1A 3HGYA 2XOEA 4RHCA 1PNVA 4D56A 3GI1A 3T7AA 3WQRA 4BQFA 1MJ9A 2H9IA 3NJRA 4AS2A 4EB0A 1UMQA 3ON5A 2WYOA 5FWXA 2JD2A 1G3IA 3AG1H 4E7HA 2X85A 1UBUS 5AI5A 4DBLE 4ENQA 3UJNA 4FFBA 4QDXA 1Z06A 4AIHA 1B0UA 3G4SI 3MTQA 3FF5A 4EPXA 1HORA 3PUWA 2F3UA 2V54A 4Q7EA 2R47A 3J80Z 4GP7A 1I7SB 4QTXA 3CD6I 1IG0A 3U7RA 5IAAA 5C8XA 4ZVPA 5IT4A 1AJEA 4D3FA 3MTAA 1U0RA 3H16A 4RBNA 1K4YA 1D2MA 4FMCB 4GI2A 1N9KA 1YRQA 1UBEA 1ADYA 4N6OA 4O4JA 4Z7NB 4KAXA 3DKWA 4BNUA 2GD1O 1X0XA 4ND7A 4OL0A 3N8KA 1NATA 2G3YA 3I0NA 2JPDA 3QKSB 2C94A 3AKEA 2Q46A 4MVJI 1HDEA 1SO8A 3EXG2 4I9UA 1O5OA 4QODA 4XWGA 3DXYA 3HCNA 5BWLA 4BO6A 2X0IA 3W8NA 2XLBA 2P5VA 3IBGA 2K5UA 4P54A 5KKAA 4E7JA 4WKCA 4XGNA 2X6OA 5DM6F 2VUTA 2CBGA 3TEDA 2XR1A 4L5YA 3WA6A 5JQWA 4S1PA 3A36A 3AGQA 2GSDA 4XSGA 1NTOA 4EELA 3FNQA 1JKIA 1RWWA 1LE8A 1Z17A 4FGSA 4P7KA 4QT4A 2YKGA 1TTQB 2JJ2A 1ZL2A 1E4VA 2CN1A 2XGXA 4HH1A 4NCJA 2A4MA 4KO4S 4OMYA 3AONB 1JEOA 3EVEA 3TQFA 1M0EA 2OYCA 2W7NA 4EY3A 4IG4A 2B0LA 1HNWB 2PTHA 5FKNA 2DPYA 3LBHA 3PHIA 2WR8A 3W5CA 3QOFA 4I4CA 3BXHA 2IGNA 1TFRA 4RGVA 1J56A 3L7CA 2FMKA 4B4WA 2DMNA 5JW6A 4R2LA 4QAJA 1K8QA 2AIRA 4RHYA 4HFNA 3I0ZA 2QMOA 3ZDRA 1TCAA 2QT0A 3LSJA 1V1RA 5ICMA 5IUKC 3L8EA 1Z18A 2R7LA 4CXFA 3P2IA 1OWLA 1FSFA 4J1SA 3E22B 3NHSA 3CZMA 4G01B 4QTTB 2PJRA 3ZGKA 2N8GA 3WU0A 5D8KB 2DOKA 2H1VA 2QUBA 4MUBA 3R7WB 2JPCA 2IX9A 3T5DA 4B3SB 1SBIA 3S70A 1U81A 3H9EO 3Q7RA 4CYCB 4RH0A 2Y0DA 3CNNA 4QWMA 2DAPA 4J4BA 3LZCA 2QD4A 4S1NA 5HOEA 4KSCA 3MK31 1NW8A 4JI7B 4Y8VA 3WHKA 3DTYA 3PVSA 3O8BA 4AW9A 3F0TA 5I9IA 1B76A 1DBRA 1Z47A 2DHDA 2JGNA 2Q0OA 1QVWA 2ZBDA 3JD0A 3ODPA 1NHAA 3Q8WA 4FR0A 4UXIA 2X1LA 2BBYA 3BDAA 3D5TA 2OCYC 2QG6A 3FOEC 4K9QA 4JYBA 1T38A 2HKOA 4KXMA 3QQPA 3GRVA 3T38A 1BMDA 2VKQA 3N2YA 4KR0A 3BR2A 1PG5A 1AC5A 1VKRA 3BXGA 3ROFA 4A5OA 3R1IA 1R6TA 4US0R 3JR3A 4YMGA 4XFJA 5EP1A 1TQMA 2RGWA 2MR6A 3QVJA 4JBXA 3G0OA 3L9FA 1T0BA 4IMIB 1JDJA 1KKMA 3AU9A 4RY2A 1Q91A 3ESYA 2BPOA 2G88A 4JBAA 3MKWB 1R15A 2I6GA 2V6FA 4MV4A 5FR1A 3FI0A 4KPEC 1NGSA 1Y0BA 5EMLA 2IA2A 1KDZA 1ETXA 1FYWA 4COKA 4EBBA 1E5VA 4KIWA 1QO0D 1I5RA 3IEUA 1MJGM 4MW6A 5EXSA 1EH7A 1D8TA 5JSZA 1L9XA 3ZKWB 3W6NA 1UFQA 1AO3A 2RGEA 1I2DA 2O0JA 2ELHA 2JA6J 4JT4A 1C7IA 2W6ID 3QI7A 1SQGA 3LOPA 1NURA 3O8DA 4FGLA 1K06A 1M6EX 5FBVB 1VQ1A 4X62B 2WADA 2IHNA 4XKCA 3PFNA 1QLJA 3E9CA 2PGNA 3R7AA 2GLXA 4E6PA 1VDMA 2B99A 5NULA 1OFCX 3V00A 3G17A 3G3EA 1WF3A 2Y75A 3A4YA 3HWRA 1MX5A 4RVGA 3TMYA 4M3GA 3W1VA 1RVDA 2PFKA 1PLJA 4BN4A 3ZVMA 4EUHA 2CLKB 4EGQA 4ZVLA 3GTJJ 1ZARA 2XBLA 3H6GA 4HWSA 4IEFB 4GM1A 3R5KA 3R6GA 2OFFA 3K8ZA 3HTUA 4ILKA 1DZ3A 5A6VA 3TPZA 4W6ZA 1XQVA 3VR6A 3RTAA 4DAOA 1FNDA 2YWXA 5ELMA 4K6OA 4HZGA 3DXJF 1YW7A 1U8RA 5J5VA 1N6IA 3OTHA 3U1KA 3CT6A 1P5ZB 2BGMA 3CKMA 1DRWA 1DTEA 1Z22A 2EWWA 3AF0A 4ZT7A 3T7CA 3MWFA 4D0NA 1EIWA 3QP5A 1H8EA 3ANTA 5AKZA 1N2CB 2P11A 2FW0A 5D1HA 5FFNA 5M04A 2BJWA 3FTFA 9MHTA 1LPQA 3CG4A 3OTWA 4PO3X 4LGWA 1EINA 2R2AA 4EM2A 3EZXA 3JARA 5CX1A 1U9NA 4OREX 4GPAA 3BD7A 3S1MJ 2IHBA 2GPAA 3K73O 3HJHA 3O90A 1NT4A 3PB3A 4G8JA 2H7YA 5D51S 5E3LA 2OZUA 4Y3OA 3V4GA 1E8DA 4Z0HO 3SZLA 5DLPA 5EGOA 1GN8A 2GBCA 2PMZN 3HHHA 2F67A 3JQDA 3O4FA 4FKMA 1DC3A 4UE6A 1DC6A 4O02B 5E4JA 5SY9A 3LO8A 4B6EA 4PLPA 3COYA 2XNHA 5AXBA 4F4HA 4RTSA 1AH2A 4MVWA 3NT4A 3LMMA 1EUDA 3AUJB 2ODEA 2CL6X 3IOYA 3N2ZB 4IDOA 3RUCA 4RTLA 2O8BB 4RL6A 4QWQA 1DKQA 4WDRA 2B8JA 2G7UA 2GVNA 3FHNA 1T9ZA 2CEKA 2HIMA 4TMTA 2QWWA 4TTVA 4E33A 3ETLA 4KBFA 4XD2A 1A8UA 3B78A 4QBTA 3UYLA 1EUCB 2BUBA 2QD3A 1DJNA 3KXLA 3L7IA 1IK6A 4BNTA 5DM0A 4HNRA 2UXXA 