1O57A

Crystal structure of the purine operon repressor of bacillus subtilis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
270
Chain Sequence
b'KFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUR OPERON REPRESSOR
publication title The Purine Repressor of Bacillus Subtilis: A Novel Combination of Domains Adapted for Transcription Regulation
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 78
structure length 270
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
A PF09182 PuR_N Bacterial purine repressor, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o57A01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1o57A02
3T8TA 2DW4A 3HSFA 4BHPA 2JI4A 1L0OC 1R00A 1LQ1A 2RC4A 3DEUA 1NULA 2K02A 3FMSA 1XGNA 2VC0A 3L00A 1QGPA 1TW3A 2VODA 1VDMA 1PP8F 3Q9SA 3I5UA 5DUKA 2FOKA 4OIRF 2PRZA 4HF0A 2PLYA 3QP6A 1ZLJA 2XBUA 1XCBA 1IUYA 3L09A 4G7ZF 5JVTA 3VEPA 3K1MA 4XRFA 4RQBA 3HTSB 4GXOA 3FHZA 2O8XA 2ZMEA 2IT0A 5FLXK 2DTRA 5F64A 2ZXJA 1XMAA 1IZ1A 2X4HA 2P6SA 4ZYHA 2XKOA 3FMQA 3ZMUA 1OYIA 2DI3A 3EETA 1Z05A 1D5VA 1ECCA 4UVAA 1W7PD 2IGBA 1XSDA 3TO7A 5EUCA 2OAZA 3CUQB 1A04A 2VOOA 5CVRA 3ISPA 4A5NA 2PN6A 4LZAA 2PRYA 5EEGA 3H92A 2OA4A 3V8JA 2E1NA 2M1BA 1TQMA 3ABUA 2GAUA 4HOBA 5FD5A 4HLXA 4QRIA 3O2PE 3CUOA 5DUIA 3HSRA 3MZYA 2M5WA 4CYDA 4LZNA 1Z91A 2IW5A 3DV8A 3K1PA 3FMRA 4JK1X 1VTNC 1ECBA 3DAHA 3IL2A 2VBXA 4UV8A 1T0FA 1SD5A 3QU3A 3QU6A 4LD5A 3CO7C 2R7DA 4IHSA 2XUBA 2E7WA 3R0AA 1MD0A 1S29A 2HGCA 1AWCA 1I6XA 5E8GA 2YSRA 2XAFA 3HRUA 3GVAA 3EFHA 4HV5A 3WTSC 3IRRA 4B09A 1P4XA 5ED4A 5HLGA 3C18A 3J80K 4LFUA 5IT3A 4PZJA 3W6JB 1O3SA 3QPHA 3LAPA 5E18F 4MEXF 2RKHA 3R61A 2M8EA 5J6XA 3KLOA 4A0XA 2P7CB 1U9YA 5D5WB 1ODDA 4Z2YA 1KU2A 3MZHA 4YIFA 2CW0F 2OBPA 1I5EA 5LGUA 2P5KA 5HIAA 1ZG5A 3I58A 2KRFA 3ACCA 1XSXA 2O6GE 1P17A 1EH8A 3BDDA 4HA8A 3MEXA 2MH2A 4YFNF 2F5CA 3ZMZA 2H6CA 4XSZF 5ICFA 2O3FA 1S7OA 4EVIA 5K5OA 1USSA 4EV0A 1KGSA 1JXSA 3DQVC 2HDCA 2GXGA 5HDNA 4RACA 3MAJA 2V1DA 4UXNA 3VOEA 4U0WA 3LPNA 5FD6A 2HKOA 2JKYA 3RDIA 3K69A 4QYIB 1KU3A 3WG9A 4P3KA 4IF4A 2QM3A 4U0YA 1LB2A 2W84A 4WXCA 2W57A 4OMYA 1TTYA 4RADA 1SMTA 2ISYA 2P5LC 4IJQA 2V1XA 1BIBA 5ERIA 2DLLA 1ON2A 3V8LA 2EFWA 4M0UA 5ESXA 1H9GA 1DUXC 1MGTA 1LEAA 2BEOA 3LQRA 2VBZA 2PG4A 1BC7C 4HW0A 4ENKA 3BP8A 1ON1A 5ILVA 3I54A 2QBYA 2DO7A 1RUOA 3WE3A 4LG0B 3KFWX 1Y0BA 4IHTA 2CQKA 1U5TA 1WSUA 5K51A 1REPC 2XV4S 4RGRA 5BS6A 4A6EA 1K78A 4HX7A 1QO0D 1Z1DA 1ONVA 1HXDA 1V9SA 3DPTA 2VC1A 4P96A 4RANA 4BXUA 2IJLA 1IF1A 3MCZA 3CO6C 3F22A 2GA1A 1R3UA 1STZA 1TC1A 2XKPA 1NONA 5E20A 5LLQA 3QRFF 4WMLA 2DT5A 2ESNA 3QAHA 4ZYDA 2P8TA 4RB1A 5LRRA 2GEBA 2MBFA 1LVAA 2ZO4A 3HSEA 4WXHA 3SZPA 3JTHA 4Q4ZF 4ZZLA 1GHCA 5KK1A 1MKMA 4G9YA 2PQ8A 4WWCA 2FRHA 4S04A 2RN7A 3LA3A 1I0IA 1QB8A 4ZFNA 2QYOA 5D6EA 3GZ6A 3I64A 3V7CA 3N2LA 1USTA 2CG4A 1ZN8A 3BZ6A 3EYIA 4YIIA 3HIFA 3FXQA 1B9MA 1BBYA 2HFHA 4LK0F 1ULYA 1ZYRF 4UHTA 1O57A 3LSTA 3DMPA 3BJAA 3M8FA 1R58A 2JRTA 4HLYA 1WRJA 5LEJA 3WTTC 1BJAA 3WU1B 3L2CA 4PGGA 2CO5A 4PGHA 1LH0A 3ECOA 3S5JA 2K27A 2G7HA 4ESBA 2DU9A 5KAMA 1AOYA 4JQFA 4RGUA 3NRVA 2DPUA 1I1SA 2EWNA 2FSWA 5AIQA 3WTYC 2RDPA 2X0LA 4AIJA 3KP2A 5FGMA 3DKWA 3R6SA 3ZP5A 4WCGA 4NQWA 4WX9A 1LDKB 2PFBA 4MGRA 5D4SA 2VOPA 1SFUA 5JHUA 4ZH4F 1FSHA 3OZFA 1QK4A 1P19A 1GXQA 4UVCA 3HOSA 2MLGA 2CFXA 1JLSA 1IXRC 1G3WA 1XGSA 2Y48A 2H07A 4LMYA 1I1GA 2W25A 3I71A 3JAMK 1Z7GA 5JSQA 4CO8A 2PMHA 3CUQC 2XROA 4TWBA 4P84A 4A0YA 2QQAA 3ROUA 2HCRA 1BOAA 4A5MA 2V6CA 2CYYA 4CDGA 3HRSA 1P4AA 3T5XA 1MDMA 3T1BA 4F8EA 4LYYA 1QQIA 4NHJA 2Z5UA 1MZBA 2FNAA 4P82A 2J5PA 5FFZA 3HRTA 4Q48A 3GLXA 2HYGD 2KIMA 4I02A 2K86A 3RYPA 5L3GA 4HQEA 5ICGA 4RB2C 3F23A 3WU0A 2STTA 2C4KA 4BH9A 1G9TA 3P9KA 1H9TA 3GW2A 4PAWA 3IKVA 5KAPA 1LDJA 4QWQA 3CJNA 3GFMA 3E6DA 1EH7A 4I09A 1HQCA 2ZMEB 4KNYA 5D5VB 1TQIA 2V79A 3HUGA 4U7DA 2VONA 5IAOA 3EUHA 1TBXA 4E70A 1KQ8A 3FM5A 2DK5A 4EJUA 1R1UA 2MLKA 4KIGA 4EM1A 3C1DA 2E55A 3SXYA 1YW9A 2M30A 1DP7P 3DXJF 3V4GA 3F8FA 1TW2A 1T38A 4P81A 3I53A 1K7AA 2ZNYA 4XLNF 2Z99A 4M71A 2ESHA 2QUFA 1IN6A 1R1TA 1JE8A 1L3LA 1FT9A 1Z6RA 4P5OA 1XDSA 2YX4A 3LAJA 2HKXA 4S2UA 2GIVA 1SD7A 5CVVA 2MD5A 1IN4A 1HGXA 3M1EA 1UPFA 1U5TC 3F72A 2JSCA 6PAXA 1ZN7A 4IRHA 1FC3A 4YG2F 3WTVC 1W4MA 2VBYA 2QENA 5H6RA 1YQAA 1KU7A 3GEZA 3TDZC 1UFRA 4WF2A 5BSKA 1J2XA 4BNCA 3H83A 2HTJA 2ETHA 1LNWA 2HOEA 3ZN0A 1BC8C 1J75A 1RIOH 1DDNA 3K1NA 1UFMA 4LGWA 3SQNA 4GYGA 3HTUA 1FZPB 2XAHA 2JKZA 4KYWA 4MHGA 3GX4X 2IRFG 1DPUA 3GFLA 1FP1D 1R22A 5HLIA 5JFRA 4ETSA 2WNSA 1S6LA 2LSOA 4B8XA 2D45A 1CF7A 5A2QK 3COAC 3B02A 4L9VA 3GGCA 3GWZA 1B9NA 4HF1A 1ZRDA 2HYFA 1TNSA 3OOPA 5DCMA 2VE9A 5DD4A 3KP7A 2NAZA 3BWGA 2IVMA 1ZAOA 2OQRA 2WWYA 2NNNA 3TOBA 1ECJA 2STWA 1MJBA 1OYYA 1GPH1 3T0YA 1HBXG 4LLGF 5BPDA 4HQMA 1YYVA 1QCCA 2F5FA 1G6NA 2A5YB 1F1ZA 4M9XA 2CGPA 2H06A 4LJZF 3TGNA 1B4AA 1T6SA 2BGCA 1SAXA 1V3FA 1BI2A 4I2OA 1XB4A 4UNOA 2EFOA 1B59A 1J9IA 2J5OA 2HS5A 4Y13A 1WKMA 4Y17A 2EFNA 1XGMA 3EDPA 2A6EF 1FBQA 1J5YA 3P7NA 4ESJA 1R7JA 4BAYA 4Y15A 1IRFA 3HHHA 1I27A 1QK3A 1LEBA 2A69F 4K2EA 1D3YA 2IA2A 2KIUA 2L4MA 1ZH5A 4M72A 1BD3A 