1O57A

Crystal structure of the purine operon repressor of bacillus subtilis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
270
Chain Sequence
KFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Purine Repressor of Bacillus Subtilis: A Novel Combination of Domains Adapted for Transcription Regulation
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords PUR OPERON REPRESSOR
total genus 78
structure length 270
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
A PF09182 PuR_N Bacterial purine repressor, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o57A01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1o57A02
3EYIA 4MEXF 1XZ8A 1I5EA 4QLCU 4GXOA 1P4AA 4BHBA 1RIOH 3KP7A 4A0YA 4YG2F 3FMQA 4KIBA 2Z33A 4RGXA 1EH7A 4HOBA 2JT1A 5E1XA 3BJ6A 3E6BA 2MD5A 1IXSB 1IN6A 2IPQX 1U5TC 5ED4A 2HZTA 2K02A 4Y17A 3ACCA 1XDSA 3RJPA 4ON0A 1IW7F 1U2WA 2DAOA 3F8FA 2EFNA 2A5YB 2QZ8A 3IWFA 3NQOA 3ZP5A 1JHFA 1IZ1A 1W30A 3V8JA 2H27A 3K2ZA 2A07F 1OYWA 3F8CA 1ZYRF 1P92A 5JSQA 5IAOA 3KE2A 2XAQA 1DUXC 5HKLA 4ESFA 3SFZA 2ZJ2A 3ZMSA 2BV6A 1HXDA 4NQWA 5LLQA 4RGSA 4OU0A 5L3FA 4UXNA 4EQQA 3TO7A 4KFCA 4UUVA 1ULYA 5CLSA 2P5VA 2KIFA 3J81K 1OYIA 3SZPA 2GXGA 4I0AA 1MDMA 1I27A 4WF2A 1F9NA 2O03A 3OZGA 2D1VA 4MGRA 5JHUA 3QW4B 1X3UA 4HW0A 2JKYA 2CSOA 4EM1A 3ZN1A 3ZMUA 1XB4A 2D45A 2MH9A 4LLNA 2ETHA 4A5NA 3MWMA 3CTAA 1R5HA 3ECOA 5BMZA 1IN7A 4OIPF 2VBZA 3BJOA 1AO0A 3DKWA 1UPFA 3FM5A 1LEBA 4O3MA 4EJTA 2EFQA 4X45A 1BIBA 2PLYA 5CJ9A 3NRVA 3M8EA 1V4RA 1UHMA 1PP8F 5L3CA 1K6OA 3WTXC 3GXOA 1MD0A 5LEJA 1STOA 3CDHA 1SMTA 3WTZA 4WX9A 2EV5A 4GYIA 3JAMK 4AWXB 4U0WA 4AIKA 5FLXK 4RHXA 3U1DA 4BH9A 2FEZA 2FF4A 2QBYB 2XAJA 4BXUA 4BAYA 1R7JA 2TDXA 3MQ0A 3GVAA 4IJAA 1TBXA 2Q2EA 3JTGA 1Q1HA 4P83A 1KU9A 4F7ZA 2R7DA 4LK0F 1GVJA 3JW4A 1IUYA 2LNBA 2QQ9A 4XSXF 4ZZLA 1BI1A 5HLHA 2WC2A 4WWCA 4EVIA 2FQ3A 1ODDA 5HOOA 4GCVA 5D8KB 2VBXA 4EJWA 4HDUA 3KETA 1NHAA 5ILVA 2ZBKA 1IRGA 3RPUA 2L4AA 1E2XA 5BOXA 4K2EA 3GYHX 3J80K 2QQBA 1PDNC 4KN6A 1KU3A 1YW7A 1DBRA 2CWEA 4KUMA 1U78A 2PJPA 4LYYA 4QYIA 2DW4A 3T8TA 4S04A 1Z05A 2VOOA 2H08A 2EFWA 4RB3C 2AEEA 2LF8A 3P7NA 2XBUA 3PQJA 3O3KA 5DD4A 1G3SA 1FOKA 1B4AA 4RB0A 2OQGA 3ULQB 3W6JB 1KYZA 5ESWA 4PFQA 1O5OA 4EM0B 3GEZA 4G7HF 1IN8A 4HF1A 3K1NA 1OROA 3R0JA 1MJAA 3HIFA 5K1YA 4ENJA 1FT9A 2EFPA 3AAFA 2VBWA 1XMAA 5CVJA 5D8LB 4I01A 2E1CA 2LDUA 3SQNA 2FBHA 5BPIA 1ZG5A 3I5UA 1TNTA 