5ICCA 3OT5A 4OKSA 3A6PC 2DBYA 3WQBA 4U1RA 3OIGA 3UJBA 2AYZA 2QVOA 1TK9A 1O94C 3QQ5A 4KDPA 2JGMA 1CUDA 2FJ0A 4MROA 4U3JB 4DYQA 2COUA 3FKQA 3IMFA 1ZGBA 3EXIB 1C3OB 3VHRA 1MDMA 4K0KB 5K45A 1C3VA 1HC7A 1S2GA 2CJYA 1KNQA 3CZQA 2CXRA 3LX8A 5ALNA 5G4KB 4ZZ2A 3WISA 5BSHA 5JBQA 4Z4QA 4JHXA 1P17A 1ZD2P 2WWYA 3E3OA 3TTUA 1DHTA 4JENA 2HA5A 1YUNA 1J59A 2HM7A 4QATA 4A2CA 3Q5FA 1VMAA 3I76A 2HXSA 3A58B 4NFSA 1P6XA 3IJPA 4F04A 3AR5A 2EP8A 1UFOA 2R6R1 4ECAA 2PIDA 2W4MA 1HZJA 5SICE 4EI9A 2PMWB 4JEHA 1N0WA 1FDOA 3UPDA 2V74B 1OAAA 5LHIA 2FWPA 2JUCA 4KAJA 4CDNA 4UVCA 5BQFA 5I7UA 3RANA 3PQJA 1CWUA 4E09A 3UK2A 1APBA 2O2JA 1LX6A 2C31A 4KPYA 3ASOH 1B6RA 5AIQA 1BWRA 5A4MS 4WZ6A 3O2SB 2D7DA 4UAVA 2QKYA 4F3TA 2LH9A 1ZNQO 3I2FA 3CLUC 2MC4A 1A96A 3CLRD 3SF0A 5IKPA 5EE9A 3KQNA 4QGAA 4KVFA 1ECJA 4Q4LA 1PFWA 2LMDA 2J32A 2BM1A 4WXYB 4YWJA 4GXNA 2D4HA 5IX8A 16PKA 4R9RA 1KI8A 2P41A 4RJIA 3QU5A 5FI0B 3TTVA 2RGXA 3IMCA 4FSXA 4F6LA 4L5AA 3TOXA 2ZDQA 3AHDA 1R71A 1HT0A 2VLIA 4TLEA 1C81A 3O4HA 3A1FA 1JHRA 1QHSA 1TWAJ 2IYSA 3WWZA 4RGSA 1K6OA 2YNMD 3F21A 1OXKB 4B7XA 1YCDA 2WJZB 3T15A 5FL7A 4IDFA 3BCHA 3ZCSA 2EBHX 4XUGB 3AB7A 3E5MA 3EVGA 1MEOA 4FOSA 4AURA 3U4QA 3UN1A 1U2DC 5ITZA 2JFNA 1T6ZA 2P6OA 4GI1A 1JILA 3KUXA 4P0PB 4RB0A 1IV6A 2PMUA 4H6XA 2RAPA 1P2BA 2HR3A 4BJ6A 5LQKA 2ZS9A 3NGMA 3H2HA 4ISBA 1MUUA 4QDTA 1E1CA 3W2WA 4IIFA 4RVDA 3VR6H 3A4NA 4LRYA 1FNCA 4DBRA 3FPGA 1EP9A 2H7XA 2UYYA 4NJEA 3B8HA 1QF7A 2IY9A 2NO1A 3LBAA 1NVWQ 1NKTA 1CUCA 1UBOS 5ALYA 4KTTE 1J5XA 1WXEA 2JFUA 1LB2A 1E5QA 2NV0A 2RH4A 3A4TA 4J6EA 4R1TA 4BLRA 4CV1A 4B3GA 1HLPA 1KMMA 2F43A 2JEYA 5IYZF 4BH9A 2GR9A 3IQIX 4LQLA 3J81K 1ZG3A 2GZWA 3OY9A 1E17A 3NP7A 2BFNA 4OQNA 3JAKB 4KMUX 4KXUA 5C8YB 2QTFA 2UUPA 4HB0A 3JXEA 2A84A 1WVIA 2YJ3A 3BXXA 1YRYE 4MMXB 4MULA 1F5SA 1BCRB 5JXWA 5FOSA 3DFZA 2ZE5A 4MCAA 2HXYA 2YWHA 2Q5JA 4NYIQ 2Q5EA 4X20A 3WRWA 3ZI7A 4MYRA 1RQRA 3UENA 4ALMA 5J23A 4UMVA 4ER3A 3HWSA 1JX6A 2IUTA 4PJ0C 2ZSKA 4C0HA 2H3HA 1IBKB 3QLVA 3PNSA 5I9LA 1FUIA 1TNDA 2ODAA 3JVIA 3OQIA 4K9LA 5TEWA 4WW0A 2VHVA 2Z8ZA 1PYOA 1G8FA 5IARA 2IEYA 1V8ZA 2FE1A 4DCVA 3H35A 1GV1A 1Z5WA 3FJYA 2HBQA 4H16A 2QZ4A 3FNIA 4LBVA 2RK6A 5D3ZA 1K68A 3USES 3GRKA 5EZYA 2FCRA 3AV0B 1VXRA 1EGMB 1YU9A 2BBOA 5ESXA 3VJKA 3W7BA 3U80A 1RETA 2R4UA 5JRDS 1T6YA 2CCJA 2AW3A 2HCJB 5JCXA 1T5OA 1B2LA 4TMKA 1Q1VA 1XC5A 3ABUA 1ZCAA 3FRHA 3HSYA 3RF7A 4L0CA 2ID4A 3VMFA 2X8WA 1ABBA 1CY4A 2QENA 1T5IA 3ZWDA 2KDOA 3H5IA 1A9XA 4B3TB 3G0BA 1T2UA 1TJNA 5DCMA 3EFHA 2X51A 1Z4KA 4WUTA 5K3FA 3IE1A 2PWBA 1M5TA 3AESB 4C5AA 2B82A 4LF9B 1TQPA 4DN6A 4IRIA 4D4KA 5AIAA 4QX6A 1B8OA 4EYSA 2QL5A 3AHHA 3GCDA 4YRGA 3OPYI 4LF8B 3HS3A 3SZRA 4TKVB 4C2TA 1DP7P 3OPYA 1FU8A 3RSNA 1KK0A 1P61B 2FSHA 3RFUA 3TJMA 2JH8A 1T1IA 4L6IA 3RUFA 3LXXA 1JZTA 3AG6A 3HVHA 4LRQA 1EJ2A 3P9SA 3BICA 1NPYA 3K69A 2W6MA 2OC4A 4IRUB 4JITA 1JKOC 4S3MA 2BXYA 5KTNA 5GONF 1K4KA 5AKKA 2O59A 2ZT7A 2JVGA 2OHXA 4YJKA 2K27A 4IFTA 3COJA 2ZYVX 5D3QA 2A1UB 1W2WB 1ZD8A 4OLAA 1MPTA 1JP7A 1MTOA 1YKFA 3E81A 3JARB 3PQ4A 4P4NA 4RFSA 5CX1B 4HEA6 5ALMA 5AR1A 5T8KA 3LKVA 4L9JA 3IT2A 3BF7A 1MO6A 1TZ2A 1VYTA 2WDZA 2V7TA 2XOKD 5AI4A 4URHA 2O0LA 3TINA 3KE8A 3JVVA 1UKAA 1JJ6C 4Q6WA 1SXJB 4A2QA 4D0PA 3RM3A 5A9SB 1ZH4A 4GMFA 5K1YA 3QYAA 4K03A 4KZKA 5IP5A 4GMDA 3L79A 4B3AA 3WBKA 1L5GB 3LQQA 5KX5A 4FHCA 5B1DA 3RCBA 3CU5A 2G71A 3MWDB 3IIEA 4P3KA 3QVKA 3MXTA 5DUKA 2A9VA 2FE4A 2D6FA 3MFKA 2VAXA 4JCCA 1WCYA 4NKRA 4MJ7A 1OZAA 2W98A 5G0UA 4BBZA 3UR3C 4EA8A 5AVQA 2A68F 1RPTA 1KQFA 3ZLJA 1XCVA 2C5GA 3VYRB 1JALA 5TX7A 2HA2A 2A6TA 