3OHPA 5FFXA 1SFXA 4OIPF 2JBHA 2RQPA 4OU0A 4G7OF 2QBYB 1ECGA 5H20A 3J81K 2Z33A 4KMFA 1FPQA 1U5TB 1AO0A 1BM9A 5E17F 2P6TA 4I98B 2LDUA 4AWXB 4RGSA 1J59A 5CYVA 2YX7A 1K78B 3E6CC 2Q8KA 1SD6A 1IAWA 4KA4A 2Z3YA 4RV4A 1HW2A 1HMPA 3KP3A 3F8CA 3ELKA 3N4MA 4G8XA 3RKYA 1T2KA 2M87A 5LHGA 3KEOA 3O6BB 3RYRA 5FLXZ 3TKYA 2H27A 3QW4B 4Q47A 5FO5A 2HEOA 3GEPA 5IT9K 3ZPLA 3GGJA 2O03A 3Q9VA 2KJCA 2DK8A 4A6DA 1ZHFA 1R36A 2VBWA 2DBBA 3IWZA 5LHIA 3U1DA 2K7LA 1KA8A 5CJ9A 5J8CA 2DQLA 3DP7A 3QP5A 1QZZA 2EA4A 2MH9A 4R79A 1XCVA 3KP4A 3HHGA 4KN6A 4L9NA 4RGXA 4A12A 4TV7A 1FBSA 5HS9A 3L9FA 4EJVA 2FU4A 4N0BA 3TQNA 3J7AO 3KETA 2B0LA 3FWEA 4M9SA 3WTXC 2KIFA 2QVOA 3GO5A 5E8IA 2Z9OA 4KMUX 1NHAA 4X45A 1FLIA 1P18A 2DAOA 1YS7A 3C7JA 2LKPA 3O3KA 4O5VA 2FMYA 2O61A 2XHKA 2NRAC 3FX3A 1OPRA 1X3UA 4L18B 5LGNA 4JITA 4RAZA 5DV5A 3LQQA 4WN3A 4LB5A 2P7VB 5HOOA 2XASA 4CHUA 2JZYA 3TO9A 4AIKA 5CVUA 3J80Z 1KYWA 2ZKZA 1QCDA 5IPFA 4H0EA 1FYKA 2A68F 2XAGA 5L3FA 1G4DA 3RI4A 4ZYGA 1MDMB 3GYHX 3L7WA 2F5EA 5K5QA 2LF7A 2EFQA 2A6HF 3B73A 2KKOA 1ZGJA 2WC2A 4EJOA 1YW8A 5TRDA 2BE5F 3VFZA 3C3WA 1Z7UA 3BROA 4RHUA 5DYMA 1QK5A 5L3DA 2EV0A 5HS8A 4YFXF 2L4AA 3F8MA 4BYYA 1PDNC 4O6JA 1IW7F 3KE2A 5H6QA 1YTYA 2LF8A 4P80A 3DEZA 4RS8A 1UB9A 1GXPA 1MZVA 1YIOA 3DFGA 1ZGAA 3LA2A 4RAYA 2FMLA 3ACBA 4BHBA 4LB6B 4F7ZA 4HX4A 4RHYA 2F5DA 2IA0A 4HV6A 3JW4A 2EHJA 4KN4X 4GO1A 2ZJ2A 1JLRA 1QPMA 5BRNA 3LRTA 1IXCA 5D5UB 4CICA 1OR7A 4EJTA 5F6FA 2UWMA 2VT3A 4M0PA 1ZRCA 4RB0A 1P92A 1HW1A 3LFKA 1O3TA 4RABA 2H94A 5TJJA 3DF8A 3AAFA 3K9TA 1IN8A 2OZ6A 1A98A 1ZG3A 1IN5A 3WTZA 1OMIA 3MJDA 1XMKA 4RQAA 3LA7A 1W7PA 4M0KA 1XTVA 3QOPA 4HBLA 2GQQA 3RTRA 4G94A 1YW7A 1K79A 3ZMVA 3BPXA 2R7FA 2VN2A 3GFJA 1R5HA 1R5GA 2A61A 1D8JA 3WGHA 2NS0A 4CZZA 1MJAA 3MQ0A 1G3TA 4N9IA 2P4WA 2OU2A 1KQ9A 3VODA 4I0AA 3RKXA 1ZARA 2HQNA 2VE8A 1PP7U 5AIPA 5FB2A 2W24A 1I0LA 3EYYA 3U2RA 1A96A 1BI3A 4HDVA 3PFIA 4P83A 4P9UA 2FEZA 2RNJA 4HYEA 4JLSA 4Q5SF 3EQLF 1YO5C 2HZTA 4P55A 1FSGA 1JHHA 3PQJA 3I4PA 4DNCA 4HDUA 4UVBA 5F1RA 2YPRA 1FBUA 1UHMA 1YFHA 4G6DA 4UV9A 3FM3A 3V7SA 4LLLA 1VSTA 1Z9CA 1TNTA 4KN7X 2GXBA 4S05A 1CF7B 3M8EA 3K2ZA 4D0PA 1TC2A 4ENMA 2QWWA 1LJ9A 5BQTA 4EMSA 4GCVA 1OREA 1RI7A 3TOAA 1HKSA 1TQPA 4RB3C 3E97A 5DCMB 1J7KA 5ESWA 3H3ZA 4I7HA 2DQRA 4PDKA 2PBIA 2QQ9A 3KB8A 1A4XA 4AIHA 2WV0A 3E5XA 1SMYF 1WI9A 3I0TA 3SZTA 2FXVA 2C6YA 2FE3A 1A95A 4EJWA 1DQPA 2V9VA 1BZYA 5D6FA 2MC3A 2A07F 2JPCA 4XSXF 3F6OA 1E17A 3GXOA 5BOXA 1DKUA 1WQ2A 5E1ZB 4A2UA 2W85A 1HSJA 2AS5F 5BQPA 4U7BA 2V1UA 3NAGA 1KYZA 3K0LA 2Q2EA 4EGZA 3G73A 2ADUA 1Z6TA 4X44A 4AD9A 5LBQA 2OD5A 3ZN1A 1U8RA 4FYMA 1P6RA 3FXUA 4XBFA 1R1VA 3D0SA 5LRSA 2DFIA 3HYIA 2ELHA 1GVJA 4EQQA 5BPIA 5D5XB 1ZN2A 3FF5A 2H08A 1Q1HA 4MNUA 3GF2A 4MQVA 3E5QA 4LLNA 1FY7A 1H0MA 2NYXA 1OYWA 2DPDA 4G6QA 4M9ZA 3JAMZ 2FF4A 1B1BA 5HLHA 4KT5C 1U2WA 2FXAA 2IP2A 4LZOA 3SHFA 3HOTA 4LYGA 3R0JA 4I0BA 2FA5A 4U0VA 3HRMA 3IC7A 2KJBA 1BD4A 5HVQC 3V7RA 3H3UA 5HDGA 4I01A 3E6MA 4XLPF 5DEQA 4P86A 5BMZA 3WGIA 4M6XA 2L54A 4ASNA 3F6VA 3IRQA 3KEQA 1STOA 3WTUC 1RNLA 2XVCA 1FSEA 4KICA 1R23A 3GUDA 2ZNZA 4ESFA 3BJ6A 2H09A 4IVNA 4RHXA 2G9WA 2L3DA 1JHFA 2L02A 4ZZDA 1EV7A 4FT8A 4G7HF 1FX7A 4U88A 5DCFA 4PFQA 2ISZA 3KP6A 5D4RA 4WXDA 3FZVA 1J0RA 2GWRA 5CVJA 4MEYF 1BI0A 4CXFA 4L5JA 1PZMA 2FBKA 4MQ9F 4O3MA 1F5TA 2HR3A 2EB7A 2E7XA 1XD7A 4L9TA 4OINF 4AVPA 2EV5A 4BHCA 1OKRA 2A3SA 1FYLA 1A97A 2EFPA 2IA1A 3ACDA 2R3SA 4R8HA 1S7AA 3M9AA 3E6BA 1O7FA 1UPUA 1BN5A 2PJPA 1L1RA 4EM0B 3PQKA 1TLHB 2UXXA 1YS6A 3CUQA 5LGTA 1KQ0A 4HZFA 4UUVA 3MFKA 3O7MA 1I5ZA 3ABTA 5AONA 1SFEA 5L3CA 5E1XA 3FXRA 2LNBA 3KCCA 4HAMA 3VB2A 3CTAA 3RPQA 2Q0OA 1FWZA 2YR2A 3MBIA 3TDUC 3WODF 1WWXA 2XRNA 3GFIA 1BI1A 1JGSA 3E5UA 4L0ZB 4FX4A 3IWFA 2P5VA 2O0YA 3KZZA 4A0ZA 2YZKA 4ZYEA 4FX0A 1G3YA 3RIRA 2BV6A 1J7JA 3JSOA 2FBIA 3MWMA 4EGYA 3W6KB 2PS1A 3ERED 1CGPA 3P9CA 1FP2A 3F21A 2OZUA 2D1HA 2MA3A 3RKWA 5A2QZ 2XGXA 2Y75A 3F8NA 4RAOA 5ILSA 2GA2A 4RHTA 1YG2A 4M74A 1DPRA 3CDHA 2AXLA 3BPVA 5HKLA 1QZYA 4OIOF 5D8LB 1W5SA 3KLNA 1ZN9A 3CLOA 2FBHA 1D6NA 3TO6A 1P2FA 2GZWA 5JR3A 2K4BA 1QNTA 1WD5A 3IHUA 4YFKF 1RZ4A 1G3SA 4ENJA 2ZBKA 3IKTA 1FNNA 1I14A 2EJRA 3V8KA 3I59B 1U9ZA 4N9HA 2TDXA 4KDPA 5J8FA 4OMZA 1XDUA 3Q5FA 4KIBA 1HKQA 2BBYA 2FNPA 3OZGA 1O3QA 1YLFA 3NQOA 3G6WA 3BY6A 2VFAA 3N97A 3KZYA 3BJOA 5E38A 3QPTA 3F8BA 2HTSA 1W30A 1B6AA 4ENNA 1HW5A 5LEKA 2K4JA 4KUMA 1C0WA 1W7PB 4DQ2A 1XN7A 3F3XA 4QYIA 4GYIA 1T39A 1OROA 4MB6A 4R1HA 5L3BA 1DBRA 3LWFA 1ZLKA 1S3JA 1L1QA 2PMUA 2XIGA 4CGZA 3JTGA 4OHCA 2Y0MA 2FQ3A 4ON0A 4P9FA 2JTVA 2BYVE 3ECHA 3KP5A 4BQAA 2IPQX 4RAQA 2D1VA 1XZNA 3J81Z 4QLCU 5CVIA 1ECFA 1IBSA 4IXAA 1ZREA 3M3HA 2RVCA 1GRVA 3ULQB 4HX8A 2QLZA 3RJPA 1UCRA 2G7UA 4KIFA 3D5LA 1XTUA 1O7LA 5JI6A 2HWVA 3R60A 2PI0A 3WGGA 5LHHA 5EEHA 2YU3A 3I59A 4M6YA 4LG0A 1XTTA 1P4WA 5HDKA 1Y0UA 4IRGA 1ZRFA 4L9JA 4OOIA 5L3EA 1VCHA 2L01A 4JBAA 1FOKA 1QBJA 1T98A 3REOA 4MTEA 5IT9Z 4IRIA 2XAQA 1XGOA 2RGVA 4FHTA 1O5OA 1BIAA 4GGGA 2PEXA 2DY0A 3HVUA 1PUEE 2P1ZA 2H6BA 1V4RA 1IN7A 5KVRA 3JSPA 2EV6A 3P9IA 2E1CA 2ZFWA 4OIQF 3ZQ7A 2M45A 2ACJA 5E1WA 3ZMSA 4KFCA 1F4KA 5K1YA 1SD4A 1CJBA 1HSTA 3GZ5A 5ICCA 4IPAA 5K5RA 2WTEA 3ZMDA 3ML6A 5ICEA 3T8RA 2OQGA 2ZCWA 3E3VA 2AEEA 4M73A 3RPUA 3SFZA 4HF2A 1LDDA 1FYMA 1IRGA 1UHWA 1ZG1A 3M7GA 1RUNA 5DD8A 2VT2A 4Z1OA 2F2EA 2HQRA 3U9GA 5HS7A 5JV5A 1YFZA 3WE2A 2JPBA 1K6OA 1HKTA 3WTWC 1IXSB 2VXZA 4IJAA 4WK8F 5ILUA 2EA2A 1DQNA 2CSOA 3S2WA 1W5TA 1A3CA 4NB5A 2EK5A 1KU9A 3R4KA 1D8KA 2RV8A 1EH6A 4LK1F 4MTDA 1MJ9A 1XZ8A 1QB7A 1G9SA 1O3RA 5DDGA 5CLSA 1XSVA 1S8NA 1U6GA 2NNYA 4L5IA 2COMA 5BQOA 2QQBA 1I13A 4PCQA 1U78A 2D2WA 3DPLC 5D8KB 2UZKA 1F9NA 1G2QA 3OV8A 1E2XA 1DKRA 2JT1A 2XAJA 3ZMTA 2UXNA 4L0YB 3G3ZA 1G2PA 1OPCA 3BOQA 2CWEA 4EM2A 1U3EM 3NEUA 2QZ8A