1USTA 2G7UA 3OOPA 2FMYA 3I53A 3B73A 4H0EA 2PN6A 3KEQA 2IW5A 2G9WA 4ZYEA 5CVIA 4MNUA 4P55A 3K1MA 2HOEA 1TC1A 3KP2A 2DK8A 5DD8A 2P5KA 1ZRCA 3TO6A 1QB8A 4Q4ZF 1KGSA 3MCZA 3EDPA 4RAQA 2LF7A 3GZ6A 1TQPA 3F3XA 2ZMEA 2CG4A 1J59A 3MJDA 4RHUA 4UHTA 2ACJA 3BJAA 5TRDA 3TQNA 2O61A 3E5UA 5HVQC 1ON1A 2KRFA 2ZCWA 5AIQA 1K78A 4LG0B 3LRTA 1G9SA 2GEBA 2HR3A 3NEUA 3M1EA 5D5WB 5IPFA 3I54A 1FC3A 5KVRA 5L3DA 5HS8A 2A6HF 1P4XA 3P9CA 5LBQA 2HCRA 3R60A 1QNTA 2X0LA 2V1UA 3GFLA 3F8BA 2XAHA 3OHPA 3JTHA 3KFWX 3EYYA 3IWZA 4HF0A 1QO0D 1U8RA 1KQ9A 1WI9A 2VXZA 4LZNA 1B1BA 2JTVA 4UVCA 1AOYA 5BPDA 4ZH4F 5ICEA 3ZN0A 3S2WA 4IF4A 4WMLA 1LDKB 4KNYA 2NNNA 3GX4X 3LQQA 4A12A 2J5OA 1OKRA 5IT9K 5FB2A 2O0YA 2VN2A 5DCMA 1I0IA 1DKUA 3GGJA 1G3TA 3VEPA 3N97A 3V8LA 2VONA 5CVRA 4A0XA 4DNCA 1JE8A 5LHHA 2Z3YA 4CGZA 3KCCA 3JSOA 1BOAA 1D6NA 2BYVE 1S7AA 5AIPA 2QLZA 3ZPLA 1D5VA 4L9NA 2DPDA 3SZTA 3W6KB 4AD9A 3J7AO 1NULA 2L01A 3B02A 2JI4A 2D1HA 5LRSA 1D8KA 3WGIA 4UNOA 5ILSA 3FWEA 1TQIA 1ZN2A 4XBFA 2MH2A 2OAZA 5FO5A 4CO8A 1R23A 2MC3A 4M6XA 5L3BA 2M30A 1J7KA 2EJRA 4WXCA 1W5TA 1HGXA 2XROA 2Y0MA 5D4RA 4HF2A 2DTRA 2QQAA 3BROA 4S2UA 3ZMDA 4M6YA 4G7OF 1Z6RA 1MDMB 5BRNA 3T1BA 1WSUA 1G2QA 3MZYA 5J8FA 4U0YA 1BD4A 2H94A 3U2RA 4ZYHA 4A6DA 4RANA 5F1RA 4ESBA 2J5PA 4Y15A 2KJBA 1QK4A 4P81A 2NRAC 4JK1X 1F4KA 4LMYA 3KLOA 4LZOA 5FFZA 1STZA 3S5JA 3KP3A 4FHTA 1HSJA 1G3YA 4EGYA 2IVMA 3I59A 1K79A 2IP2A 3ML6A 5LHGA 4UVBA 2WWYA 4TV7A 2VODA 1OPCA 2KJCA 4IHTA 2A3SA 2H6BA 2YX4A 1S6LA 4YIFA 4EJVA 1Z1DA 3MEXA 3EETA 1BZYA 2VC1A 1UCRA 4DQ2A 5F64A 1ECGA 1J5YA 4MHGA 4KA4A 2XAFA 4UV9A 3C18A 1LNWA 2PRYA 5IT9Z 4HQMA 3RPQA 1RUOA 2W85A 4YFXF 5H6QA 3FM3A 4JQFA 2KIUA 5FGMA 4LLGF 4NHJA 4RQBA 3BP8A 2MBFA 1BC8C 2FRHA 2DO7A 4P96A 2RDPA 2OZUA 2OD5A 3QPHA 3T0YA 4ETSA 3FZVA 1O7LA 2HYFA 1ZGJA 3LA3A 3CUQA 1FBQA 1W4MA 3DP7A 1FSHA 5JR3A 1FP2A 4HA8A 4XLPF 2FNAA 2FXAA 1O57A 3R61A 1A4XA 4BYYA 1H9GA 1YS6A 2Q8KA 3I58A 4EJUA 1JXSA 5DDGA 1HBXG 1ECBA 5CVUA 2PMUA 3WGHA 1GXQA 2VOPA 3WODF 4P86A 1DPUA 1WRJA 3HSFA 2HEOA 2M1BA 4WXDA 3F6VA 3FF5A 4I2OA 3P9IA 1R1TA 3WGGA 2ZXJA 1SMYF 3CLOA 4RAZA 1SD5A 1D3YA 1G3WA 2Z99A 2O3FA 4M71A 2HKXA 3G3ZA 1ZN9A 4LLLA 3TDUC 4LZAA 1UFMA 1QQIA 3G73A 2F5FA 1S3JA 1BI0A 2AS5F 5HLIA 2ZKZA 3LPNA 1R00A 2A69F 2VFAA 4M0PA 4F8EA 2VC0A 4P9FA 2XKOA 3H3ZA 4I98B 1T6SA 4G6QA 5LGNA 1J9IA 2CYYA 3L00A 1ZG1A 2YU3A 3L09A 4L9JA 1P18A 3N2LA 3HSRA 3J80Z 4LYGA 3R6SA 5E17F 