2C9DA 2BGTA 1PWEA 2RJ3A 3HB9A 1Z2OX 1AOYA 1QH8A 4HF0A 1B74A 1ZI8A 3ETGA 4X41A 3U44B 4KL8S 3L6CA 5F5LA 5DM1A 1ONNA 3L6UA 4US2R 2OCCH 1Z3CA 1I2ZA 3O2NA 5JMPA 5ECYA 1JHXA 2JKYA 2XB6A 3QMVA 3HYSA 3G71I 2IEZA 3GAZA 5KYVA 1BEZA 5CFLA 1W36B 2MW8A 5E8RA 1IW7F 4YAOA 1CLUA 3WNBA 4OIRF 1UF9A 3S15J 1FFSA 5C0OE 5AW3A 1QIJA 2XH8A 3DM9B 1CUFA 4FILA 3BZUA 2ATIA 3RCOA 1S01A 4BAZA 3UKGA 2DWQA 2RC4A 5HM8A 1E6WA 1K7SN 3A6KA 3S3MA 5FRMA 2P6TA 3AETA 3LV8A 2CNWA 3VPDA 2PSEA 4HAUA 1QGUB 3OIVA 1G3TA 4HF1A 4K7JA 1RI7A 1Y4SA 5G1PA 3JR9A 2XMZA 3HZHA 3DEZA 4M74A 1FOEB 5YASA 3FDXA 5J9FA 2XIQA 2KL4A 2E6KA 2Y6VA 1L5LA 2DCEA 4FE4A 2P2LA 3DTVD 1E62A 1KI3A 5BPHA 5F64A 4Q7QA 4X8OA 5KTKA 4DADA 1E9AA 3NDJA 1QO7A 1QHGA 3KP7A 2IVZA 3LIIA 2WSSA 4NPHA 1XNRB 2RCYA 5E1WA 3PQDA 2NTNA 3NOQA 5D5VB 1WCIA 2CWEA 1JDBC 1FQOA 4H7FA 4Q0MA 5DXAA 3Q9SA 4YX9A 2GSWA 2NAFA 1WKBA 2H5IA 2IXBA 3FR8A 1CUAA 2BDTA 4UVBA 4IYRA 1DUXC 1YQDA 4IZOA 4MARA 3CF4A 3C7AA 1THZA 4B8WA 4BGIA 1U5CA 3WDKA 5BW5A 1H85A 1G3MA 1F48A 3DEWA 3IO3A 1Y33E 3OE7A 1NUPA 2PPVA 3IIIA 5TPWA 5HJ5A 2VFAA 4FYMA 5CB6A 4BQOA 4IQJA 3G9ZA 3HI4A 4JR0A 2FZVA 1TM4E 4N0BA 2PJRB 1JI8A 1NF3A 4A3JJ 1C7FA 2ZANA 3ND6A 3V4VB 3PQKA 5GM1A 3ZWOA 1Y6FA 4RJLA 1VE3A 4UM5A 5BWMA 1ZUD1 1ODKA 2EKZA 3F3KA 3FNEA 4JY7A 3ZU3A 4N6GA 1QU3A 1PVDA 2F3SA 4P3NA 2AG6A 1MMSA 4PYQA 1EEHA 1P60A 3I04M 1Z73A 4MJLA 4Q39A 4JXZA 1LJ9A 1CB0A 1PBTA 2B92A 2WKRA 5B3KA 2QQ5A 1N5JA 2Q1SA 4PY2A 3BEDA 3VUEA 3WP1B 1LBQA 2DQLA 2EQBA 2WUVA 1DP4A 4DEYA 4L9RA 1QGED 1E1DA 1XEXA 1XKXA 1ZXLA 2G9VA 5HPYB 1BXRB 1P44A 1BKYA 1EDOA 1ETQA 2OSBA 2PDAA 2LKSA 2Q3DA 2XZPA 1YW9A 1XA3A 4P31A 5GAGJ 3O3KA 1BFUA 5IANA 5ILOA 1PRYA 4RMNA 3UGQA 3PD7A 4CKWB 5I9NA 1K3FA 2BFCB 1NRJB 2M87A 1JJIA 2JGEA 4G26A 4XWAA 5B64A 3R3WA 1X7WB 1W5FA 1V7PC 2GO1A 3N2NA 4P5PA 3RC2A 2FJUA 3DF7A 3Q5GA 3VAAA 5AVYA 5H9WA 4Z9FA 2MLKA 4Y1RA 3R5TA 4KFCA 3OMLA 5JRJA 3W5BA 4P9UA 5EHGA 3IV5A 1UZLA 1A4IA 1OZ0A 1RRVA 1U0OC 1AA7A 1ZCZA 3CLTD 4M8IA 4AG3A 4E3ZA 1I1NA 5C1BA 3FXQA 3GLFB 2ZXHA 4NICA 5FUBA 1GGNA 3Q40A 1CX9B 1HYEA 1PDNC 1J2TA 4E7LA 1JBEA 4ENRA 5CT9A 4LJ4A 4PIPA 5LMNB 2HSZA 3D6TB 1QIFA 1PG2A 3W9SA 2EW8A 3PQ5A 2Q2EA 4GIBA 4U7JA 4DGWB 2JHAA 3IILA 4ETWA 2J4FA 3JWJA 4YHHB 1OF1A 1M7BA 4F5ZA 2VJAA 1ZIDA 1DWPA 3HUGB 2MYPA 2QTLA 3TNFA 1JDUA 4ABZA 3F23A 3R5SA 4B2IA 3J81A 1P0IA 2IHTA 4GYWA 5GM2A 4BE1A 2V9CA 4EATA 5LD2B 2DFLA 3EFBA 1UWCA 1QDLB 1W4BA 3IDQA 3OKFA 1CBUA 2IU0A 4MUYA 5BN4A 2JS7A 4RQUA 1ADFA 1W96A 4XVQA 4ND5A 3F9CA 2X9VA 4OJKA 4J7XA 1E4YA 2QL9A 3F2VA 4TXHA 5KYXA 4HNQA 2O61A 1AHNA 4KFTA 3FHJA 2C6YA 4OEHA 2HA0A 1KH2A 3BMOA 4YMTA 3DF9A 1A7UA 4EJTA 3GTGJ 1G9TA 4RVHA 3DWEX 4J1TC 4CNQA 2JI9A 1RJGA 4IF6A 2XQFA 2XWJI 5FUYA 3TXYA 1IHOA 2HYDA 2RBKA 3U31A 3KE9A 1RC1A 1VIDA 4BECA 5DTQA 5DZSA 1Y6RA 5H2FC 3MMNA 3GGCA 4RF3A 4G0QA 1UOQA 4XASA 2CZCA 2V3WA 4M22A 1DU4A 3U3MA 1W7PD 1LFDB 3DE2X 1NSTA 1WOMA 1XTRA 1UH5A 2ZJPF 1UEJA 1M2VB 2VP6A 3HV2A 1EZ1A 4ZANA 1L7XA 3KV1A 1Z5OA 2XKJE 3N39C 2L69A 3JY6A 3WGVA 1KZ1A 1N33B 4INJA 3QVWA 4IUCS 3BZ6A 2Q3MA 2XT6A 1E9RA 2M5WA 3I1IA 4P2GA 4OOEA 1SVOA 1NN5A 1UBCA 5FYQA 2JIZA 4MWEA 2Y2VA 3AM5A 3FXUA 2GBPA 5CG2A 4HSTA 1ABEA 2HOQA 1YR8A 5HZKA 1SVLA 4HRYA 5CUQA 3FM5A 3WWCA 5KTSA 2OGWA 3RO7A 3K7EA 3UM9A 1V5EA 3CCYA 1XLUA 2RBEA 2JJ7A 4DIUA 1PIWA 1NBHA 1RABA 1NBMA 1D5WA 3C7JA 1ZITA 2YRWA 3I6BA 4HC4A 4MVJF 4U6QA 3KP6A 3UC9A 3MCUA 1HF0A 1AK9A 3WL3A 1KJIA 4F60A 4N7BA 1NQOA 4PQRA 4KNYA 2TYSB 5KYXB 3PXUA 1EE1A 1KXJA 4JQCA 4NZOA 2N3ZA 5THKA 3R8XA 5JAMA 2VH1A 2EQ5A 5I7HA 1P9QC 2GYVA 2Y1LA 5CYPA 3SR3A 1I1SA 