chains in the Genus database with same CATH superfamily
4YRAA 4ZC1A 2XW6A 2FPKA 5KJEA 1M83A 4MKZA 2NU9A 1B6SA 3KPJA 1WHTA 1S4MA 2WQ7A 5HA5A 1TW3A 4YUXA 2X0FA 5BWBA 4CM1A 5K8UA 4X62B 3AF6A 4ZC3A 4NFLA 1RYFA 1GA1A 1EFAA 1EH5A 1RQGA 4LXQA 2EL9A 3T06B 4Q9HA 5CDSA 5CEEA 1B2LA 4WKOA 1ISGA 3NETA 2XVZA 4NKRA 1XRJA 3H11B 1DV2A 4L3WA 3JQAA 2H3EA 4ZYHA 2XKOA 1PW5A 4YIKA 1JI8A 3ZZMA 4ZGGA 1PU2A 4PLZA 4Y6PA 2K9SA 1ECCA 1K75A 1M33A 2ZSIB 2A9JA 2CVHA 3GLSA 3K9FC 1A04A 5KNBA 4LZAA 4L4ZA 1XK6A 1IEVA 3AFHA 4L6IA 3H92A 1UBTS 4DDTA 1BMTA 3L7KA 3SIXA 3MD9A 3VSKA 3OPXA 1C41A 1I4EB 2DR3A 1C9EA 2GAUA 1L5WA 4F04A 3KBOA 3GGSA 2WG1A 2DT7B 1QH0A 2HUPA 3UBTA 3JQBA 1C81A 3L8ZA 2KMUA 5A5FA 3C3DA 3PIOF 4QUKA 4R84A 1SVLA 2Q4EA 2VBXA 2H1HA 5J40A 2WJWA 3R7NA 2GTPA 4QT4A 2ZSAA 5G3ZA 3BTJA 4HAYA 1U7TA 4A8JA 2NTNA 1E6KA 2DQYA 3N8DA 4N39A 3H05A 1HT2E 1KSFX 4IGFA 3S32A 4DLSA 4MZDA 2CWWA 3MWYW 3U1KA 1HYBA 2OAQ1 4G41A 4B83A 3IO3A 4AKSA 5CFZA 1ZL2A 4ZJZA 4HPQA 4Z2YA 7ABPA 1GZ6A 1MMGA 4JVSB 4Z4IA 2V8OA 5EJCA 4C0HA 1QOZA 4UNIA 1XCJA 5KSPA 3QBDA 3NHWA 3L3BA 5KVCA 2QVBA 3IUPA 4IOMA 5JZSA 2YNMA 3DE2X 4HFRA 3FIWA 2ZSEA 3LX4A 4X1YA 4YMWA 1J1ZA 4PINA 5HDNA 2YDXA 2E5LB 5LN1A 1J2TA 1JHDA 1PV4A 1V5FA 4J1NA 3FW1A 1AKEA 1K98A 5GINE 3C1TA 1DRJA 3K4HA 4U0YA 4CKCB 4WXMA 1X7HA 1YQXA 5FUXA 4X8MA 3MJHA 4WRRA 2E21A 5JC8A 1PK8A 3MN1A 1NVUQ 2VJKA 1VQ4I 5ALPA 3TW0A 3DUWA 3UUEA 3VM6A 3E6AA 1POGA 4PFPA 1U2QA 1OXKB 4UHHA 1YOBA 2PUFA 3EMKA 3O2SB 3BP8A 3LZ6A 1EGMB 1AQYA 1Z06A 2DO7A 5HQTA 1WU8A 1NBMA 3HDQA 2UXCB 1D1QA 4BUCA 3B9QA 2Y3IA 3DR5A 1QO0D 3B7GA 4CQLB 1M1UA 1YRNA 1U04A 5GOTA 4WCDA 2R62A 3R3JA 2QVCA 2CE7A 5DEIA 4Q37A 4MV7A 3NO4A 1UDCA 2IXAA 4LDJA 1EWVA 2ET6A 3ZD8A 2OC9A 3D0KA 3H18A 4G9YA 5F7JA 2PQ8A 3KJFA 4AMZA 2KFDA 1YE8A 2VAPA 3TFOA 2Y31A 3DMRA 1USTA 3JX9A 1Q1BA 2WHPB 3CNLA 1YHNA 2P6MA 1ML4A 1QIJA 1G8MA 3FUXA 3H5VA 1N9GA 3JWJA 1I3AA 4F5WA 1I7QB 1RACA 4HLYA 1W34A 4YT8A 2QTMA 2ILTA 3MCUA 1NJ6A 1LH0A 3WYBA 4OJNA 2QL7A 4TXLA 4B8ZA 3EXG1 1UXHA 4FN4A 1BJZA 4DIUA 1X1TA 5I48A 4PFKA 2FSWA 4JZKA 1IXYA 3GBSA 3H5LA 1G20A 2EIJH 3WTYC 1QH9A 2I29A 3C74A 2H6EA 2DPMA 1XEWY 4GR5A 1W29A 4MW0A 5KNDA 5LYJB 5FI0B 4MVJA 4C9YA 2DCEA 3JYQA 1HV8A 2XXJA 1U2SA 4BRWA 3HOSA 3ZWNA 2PV7A 4NCXA 4KWCA 4RLSA 4BVJA 1RMYA 4TWBA 4N12A 1K7FB 3GRPA 1E2BA 2QQAA 3RIEA 5C4GB 3HRSA 3D31A 5EIFA 4LC0A 2RREA 3I8XA 4LN1A 1CY2A 1UK7A 1HK7A 2P1DA 4W9RA 3A1TA 5TQ2B 1JKJB 3OE7D 1WCXA 4CIYA 2FWRA 3MHPA 1M6EX 5AI0A 3ZLJA 3JQCA 3DBIA 4RCVA 2GB4A 3AQ4A 1TO1E 1E3WB 4M1KA 4GOJA 5E1OA 3KZMA 5KOJB 4EHDA 821PA 3P9QA 5THQA 4M9CA 3FLMA 4B46A 1IY2A 1SIBE 3TS1A 2HDOA 2R7XA 4RFVA 1MQ9A 2VONA 4FOOA 1DBWA 5HG0A 5E3OA 2QRUA 4QPJC 4MR8B 4XIGS 2MABA 3DOEA 5AM3A 3LVRE 3VV3A 2VQ6A 3PXGA 3V8RA 3GPLA 4GQIA 1T26A 1CZOA 2Z43A 3DEHA 3WAGA 3T7EA 5KQPA 2ESHA 1L3LA 1K83J 3R41A 1RFLA 2YX4A 2B36A 2R6CA 2PX9A 1Q1QA 2OV6A 1P0CA 1TZBA 1FK8A 4ZVSA 5TPWA 2VQFB 1Z7YA 5HFNA 1W4MA 3L7DA 3HXPA 1M5RA 2H4WA 3T35A 5E9WA 2XGMA 1CCWA 4LOLA 1YDHA 4LJ7A 5BSKA 1TCUA 2HTJA 4MS1B 4CEHB 4R7GA 3NVMB 1W75A 1TZLA 1IK4A 4OQNA 4H7PA 4YMGA 3E82A 1W4LA 2C97A 1R9JA 2GZMA 4POAA 3DOIA 2IRFG 1FP1D 4L4YA 1G55A 3TQHA 4WKBA 1CETA 3D4PA 1B2RA 3VVMA 4M9QA 4CV2A 3RSLA 4QPZA 1Y9EA 1IOLA 1DIHA 3DT8A 3QX8A 3C7CB 2J9FB 2NVWA 1OLXA 4UVEA 3C7DB 2VE9A 1W4AA 4JT9A 3M6WA 1Q0UA 4HNHA 4CMKA 2ZJZA 3C7AA 3KP7A 3U49A 4OHXA 1BKDR 2HREA 3TOBA 1MJBA 1RLUA 3DW3X 4KOEC 2J0EA 5EZYF 3TTTA 2HMWA 1JYFA 4KUGA 3GTJJ 1JKMA 2CMFA 2I4RA 4UM9D 3GI1A 4LXGA 3W9YA 4AIIA 4JR1A 5EUMA 3A4VA 3OL4A 1B59A 2Q6TA 2F8SA 2B82A 2IHNA 2O8DA 4E51A 1BH6A 2CQNA 2I65A 1XNJA 3IHKA 5IP9J 3KNZA 1XRLA 1J5YA 1J2YA 2V9KA 1ADBA 2BEWA 3THOA 4UPVA 1COWD 2FKAA 1OC4A 2JGMA 5JO0A 4FE4A 3G68A 4ZT5A 3NV9A 3GLIB 4K2EA 1ICIA 2DYKA 4K8RB 2H4JA 4D3ZA 3SVLA 3WRXA 3EA0A 3OEHD 2YZMA 5J4LA 1I7DA 1SFXA 3P94A 3C24A 4OGGA 1X1EA 4K1XA 4ZV4A 1SQ0A 1XVLA 4KMFA 1YJBA 4IMIB 1TKCA 1P45A 3QV2A 3Q40A 1XI2A 2A9FA 2Z6VA 1VIYA 2ASVA 4AWXB 3E6CC 3OS2A 4G0OA 4B6RA 2NNLD 3TTYA 1JDZA 5CTJA 2WFAA 1TL8A 3WOVA 1NF3A 4I2VA 2GYYA 1XTBA 4FLEA 4G8XA 4FZJA 1E5TA 3BXGA 3BAFA 1CZUA 5FLXZ 2NUAB 2OTJI 2H1WA 1WMAA 4YB8A 3TBFA 3HUDA 4C2BA 3GEPA 2RGCA 1C9DB 5DWQA 2X6RA 2R5WA 4E7ZA 2KRHA 1Y3HA 1MG5A 3ZY6A 2BL4A 2H4HA 2E37A 4F9TA 3GN1A 3D0RA 2Y77A 1GQFA 1M74A 4KN6A 1I3NA 3DZJA 3WLAA 2FU4A 2Q1TA 1KDPA 4XPIB 4JL8A 1FEXA 3G8CA 3D6AA 3UY4A 2OXEA 1UBRS 1Z74A 2BFAA 4C0SA 1H4QA 5AI9A 2EZ4A 3I5MA 3TO5A 5C34B 2VJ4A 4EPWA 