4ENMA 3DMPA 4RGRA 4N0BA 3T8RA 3E6CC 4KYWA 2QM3A 2XAGA 5JI6A 3OZFA 2Y48A 3CJNA 2RV8A 4L9VA 2UWMA 2F5DA 2CO5A 3L9FA 3D0SA 1YLFA 1ZN7A 2H06A 2ADUA 3QP5A 2P4WA 1GRVA 3REOA 3FXQA 4L5JA 4N9HA 2RGVA 4EJOA 3HOTA 4Y13A 4CHUA 4ASNA 3RDIA 2GXBA 5ICGA 3HTUA 2EB7A 2P7VB 1ECFA 2G7HA 2IA2A 1W5SA 3KZYA 4OIRF 2E1NA 2KKOA 1HKTA 3LFKA 4Q5SF 3V8KA 3HRUA 4M9ZA 4O5VA 2YZKA 1B59A 2FBKA 2X4HA 4M0UA 1IXCA 3QPTA 4OMYA 1YW8A 3I4PA 5CYVA 2XGXA 1LJ9A 4M72A 3LA2A 1IXRC 1QK5A 4PGHA 4G9YA 1W7PA 1DQPA 2DBBA 1ZAOA 2W25A 1SFEA 5J6XA 4N9IA 5KK1A 4GGGA 5JFRA 1YIOA 1Z7GA 3T5XA 1YW9A 3FX3A 4LB6B 4O6JA 4QYIB 3VB2A 3QAHA 2JPCA 4R79A 2V1DA 3K0LA 1I0LA 2Q0OA 3TGNA 4HAMA 4MTEA 3HRTA 1O3SA 3DEZA 1FX7A 3M8FA 1Y0BA 2YSRA 1XZNA 2VBYA 5A2QZ 4B09A 3L2CA 4IRIA 3DV8A 3E6MA 3HRSA 2A61A 1PUEE 1W7PD 1OMIA 1OPRA 1I14A 4IRHA 4KMUX 5HIAA 1QZYA 1TQMA 1EH6A 2QVOA 4RV4A 2F2EA 4OINF 3M7GA 3QOPA 2XRNA 4KT5C 4JBAA 2STTA 4B8XA 1TW2A 1YQAA 1CF7A 1R3UA 2W24A 3F22A 4A2UA 2P1ZA 1NONA 3RYRA 4I0BA 2F5EA 5D5UB 2ZMEB 2P6TA 4U88A 2XVCA 4XRFA 1Z9CA 3G6WA 3WE3A 1O3TA 2RN7A 2IT0A 3HHHA 2E55A 1H9TA 4P5OA 2PI0A 1LVAA 1HKSA 5DUKA 5BS6A 3M3HA 3RKXA 2M87A 4LFUA 5IT3A 1JHHA 1XCVA 5FD6A 3HHGA 3ERED 5HDGA 1KA8A 4I02A 2COMA 1VDMA 1JLSA 4HX8A 3QP6A 4IPAA 2DY0A 1HW5A 3WG9A 2JZYA 2OQRA 1XCBA 4PGGA 1LH0A 4D0PA 3BZ6A 4GYGA 2JPBA 1SAXA 2HDCA 2L54A 1FYLA 4XLNF 1FSGA 2RNJA 3TOAA 1V9SA 2YX7A 5ESXA 3ACDA 3K9TA 2W84A 1XD7A 5BQOA 2FOKA 1P6RA 1OR7A 2OZ6A 2WV0A 4FX0A 3GUDA 2A6EF 1BBYA 4QWQA 5FD5A 3JAMZ 3GFIA 1S7OA 3KZZA 2CFXA 1CJBA 2RC4A 1BI2A 3IRQA 2WTEA 2GA2A 1FPQA 1R36A 1XTUA 5LHIA 2DQLA 3V4GA 1O3RA 1ECJA 3LA7A 3BPVA 5FFXA 2A68F 1U5TA 3LSTA 3ZQ7A 1MJBA 1XGNA 2O6GE 1C0WA 2IRFG 1E17A 4ENNA 1MZVA 4L9TA 3SHFA 1R5GA 2EV0A 4CZZA 3L7WA 1PP7U 3KB8A 3I64A 2MLGA 3BWGA 1P2FA 3H92A 3TO9A 4RHYA 3EUHA 2QYOA 1HQCA 5E18F 2ESNA 1HMPA 2Z5UA 2DFIA 2EK5A 3CUQC 3OV8A 1FNNA 5DEQA 4ENKA 2HTSA 1UFRA 3BOQA 5BQTA 4Z1OA 3R4KA 1FYMA 5ILUA 2JSCA 3F23A 3E97A 1SFXA 1TTYA 1RI7A 5LGUA 2K27A 3ELKA 1FYKA 2PBIA 2QBYA 3HTSB 3ACBA 4L0ZB 3KEOA 2FSWA 2GAUA 4ZYGA 2QUFA 4CYDA 3I0TA 3KLNA 4FT8A 4LG0A 2R7FA 4GO1A 2XIGA 1UB9A 1JLRA 1MJ9A 1T39A 2H07A 2PG4A 1F1ZA 1ZG3A 2IA1A 3GW2A 4HLXA 1T2KA 3R0AA 3GFJA 2FE3A 2XUBA 4CICA 5L3GA 2M8EA 3DQVC 2EWNA 2V6CA 2IJLA 5A2QK 1Y0UA 1SFUA 3HOSA 1OREA 2M45A 1LDDA 2VE8A 3PQKA 2K4JA 3J81Z 5H6RA 5H20A 2CQKA 1I1GA 3TDZC 1T98A 3WTTC 3QU3A 4L0YB 2F5CA 1ZRFA 3U9GA 5LGTA 