4ZGBA 5ICSA 1JHZA 1T0UA 1U9ZA 4BQNA 3KVOA 3MMZA 3V1YA 1H94A 1PP8F 1FRVA 5CA1F 3RVSA 3AJDA 3FW1A 5C1PA 4L02A 3CEMA 2X1DA 4OHBA 1SAXA 5IJAA 4BE9A 4MGZR 2OZLA 2CV1A 3AG3H 1HXHA 1WHTB 5GONB 1C1XB 3ANMA 2G1JA 5EIHA 3TW8A 4EJSA 5L6LB 4MA5A 1WBBA 4DLZA 2VJIA 2GZ2A 3UAOA 1M75A 3WO1A 1CULC 4R2WA 3IDOA 3LRXA 2GF0A 3NNNA 1NNLA 3NBMA 4Y2VA 3R9IA 3P4XA 1R23A 2HC9A 3CO0S 3E3LA 3FKSD 3JPYA 5KTTA 1NKSA 3CQZJ 4DM7A 1Z7LA 1FJ2A 3JV7A 3QMPA 4J91A 3G2KA 2V45A 1B8PA 4Q05A 1O94A 2C4UA 2QL6A 2ZIXA 4LE2A 2EFGA 4XSVA 2E48A 4EUKA 3Q1KA 4H0EA 1M5UA 4FYPA 4IGAA 5CB4A 3ZEAA 3X1KA 1R6AA 1GA6A 3D0QA 3SIXA 4B76A 5DSZA 1X92A 1TYZA 1VB3A 4C9YA 3ESWB 1E63A 4AF7A 1J8DA 2PXHA 4YAWA 1T9HA 1I6XA 4CR6A 1F36A 1O0CA 3EJ6A 2CY0A 4YP9A 2X8AA 2FP4A 2VSXA 2WJGA 1RPWA 1YH3A 3E6CC 1IVYA 1QG2A 1P92A 2DKNA 1KWKA 2YBDA 3GLHA 2J3EA 3TDUC 1PEKE 1UM9A 1G18A 3RW9A 3LK7A 3ONNA 4LXGA 3ZW9A 4M0MA 1T24A 4C4TA 2Z8YM 1E3WB 1ZKDA 2XWSA 3RC8A 2ZRFA 1Q77A 2XMSA 1T5BA 1P0QA 2JGDA 4RD3A 4RIGA 3IUEA 5BN5A 4CU2A 4WL0A 2OAZA 3S1AA 2P27A 1OLXB 2VJ5A 4BE2A 4Y2TA 4LDNA 4EY7A 3LBFA 3ZKAA 1G7TA 4QBIA 2MSYA 1PS8A 2HU5A 2JGLA 1NW4A 1JFRA 3C97A 1QIIA 3EC7A 2NZUG 1MRZA 4GGGA 4IHTA 1DBWA 3EXAA 5DFAA 2V0NA 1AUOA 4I6GA 5C5DA 1XDZA 5A3QA 2WY2D 1T9GR 1NLFA 1XVLA 5L3GA 4HP8A 1NMYA 5I45A 3C4QA 1V55H 3AG2H 3RROA 2XF5A 3CLOA 5AI6A 1YC2A 4ZICA 4QDKA 2EX0A 1DTWB 3GMDA 3UA4A 1OSNA 4IDNA 2IS4A 4Q5IA 3ZJTA 2M0MA 4M3DA 4CIBA 3OYBA 1T9BA 3HBLA 1F0KA 2NVQJ 3DBLA 2WU1A 1E2JA 1JLMA 1XSXA 4D74A 2IYPA 4KWEA 3DNMA 3RBVA 1UDXA 3I34X 4OFZA 4IH4A 5IYZB 4DABA 2DA7A 1JT0A 5EUQB 4PBSA 1J9ZA 1GUDA 2DOFA 1S3IA 5AKIA 4BVBA 4DDKA 1LEAA 4DHWA 5DSXA 3HB5X 3H9BA 4KACA 4FSDA 4TWZA 5AQ1A 1T2FA 2AUTA 3UJ8A 4B5LA 2V7BA 4CIAA 3VSEA 1GKUB 2QTVB 1EZ4A 1J0CA 3MN1A 1OWOA 1BJAA 2EZTA 3F6YA 2WAEA 2E4AA 2ZW9A 3DKKA 1BN6A 1YB4A 4X20B 5DX0A 5EQDA 4U2BA 3ZN2A 1MAAA 2JLWA 4X71A 2PUTA 4I50B 4QUJA 5KNBA 4FYYA 5IMSA 4J16C 4LWQA 1P75A 5U4QA 4FHGA 3AW9A 3GIDA 3LQYA 3FVWA 3W6UA 3N1UA 5FD5A 1K78A 1GAJA 1X9HA 1AHDP 2E1RA 5D6FA 2FW6A 2ERXA 4WAUA 5DD8A 3GYHX 3AIKA 4H3VA 4KO8A 1CUJA 2XNSA 3MM4A 4NECA 2P5LC 3OQOA 1WJDA 3DPUA 3F22A 1Q20A 2H1IA 2TRSB 3U4QB 1N2XA 2PCJA 2H63A 4UBJA 4HV6A 2WIBA 1KKUA 3PFHA 2GK6A 3BSYA 4FFRA 4C29A 4E2FA 1CIPA 3V3KA 5AM3A 5M2QA 3CZRA 1OJLA 1SQFA 3CPJB 3RWOA 1NYQA 1ZN7A 3LNQA 3NCHA 4BNYA 3NWPA 3GZTB 1T8PA 4JI0B 4BUCA 1NW7A 1RC9A 1EDEA 3LL4A 1EWKA 2R93J 2DTDA 4W5OA 1M1YE 2V79A 3FMGA 3TRHA 3EG9A 2FEKA 5I7FA 4UTVA 3T7IA 2O5CA 1JIKA 1PFVA 5EZYF 4UQPA 4X94A 5IBQA 3CFYA 3IT1A 5EXTA 3K1PA 3I9OA 3K4BA 2H09A 3LHIA 2O2XA 3QODA 2EIXA 3BMOB 3FMOB 5CR9A 4Z5XA 2XWQA 2V9PA 3LNTA 4HV4A 3E1GA 3N58A 3K1AA 2IL1A 1SD4A 2EVWX 1XDGA 2GH1A 3PGA1 5FOWA 1KVTA 4Z1OA 3DAOA 3MAAC 1E2LA 3IEVA 2QIPA 4L18B 3IMGA 3NXKA 5DXFA 3WKCA 3TAHA 3HQ4O 3QEMB 4E13A 1N5IA 4QFBA 3DE5X 2MHCA 3A9VA 1ISJA 2I8CA 3HO6A 4POOA 2HIAA 1C9YA 2ZAGA 3JRCA 2LRHA 4BHPA 1XD7A 3CISA 3PCTA 3FISA 4UPVA 4XM0A 2D5VA 4F2DA 4RTQA 2A1UA 5HODA 3E9YA 4TS4A 3DV0B 5MFPA 2BC9A 2YCLA 3LT4A 2PO7A 3CXRA 1ZNYA 1VCMA 4LDAA 2VPLA 1PUFA 2C04A 4OKIA 1QQIA 5B1AH 3L2RA 1IB6A 4BQIA 1ZJ6A 2XYRA 2YL2A 3C2QA 3DFKA 3EA5A 1SUAA 5CVUA 4RFSB 2RKWA 4FGUA 1H2BA 3WS7A 4XJSA 3ZLTA 1S89A 2H06A 4NJOA 4G4SP 2P2YA 2YHAA 3O03A 2K9SA 4K26A 3UICA 3VFDA 4D9NA 4H27A 2NYXA 4DY6A 3KVRA 4A1FA 4UTXA 2A58A 2J7PD 3C3WA 3PYXA 4D97A 2O8KA 2EJVA 3N6VA 1NUAA 1ACJA 1B3BA 1Q7BA 2XMCA 3FTQA 1GPLA 3R61A 3A10A 1OYYA 2HQRA 1E9EA 3IAM6 2DT5A 4YB8A 3BTSA 4DR1B 2ZZMA 5TT0A 4P34A 1EUYA 3MEQA 4Z9XA 3SBOA 1VE6A 3QFRA 1ZLJA 3GLXA 5LMZA 1T3LA 4AIDA 