4EHFA 1GRRA 3W8NA 1SXJB 3OIYA 4EHIA 4MV4A 1KVUA 4CFSA 1TM1E 5PNTA 1R9GA 2ZTLA 2YMMA 1EQAA 4KODA 2P0YA 4WA7A 4JIMA 1VMDA 3GJ7A 3HJRA 2EG9A 3THWA 1KYTA 4MKHA 4QG7A 3ETNA 3D3WA 1NU6A 3MBOA 4WK0B 4UFPA 5C3MA 3KJEA 3H36A 3BF7A 3FBGA 2I4OA 3L7CA 1J56A 2QTLA 2VTBA 5ESRA 4IHXA 1BMFD 3WQHA 4QICA 1VG9B 1EVEA 3AM5A 5EE9A 3LC7O 3SX0A 4F5ZA 4UMDA 3AC0A 4IV5A 1GWNA 1YIOA 1OISA 5M5YJ 1T1GA 3A1DA 2C9MA 1NQWA 3GJXC 4JP3A 1NJ1A 1KRXA 3R6GA 1JFFA 4ZEXA 1A1SA 1MV5A 2ID3A 1IU9A 5TV2A 4Y2JA 1Q16A 4I9UA 1MAUA 1NXPA 1L4LA 3Q6IA 3KB1A 4OYLA 4R98A 2W98A 2JZOA 2Y30A 4ZDKA 2X9DA 1FFSA 4GF5A 4HBLA 2ZR9A 3R40A 1FIUA 5C5IA 2BCJQ 2G17A 2D74A 1MRNA 3DFZA 4AIRA 4RFSB 3C43A 1QDUA 3R2JA 3R7DA 1MJAA 2ZJ4A 1OTYA 2PJUA 3CMAI 4BL0B 4ZICA 3HC7A 4JELA 2UUPA 4Y52J 1Z2DA 2MYPA 4QRDA 4AS2A 4BBPA 5EJ5A 2H1CA 4PCLA 3UJBA 5E3MA 1FP4B 1V96A 3NT4A 1JHHA 1Q21A 2ISSD 1ZCBA 2IPXA 2Y1LA 3E48A 3L7AA 2BGMA 2O54A 2BEUB 4ZT3A 3JQ7A 4CF4A 5A06A 3OIFA 3KYJB 1PFQA 2GN9A 3C3KA 5HW0A 4QVIA 2FR8A 1TUEA 3RSGA 1JXAA 3JQGA 4QO7A 2ECCA 3B6JA 1QF9A 3H3ZA 1EI9A 1T3SA 1SKBA 3OUZA 4CCMA 1BWRA 4WVLA 1DU4A 5CVCA 5JXIA 1X1QA 3IUYA 4BE7B 2VAWA 4FILA 1KU0A 3DGFC 1P44A 2QT1A 2ZJ7A 1CDDA 4BE9A 1JQJC 3NAGA 4BZXA 4ZMRA 3ORHA 2POCA 5I45A 4WOBA 4UMFA 5C3UA 2DWQA 5JYDA 1SXJD 2ADUA 1XCLA 4V0OA 5LBQA 1P80A 3B2NA 5LRSA 2VPQA 4D26A 5D2CA 1KZ1A 1RWMA 3T1NA 5JS7A 5D5XB 5F4ZA 4BGIA 1NVEA 4GOKA 3G2IA 4M9ZA 4KMMA 5LWHA 3ND9A 4ZREA 4AF6A 3FTQA 2CNBA 5DDIP 4E32A 3IVMA 3NXSA 4OU5A 2LFBA 3KZNA 5HVQC 1WEHA 4FZVA 1JHAA 2IVFA 1YUNA 1KIMA 2JASA 3EIQA 4URUR 2GK4A 1IUKA 1CUZA 5BMZA 3AFGA 4JK3A 4HS9A 3PHJA 1YBFA 3U7JA 4DEXA 5EHIA 3KEQA 1STOA 5CQGA 5FWXA 2QTVB 4KICA 3M33A 5AW1A 3CNBA 5KTMA 4W6ZA 1N2SA 2JJMA 3GDGA 4GUDA 1I3KA 4DNFA 4DM4A 3CQZJ 3LL7A 1D0SA 2GPBA 1OGJA 3WHPA 3A06A 2OVFA 4Q7EA 3GLGB 3KP6A 1N2ZA 2DJNA 1U3TA 2GEUA 2WVGA 3RRBA 2IUTA 5H9WA 2AOXA 2VBCA 4MP8A 1AHPA 1XZQA 4OGWA 3RTAA 4D99A 3ET5A 2H16A 2BYTA 1OKRA 3HFSA 4FOLA 3VNAA 4LJ9A 1QONA 1SAUA 1JGTA 4HWRA 2VF2A 3U4GA 1JIQA 4QJ5A 4YY3B 3KC2A 2QVLA 3I3LA 2B25A 4LA4A 3DSRA 3KB6A 4LBWA 1JPUA 4GZLA 1RP1A 1OT3A 3PSAA 2H1SA 3H0EA 4I19A 3MBIA 1JWBB 2F43A 2GM9A 5B3JA 3PTZA 4GD3Q 1JZQA 3L8CA 2QTCA 4UHEA 4EHBA 1NHGA 2EWWA 1O6FA 2EWMA 2FFQA 1EJ2A 3LYUA 2K40A 4PZCA 2B20A 2W9XA 1M9NA 1IQPA 4IHJF 4FFSA 2P7HA 1IWBB 1FP2A 3U39A 1E0AA 2NZUG 1ZSVA 2CVPA 1BR2A 4RMGA 1YG2A 4JGIA 2JSPA 5F7XA 3LQ1A 4MS3B 4ZVVA 3RSFA 2ZSUA 4OIOF 4N9QA 3WXBA 1DG3A 2AC7A 3GZJA 5BUQA 3C7TA 1N2BA 1KDTA 3S28A 2HXGA 5BSGA 3LLUA 4G9BA 1JLLA 3V1YA 1Z26A 4ZAGA 1V4NA 2IZZA 1UZLA 2DRIA 4EGQA 3I76A 3SC4A 3ZHSA 5AW0A 3IHUA 3NP9A 4XB1A 4MOWA 1NUQA 3HSYA 1Z4QA 3BB4A 1VE3A 4Q1AA 3JD2A 1UQRA 1JVBA 2VKQA 3V4VB 3UQZA 4OGKA 5EFZA 3AKZA 3LKBA 5JPCA 2QI9C 4PO3X 4AS1A 4DOZA 2VFAA 1IEXA 1U9NA 1MC4A 1F2UB 1VBFA 1AK1A 2X9GA 1LDYA 4CKWB 2XZLA 1YKFA 2R1TB 3ITNA 3FHLA 1T1EA 1YOVA 3WC4A 1WVMA 2RGGA 1R74A 1GY8A 5DCLA 2JTVA 5HKKD 1RTTA 4U00A 5E2IA 2BUCA 4X84A 3JAWB 3O93A 4IIJF 3JASA 4LY3A 3L8GA 3M3HA 2E89A 2YRFA 1UCRA 5B4TA 4ND8B 1XT6A 4DC0A 1M6VB 4Z4GA 3GEEA 5A6SB 5LHHA 1GTJ1 4Z9YA 5CG1A 3N0RA 5KVVA 4LG0A 3C1AA 1MEEA 2JZCA 3DVLA 1O6BA 1KPHA 4JBAA 2I10A 4AVZA 3KKEA 1P81A 1Y6JA 4RTLA 2UUAB 2CV2A 1UAAA 5HX7A 4KMRA 1BIAA 3OOUA 5JBQA 2PMKA 3GY0A 4KFUA 3MZ8A 4XKWA 4M37A 5AW8A 3IBYA 3N7TA 5ENZA 1OF1A 4M7RA 3AVTA 4OIQF 3SQMA 1WM1A 1CJBA 1EF4A 4IZOA 1VBNA 5LLDA 4V1CI 4IFIA 3GB9A 2HA5A 4LG1A 3R6LA 4X3PA 1FMLA 2OAP1 3KCNA 4LY6A 3RSZA 4IDBA 3L1PA 3P4XA 2BHRA 2VYCA 2XMRA 1Q0LA 1ZG1A 4NHEA 4OD0A 3M7GA 4ILKA 2Z6UA 3OZAA 5IXSA 5JV5A 1C7JA 3MKLA 2FRXA 1ODIA 1YFZA 2NXJA 3DC7A 5C1IA 1K97A 1VIAA 3OWXA 4FWIB 3FUTA 6CHYA 2O9JA 3R6WA 1U3GA 1SPXA 4L15A 2CSOA 2MCFA 3TX2A 1MMAA 3HY3A 4HVCA 5E3HA 4CL0A 4JLOA 4RMJA 1P5FA 2XUAA 3GFVA 3FFXA 1EWQA 4C0JA 1YU6A 5J4KA 3P26A 3Q5DA 3ND5A 4B73A 3ZW9A 5JMPA 2XUPA 4KO4S 2DXIA 5KYNA 4TQUS 1QVAA 1E96A 1DXYA 1I13A 5B6IA 4IMJB 1CR4A 2D2WA 3M4JA 2J9RA 2NM0A 3D8BA 3G3ZA 3C8HA 5KQLA 1FNBA 4C7KA 1S7EA 1U2RA 3FDXA 4EA8A 1L5VA 3WR5A 2DW4A 3RV3A 1L0OC 1R00A 2XRZA 1HC8A 4B3MB 2K02A 3QEBZ 4ZHSA 5C4IA 2ME6A 2VAXA 1IDOA 3LUDA 2GJ8A 4QTRA 5HXAA 3MGKA 3OIUA 1YVEI 1WSBA 1SUPA 2QM7A 4ZDLA 5B1YA 3HBFA 2H65A 1W76A 4OB7A 4BEBA 2HNHA 2O2GA 4JGGA 1OAOA 2O0MA 1XAHA 2PJZA 4RD1A 3VO1A 3FA2A 1TT7A 4ZXFA 2AZMA 2JGJA 3RIYA 5A0VA 1VQ1A 4GUAA 1XRSB 1FJGB 1XZCA 2AJCA 3IQGX 1ODFA 2P11A 3CLTC 5JI3E 3AVUA 3W2AA 4WKGA 3H04A 2HMTA 4XWWA 3SM3A 2PRYA 4DA0A 4Z8YA 4HLDA 4BEHA 2KX7A 4N5IX 1JHUA 1BX1A 2YN4A 3ABUA 2FZGA 1RQNA 3Q12A 4K9OA 4J90A 4WOCA 4TYQA 1E5LA 4WZBB 4ZT4A 2AFHE 1M76A 2IC5A 1SD5A 3LZDA 1A7KA 4PTLA 4QXRA 1MD0A 4KI0A 1CZLA 1ISMA 3UW3A 3UENA 4BGVA 1KE1A 1NR7A 3LO8A 4ITRC 2R1ZA 3V4SA 4K86A 4XQGA 1Z8DA 3ZXUB 3DJFA 5JAQA 3K1TA 5ED4A 4U2CA 3QBJA 2HBZA 4LBVA 2ELJA 4GPIB 5IT3A 5C44J 5A1JA 1VQ5I 3K6KA 4AY6A 1HTTA 4UARA 1LUAA 4GDMA 3OTOB 4ZU6X 1JG4A 3R7BA 4J2TA 3W2VA 3TSYA 4D98A 5AK0A 3TI9A 2W8BB 3E7DA 2RONA 1KU2A 2Y05A 4CNBA 1ZG5A 5BMVB 3KXDA 1J9EA 3ZU4A 2QE7D 4FCVA 3BDDA 2VF5X 4BUJA 5FP0A 3RIGA 2F5CA 4BACA 3VR5H 4JJZA 3CTMA 1G21E 1XMSA 1N2CE 3EJ6A 2NSJA 4PHTA 4AZWA 4N1AA 4R51A 