2PFBA 2XV4S 1O7FA 2YR2A 3GFMA 2P6SA 2PEXA 1P17A 3H3UA 3DAHA 2Z9OA 3WE2A 3PFIA 2WNSA 1ZARA 4EGZA 4HQEA 1KU7A 2V79A 3GLXA 5K5OA 2DI3A 1HSTA 2NS0A 3QRFF 1BM9A 1L1QA 4RQAA 4IXAA 1LDJA 1DPRA 3DPLC 2FA5A 5DCMB 1P19A 1HW2A 2ZFWA 4BNCA 2VT3A 2W57A 1XSDA 1KQ0A 1IBSA 3F8NA 5JVTA 4P84A 3CUQB 1PZMA 5CVVA 5FLXZ 4P9UA 1R1VA 4A0ZA 6PAXA 1WKMA 4PZJA 4P3KA 1XN7A 3O2PE 4AVPA 5ICCA 1USSA 5JV5A 2ZNZA 5D4SA 1ON2A 1ZREA 3P9KA 1ZRDA 1L1RA 1ZH5A 1I13A 2FMLA 1G4DA 3FXUA 3C1DA 5F6FA 1XSXA 1U9YA 1G9TA 2QENA 4IVNA 5E38A 2NYXA 3M9AA 4EMSA 4RB1A 2E7WA 1SD4A 2FXVA 3Q9VA 3GO5A 4P80A 2DPUA 3DXJF 4Q48A 3LWFA 2EV6A 2RVCA 4PAWA 2GIVA 2ZNYA 4ESJA 3IKVA 4RAYA 2XASA 1K78B 4P82A 1T0FA 3F21A 3GGCA 5LRRA 2OU2A 3LAJA 2KIMA 1U3EM 4WCGA 4RAOA 2HQNA 2HYGD 1YFZA 4U7BA 3Q5FA 3E5XA 3EFHA 2OA4A 4HYEA 4HV5A 3V7RA 5EUCA 4JLSA 4LD5A 1QCDA 5TJJA 1G2PA 2FU4A 3MAJA 4M9SA 1FWZA 1QK3A 1TNSA 3V7SA 4CDGA 1V3FA 3KP6A 1G6NA 1XMKA 1YS7A 2P7CB 4M73A 3ABTA 1BN5A 1WD5A 1BI3A 4BQAA 3IC7A 2NNYA 1CF7B 1BJAA 1FBSA 5EEGA 4I09A 2K7LA 2DQRA 3HRMA 2UXNA 1B6AA 4NB5A 2FNPA 2OBPA 3VODA 3SXYA 3LAPA 3WTVC 2HQRA 4EM2A 2R3SA 2STWA 4OIQF 4UVAA 1VCHA 2MLKA 2LSOA 4KDPA 2JBHA 3K69A 2H6CA 3MFKA 1FP1D 5ICFA 1O3QA 2BEOA 1U9ZA 4I7HA 4S05A 3E6DA 4M74A 2D2WA 5J8CA 2L3DA 4IHSA 5HLGA 5E8GA 2FBIA 1EV7A 1J75A 2AXLA 1R58A 1S8NA 2GA1A 3RYPA 1A98A 3IL2A 1MKMA 1VSTA 1XDUA 5KAMA 4WXHA 1SD6A 4R8HA 3BY6A 2HGCA 2ESHA 3VOEA 5HS7A 2L02A 3DFGA 3E3VA 2HKOA 1LEAA 4OHCA 4E70A 2EFOA 1P4WA 2PRZA 3F6OA 1CGPA 1XGSA 4RHTA 4MEYF 4EV0A 5K5RA 1YFHA 5KAPA 3HVUA 3V7CA 5K5QA 4MQ9F 1A97A 2P5LC 1Z7UA 1REPC 1FSEA 3C7JA 1A3CA 5E20A 4XSZF 5HDKA 4TWBA 1QPMA 2E7XA 1FZPB 4KICA 1I6XA 1ONVA 1TC2A 4M0KA 2YPRA 1B9NA 4RABA 5BSKA 3DEUA 2CW0F 3ROUA 1ECCA 4RADA 4G94A 4R1HA 2P8TA 3CO7C 3MBIA 1WWXA 5LEKA 1XGOA 4HX4A 1RZ4A 5HS9A 5E1WA 4L5IA 3ZMTA 3DPTA 2ELHA 3DF8A 1H0MA 4Q47A 1ZLKA 1LQ1A 1U6GA 1QB7A 2ZO4A 3I71A 2HTJA 1TW3A 2JRTA 1ZN8A 1LB2A 3WTUC 1KQ8A 1Z91A 5D5XB 4UV8A 3ABUA 2RKHA 1A96A 4ZFNA 5DCFA 4PDKA 4MTDA 4RACA 3Q9SA 1WQ2A 5K51A 4KIGA 3ZMVA 3MZHA 4KN7X 1UPUA 3RKYA 2HWVA 1L0OC 3LQRA 3NAGA 2PQ8A 3IRRA 2C4KA 4LK1F 1KYWA 1TLHB 5DYMA 1MZBA 4CXFA 3D5LA 3N4MA 3HYIA 2L4MA 4HDVA 2C6YA 4BHCA 1AWCA 4OIOF 1UHWA 4ZZDA 2QWWA 5DUIA 3FXRA 4Z2YA 2K86A 1BD3A 1FLIA 1GPH1 5BQPA 4RS8A 5E1ZB 1DP7P 4U0VA 1SD7A 4BHPA 2H09A 2RQPA 1DQNA 4U7DA 3WTWC 4OMZA 1XTVA 3GWZA 5L3EA 2GZWA 2XKPA 1XGMA 2B0LA 1QZZA 4YFNF 