2QVBA 1JWBB 2YDYA 3GGJA 4FFNA 4PG5A 3V8RA 1RTKA 4ZQFA 1JDSA 2H4XA 3UA3A 1Q7TA 2WDPA 4XFDA 2IS6A 1GLNA 5HQ3A 2G6TA 3E9ZA 4PLZA 1A5BB 3STVA 3BEOA 3FYUC 4MQ6A 3TM5A 1JWLA 3FVVA 4EUSA 2QXYA 2XNJA 4OP2A 4CF5A 1KSJA 4RVSA 4KN8A 2IOQA 3AB3A 1T2EA 3X43A 1EQAA 3D3JA 4K6MA 3DLHA 4WKNA 1AS2A 1SIBE 2KIQA 1OU0A 3QJYA 2M2IA 4QOFA 4UAUA 3L04A 1A2QA 1IBMB 1WUKS 4HSRA 3I8SA 4X45A 4BCDA 2UUAB 1EBBA 5HRAA 2KIMA 3EQ9A 1XXHE 2O2IA 3BRWA 5HCUA 1GQ2A 1UJBA 4P7JA 5FIUA 1GGKA 4YO7A 3U7QB 3KBBA 1N2CA 2XUBA 3JVEA 2V7FA 3FCSB 5AESA 3VNQA 2REOA 3CM0A 3G2MA 4GM4A 3WKBA 1Y1QA 4C6HA 3HSKA 4J2HA 1XTAA 1C8LA 1GPNA 2WD7B 1U1DA 1E3DA 2IE0A 3AKYA 3C98A 2FZ4A 3V7WA 2O07A 3REGA 4HMQA 1R6RA 4AXBA 4LUCA 1ZK8A 1KU0A 1QG6A 1KORA 1N75A 2IEKA 3JTGA 2WZDA 2X42A 4DVJA 3I42A 4G41A 3DTKA 3I6IA 4C30A 4RKRA 5FRNA 4WN9A 2NVWA 2AXLA 3ZNOA 1MVNA 5HZMA 1ENZA 1PKXA 2IHKA 4L3OA 4BX2A 3P0FA 3AJ8A 4N03A 5HW0A 3H2SA 1FLDA 3DUFA 5I7EA 4ETNA 5THQA 1IQPA 1YULA 5CMLA 3F9KA 2GAUA 1W0UA 1V35A 2A9FA 1EFPB 4HDKA 4TL8A 4YP0A 5DGHA 3MILA 1MO5A 4E6KG 4I8XA 1ULSA 4ARBA 4TGLA 4D8WA 1JQKA 4R2IA 1Q14A 4XIGS 2IYRA 5JCJD 1AA6A 1U11A 4UHTA 2HSWA 1AD2A 2VDMB 5CEEA 4PJJA 3KKOA 3LPNA 1UG2A 4QUKA 4CTJA 5L3EA 3ZCQA 2R92J 4MQBA 2IFTA 5FL7D 1PFUA 5H82A 3BTOA 3Q8XB 1GM5A 4YXWD 5BPFA 3TDZC 1FNSA 1ZD3A 1YIOA 5DI3A 4CKCA 5K3OA 1Z82A 1ZA2A 2JAQA 2P90A 3HPRA 4WCFB 1PR5A 1VMIA 1NXPA 3MJFA 1R9TJ 4A2PA 4D43A 1F4KA 4GQBA 3KSMA 4I3HA 2HX1A 2H2WA 1JUPA 1U3VA 4XH9B 1PQUA 1IRZA 2PT6A 4MGIR 4AMGA 4IRGA 4RXTA 1QXSA 2F3QA 1XD9A 2JVIA 4IOCF 2UDPA 3RUEA 2RMKA 3C8MA 4Z6YA 3AEQA 3MBIA 1NF9A 3P97A 1G2PA 4YPOA 4FFMA 3DDZX 4B31A 4MUMA 2VJMA 3T3GA 3DZBA 3WLMA 4QYXA 2FPKA 2P67A 3PDJA 1FWZA 4Q1CA 4N0MA 3R5HA 4BB9A 5BSWA 4WFJA 3TNYA 2V1UA 5JLWA 3SSNA 1PX0A 1K7EB 4GLLA 2AMLA 3G8BA 4RY0A 3OJXA 1PEDA 1P3DA 4L0MA 5TJJA 4Q9DA 3H4TA 3N8HA 4H7EA 1HI9A 4HH4A 1UKYA 1V47A 5BSUA 4FMDB 2G72A 3CGGA 5GMOA 1ZUWA 4BL0B 1GPBA 1OC2A 4IJQA 3WGJA 4PLYA 4CV3A 2ZG6A 4RULA 3HRMA 5LRSA 2VL7A 4P9FA 1WMEA 1VFPA 1FUKA 1NAHA 5BOSA 5C9ZA 1U3GA 1FP4A 1KF0A 2LGJA 5FBQB 1JB1A 5A2QA 1L8LA 4AMUA 1I3QJ 3IUPA 3JQFC 3S3TA 5LUAA 3D5RC 3GQBB 1BIFA 3PRYA 2A1IA 3ZE7A 3AFIA 2VIXA 1FY7A 2CYAA 3F4BA 1P62B 3F90A 4O1HA 4QYIA 5DK6A 4H3KB 1Q5PA 1QKKA 3IV9A 2VWPA 1KDTA 1WETA 2DJNA 1I4LD 2PH7A 4UUQA 3B6AA 1IUPA 2ZBFA 3IODA 3NVMB 4JI6B 4OP1A 5KC8A 5AHXA 3JQAB 3MOSA 1N3BA 4F3NA 4UUSA 2OBXA 3QP6A 1FJLA 4XI9A 2AFHA 4JJ7A 5CH5A 3CGWA 3ZV4A 4Z9BA 4ZKDA 4U3JA 2XXAA 3DEYX 1V3TA 3QZUA 4AJLA 2YY6A 5GOTA 3ABRB 4DANA 3MSCA 4XCQA 2P6PA 5LDHA 3PD1A 1USIA 1R36A 2W6QA 3QXXA 4H77A 2VJBA 4K9KA 2DFIA 4DIOA 4MMYB 2DYKA 4HDNB 4TTIA 1RS0A 3TLKA 3C6YA 4TM8A 2HRBA 2XDQB 5KQSA 5L3CA 1A76A 1EK2A 5ILSA 4M7RA 1KJNA 1HH4A 3QJ5A 2WW8A 4IQ0A 3UMSA 1KHTA 2BGWA 3F1KA 3QPWA 4UBKA 1T0PA 1ZJYA 3H9QA 4BO1A 2D5IA 2O8XA 1JNYA 1HBJA 2C98A 2UXBB 2A7QA 1JVSA 3ITNA 3CP2A 2ZBPA 1SVSA 2RJOA 4C0QC 3EF3A 4FDVA 3Q9VA 3I55I 3DULA 3ZE8A 4F9EA 2MYSA 1KDVA 3K16A 5CNKA 2GTIA 1JN0A 3KWMA 4UBIA 4Y13A 3BTVA 3G5LA 4QDJA 4I55F 1GYRA 1EFDN 3RKRA 1CLEA 3GMIA 1ZVJA 5H80A 1UZMA 4O6VA 2X6XA 2IOFA 2ERYA 1GNSA 2ZAMA 2DFFA 3C1OA 3H0GJ 2XVAA 2XIJA 4KXLA 5H3LA 2P8JA 2ZT5A 3IOBA 5ECGC 3M6LA 5I7AA 4GOMD 5EYRA 2W2NA 3DZCA 3R0ZA 4F6CA 2F8SA 2VEOA 3B9PA 3D59A 3ZZMA 3OQIB 4RQAA 3VTZA 1BCSA 4E14A 5L3BA 2D2FA 3A32A 3PUHA 2W2TA 3CLSC 1MZBA 3LZDA 1PR1A 2XRYA 1CY8A 1KARA 2PG3A 4N5LA 4DLAA 4ZV4A 2PUCA 5AVXA 2D0DA 3P5BA 2GAJA 4A3EJ 4UVDA 5L3DA 2GOYA 5LN1A 1KVRA 3CVJA 1NUUA 5E1XA 2CZQA 1T6XA 2XECA 4FNOA 1JQDA 3JAWB 4QC2A 1FW6A 4DR6B 3KJQA 1JECA 3EGWA 1KGSA 