1TKBA 3U9LA 3OZIA 3RVBA 5FD6A 1JHVA 2HU7A 4BV2A 2E1RA 2ARKA 4DUGA 1F06A 2ZRIA 4KVZA 3W0LB 2W57A 1U3CA 4BO2A 1GEGA 1FL9A 2Q6VA 1OI4A 4XX0B 3OPVA 4IXNA 3AI7A 3G0OA 4HDSA 1ZI9A 1I7PA 1PR3A 3HCNA 4AX8A 2C2ZA 3SZRA 4RZXA 3LT0A 5E6RA 2NYUA 5AW6A 4H7KA 4X66B 1K5GA 1UZNA 3D3QA 3WE3A 3D02A 4L8FA 2CQKA 4QBGB 1QBGA 4GBED 1XKQA 2ANCA 4LG3A 3U31A 3AF5A 2RHGB 4TKUA 3T9DA 5CIQA 4MJLA 2OCXA 2HWYA 2AH5A 3FUVA 2HU8A 2N75A 1NQ5A 2DT5A 1PR1A 5E6UA 3DBLA 1QIDA 4WXEA 2EJVA 4ECEA 2V9PA 4AZ3A 3TTSA 2C00A 1Q3KA 3OS1A 3X2QH 4B3JA 5TPZA 3LSPA 4GZ3A 2I2AA 1HL3A 2ZRPA 2DODA 2LXNA 1WUJS 4FSXA 4II2A 2YWHA 1RRJA 1PLKA 5DIZA 3JRHA 3ME5A 2RGRA 2R00C 4NNOA 4NL4H 1SU4A 3BB1A 3OFVA 1NYQA 2AJBA 1E1CB 2DSTA 3A6JA 4N4OB 1XKXA 4J43A 4IIUA 3PGJA 1XNGA 1G2HA 5U1PA 3ZCSA 1YO6A 1FFHA 1KY3A 4I4TB 4F4JA 3PZRA 5CT4A 3CH6A 4EW1A 5AIQA 4D7NA 1WCIA 2GKOA 1FTTA 3RHTA 5CEJA 1FYFA 4FWBA 1JQ3A 4MGRA 2OV4A 1FXWA 5JC1A 1P19A 3Q0TA 2MLGA 3RVQA 1UKZA 4CKBA 4LV8B 1GGKA 2I8AA 4P38A 5I8WA 1BOAA 4P3OA 4A5MA 3SEFA 2CYYA 2EQBA 2OFWA 4S12A 1DPFA 1GU7A 3TRDA 2XF7A 4Y98A 5DNWA 4LJLA 2FFAA 1MZBA 3EWNA 4C4PA 2JHFA 3VNBA 4QPCA 2EATA 1G9TA 3CU5A 1L7XA 3OJFA 5JQGA 3PO3J 4ZCPA 2QR5A 1DCMA 3OUUA 4BVFA 2G80A 4PSVA 2OSBA 5GV7A 2QT9A 3G3EA 5AK4A 1HQCA 2V79A 3SKXA 2FEPA 3O5AA 3WLTA 3LT1A 2R8ZA 1WXIA 5TMEA 5MGBA 1UWKA 4XIJA 1C9JA 3DQQA 2PX4A 3Q7EA 4Y2YA 3TQOA 3DHNA 4H4DA 5KDDA 5HRCA 2HXYA 3M6MD 3EVDA 1L3BA 3D4BA 4UXHA 2GA9A 4ALNA 4XLNF 2VNAA 3Q7PA 3RQ4A 1Z6RA 3T7KA 3USCS 4FOTA 5HZGA 3AKDA 4B17A 1FRVA 2VDPB 1UPFA 1XU7A 3F72A 3PCTA 4Y1RB 1N9KA 3WTVC 4NDZA 1FZQA 1U1FA 3BH7A 2QENA 1USGA 1L4KA 1B6GA 4URFA 3FPLA 3JU3A 4AZ0A 1JTVA 4CCOA 4AYTA 2C04A 4MWDA 4L9RA 1GNPA 4PYLA 1GA4A 2GHRA 2VUUA 2ATCA 5K3OA 3ENZA 1T9GR 2I87A 4KP7A 3HK2A 3UB4A 2V5VA 4ZDWA 3R0VA 5CA1F 1RQLA 2VDWB 3V4PB 3WI7A 3B02A 3UJNA 3AXTA 4FM9A 1SK9A 4L5BA 1ZRDA 5KTYA 2ZROA 1W5EA 2QD2A 4U6NA 3M3PA 1DC8A 1F48A 3CN9A 4R7TA 1CR1A 3CLUC 4CRWB 2BEVA 5L3RA 1TZCA 4HX9A 4O4JF 4QQFA 5CDFA 1CUVA 3MGGA 2ZUTA 4FE3A 1JFRA 5C80A 5EIAA 5BT9A 1UPBA 3H9BA 3QFSA 2OMKA 4XQFA 1M34B 1J2EA 3IV9A 1ZUHA 5CXQA 3A9WA 4FN5A 3TWOA 2BGCA 4MMXB 5BURA 2L9SA 3PF8A 1EUCA 1SY7A 5TISC 1ZOPA 4MR7A 3HCEA 1WKMA 4BO9A 4B0PA 4FX2A 4WL0A 1KAMA 2RHCA 2I1QA 1VG8A 4MVCA 5B7NA 3AUFA 3G4SI 1RC9A 4CLOB 5CA0A 4B75A 3PUWA 2WF9A 3KE9A 3PUZA 4R54A 5HQ3A 4HGNA 4WX2B 5ALUA 3OETA 1SU8A 1PTJA 4KLAA 1RRFA 2H2GA 3UOGA 4OV6B 5IDXA 1RR6A 3CUWA 4YUAA 1VQ8I 2CQQA 1Y48E 1JT0A 4PANA 4OIPF 3ZZ1A 3W3AA 2PBLA 2PPLA 4EO7A 1PQ4A 1FU4A 4J19A 2GLUA 4DRYA 2P79A 2FGJA 1GPAA 3FPEA 4JB2A 3DLPX 4A0FA 2Q8KA 3PL1A 4BMNA 4C29A 2B8JA 2OCPA 5GONF 3U7FB 3AR5A 3AF0A 3EVGA 1VQNI 1RP7A 1XRNA 2NU8B 4B6QA 3R8XA 1U8EA 1TQ6A 3TD2A 3TW4A 2M7AA 2H2WA 3E3OA 4I3FA 2H27A 3CCSI 2CCGA 1HLFA 3H9GA 2JLYA 1ZHFA 2Q5QA 3F97A 3LDUA 4HX5A 3SLRA 3OYKA 2P5YA 3IWZA 1T9BA 1WEKA 2EXXA 1CDOA 4FMCB 5J8CA 3D1JA 1N1EA 1WXWA 4BMYA 4QHTA 4X5OA 4DLBA 4GI2A 1DB3A 3W5UA 1U0SY 3AEQA 3DXFA 3KXKA 2PMZA 4M9SA 3PC4A 4NQRA 3G2HA 3B6EA 4GFDA 3WLSA 5EVCA 4BU0A 3E8SA 4ARZA 1ZINA 1M2EA 4CG1A 2LKPA 4LZWA 1SPBS 2NRAC 3FY4A 1RAFA 4GKJB 1WOMA 2IXBA 2IDMA 3ND6A 3N5CA 3IQZA 2PLRA 2L9VA 4L28A 4G8DA 1ZXXA 1KZ9A 2FA9A 2HRBA 2XNCA 2MR5A 2RI0A 4KJXA 3K9BA 1K7YA 3OMWA 4AC0A 3GJ6A 1JVNA 2OPHA 4YRTA 1FYKA 4R8KA 1MNAA 2QTZA 5IX8A 4YJHB 1ZHHA 1QAMA 3RAEC 1UFKA 5CCXA 3CKLA 3G1UA 2A6HF 4MLDA 2FPOA 2KKOA 1ZGJA 3LSYA 1P4GA 1RPJA 1J8VA 1UOQA 1GPKA 3MQFA 1SEPA 2WJ4A 1H8HA 1BYUA 4JN6B 2CK3A 4L0QA 4EQ6B 2NZ2A 5H6QA 2P2GA 4D45A 4P80A 1MTOA 3LXUX 4XRMA 2ZIAA 4EI8A 1U0GA 2O7RA 5FLKA 5H5JA 2DVMA 5TMPA 3RU2A 2LD4A 2MMCA 4DADA 2WWRA 4KN4X 2BH2A 2PMZN 5BRNA 1IXCA 4FFDA 3W9UA 5D5UB 4JI1B 3LVBA 5AJUA 2VT3A 4RL6A 4TUYB 2VJQA 2IKQA 1W581 4XD7D 1O3TA 1BTOA 2K5UA 5TJJA 4N9WA 3QMVA 2B6HA 4D74A 3WTZA 2GH1A 2CL5A 3LU1A 4FI3C 2PYZA 4BCDA 3CUKA 5AI6A 3LA7A 4LVNA 2G08A 4ZQHA 1M2NA 1DRWA 4DOMA 3SHWA 3TE6A 1R5HA 4DHEA 2X1HA 1CVLA 3CUEF 3WGHA 5KOIA 5IK2A 3VU0A 1ZUIA 3MQ0A 4WINA 2I91A 2P4WA 2ZR0A 3PJEA 5T57A 5ADVA 3U4MA 4ZMSA 5CXSA 5KYWB 2O0JA 4ZAFA 3IV6A 3N2GA 3A2NA 4W8HA 1NX9A 2LMDA 5L7YA 4AWAA 3K0FA 2RNJA 1A8PA 5K8VA 1M7GA 2QB5A 2IGKA 1VPWA 4KXLA 2BGKA 4G6DA 5KPDA 1QKKA 1N57A 1SCNE 4WUTA 2XNKA 1A50B 3KU4A 3O1LA 1EX1A 4NYIQ 4ZVMA 4MQLA 3OWOA 1IG7A 4M8LA 5BYBA 1EXMA 3ZS9A 3DC2A 1CRZA 1K4TA 4EENA 1YA8A 1IHDA 2HWXA 2WB4A 1U7HA 2NP7A 5FR1A 3E05A 4BVHA 2YIMA 2QG9A 3WHIA 4C5BA 2HHLA 4QLAA 5EIBC 4BKXA 1PT8A 1QSGA 1XDBA 4L57A 1LDBA 5L7WA 2OV2A 3F8SA 4KWEA 1YGYA 1DRKA 4GMKA 1E98A 2GHIA 2A07F 5J2UB 3FOZA 5CVEA 1ENPA 2QSFX 3PNPA 4O4LA 1T36A 1EFTA 1NMSA 2W85A 1QIIA 3UAXA 1MKYA 5AHKA 3BMNA 3BYZA 1IJKA 2PFSA 2LGJA 1ZISA 3SBXA 1R1VA 3D0SA 1LQUA 4IQ8A 1R66A 4M3DA 1V1RA 4D9JA 1WUIS 2M6RA 2AHOA 3Q3EA 2C9YA 5GQSA 4MQVA 1N75A 1JR3A 2A6TA 3Q0IA 3QNUA 1T8IA 4TV8F 3OU6A 3AVYA 1B1BA 4KKXB 2IP2A 4LZOA 5EE3A 5F2EA 2CW8A 3MUEA 4OATA 1F7VA 3NWSA 4DLXA 1Z3YA 2AMYA 5K03A 1AKHA 3LBYA 4M4SA 1TIBA 1XAIA 3QA9A 1E2DA 3D8UA 3QUBA 3KHSA 1DFGA 3LHDA 2GESA 2M1XA 1G3QA 3A4CA 2IHUA 2AS0A 1JAZA 4E13A 4FIDA 2JIRA 3NXKA 4EYOA 1JHFA 4YV2A 4JLKA 3L8DA 5LA6A 1LEHA 2FJ0A 