3F72A 4G7ZF 4HBLA 4FYMA 2NAZA 5E8IA 4HZFA 3BDDA 3CUOA 2DT5A 3RI4A 3HUGA 1ZHFA 4LJZF 2VE9A 3O6BB 3IKTA 2LKPA 4QRIA 3HSEA 2K4BA 3QU6A 4KMFA 1HKQA 1QGPA 4ZYDA 4YFKF 1I5ZA 2BE5F 3C3WA 1IRFA 3GEPA 3F8MA 5EEHA 1Z6TA 4M9XA 4PCQA 1D8JA 1A04A 1KU2A 1DKRA 1J0RA 4MB6A 1QBJA 1U5TB 1IN4A 3FHZA 1R1UA 1GXPA 2JKZA 3FMSA 3EQLF 3COAC 3KP5A 1ZGAA 1YTYA 4IRGA 4KN4X 2DK5A 3FMRA 2PS1A 1HW1A 2HS5A 3ECHA 4LB5A 2ISZA 3TKYA 1IF1A 2IGBA 2VT2A 1JGSA 2HFHA 4AIJA 4L18B 3BPXA 5DV5A 4AIHA 4RB2C 3RKWA 1F5TA 1FY7A 1XTTA 1K7AA 1ZLJA 3JSPA 2CGPA 1BIAA 3RTRA 4KIFA 1BC7C 1W7PB 3GZ5A 3ISPA 5D5VB 1XSVA 2PMHA 5HDNA 4HX7A 3E5QA 1S29A 4OOIA 2IA0A 1RNLA 2BGCA 1OYYA 2GWRA 1R22A 2BBYA 1J7JA 1MGTA 2Y75A 4WN3A 3KP4A 4A5MA 1L3LA 2O8XA 4HV6A 2V1XA 3WTYC 1IN5A 4G6DA 4IJQA 3IHUA 3H83A 2EA4A 4RGUA 3WU1B 3GF2A 3WU0A 4G8XA 4YIIA 4MQVA 1GHCA 1VTNC 3VFZA 3CO6C 4LGWA 4A6EA 1RUNA 5D6EA 1YG2A 1I1SA 2UZKA 1IAWA 2V9VA 1A95A 4FX4A 2MA3A 3I59B 2M5WA 4X44A 1YO5C 1FBUA 2ISYA 1B9MA 3K1PA 1T38A 3TOBA 4WK8F 2EA2A 2DU9A 5AONA 1DDNA 2EHJA 1EH8A 3O7MA 3RIRA 5ERIA 2UXXA 1YYVA 5D6FA 2GQQA 1QCCA 2XHKA 3WTSC 4JITA 3ZMZA 4HLYA 1J2XA 2DLLA
chains in the Genus database with same CATH superfamily
2AKAB 1E61A 3BTJA 5FFFA 1W52X 4MEXF 2CJPA 3O9ZA 1XVIA 3WO1A 1TT7A 2C57A 4B4WA 1DCTA 5IJ9A 1G6OA 3QMVA 3OE5A 1EWVA 3GNTA 1AQNA 2G70A 3T7RA 2ZB4A 1Z33A 2G9NA 1T9KA 4MVJD 4DWWA 3C3KA 3H86A 3L8ZA 4I4IA 5I48A 3LBIA 1TEHA 4TLMB 1KAGA 4NZNA 3LL4A 1RIOH 2WE7A 2DSTA 2C94A 1A8HA 1BNCA 2ZREA 2IZOA 4KFSA 4ZDOA 1GTL1 2WJZB 3EVTA 2CE2X 3NANA 4KAFA 2B8EA 4BJ5A 3B70A 5J2UF 3FMQA 4FFNA 5LLTA 2F6CA 1Z13A 4KI0A 1BU8A 4IH1A 4MRRA 4F21A 2XWSA 2VXCA 4EPVA 2Z8XA 1EH7A 3X2EA 3T7DA 4IGFA 4RMIA 1YR9A 3FXLA 3OSFA 2VTBA 2JT1A 3VHQA 4HNAA 3H5RA 3AVUA 4IZZA 2OFWA 2GBIA 3IEXA 1G6KA 1IN6A 3OIFA 4KRGA 4MVJE 2ZRNA 2A2ZA 4IHVA 1U5TC 1XGKA 2XMBA 3HU3A 4GLJA 4FI3F 4R81A 4BMYA 2OCCH 4YCMA 3BHNA 1GYPA 5J59A 4PBRA 1RQNA 3HCBA 2DKFA 2X0NA 3SF8B 3WNBA 2G07A 2YCLA 2K02A 1R0CA 3ED5A 1EP1B 4Y17A 1LLDA 1X14A 4GMXA 5EA2A 3V4PB 3PJEA 1Q12A 1U1CA 4DYCA 1K2WA 3Q1LA 8OHMA 2XQVA 2C7GA 2QMQA 2VR1A 3ZV3A 5JWRA 3OT4A 4B33A 2QU8A 5HDQA 1JHOA 1IW7F 1Y4AE 3BERA 3O90A 4KC0A 1K7YA 3IKLA 3MQ2A 4NNOA 4WQMA 1P45A 5BV1A 1GFZA 4NOJA 3UXMA 4NJEA 3F49S 3OC0A 4MUXA 2GSWA 2DN0A 2A5YB 2EFNA 2QZ8A 2JASA 2R1VA 2VDRB 1ADCA 2VAVA 4H6PA 2XT6A 2HXIA 1K8ZB 4R2MA 4B6EA 4AJLA 1XJ0A 1KA9H 2VJQA 3K5PA 5DHPA 1NUTA 3MFYA 4LYFA 