1CSEE 3OQVA 5HF6A 4TXNA 1AG9A 1GGMA 2OUMA 1D5YA 5DCFA 2C1ZA 3QX7A 4FYXA 4M53A 4NPCA 1Z56C 1VGQA 3C70A 2QUAA 3GVCA 4TYYA 2XB9A 3GF2A 3I9V1 1L1EA 3A6ZA 4W5TA 1WJCA 3BPXA 1VYUA 3PFKA 5HBRA 3U4HA 4G7OF 3CCCA 5LJIA 2QM0A 3V7RA 5AXDA 2FBHA 3QXJA 5I4KA 3D1VA 4KIFA 2W6CX 1STZA 1HE2A 4YRLA 3ZCVA 2C5SA 1JSXA 4N8SA 4Q48A 4OJYA 2RV8A 2Q9CA 3N59A 4QLBA 3G1UA 3KOMA 2OA4A 4Q1DA 1RBMA 1VNDA 2H9YA 4Z4CA 1WUHS 1KAMA 2XTZA 1Y37A 2I8AA 4G8DA 5B3LA 1XZKA 2FPGB 4UC0A 3ERED 1FDRA 4R3NA 5ITZB 1LUAA 1ZGZA 1K4MA 4Q7MB 5HXAA 1BG6A 4AKEA 3URKA 3R41A 4MWDA 2FN4A 3LXUX 3AUKA 4GM0A 1ZKGA 2P3LA 3UUGA 4XIYA 3E4CA 1KMIY 3ELUA 4OK6A 2A78A 3CEHA 4DQ0A 2FUG2 1EX1A 1VYVA 3LTEA 4PGAA 2VYNA 4QGFA 3CE9A 4OU4A 1ZU5A 1ZH5A 3HCBA 4IHJF 4WA8A 4ALIA 4EG5A 5HKOA 1R5BA 1WCMJ 3BY6A 1GAXA 4X8MA 4JB2A 4YALA 4G84A 1DOHA 1XDWA 1M34B 4IX1A 1TM1E 2C0PA 3UCEA 3PLAE 1MENA 3FX2A 1BH6A 3VBCA 4X1KB 2CDNA 2YINC 1LH0A 1YF3A 1ZK1A 3EY4A 5CURA 2EFYA 4L50A 2QQ8A 1U6GA 3U3RA 2M9MA 9ABPA 3KZVA 4ZDJA 3SBEA 4UKDA 4IJKA 1VG1A 5EGNA 3T7EA 2ZI9A 2NAPA 4IWYA 3PHGA 2NVBA 1YACA 3CUSA 5ENDA 3DW3X 3WFIA 2AS5F 3HTXA 2OVBA 3GEZA 3MFQA 4MYSA 4GX0A 4OUDB 4A0HA 1RXSA 2HL6A 1I5ZA 4RCZA 3G7NA 3D81A 5TPZA 5K7SA 1JHUA 4PX2A 5AVSA 4EW3A 4Q4AA 2A5LA 3K0CA 4L9WA 2WTUA 1D3YA 3CJQB 1NVAA 4IQFA 5LIPA 2HLDA 4X9XA 2JKZA 3L41A 3F73A 4ZYYA 3OIFA 1U1CA 3WFJA 2L7KA 1BMFD 1M8PA 3HCFA 1KONA 2WBLC 2ZJ6A 2Z2SB 3S2ZA 4DZTA 4RF4A 4PF1A 2E34A 5IJWA 4DNOA 4XJVA 3FNHA 4DJEC 1NG7A 1U5TC 3HJCA 1IZ8A 2IS2A 2O9LA 2H9AA 3NKVA 4XJXA 2A5FA 1U8EA 2QUHA 5IJXA 1E3HA 2XRMA 3ICPA 4ZVVA 5AVZA 4NCKA 5JJCA 3GLHB 1NG6A 3HN2A 4XPIB 3DO6A 5CITA 1QH1A 5A9TA 5JV5A 1GYQA 1O3RA 3PNYA 4UUSB 4EW2A 3MJEA 5A3RA 3A31A 3FPCA 4IDQA 4GKBA 3KZIC 1D0VA 1IGNA 2FP3A 5CA0B 1KEWA 4LWZA 1FS4A 2HOEA 3HGGA 2SKCA 3S2SA 1VI0A 4DSTA 1IN7A 1YCHA 2HU8A 3SXJA 4NQZA 4AI6A 4JYZA 5C53B 4NONA 4RGBA 3KQKA 2ISCA 1G3WA 2O8BA 2LBPA 1K2VN 3G5MA 5CVCA 4BBAA 1LJ8A 4QUAA 1XZ8A 1RWXA 4ZEWA 1YBMA 2L4AA 1N5DA 1PD0A 3OZXA 2G07A 3R6SA 3ZLBA 5AW0A 3AQIA 1GTMA 2PHZA 4AIKA 5H59A 3BZCA 4QREA 3OAAD 3QLTA 3KPWA 5AKJA 1GHTA 2NVOA 1IHXA 4C4OA 4CEJB 1K83J 1N2EA 2WAAA 3F72A 4MFDA 3P7MA 2HXGA 1FS6A 1IN1A 1Z07A 3FWPA 4RMIA 5HLIA 2ZTVA 1GZ3A 4JKYA 2IUUA 3N7UA 3CB2A 4JLVA 1JHPA 2J33A 3T7JA 4O2LA 1UMKA 4H2DA 5A05A 3WNDA 5AUQA 4ESJA 2DLDA 4LLGF 3CEPB 3ETNA 3L4BC 1HLVA 4OIMA 1NIJA 4LK2A 4WOBA 3WYNA 1AX9A 1Y3AA 3AR6A 1MHTA 2VK8A 3ESAA 4MHSA 5HKBA 2R6ZA 2VXBA 4WLEA 4I2VA 4AWAA 2LWIA 1IB0A 1ZXXA 4LOIA 1JGSA 1XO1A 4R9SA 3WHLA 5KOJB 4KITB 4O8CA 2RVCA 2CJWA 2P35A 3GPCA 2KRHA 4LTDA 1BGXT 4R98A 4CTNA 1W0KA 3DDWA 4KMMA 2IH2A 1YC5A 1KA8A 1JTYA 2B2XA 2NVTJ 2GM5A 3IQHX 4R01A 2J5OA 2VPXA 4RLSA 2IBDA 3VTFA 1HL3A 1H2RS 1XV5A 2C4HA 4W63A 1VCIA 2Z9OA 2OQGA 5D8LB 3JRDA 3THOA 4B1FA 3LQRA 1OFVA 2YW2A 1R3UA 3LBIA 3PDCA 3VC7A 1FZTA 3ANLA 4MX8A 3O8HA 2GEFA 1CZHA 1A9TA 1XZCA 3CV3A 3D2BA 3LCJA 121PA 2UYQA 3R8CA 4A8JC 4EARA 3U3XA 1ZTRA 4A15A 3F8MA 1TTYA 5FF9A 3TNDA 3HL2A 1QHHA 5BVHB 3DP9A 1ZAOA 3EISA 4I50A 4KLZA 2MYUA 2R5WA 1MDBA 2EJCA 2HKIA 3FE2A 1MNEA 3FNGA 4UPEA 1SPXA 1IBCA 5JMWA 4Z7OB 4AKGA 2W4QA 4PYIA 1I0ZA 4F92B 2VA8A 2YJ5A 3B8EA 2X6RA 4PLWA 5A02A 2ZEJA 4JZKA 4QYSA 1FSEA 4TTAA 5GJCA 4ZU3A 3RKQA 3GO4A 1IDYA 4DT1A 2XX3A 1PKEA 2I1WA 2PT5A 4HR7A 4L22A 4G0UA 1G66A 1SD5A 5INTA 1L0OC 3S5UA 1AN9A 2JAWA 3DVAB 3E9RA 4Q1VA 5CCXA 4JQYA 1A98A 3Q11A 4ZDKA 1E8MA 2F4OB 3QUCA 4PS1A 3ZTYA 4ZYWA 2BE7A 3AY7A 3OZGA 1P91A 5E8JA 3DBLB 1TM5E 5CJJA 5TMBA 3W9UA 3QG5A 3W5DA 1FDIA 1QZZA 5D01A 3MIZA 3HWWA 3EA0A 3F6RA 4W8OA 1ZQ9A 3TR6A 5LNK1 