4CHTA 4U88A 2WAXA 3GAFA 3ANLA 3SR3A 5B1AH 4B4KA 3BGIA 3AHDA 5ALKA 4C76A 3UCFA 4C4SA 1E3OC 2YVUA 2EJBA 2VG8A 3ORSA 1PZMA 4ZEWA 1LRKA 2IE0A 3TAXA 3G8DA 4P93A 2HR3A 1VLZA 3OKPA 3IAEA 4AVPA 2FJUA 5J23A 3EEFA 1FYLA 4A23A 1O94C 3M34A 1PYGA 2A30A 5DK6A 4LJYA 3E3LA 1JTXA 3L7BA 4N3BA 5ELLA 4FX5A 1L1RA 4XLEA 1PBTA 2PKQP 3WWPA 3GBPA 5E7IA 4U63A 4TS3A 2UXXA 4Y2PA 4DAOA 3NEJA 1JFSA 4V0RA 4ILEA 2JCSA 3QXSA 2WHXA 3H5NA 3IERA 5L6LB 4RENA 2DR0A 3N5KA 1GKIA 5CM9C 1R0BA 3HADA 1Z6ZA 5E1DA 4LJAA 2JJ7A 4FX4A 1UPAA 4J03A 3IT1A 3MQ2A 1U8YA 1CHDA 4ZYEA 1E2HA 3RYTC 2Y1OA 3NDRA 1Z63A 3AXSA 3I32A 1A77A 3Q10A 3O9VA 4XUEA 5FYQA 4DDUA 2XGXA 1YQQA 3IBFA 2GA2A 2XRMA 4NU6A 4PNPA 2N1MA 3CDHA 1O9GA 2RGBA 1TAGA 3BPVA 2HLPA 2WJGA 1E1DA 4XZ3A 2VZ0A 3L6DA 3M82A 1KDOA 4N0EA 3DMDA 3CLOA 1FTSA 2ERYA 3LCUA 4ZOCA 5HMLA 2G9ZA 3UGQA 1Z88A 5IOYA 2PK3A 4P7FA 1XQ9A 4E2ZA 2ZRAA 3OWTA 1G3SA 1YJXA 3RBXA 1Q92A 4EIWA 4D0SA 1FNNA 1JWLA 3STWA 2DFKB 1A5JA 1O5IA 1U9ZA 4BQQA 2CHQA 4KQMA 1XDUA 3ZOBA 4LFBB 3DF7A 2WVJA 1QHEA 1KMMA 2M98A 1EFPB 2BBYA 2M8GX 1Z5NA 4ABYA 4G2TA 3MLEA 4YMTA 4EY5A 4O4HA 3KALA 2ZRFA 2R85A 1B8IA 1Z68A 5FTJA 3ADKA 3BGSA 3FF1A 1C0WA 1ZGGA 4UHBA 1EAYA 5L3BA 3UGTA 1N9ZA 4B3BA 4F8YA 1ZD5A 4F3QA 4MA0A 5ITVA 1FDUA 3A3NA 5G3YA 5ALFA 2XE8A 4P9FA 1TWGJ 2JGRA 4RCZA 4JP8A 3VH3A 4Q1BA 5BN5B 2Z8ZA 2R1VB 1SBCA 3LX8A 2A2ZA 4YWJA 4ZYLA 3O84A 2FWAA 4YRIA 1W4CA 4EOGA 1P91A 4N3AA 1KJWA 1KYVA 1HC7A 3D5LA 4N5MA 4AQYB 4X7BA 5DS9A 2B6NA 5C7YA 5AI8A 4B43A 1LVKA 2GXSA 1Q1GA 4TQ9A 2DU8A 4UM9B 1OTXA 5EJMA 2Z5VA 1G8PA 3CLVA 4L9JA 3QVKA 4BRZA 1DO8A 1T2CA 1T98A 3MGCA 2LBFB 1P2UA 4GX5A 3EPPA 5C51B 1EG7A 2X5OA 4BKQA 1L7EA 3ZZUA 4HEJA 4C03A 1XU9A 2ZFWA 2OENG 2ACJA 1E99A 3C6YA 1CUIA 3C3MA 1SFOJ 1CR6A 2I66A 3NEPX 2CNWA 4HI0E 1OLUA 1E1NA 4PHGA 2BFFA 1CUSA 2QMHA 2ZCWA 3EXIA 4TS4A 2G4CA 1KJQA 2YWBA 3NTLA 5TX7A 3AI2A 2HCBA 1MABB 3F1LA 4M1YA 2RE8A 1IC6A 1ZLXA 4WESA 3ETHA 1QX3A 1VGQA 5EN4A 5FTKA 2UYHA 1P7ZA 3D7KA 3IJPA 3CBGA 1XJCA 3F3KA 2YWEA 3BCBA 3OQIA 2CW7A 5L53A 4LBZA 5CHEA 3U60B 1WAMA 5IDQA 4MUJA 5I9LA 2CXPA 3CVJA 5KYUA 3KD3A 4IJ5A 5FKNA 3U37A 2FUEA 1L5KA 4CMIA 4KE9A 2PGDA 3GUCA 2RV8A 5EUQB 2JDID 3B1ZA 5DDGA 3PFGA 3DE7X 4K87A 4YEDA 4L5IA 2QQBA 3WK7A 1VFNA 2ZYGA 3OLWA 1L5MA 3CW9A 2RG7A 1D4ZA 4DR4B 3ZCXA 4ZOAA 5A03A 2FPIB 4F45A 4ZQCB 4CT5A 3WV5A 3JCZA 4D0RA 3U61B 4KR2A 4W99A 2H0QA 3VZBA 4FYWA 3T8TA 3DB1A 2ODBA 1OFCX 1GUFA 4GXRA 2DFEA 5GTIC 5FTLA 2C7PA 2X0KA 4II7A 2V6IA 3U80A 3K0CA 3VOTA 2O3UA 2YWRA 2G9UA 4GLJA 3AG6A 1W87A 5IJ9B 2BFPA 2J31A 1N25A 5J9FA 4XX1A 2BW0A 3WBJA 5BN4A 3R0XA 5F0CA 4GC5A 5KNDD 2V7BA 3OZUA 4MVJD 3AYZB 4KV7A 3VHXA 1XMAA 1BGVA 3KS9A 4Y0NA 3KKLA 1RRVA 1YC2A 1N4DA 4LXIA 4ARVA 4Q03A 1FSFA 2OHGA 3KSUA 4EB6B 2EBIA 1SXPA 4ANFA 5A4IS 1U2GA 5CVRA 1RJFA 3HJGA 1EBBA 4J1TC 3BKXA 5LCXA 1CVRA 4D3XA 1QE5A 3V8JA 5FL7D 3T0FA 3T3MB 5EGNA 2MTBA 4N7RA 2O2DA 3FSJX 3UMBA 4FJ0A 3MZYA 2GBLA 4PQYA 4RA2A 2O59A 1RKWA 3B3FA 4OHOA 4ER3A 4LE2A 1K6XA 1AZSC 5H4GA 3DVRX 5ARDA 5C5CA 4PLPA 2PS3A 1AGPA 3O4GA 1UKBA 1P9NA 4WACA 2DPYA 3E3AA 3QG5A 1JYEA 1NBOA 1DAKA 5E8GA 3QODA 2WD7A 4L7QA 3CWCA 3TUZC 4X90A 2AMLA 3AINA 3WTSC 3NV7A 5IDVA 4JXJA 1JDNA 3AG1H 4TKZA 2NX2A 5HLGA 1TYAE 2OZLA 3ZGKA 2DC1A 2DUUA 2C7RA 1QGOA 1LZKA 4IL5A 5E18F 4WZAB 3PV0A 1CB7A 1R5BA 4R16A 2PMDA 4HEHA 3AHCA 1D0ZA 4L76A 3VPRA 5LGUA 4L4XA 1A2OA 4HKTA 4CMJA 5FROA 3NP7A 2JA8J 3W5SA 3ACCA 3O7WA 1NYRA 4UUSA 2WU0A 3A0BC 4BJHB 5J43A 1QA6A 3DMTC 3L41A 3AKYA 4NJMB 1PWZA 4W5HA 4FYJA 2V03A 4PQGA 2O3FA 4F7DA 3B36A 3BG6A 1ESCA 3ZBTA 1P1KA 5B1DA 2PPVA 1GTSA 2WFZA 4Y9DA 3QYAA 1V3QE 2CHEA 3EYWA 1V54H 2AYZA 1NBEA 4BTVA 1UBOS 2EFCB 3VOEA 1H4SA 3EH2A 2MSYA 4LRYA 3RDIA 2VJMB 4O2AA 3QEMB 4TVOA 3GIDA 4IIFA 1YJ9I 1EM8B 3IAM6 4MULA 4G85A 2HEGA 2V45A 4XJXA 5DU2A 1I6LA 4LOKA 4AZTA 5E9JA 3PWKA 5KJ6A 2J6BA 1X1DA 2ZE5A 3P5SA 4Z4QA 4JI3B 2SICE 5DI3B 4RH1A 3NG1A 3BSYA 3OLCX 2FQQA 2V4UA 4M0UA 1H9GA 2QD1A 1A4UA 1CUYA 3DZGA 5KTPA 3CPEA 2JFOA 3I9V2 3DV9A 3W1EA 2QBYA 3RRMA 5LP6B 1Z2OX 4GGOA 4RM3A 5KSYA 3GVHA 1ANKA 4YELA 2ZB7A 4YUZA 1EK2A 5FFFA 3PWZA 3VZQA 4P7GA 3WDKA 2I80A 4CG3A 1UKYA 5G0WA 3WGOA 5A0FA 4I7EA 1N8KA 4QUBA 1A6IA 3EBLA 4X8OA 5KYVA 1PFKA 1RKQA 3N53A 4BIMA 3CIFA 4C3ZA 1LE8B 1D2RA 2O2CA 1IG3A 4E5YA 4YN3A 4HV4A 2PRJA 2IY7A 3D3NA 3DTVA 3IKMB 1ZU5A 2IHKA 1HZZA 1DO0A 2IXFA 2ZWPA 2L82A 4E7SA 3WGNA 1DZIA 2P4QA 3EYIA 3FXQA 3G2OA 1C1HA 4FEGA 4KVFA 2SCUB 3MAAC 1MUUA 4QDUA 3TIGA 4I66A 2FK7A 4IWYA 1Y6GA 2GXQA 3VSEA 4HYQA 4S0HB 1RHRA 1WXEA 1JJ7A 4JI2B 1NIJA 2PD6A 1WCYA 3WWEA 2X85A 3H2JA 2EWNA 4S0ZA 8AT1A 3I0MA 4JB8A 5FGMA 3TUJC 4MV3A 1ZJ6A 4UM5A 10MHA 3GROA 1UCFA 2GASA 1VHJA 5KVQA 2RB5A 3OZRA 4ZH4F 1T5SA 3ELDA 4BAZA 3PSFA 4V2UA 1WDMA 4UVCA 1E3EA 2HU9A 3SXPA 3KV3O 3IYLW 5JPIA 2H07A 2PRKA 1F4LA 1Z7GA 5JSQA 1TAQA 1B8NA 4WVFA 5IU6A 1O4XA 3LXXA 5IANA 5LQNA 4HNAA 1KDVA 3EEIA 3TG8A 2WD8A 3VO9A 2XWQA 3VTKA 1KO1A 3VPFA 3OU2A 2R4GA 3DPUA 2AWNA 2O3RA 1Y6FA 3IS3A 2GD2A 1IBRA 4HDMB 2G7MC 4BX0A 4YMLA 5NLLA 2WFMA 3H97A 5AM5A 4BYGA 5EAIA 1PG5A 5F7OA 3SFTA 4YJ3B 5JZBA 1GNLA 1LF5A 3N58A 4ZTUB 2C7VA 4Z1MA 2JW5A 5H8WA 