4OG2A 5BURA 3PL8A 2ZJ6A 5AJVB 4GOXA 2G1PA 1I2AA 1EEXB 2DHRA 3INNA 1E3WA 2VQSA 3K4HA 3FTCA 4H1UA 1NT2A 5KHOC 3PKZA 4QPOA 1H9AA 1KEVA 4OGFA 5IAOA 2H48A 2DETA 1C2TA 1IOZA 1L4MA 1H0SA 1LBEA 5D5PA 1DC6A 2IE8A 1TPZA 4IRMA 4R8MA 1DUXC 3DEKA 4O29A 5HKLA 3QEMA 2DJIA 5DHTA 3WRWA 4BOYA 4EUKA 4NQWA 1HXDA 2C2KA 5LYYA 2QJOA 5BMVA 2QLMA 5CEFA 5HEKA 4OU0A 4JC0A 2Z5FA 1QQ5A 2QN7A 4NEHB 1IY0A 1E7WA 1E5TA 5FOQA 3O6VA 4N65A 4QRDA 4XUEA 1KMHA 4YRDA 3NBKA 4DEXA 4UUVA 1S4QA 1RAGA 1ULYA 5CLSA 3F3MA 3ICCA 3PUXA 4QUDA 4FYWA 4U7FA 4HVCA 2BFBB 3WP1B 5BV2P 2HIGA 5L3VA 2X2OA 4LV6A 4NC8A 4FKBA 4I0AA 4K3VA 5JCXA 2NUAA 3DEJA 3G2OA 3TLBA 3UHFA 1USIA 1RT9A 1KAOA 3TZLA 4B79A 1ZU4A 3A1DA 1W93A 3JQFC 5HQ3A 3O2JA 2VJBA 2QJFA 5LZ2A 4OUDA 5EESA 4HLUC 4J2TA 3E58A 2ECPA 3OCWA 2AK3A 2XXBA 3DKRA 3K1AA 1J06A 1E89A 2Q9UA 4D96A 5CDUA 5LXTB 2JJYA 2VZLA 3B1ZA 4GX0A 1P7ZA 1ZA2A 5HW0A 3PIRA 6REQA 4MDYA 2YZNA 3PWKA 3NNSA 1II0A 5A62A 1XB4A 3UGTA 1MO2A 1T0IA 1JAHA 3ZQJA 1KO1A 2IEGA 2H51A 4LY6A 4A5NA 3MWMA 5GJVC 1PL7A 3NAZA 3RUPA 3ER9A 3V1LA 2AZXA 3ECOA 4GKVA 5BMZA 3ONDA 4TWIA 4EG4A 1EFDN 1M10A 1ZBDA 3B2EA 3E84A 3EIUA 2JGNA 3KXIA 5BUZA 3LZDA 1EGQA 3MYYA 1EESA 1OXMA 3QI2A 4PS1A 1SQFA 2P6MA 2WSYB 4NKRA 1XTAA 3BJOA 3M6XA 3BM5A 4Z9AA 5IBPA 3H36A 1Y7TA 1MFPA 1YIAA 3OZBA 1XTSA 2IH2A 1WBJB 3U81A 4FR5A 5CBPA 4DJEC 1WHUA 3AVWA 3DKWA 1B73A 4Y1FA 2BMWA 5F98A 4HXGA 4ND1A 4TWAA 5HIIA 1G7CA 1ETVA 3JASB 1QUEA 1QZXA 4NC6A 3FM5A 1LEBA 1YCGA 2JLRA 5ALIA 4FD2A 3RTGA 2NTEA 3WA6A 3KZXA 5KOHB 5HMLA 2IYQA 1MOQA 1PWXA 2FMIA 4RUKA 3W6UA 2NPIA 1Q7BA 3RASA 2IXDA 1B0ZA 2EJTA 1ZIXA 2GHRA 4JI5B 2CLKB 3WGTA 5CJ9A 3M6FA 2AXQA 4H3HB 1YKGA 3G9QA 1P6UA 2XTZA 5EWMA 4Z3OA 5J5VA 4CR7A 1O6CA 2QU7A 5IP7J 1F17A 2CNWD 3C4QA 2WLTA 3DUFA 3N39C 4MUAA 2PGDA 2XUZA 3I8XA 3QY9A 3D6MA 1PP8F 4YJDA 3DTNA 4OX9B 5L3CA 1K6OA 1JS1X 2WD7A 3Q15C 4WOPA 5E3OA 5FQNA 3HSKA 4TQUS 3RT9A 2R5ZA 1WIWA 4KBYA 1YL6A 2FP4B 2W37A 2VBIA 2AK2A 5GVSA 1E59A 3WTZA 1NU8A 3VO2A 1BCRB 1DRJA 4KR0A 2BWJA 2Q4RA 4YBRA 1Z68A 4AWXB 4AIKA 2HUNA 2E5WA 1PJ8A 1JHQA 4RHXA 4A23A 1KYQA 3U1DA 4I9GA 3W7BA 1KZHA 4WUVA 1JQJC 1UJNA 1WW2A 4WCFA 3BOSA 4BH9A 3NWJA 2IYYA 3PG5A 2NO1A 5FJJA 3U0BA 1H5QA 2FEZA 1VQNI 1NG1A 4O2LA 3VOBA 5IM4F 3T34A 3OG9A 1JNXX 1WU7A 5ADWA 2OTJI 3V7UA 5D3MB 4QUBA 4EJSA 4LMPA 2F3PA 1AKEA 1O94D 3U16A 4EHAA 2Q46A 3GJTA 3ET4A 3SSOA 4BVKA 4EATA 1R7JA 1U8YA 2D00A 3BHMA 3UV3A 2ERXA 3FWZA 