4M6VA 4XLFA 1SCIA 3DEIA 2F2EA 3WWOA 1T2AA 2BFDB 3HRIA 4EZBA 4AZ3A 5AJUA 2RD2A 4RK0A 3RWBA 2ZSAA 4G1VA 1WPRA 4ZJZA 1H1DA 1WVMA 3OWXA 3V6LA 4XARA 2IU4A 1GZHB 2K02A 4YEJA 1TT5A 3EMKA 3LLMA 2AQHA 5LHGA 3KVYA 4UHKA 5TS2A 4DIDA 3SC2A 2YJ6A 2O7QA 4YJDA 2VT3A 1R8JA 3KXKA 4MTDA 3VA7A 1N4AA 5DWVA 3RI3A 1BXZA 4JIGA 3ZWMA 2QVXX 1Z2NX 1PL8A 1YZNA 2ZT8A 4Q4ZF 3RARA 1XCOA 3IH2A 1GAEO 1KDPA 4ZVQA 1QTRA 1O03A 2B21A 2O50A 1XLTA 3CVVA 3RAFC 1DTWA 2YXLA 3TFOA 3SFTA 4V2IA 3JREA 4MGEA 1NMQA 3BD8A 1SBQA 3GOHA 1OLUB 2HNBA 3MQ4A 1M2GA 5ILQA 3EYIA 3OBIA 4EG1A 4ENTA 4X84A 2W48A 2XKPA 3L02A 4MV1A 3GR6A 4P9NA 3FBWA 4ONEA 1GVDA 5KNBD 5LLQA 1W19A 4LNHA 3KDPA 1KRWA 1THMA 4YUWA 8AT1A 1E6UA 2QAGB 3KTFA 3A3NA 1XZJA 1Q74A 3E53A 3PF9A 3THXB 4ECEA 3TL3A 4OJQA 2IZ7A 3NHZA 1V3UA 1YFKA 2QQ9A 1MJGA 3A1DA 1L1FA 3G2LA 4EA7A 1XHFA 2QUFA 2OKCA 4MR9A 2W6JA 4R41A 4CR8A 2MLGA 2BKXA 2VDOB 2GNPA 3K1TA 4I5GA 1GPUA 2W5UA 3FBTA 1MFZA 1U65A 3GFQA 3HB7A 4EGSA 1ZLXA 4O1MA 2C61A 1M73E 1YI8A 2CMFA 2G1UA 3DW1X 2NV6A 3CNOA 5F2OA 1D2NA 2JIRA 2PXCA 4JQFA 3HO8A 3MWYW 3WV5A 1UL1X 1XGKA 2OESA 3C24A 2UWMA 4MAFA 1B41A 4RSMA 5AVKA 1GVNB 3SYMA 3DGEC 5DO9A 3UVEA 2R7WA 5FROA 2GZMA 2VODA 4IXAA 2P9YA 3LVQE 4UPDA 1X1RA 4OU5A 4UHHA 5BXQC 3BPVA 3BB3A 3Q12A 4HPQA 1JWAB 5CD1A 3D8HA 4QBGB 3M6UA 1OPXA 4KQMA 4NFLA 3I5MA 4W5JA 3TSCA 3ZQKA 3UAYA 2XAGA 3O31A 3CURA 4GLBA 1GL6A 1RYFA 4AXXA 4D45A 3ENVA 3WTWC 2JDID 2BR3A 2J4DA 3V33A 3U5TA 4DB4A 3AOEA 4KIBA 1AMNA 4ZYHA 3PDHA 4G81A 4N3NA 3B1JA 1EXDA 1X9GA 1SIWA 1RACA 1PQYA 3PUZA 2OZLB 1EX7A 4OXKA 2EA4A 4HUTA 1KYXA 3HYTA 2VHEA 3U0BA 3RYCA 3MQFA 3AYXB 3DVQX 4PSKA 3GLUA 4YQYA 3OYDA 4BWFB 1ZRSA 2Q0QA 2EJWA 3SYRA 4PLHA 1KJWA 3GFOA 4DDTA 2H85A 2NQTA 2Q3HA 2Q6IA 2X9DA 2R68A 3LWDA 5ER6A 4UTNA 1U1GA 3CLKA 1LGYA 3DMPA 2DPMA 3FXJA 3KAQA 4R51A 3ZLVA 5EJ6A 2G1PA 4GXRA 5EDNA 1W76A 1ZJWA 4X92A 2H8GA 1JIIA 4C5BA 2X4GA 4RD4A 1IHPA 4V0KA 3AMVA 5EHNA 5HIJA 5J2UA 1UXIA 3UAXA 2V6CA 4CL2A 1BZYA 1XTUA 3WLNA 2VHJA 4TZ0A 3BJEA 3PF8A 5IULC 3WIBA 1ENHA 1STOA 5AI0A 3TKLA 4M87A 1U0GA 3GJXC 3MBOA 4HXFB 5EHQA 4BNMA 3DJFA 1N1DA 3MINB 1IEWA 1UZCA 3M33A 1QBKC 2OSVA 2FMFA 3FK7A 4NYMR 3H84A 4NENB 3CCUI 4WASA 4BEJA 2G36A 3H8SA 4X85A 1PDVA 1E98A 1F2TA 3H4VA 2XQIA 4M3BA 2BZTA 4FHDA 3ED5A 1L5HA 1J9IA 2P4UA 3AOGA 4YNBA 5H9VA 2KISA 4XSHA 2A30A 2CXNA 3A4LA 3M6FA 4FBLA 1R4NB 3VISA 2NP7A 3JVUA 3HXKA 1TVEA 3U9LA 1YL5A 3CY6A 4XD7A 4DCNA 1QHHB 2VBXA 4FYJA 1XRLA 3WTYC 3IDAA 4AJ1A 4CHGA 5ITVA 2KM1A 2W2KA 5DHFA 4EL0A 5DVZA 1P31A 4NK4A 1MA0A 1JQBA 2DYRH 1MTZA 3GVHA 4UU7A 1TU4A 3ONFA 2FDCA 3O4VA 2YV3A 1J2XA 4AC0A 2VATA 4G8BA 2XUFA 3ZMZA 2Y2UA 1G8AA 3ZWVA 3FOAA 4INAA 2GCIA 5CAEB 3DE6X 3H8JA 1Y1RA 1OWNA 1SRRA 2W4IA 1M7GA 1QE0A 3NTVA 3V4LA 1VQMI 5DH9A 5JYBA 1MF7A 4NBQA 4XLLA 2JFPA 5ALKA 5MF6A 3N0RA 2IP4A 3DMYA 1BN5A 2VNIA 2BDUA 1MBEA 1MDFA 4HJRA 4U02A 4ZO4A 5FJIA 1P2VA 4REMA 5DIZA 3HHEA 4RNCA 1Z25A 3NATA 4A69C 1FU7A 2IU3A 3KB8A 2OD5A 2PGJA 5C31A 2E35A 2D2VA 1KU6A 4DOZA 3F6PA 4K2HA 3RRYA 1TYBE 3CCVI 3GUVA 4BNIA 3ISPA 1PDOA 2RB5A 2QX6A 4HQFA 5LHHA 4MPDA 2W70A 2E2WA 3HCPA 3R23A 3KTAA 1YHYA 2FZCA 5C80A 2DQZA 4HYYA 2NSLA 2DA4A 4ITUA 4IRMA 4LXIA 3RGGA 1TW2A 2AXNA 4IHKA 3HI6A 3TQTA 1YMUA 4I99A 4BAYA 1X1PA 1KPIA 1LDDA 2J9FB 2QDXA 3PNPA 4WBXC 1R0YA 3R7SA 3ZJYA 4ENUA 1NBMD 2IYXA 2C3PA 5FFZA 5B1HA 3E9EA 2C07A 3B6MA 2DA6A 2V5AA 1EP2B 4LBWA 2FZWA 3WMWA 2EZLA 2XNCA 4MNUA 1KQGA 3TNLA 2SICE 4KVGA 4YRVA 1U7DA 2GN8A 1HR0B 1FLNA 2UAGA 1D1QA 5EZ5A 4ZEVA 1ZMXA 3S81A 3FM3A 1FUYB 1JMYA 1Y5NA 1T56A 4KH1A 5EP3A 3ZQLA 1OPCA 1PT6A 