5DX8A 1MMDA 3EUHA 3L0SA 2CYAA 4N8SA 3FM5A 4EJUA 2E55A 1KTIA 1FLDA 1GNQA 3OCZA 1SC3A 3KQSA 2NOGA 4NOJA 3S1LA 5J47A 5ED0A 1X7XB 3PXUA 1MRZA 5JAOA 5GTHC 2RNGA 4NSNA 4NZMA 1E7SA 1F9AA 1V25A 1IN6A 4YV0A 2O8BA 5F73A 2JAQA 4LQDA 4BXOA 3CVWA 3C2BA 4NG5A 2W6IA 1Q19A 1HNNA 1JUDA 4LHZA 3G02A 4QLOA 4FFOA 3AVPA 1SFRA 1PAUA 2BIFA 1W35A 4OMCA 1UFRA 5IH7A 4EW3A 3CTPA 3DG9A 2EX4A 4DYVA 1CDZA 4BNYA 2JH9A 4HY3A 1FZPB 5REQA 2XAHA 1A9XA 3DFMA 2O14A 3R7AA 1ZOOA 3NAZA 2WK1A 1LPPA 1BL0A 1PJ4A 1KO7A 1RZ3A 4OKNA 221PA 1UAGA 4PZLA 5HLIA 3IHWA 3FXOA 4DR2B 1UBUS 4OP2A 5IW8A 2XUDA 4D4KA 3PQ7A 1SWVA 1UBKS 1G66A 3H9CA 3K4BA 2Q5JA 3PC8A 4MWEA 5DCMA 3W1WA 4PGFA 2PXCA 2NG1A 4RGQA 1OCPA 4PS0A 1AVTA 1HE5A 2W37A 3BSFA 4QGAA 4B76A 3M7IA 1FX0B 1TEXA 1H69A 5J5AA 4U5XA 3HH8A 4K9LA 1FJHA 1I3QJ 4KO3S 1L4GA 3VBCA 4O4IB 4Y30A 3TQSA 4YV7A 1XZEA 4UASA 2VJCA 3IELA 1NN1A 2JBWA 3CCBA 1T6SA 2P0WA 1WSWA 5J1UA 2NU7B 1J9IA 4DR5B 4ZAZA 2UUZA 3CE6A 2X6WA 3W6OA 3VYSB 1GUDA 2WWXA 1X7ZA 2V0NA 2VTDA 1VSUA 4C3IJ 3CG4A 5IT0A 1R7JA 3LUAA 3O9ZA 2I6UA 3GLHA 3I5YA 4B32A 1Y98A 4DDHA 1THTA 3M0EA 5SV2A 1ZH5A 2F3RA 4HLQB 4LMPA 1XWFA 4FONA 3UMYA 3H9EO 3W8DA 1RMTA 1DWPA 2RHBA 1QYWA 1GKYA 3H35A 1U5TB 3HVRA 3LWBA 4S3MA 3UXEA 2Y1DA 2BKUA 4DW6A 2GCNA 3EOBI 1X9IA 2P2LA 1E0SA 5DASA 1WJCA 5CIWA 4JLAA 3GCMA 1Y3IA 4W1PA 3QWAA 4PN7A 3DVAA 2DQ4A 1G4AE 4D4LA 2PUAA 1ZR4A 4B45A 1S2OA 4FR5A 5D3MB 4WFJA 5EJ2A 2XMGA 4BVLA 4DY4A 4HQNA 5IT9A 1XF9A 3T4EA 2EBWA 2ZTVA 4BLWA 1HG1A 4JYCA 4RIEA 3TLYA 3G8YA 4IDPA 1P5ZB 5SYNA 4EBBA 4KQIA 3LY5A 2VBWA 5C1DA 5IPAA 2ZEJA 4M99A 2Q3LA 1EBUA 4RIFA 5SYMA 5CJ9A 1W6UA 3RKUA 1KR2A 1U9OA 3QP5A 2OB2A 4UFNA 4MQFA 2EG5A 4JFRA 1P72A 3WHKA 2C8KA 2JJ2D 3EIWA 3TQNA 4FS8A 3UICA 1DRVA 5FUVA 1RXUA 4YASA 3U3KA 3HOUJ 4X45A 2WKSA 5C8ZA 3O3KA 4O5VA 4BDTA 2NTJA 3CCEI 2J7PA 1KBOA 3GA7A 2CJPA 1KDYA 5KYYA 2H00A 2OZVA 3KXIA 4AAYA 2XMZA 1GQRA 4P7KA 1MMNA 3AHJA 1BJKA 5LR6A 4IVPA 5JSHA 1JG6A 3TM4A 1M1NB 4BMCA 1PD1A 4EI7A 1HDOA 3IV7A 4MB0A 3BMXA 1QG4A 4ZYGA 4QXOA 3KYLA 1D4FA 4BV3A 1Z4MA 2YS9A 4MW6A 4G65A 1N6RA 5HOEA 3Q72A 1GLNA 1O87A 4Q4JA 3E61A 2CD7A 1YW8A 2YYSA 2WG2A 1BCRB 3ZGZA 2YMPA 4BKUA 1ETQA 2G1AA 2HZ7A 4BTLA 3PBKA 4UPDA 3AESA 1X1CA 4V02A 1J49A 3X1ZA 3RUEA 2HQ1A 3W4KA 1SVOA 3VR2A 5DTDA 5KC8A 3C15C 3HFGA 4RHYA 1R49A 4UW9A 3ZGVA 2V5AA 4TMKA 4GO1A 1XL1A 2Y0DA 1JJIA 4FUQA 2IYPA 1OR7A 1HWYA 3OUTA 3RSOA 3QKWA 3IBTA 1LC3A 2WFLB 3DHVA 5D7BA 3NALA 3T3GA 2OZ6A 3SICE 3MJDA 4HDOB 3HUEA 1EHCA 1PZNA 5KS2A 5FBRB 1N6NA 1XTVA 2Q1ZB 3D4OA 1O58A 3ZJTA 4HWSA 3OLYA 2VN2A 1II8A 2AUMA 5FPTA 1P7PA 4ZHQA 2WKQA 2QGNA 3PPWA 2VJ5A 3NS7A 1B72A 1N5RA 4IJMA 2E4AA 1HPLA 3EQZA 4EGCB 3U2RA 4TQGA 1QVUA 3OJWA 2COKA 3UT5B 2FRDA 4OXYA 2ZJQF 2QY9A 1Q0TA 3EQLF 4V19K 3GFTA 4UNQA 3S1AA 3VDQA 1J8QA 5AP9A 2IV2X 1KI8A 2VZ8A 1Q44A 1LJUA 3BR5A 5B5SA 3NCHA 4E03A 1IZ9A 1D2MA 3NBYC 2WVAA 3L05A 2XLBA 4M7PA 4ENMA 3C5CA 2J0SA 2VLAA 4BKRA 1F43A 2XUGA 3UWKA 3RQIA 3IOEA 2V8BA 2DECA 3AHIA 3LXMA 1FUEA 1ZPDA 3OM8A 1GFWA 1P5JA 5AIBA 5BOVA 2QQ9A 2H9IA 4CE6A 4MO7A 4QBTA 4GW3A 2IUUA 3SZTA 1NXOA 4A3LJ 1BZYA 5IYCJ 4E7PA 4UU8A 4A6XA 4JLDA 3D7NA 3T7TA 1HSJA 1S89A 2BD0A 4BAGA 4YAKA 1FVXA 3H3XA 2DFPA 3CW8X 5AKHA 4B4DA 2BGJA 4OP3A 1XMPA 4JJEA 2V58A 3D3JA 1WI3A 3LTNC 3ONEA 2DFIA 3HYIA 1F0PA 3BAZA 2FCAA 4HR7A 5I6DA 2OWDA 3C2QA 1GL7A 4W5TA 1YRAA 1ZN2A 3G88A 1Q1HA 3CC4I 2O52A 3VUFA 1OYWA 3ISTA 3DXXA 5EZQA 1P5RA 2XDVA 3OZTA 4B3XA 3WLEA 1DL5A 1D0XA 1G5PA 1BFUA 4UU0A 1FUYB 4IRXA 2ZYWX 1QFYA 4QL3A 3ZK9A 4FSDA 1KS2A 1TK2A 4CUKA 1CZNA 2TECE 3GTGJ 3G2NA 2FYTA 1W94A 4DWWA 1EFVB 1Y42X 4F7WA 3VJMA 1O95D 2Q5HA 5A3VA 4J4BA 3RJMA 4F55A 4CQJA 1JG1A 3B3QA 5KX5F 4D79A 2F64A 1DGQA 1LCIA 3EOZA 4LUCA 1VB3A 2B21A 2AFIB 3KP1A 4ZOBA 2L3DA 3K94A 3RHSA 2VVTA 1PR2A 4B79A 4YYEA 2PR2A 1J21A 5T4BA 4CLHA 4AW9A 1Z33A 3RUAA 2R7TA 5HDQA 4CXFA 1VFPA 5K6TA 2I8LA 5H3CA 1EKXA 1WDLA 1NDQA 2R6GA 3L1JA 2EB7A 4I50B 5T3UA 4GGMX 4OYHA 3SJUA 3E9YA 2HLDD 2NACA 2ZTHA 2QCOA 2FPSA 4KXNA 3HJCA 2AOTB 3FROA 1ORRA 1IFXA 5HEKA 4RVSA 1KQ0A 1Z8HA 4OLBA 2XF8A 1P0IA 1XPOA 3T38A 3S44A 2PKCA 2OGTA 4Z49A 4A4DA 4M22A 1E4YA 3QI7A 4LZPA 1REQB 3VB2A 1D2CA 5D6OA 1RU3A 5EPUA 1TYBE 4ETMA 1PJ3A 1AHHA 3R0QA 3G5AA 1J25A 4RK5A 4BLRA 2OMEA 1EINA 1TL7C 3T7CA 4IXMA 1HQKA 3W5VA 3CKKA 4I5IA 5ALWA 2A5WA 1T6BY 3H3JA 2BV6A 1ZD1A 4EGYA 3GEMA 2EW1A 2TYSB 1Y5RA 5CD1A 2H5LA 4D5FA 2ZAGA 4MB2A 2FG5A 3GMIA 3F6RA 1YFKA 4OO3A 1HBJA 2BHYA 5DM0A 2GWHA 4GSLA 1VE5A 1YBVA 1DJLA 2V6GA 3VX3A 3LUKA 2WSBA 1OXSC 1RKTA 1ZW1A 3WMFA 1WBJB 5D8LB 3CRRA 4D44A 1K66A 2PY6A 3JATA 2W7TA 1VJ0A 4BCCA 4MYDA 2OQVA 2VIXA 1UM9A 4GEGA 1M10A 2Z08A 4K0RA 2V7FA 5EKTA 4ES6A 4K6OA 1NW7A 4GXQA 3BMQB 3EDYA 1RM0A 1YNOA 5LQCA 5CNKA 3I59B 2ADMA 2VHEA 1ZCAA 1CJKC 2I4TA 3D43A 3TW8A 4YCNA 5KTOA 1CZKA 3A28A 3SQOA 5EQDA 2C59A 3AEYA 2GAAA 4AURA 4QG3A 1GPMA 4Z3DA 3QHQA 2W2KA 5JY6A 4DREA 2HR1A 1W30A 4IQJA 1YZVA 3PX7A 4IFEA 1T91A 4E7IA 4R3UC 1Q7EA 3D7RA 3CEMA 3L04A 2X4IA 3V4OA 3BHMA 1RPAA 4LJSA 3HCBA 3T94A 3OYBA 1SQ5A 1CUDA 4MXDA 4QAJA 4RAQA 1MJHA 3UFXB 1OYVA 1P1FA 4XRSG 5L3SA 3EODA 3A05A 5FQNA 3T5BA 3WLJA 1T0BA 2G7UA 