4QG7A 1NW7A 3NP9A 3T9CA 2RBEA 2X6TA 4LFBB 2QE7A 4EY7A 1TBXA 4W97A 4N47A 5JMWA 3OQNA 3EIWA 1UH5A 4P83A 2UXCB 2VKTA 1C30B 2R7DA 1NQXA 2PZLA 4EJMA 4LK0F 3GLVA 5LC1A 1M0EA 4WD3A 4O33A 3RUAA 4YRAA 2QQ9A 4WDQA 2QMOA 2L7ZA 4FQ5A 4IILA 1NG7A 4U7GA 2Q7DA 3UW1A 3ZHVA 4KR7A 5K05A 1XMXA 2KDOA 1HC7A 1BI1A 1ULBA 2I2FA 3L7YA 4DDHA 3V5NA 4F5DA 1JZQA 3E9NA 3EYAA 4BZPA 1YL7A 5CVEA 5FXMA 1ZCFA 1GTJ1 2HL6A 2O7VA 2WTMA 2FQ3A 1DBIA 3KRTA 2PH3A 5ULLA 1RKXA 3RC7A 3WK8A 3H17A 1TNDA 2XF8A 1GDHA 1QIDA 5MHTA 1NPDA 2IUTA 3I72A 5KC8A 3O47A 1X9IA 2VBXA 1SKUA 3NG1A 3MKYB 1SM4A 2JGMA 4HUJA 4N4AA 4UNSA 1CDDA 1M2EA 8MHTA 2AFHB 1NHAA 4L75A 3TLGB 4YRSA 5KTNA 4JBHA 3ODGA 3RUIA 5MN5A 2E34A 1W6UA 3ROPA 1IRGA 1BEUB 2HO4A 4BRSA 3PR3A 3PYXA 1AKHA 3GFTA 4AF8A 1E2XA 2HDDA 2BZTA 1FS5A 2P30A 2RG7A 3GYHX 4JY7A 1H85A 2GTHA 1MB0A 2GZ2A 3H5IA 1PDNC 4GC9A 4EW3A 4QDKA 1X87A 1YW7A 3WQRA 2H16A 3OZVA 3VC2A 1I4EB 1Q19A 4K9KA 3CX4A 3N5CA 4EDHA 1T1EA 4EKGA 4P0PB 5AVTA 1Z0AA 1NJSA 1O0SA 1CUHA 1FY2A 1R37A 1U7WA 1VRCA 4G12A 2CJXA 2CLHB 1X9HA 2Z95A 1W36D 1U78A 3IMCA 2JA6J 1YV9A 2HU5A 3FZEA 4IFTA 3EB9A 4I3GA 2GAOA 2I2CA 4HDMB 4XJVA 3TD6A 3W9YA 4ZWNA 3G2LA 4FASD 2BF4A 4JEHA 5TQ2B 3GVCA 2ZUTA 2DW4A 1BFKA 3QKRA 4ZN6A 1Z05A 3W6OA 1WZCA 2B3TA 4C2UA 3KQOA 3L07A 3QFFA 4GYWA 5IJXA 3S8MA 3S0JA 5A4AA 1G7TA 1E7MA 3ZJ4A 5JWOA 5CPBA 3P7NA 4WADA 3AM4A 3BGIA 1E3HA 4HGQA 5K0FA 3ER8A 2WF5A 1XLTC 3OJ0A 1BHSA 3OZIA 4O2AF 5DJ5A 1MB9A 2ATXA 2VTKA 4GI7A 1K5PA 4CT5A 1NQTA 4WLFA 1FOKA 1V9CA 2P6NA 3PUKA 2WJ4A 3UAVA 5JD6A 2WTBA 4ZYUA 3O4VA 5C7LO 2C4NA 2B9SA 2CDAA 1XC5A 2DPLA 3ZWCA 2ECCA 5B55A 1TU4A 4B3CA 2KE5A 3AL0B 1XCLA 3VVBA 4DABA 2YUIA 4GP6A 1H8ED 2QEXI 4EM0B 1JXAA 2X8BA 3NBZC 3Q2OA 3TSAA 1PTKA 1Q91A 4H59A 3VPDA 2O3RA 4N5NA 2O05A 4B6RA 2AOUB 1N1GA 1W5FA 1WDKA 1OROA 2G08A 1ITYA 2HUPA 2H7YA 3EVDA 4IUBS 2QPTA 3G71I 3HIFA 2OAGA 1ZK8A 3HOYJ 1ORWA 1W2WB 2A0FA 1OAAA 1MEJA 4Y6GB 1E2IA 4BNHA 3EBPA 3OQHA 2H4JA 4D5FA 1ULUA 3UMRA 4BNIA 3VV2A 2QLNA 2VBWA 3BCAA 1XMAA 3CYFA 3DLTA 5FKNA 3G7NA 3IDOA 2DPXA 3KQYA 3LCUA 1QE5A 3GUYA 5D8LB 2FW6A 4OQMA 2FZVA 4I01A 1ODSA 2E1CA 1U5CA 1MF7A 1XD8A 2ZYSA 2NVUB 1KH2A 3NW9A 3K70B 5KYKA 4JI6B 2FBHA 4GD3Q 3RHSA 5BPIA 3CLQA 1GUBA 1UBFA 4Z54A 1LF5A 5JO9A 3I5UA 4ZI7B 4GBGA 2QZ4A 4BKOA 3TECE 4Y2RA 2VUUA 2IWHA 2FMYA 1NAHA 3B73A 2FWIA 4I7EA 2P2LA 3N8KA 1ZMOA 3HVKA 3RT7A 5KJ1A 3OA2A 4KLCA 3KEQA 4CLEA 1ZP6A 4ZYEA 4HNVA 4MUKA 5DP2A 