1KEZA 3VSAA 4NEGA 1GILA 4WXPA 1OTYA 1RXVA 1XVIA 2R5ZB 1PJRA 2VUUA 4HLDA 3EPPA 4RTPA 2C83A 1HTBA 2CVZA 4Z3DA 4AMYA 1DBPA 2LRDA 1FOKA 3LS2A 3QVTA 2OYRA 4ZI7F 3VSKA 1CZNA 1OY1A 5JOQA 4L4ZA 3K92A 2I67A 3QX8A 3GLIE 1T5HX 5DHTA 3MUNA 1PJSA 2DJIA 2ZRQA 5HJEA 1FDVA 2ZWPA 3W1EA 1YRLA 2AFHB 2STWA 4PZAA 4XX0B 4JI8B 2EG9A 1W5EA 5CFQA 2Q1XA 4UCWA 4CZZA 4CXMA 3BBLA 2VYQA 4JLBA 2CJJA 3TRDA 1HE5A 2E49A 3JYQA 3K09C 4UOZA 2VOPA 3DDHA 2CWWA 1TWGJ 4L8FA 2DH5A 4IEEA 3Q2IA 3RIEA 2D13A 4R2MA 4IHYA 3S17J 2XCSB 4YT4A 1LLCA 2Y67A 1FTTA 2Q62A 3FFAA 2QSYA 4TL6A 1TT5B 3QVVA 3SX4A 3WX0A 5JC1A 1BOFA 4HRVA 1NQXA 3ZHUA 2R5YB 1U2DA 3LT0A 2G70A 3EB9A 2QSGX 3CTPA 4B82A 4ZT3A 1Y7IA 2GM9A 5KIAA 4UV8A 2BP7B 2P2DA 1TPZA 5DX1A 1H4QA 3K9NA 1WRJA 1GFZA 1ND5A 2W2LD 2OBNA 2WABA 5E18F 4WOKA 2CDCA 1JG2A 3FPLA 2CUJA 2GHQA 4F3YA 3T1YB 1Z05A 1QOZA 4BMSA 2MTBA 3PHHA 2WMOB 3L07A 1W0TA 2QAGC 1ODLA 4NOKA 3GRPA 4J6FA 1TQDA 4UQOA 2ZRAA 3NWOA 3RSOA 2AHQA 1R5NA 2K2QB 4XEUA 4BJ5C 1B8UA 2Y0PA 3AVTA 2IPLA 1BC7C 2QGZA 4JEIA 4L3WA 4TL7A 4TTPA 5ED0A 4DJ5X 3A6GA 3HK2A 1P4RA 4CA0A 1Z21A 3IRRA 5AW1A 2NOAA 4BMOB 3CCJI 1Z2EA 2XD4A 1L5SA 3CESA 1FP4B 2X3FA 3LECA 2CFIA 1KEVA 1YA8A 4XORA 2JTVA 3H2GA 3LVRE 3VO2A 1T9CA 2RHWA 2YVAA 3K2EA 2BHTA 5JD5A 3AIMA 4YJ2B 4MQEA 1RYEA 1QPIA 1ZG5A 2DLLA 5ICFA 2JJ8A 5BQTA 2NNLD 2P78A 3G8DA 4KB5A 3ZCOA 4FT4A 5AOAA 5BT8A 1UT8A 1GV5A 3GJQA 4HRAA 4YIKA 4BWGA 5TQ0B 5JWRA 5DGDA 2R8OA 1JHMA 3B12A 4XLTA 3I28A 2PZ8A 4NFHA 4AM3A 3BL8A 5H1YA 3NB0A 3W2FA 2W9XA 2XYPA 4NTZA 3V8NA 3WGKA 4MQMA 4HWGA 5DJ5A 4A92A 2D3WA 1Z16A 2FFRA 5DCWA 4R0MA 5K8JB 3BD9A 1TIPA 1BDBA 3N8NA 5K0JA 5EJIA 3TO9A 1LJLA 4KLCA 3GZ4A 1MH1A 3PQFA 1EXMA 1D0YA 2J5KA 3DBRA 4HDMB 4PQFA 3EIFA 1CDZA 3RSFA 3UT5B 5F3WB 1XYYA 2RFLA 3ELWA 4GBJA 3NQ41 4NDNE 2RONA 3GJYA 1NULA 1WJ5A 2YJZA 4KQWA 4ARCA 3F8BA 2EKBA 4HAXA 2QW8A 2QJTA 3ABOB 2FW1A 5AHRA 5TY0A 3RABA 1WI9A 1K4SA 1Z0KA 1UP6A 2YR2A 1SUSA 3D8UA 3GL9A 3EVFA 1I2BA 4R31A 4LLNA 5FNVF 3K9GA 3K94A 4WLVA 2QJWA 4X3PA 3ZCUA 1U04A 5T67A 5T64A 3WLFA 1JTVA 2JFXA 1Q92A 2NXWA 4RPGA 3GZ6A 3AHGA 2ODQA 2NTYC 3GNSA 5CCDA 4LOCA 3FCOA 2WF9A 4EH1A 3LVBA 1QCDA 3A0BC 5FB3A 5ITSA 3HOXJ 4OAOA 1BD3A 1TLLA 1WG8A 2YWGA 5G2OA 2A57A 2ZI7A 3QPBA 4MDHA 4ZVKA 1U94A 4PSWA 2IPXA 1T1JA 2A0UA 2HRZA 4QTZA 4Y2RA 1BA2A 2PRIA 2ZZKA 1HV8A 5IDYA 4YT2A 5A9RA 2ECCA 1PT9A 3VSLA 3LSPA 2P65A 1OCOH 4NAHA 4CSWA 5BR4A 2HT1A 1KO8A 4BEBA 1CFZA 2B4QA 4DHEA 3JD4A 3C3CA 2ZI6A 4RIHA 4K3UA 1QA6A 3V46A 2JSCA 3KLBA 1YDEA 5ALQA 1YTUA 3PPYA 4R0NA 5JBNA 3QE4A 4IS2A 5LRRA 4DYDA 1I3MA 4PG4A 5LQRA 3MOIA 4ZTUB 2WTXA 2KDZA 2JA2A 2W2PA 2LPMA 4WCFC 2XQGA 3QVMA 4MHOA 3MWMA 1LKXA 1J33A 1ZXBA 4OGWA 1G8GA 5FHQA 3I4NJ 2NADA 4FGJA 3WFZA 1F7UA 1G55A 3P52A 3WNQA 1Y5IA 2K87A 2BFCA 3KQLA 5GADJ 2NXJA 3CUUA 3EXIA 1WEKA 2OZKA 4R6WA 3H83A 3LT1A 4G5QA 5HQ3B 4I2OA 3PGKA 2XRZA 3CIOA 4X6YA 3FGZA 4DSOA 6GPBA 5IT9Z 2NPFA 1NVKA 5DYMA 1ENPA 3BORA 4MV0A 5B6PA 3HU5A 1CEYA 3HOVJ 1OROA 3PFYA 1QTNA 1YVRA 2JJ1A 2HOAA 3KYBA 1E1MA 4FKZA 4GPD1 2VK2A 3RJMA 1BMQA 3DOOA 4G6TB 4YUYA 5KJ6A 3CUVA 4NY1A 3L8FA 1H2HA 1ZOOA 2VQHA 3AKCA 4ID3A 2COBA 1GUFA 2RK4A 5FH9A 2QY6A 4H1HA 7ABPA 3QXCA 2QHXA 2MU1A 3KXPA 4WCVA 4OG2A 2J31A 2YS6A 5AIBA 4YI5A 2CSUA 2IWRA 2AUNA 5HUHA 1N34B 2O2ZA 3ZNPA 3UXHA 4NXNB 3DLCA 2ZPAA 5PGMA 2AEJA 3W6ZA 3QWIA 3IBTA 3BP8A 1ATZA 2Q0HA 3TQQA 4Z4HA 1J07A 2RDPA 4BLPA 2JRTA 2WSMA 1SMYF 3NAUA 3BSWA 5DPMA 2J4CA 3C7CB 3IAEA 4D4GA 1XCPA 5BWNA 4OX9B 2HAEA 1OR7C 1RJ9A 2L5QA 4UEOA 2WAMA 4Z8XA 4E5UA 5IWAB 4BNJA 3A1TA 3LBYA 3ZHTA 3SXPA 4F3KA 2IXEA 4PONA 4EQZA