3SBEA 3H5WA 1XTUA 1UP4A 5MGNA 2YVLA 3FYUA 1T5BA 3ICWA 5A5VA 4E12A 3VVBA 3CX7A 1PJCA 1ESDA 1XSEA 3SU8A 4EYGA 2D2FA 2XQVA 1JTEA 3H42B 4AY3A 4KX3A 2L01A 3LY9A 2PVPA 3I8OA 1B16A 7REQB 2G1KA 1I3MA 2GBIA 2VEOA 3HFJA 4ZO6A 3U7QB 4GGPA 2XUJA 4J94A 4J6FA 4WFIA 1E4EA 4PO8A 4ZGBA 2FUNB 2H3HA 2W2PA 5JDIA 4GP6A 3GJ5A 2VDLB 3JYPA 1QNLA 4JJKA 4OLHA 5E1WA 3R44A 4Q7LA 5K1YA 2ZRBA 3K09C 4DCMA 1N2XA 4YRQA 5L3QB 4FCYA 2Q28A 3PJGA 1L5OA 3K0SA 4NF2A 1YBAA 5IFLA 3GQBA 2OQGA 5BN3B 2RC5A 2CEAA 4M73A 4X6AJ 3LUPA 1ZHOA 5AKLA 1O5TA 2DBVO 3AHFA 4MAMA 2C2OA 3QEJA 1ZEMA 2FWJA 1EYZA 3ASOH 3Q3VA 4HDRB 3BL5A 1AX9A 3ICPA 1PJSA 4NENB 5B36A 2CT8A 1RYMA 5D86A 4QBHA 3AERB 5IC6A 1QZUA 2DT6A 3L6CA 3KOXA 2V55B 2QX6A 4X00A 1CY4A 3HJAA 3LPLA 1Q0SA 1RBQA 4FD2A 5ENDA 4ODIA 1V7ZA 3E1KA 3TLEA 3H2GA 1G9SA 1U1GA 2ODNA 2HJWA 1NXWA 2BFDA 3STTA 3RAJA 3OIGA 4BY1J 1QGED 1SOAA 4C4OA 1D1CA 3N6RA 3G59A 4R2IA 4IGKA 2PHZA 1VQKI 1QNFA 5D8KB 2JFFA 3ASYA 1SKQA 2IIVA 1WZUA 2XAJA 4ZI7A 1G2PA 3AB8A 4MFEA 1L8XA 2AFVA 3ICCA 2A58A 1KOFA 2X51A 3TR6A 1RI4A 4WCVA 2JI4A 4GMHA 2ZBEA 3DEUA 2O4UX 4AYWA 2J3JA 2HHAA 1S0UA 1WZEA 3MRXA 4Y2VA 3H3VK 1QGPA 1CR0A 3GLGE 3GTPJ 1KK1A 2ES4A 4E08A 5HCIA 2C61A 4LIVA 1X8LA 4OIRF 1QFMA 1WPXA 3J7AC 2OXTA 4CFZA 2FD5A 2WSYB 3SC3A 2DKNA 2C1ZA 5IBRA 1SCUB 4WLVA 3HTSB 4I1OA 2WT4A 3AF1A 1CFZA 2CJJA 3INTA 2WC1A 1AHIA 3G7SA 1XVIA 4MIOA 2XSDC 1IWPB 4ZCRA 1G7CA 3WNDA 3VNRA 1GZHB 1W8DA 3DBHA 2KHMA 2X1LA 5DX0A 1KERA 5K0SA 1AU9A 3ZLUA 1KZHA 2FQWA 1QQAA 2O2IA 2HBRA 4GOMD 3VC2A 4OHYA 4MQEB 2MDTA 1OI2A 2EDAA 4RFLA 2E2HJ 2IE8A 3BRQA 1H42A 2WRZA 3HSRA 3S0JA 1XQ1A 2M5WA 1JT2A 2VJBA 3KOMA 3P0FA 4DLUA 2J48A 4DV7B 2BMAA 5I3ZA 1Q3HA 3FUWA 3P20A 1DJNA 1QQTA 1XD2B 2AVDA 1XCGB 3DAHA 3DE1X 3BXXA 1HUQA 1WDTA 4HRAA 1H65A 3E1SA 1Z0KA 2YOHA 1A5ZA 4O2LA 3K1AB 4NYIR 5CX1B 1MH4A 4DV5B 1KO8A 2FPGA 1NW4A 3EFHA 4FQ5A 3EG9A 4RZUA 4E33A 2QTRA 3IMEA 4L0MA 1B0AA 3DMGA 3PUHA 3PEFA 1VI0A 3WMRA 3QU7A 4A0SA 1J0AA 2DMUA 2ZJYA 3OOEA 3IX7A 3OTHA 2DHDA 1ORHA 1OX4A 2LD5A 4XR9A 3IDFA 1YKGA 2VK1A 4NUBA 1K3FA 4DIQA 1QHGA 4GI3A 4EVSA 1V16B 3B9RA 3F7NA 4LIPD 3CUYA 2EFHB 2J30A 1IY1A 2P40A 2OE2A 1WXXA 3KT0A 3HWX1 2OORA 3OQVA 1AQJA 2G72A 4G5SA 3A4IA 5M7EA 3KLBA 2GUGA 4YFNF 3AHEA 5ICFA 1J0BA 4E5MA 4BKOA 4YACA 1GGFA 3VH2A 1XF1A 5JAHA 4RSRA 3E9DA 4D96A 5EJ4A 4RU1A 3ER8A 1KRHA 2AO9A 2P69A 1TX4B 4UXNA 2A0KA 2XKKA 3SC2B 1BH2A 4D4JA 3RKQA 1AUOA 2GTIA 2DFVA 2CLLB 1QRRA 3RVJA 1MV8A 5KWVA 4HQRA 4H15A 1UPTA 4FKBA 4TLAA 1JTFA 2P4EA 5LOVB 1NQTA 4I6ZA 3S2GA 4YBRA 1NIPA 2GF9A 4N5HX 4ABZA 2QN7A 4PLVA 3P52A 3RW9A 1QHXA 1W88A 4EG8A 1BIBA 1IQ0A 3RCBA 3EVZA 2PH3A 3PZBA 3U62A 4R9UC 1WJBA 2VUTA 1G42A 1FB5A 4OHMA 2IH2A 3ZWBA 1ECPA 1CUBA 3H4VA 3U1TA 4BJ6A 2QVYX 1ZU4A 5FH9A 4P5EA 4X1OA 3WRVA 1FIAA 5KOHA 1C5KA 1JLMA 5KBYA 1OW3B 1RAAA 1N2OA 1D8TA 2A1UB 5E4TA 5AWFC 3HY6A 3AKCA 3NMUF 4CI0B 4B3FX 1SB9A 5BS6A 5DGCA 2FI1A 4RUKA 1HXDA 2VPWA 4BXUA 5FA6A 3GD7A 2QXTA 3PHIA 1BHQ1 3IQEA 3TF5A 1P7IA 2HSGA 3ZU6A 4BNLA 1DTEA 5GPBA 3I72A 3GJYA 3ZLVA 1OH7A 4RB1A 2ZXIA 4O1IA 2FOWA 4FKMA 4G8JA 2AOUB 2GVDC 3NOXA 3RC1A 3BHIA 3O90A 4DR3B 3IO5A 4EI9A 1GZUA 3I28A 4EDFA 3GN2A 3V4ZA 4D9FA 3NARA 4ZVRA 3PNOA 3OR1C 4TV9B 2ECBA 5FV4A 5CDUA 1QBKC 3S27A 5LKRA 6REQB 4TTQA 3VTZA 4TPKA 1CUGA 4UAGA 1O4WA 1VSBA 1XV5A 1FYVA 3WU1B 1I2MA 4N82A 2FJ1A 1PX0A 3AHGA 3TSWA 4DV6B 2O8VA 4I4NA 3O03A 3S2IA 1I1SA 3GZNA 1ODJA 4B31A 2R6FA 4QELA 1RESA 1RE0A 2IX9A 2OFFA 2FMKA 4WX9A 1PVOA 4RVGA 3WBBA 2CJXA 3JAMA 4BNGA 3PJFA 4H60A 4LVOA 3F46A 3ORFA 3SR0A 1FDOA 4I1IA 1Y4AE 2I03A 5AVYA 4J0DA 4MCHA 3SYKA 2W25A 2DQZA 5GAJA 2Q2QA 1LPBB 2QVXX 2ZJ8A 1EXDA 2XECA 3TPZA 3EZNA 1U7PA 2QUJA 5BQXA 1N2GA 1JSXA 3LUCA 2A7QA 3KZXA 3HB5X 3RS0A 1XLVA 1GG8A 2JEOA 1KXZA 1DU0A 3D54D 4URZR 2NU9B 8OHMA 5A62A 5GVSA 1WHTB 3S2HJ 4X6UA 1H3EA 2ORWA 4IH1A 1HT3A 4KDFA 2DDAA 2VDNB 2ZZKA 4YMIA 2STTA 1LWOA 3P9KA 5KTTA 1SB8A 4CTKA 4TTSA 3DE3X 4CGYA 3DOJA 2XWBF 4H59A 1PKEA 4AQ7A 2DGDA 2FMHA 5HFAA 4Q4DA 3JQAB 5A0TA 4W97A 2X9VA 3QTTA 4JY7A 2I5UA 5CM8B 2Q07A 3EIXA 2QGUA 3QVGA 3DFUA 4QFDA 4EM1A 3C1DA 4CIBA 2WA2A 1LBHA 3WIUA 4KTVE 1ZD3A 4B5LA 2NPFA 3F3MA 3DXJF 3NC4A 2XNJA 3A4TA 1QH8A 1MO2A 2Y68A 1Z5OA 2Q3BA 5B66C 3GELA 2D7CA 2IS4A 1KC3A 3ZGNA 2HKIA 1LPAB 1H8HD 1JJ8C 4W4TA 1TDJA 2CYBA 4F0JA 1U9IA 3AVXA 5LDHA 3RSCA 1KJ8A 2HTFA 3QE9Y 2LLKA 1N2HA 4IRHA 2C4VA 2IHJA 3OD1A 1VLHA 3ADPA 1QQ5A 5HF9A 5TXGA 2WMYA 1JLHA 3SIPA 4BO5A 1KJIA 4BNCA 5DRYA 4A8JB 3RRXA 4XL9A 2OCAA 2EU8A 3C3PA 2ZRGA 3V46A 5T4FA 5FBLB 4KIUA 4QUDA 1K86A 1F20A 4LYDA 2ZT8A 3IEVA 4OFBA 5FBQB 3TPFA 2R68A 1B9NA 1J07A 1XZHA 4DV1B 1SR8A 4CN8A 4URHA 4Q3CA 3COVA 1KOGA 2H1RA 1I9CA 2KLOA 2HDHA 1HLDA 3R20A 1AKVA 2XRYA 4B3AA 2V7XA 3UV7A 4AQDA 3NT5A 5LP6C 3M6FA 4X1YB 1MW9X 2ZYUX 3VH4A 1AA7A 2IIQA 2C88A 4FLFA 5JOQA 1HBXG 1XK7A 3CX8A 3EDOA 2VSYA 3A58B 3LAWA 3K8QA 5E1BA 1SXJC 4G3XA 3OA0A 4KAAA 1EESA 3KTAA 2WEKA 1BI2A 3CLSD 5EPEA 4TWZA 3U6KA 2AMJA 3ZVMA 1EDEA 5BVHA 1X0VA 2IXTA 4LYEA 3AG2H 2YXLA 1MBFA 5F52A 5H80A 1XGMA 1U5CA 1FSPA 3LSGA 1UAYA 1D5YA 2I54A 4WNCA 1NMXA 2XQFA 3DA8A 3P0EA 3VZSA 1JXMA 4NBTA 4H6XA 3GPIA