2H92A 3LMKA 4P55A 4GX1A 5FHRA 5ILGA 3TLJA 2IPAB 1V25A 4W4TA 1T9CA 4BCDA 3PNVA 3RV4A 5JXWA 1XPOA 5DD8A 3GHYA 1ZRCA 2O7RA 3AIMA 1NJFA 4Q34A 4GI2A 2XCRB 2PRJA 2ZK7A 4Y9RA 1QG4A 1GPKA 3EJ6A 3MMNA 4OQZA 3OOSA 2Q8PA 3REQB 2LF7A 5K8UA 5F7JA 1LKXA 4PZLA 5C8YA 3AOGA 1X3ZB 3OEHA 3NLLA 5TGDA 3AR6A 2LY2A 1Y89A 1V41E 1UPBA 2VJDA 1EHCA 1P0IA 4B31A 4EPWA 2FWJA 3JCUC 2PXAA 3PNBA 5TMBA 4PCUA 3MB8A 3MJDA 2R5YA 2PA3A 3FDXA 1SEUA 1AN0A 3L79A 2ZMEC 3DU5A 1BE1A 3KSAC 3JQBC 2QTFA 4LAFA 3BE6A 1U8XX 4UHTA 5B4UA 3F5SA 4IIXA 3WLQA 1REQA 2FOIA 1P7PA 1XTKA 2QIPA 1K7EB 3JQ9C 4IWNA 4X1OA 3HP4A 4KIJA 2X4IA 3CW9A 5BN4B 5L3QA 1SKBA 3ITKA 1K75A 3FPCA 4KRYA 4A03A 1CBUA 2ZSEA 2QY6A 5I7FA 2GNPA 1X77A 2DWPA 2PU7A 3AJEA 1L4BA 2MC4A 5HVQC 4EHNA 1ON1A 2N8GA 1GT0C 3AYZB 4XJSA 1ZRSA 4DGWB 4EJ6A 1W25A 4UTRA 1QYRA 5CB6A 2HFKA 1VG1A 4K0KB 1R9NA 2H2WA 1KC1A 1NBIA 1K78A 4LG0B 1R5OA 3ZLTA 3L8MA 3W1WA 1GZ7A 5FEMA 4BRWA 1JQKA 3FTFA 1M1YA 1OLXB 2JC3A 3CKMA 5JXIA 1PYGA 3LU1A 4MMZB 4RVSA 1ZS9A 5I9LA 2GEBA 2HR1A 3OS0A 1PQYA 3NTRA 3QBVA 1DARA 4UBKA 3V9AA 5KTOA 2FTKE 2G71A 3ZXYA 4U7TB 2IHKA 3CHYA 4UNIA 1M0TA 1S2LA 3C85A 1XJQA 2AZTA 2EHDA 1KEEA 2VPXA 1CF2O 3FUTA 1LSJA 3SX4A 1FC3A 1PJSA 3EC2A 4H4EA 4JEMA 3EVEA 5FTNA 4F1WA 4B6PA 5AJZA 4M87A 5A1JA 4BQFA 4EIWA 4RVNA 1GU0A 4AJNA 3BFPA 1DKNA 2X4LA 2PKYX 1GUZA 5CB8A 4OREX 3VR4D 3JR3A 1KQOA 1RLTA 2VUHB 5DCUA 5HVNA 4LC0A 2KX7A 1SPXA 4FYJA 2DYSH 2I9KA 3ICOA 4V2UA 4U39A 2GESA 4B2LA 3GFLA 2O6HA 1PX0A 3F8BA 3HGYA 2ZSJA 3MTQA 2VJNA 4G6TB 3ZHYA 2FRDC 4DOZA 2GI4A 3B3JA 2IVZA 5E7QA 2Y31A 1DWUA 2A0UA 3A6LA 3LO8A 1UHSA 4IDHA 4AN4A 4KVZA 4EKYA 5B5SA 1XMQB 2NSLA 1WJFA 2BJHA 4QG3A 2MJLA 5JMOA 1NLUA 3GEEA 5KQMA 4TTRA 3PGKA 3PGMA 4DN6A 4X7BA 2Q49A 3TFQA 2G5TA 1N2EA 1WVIA 3KSZO 1WI9A 4C9YA 1XS9A 1RJEA 2FW1A 2YUTA 3QMWA 4TTTS 1KDZA 2IV3A 1B1BA 3TLKA 3UGKA 2GSDA 3ZXUB 1B72B 4UVCA 1QFJA 1R8SA 4I66A 1KYVA 2FX0A 4URFA 3SS9X 2X2PA 5T4BA 2HSWA 1FRFS 2UZ1A 5TR9A 3HDDA 1TEZA 1U8AA 3S2WA 3D3QA 4EK9A 1VPTA 1RRGA 2NZXA 5CG2A 3AINA 5TMPA 4W5NA 4EI7A 4A0SA 4DV6B 3LMMA 3MJFA 4AZ0B 2ZVJA 2ASVA 5J1SB 3RDPA 5DMXA 5I9SA 4A27A 2NNNA 2LKXA 2QUHA 2CD7A 2GBCA 3RPUD 1T43A 1EDEA 1XP5A 3KU4A 5J47A 5DHSA 4J6FA 3WLTA 5IJ9B 1M34A 3H1GA 4MEBA 4PEVA 3I12A 2H1IA 2XA2A 2Q5HA 3VHRA 1R6XA 3AB8A 1VBNA 3NGXA 3P27A 4EF4A 5AW3A 5KB3A 1RYYA 1ZJJA 1RYMA 1HZJA 1HXHA 2VN2A 3C4VA 4J4BA 3T3NA 3SFIA 1M6YA 2QAGC 4P31A 3RJ9A 2G25A 1IWBB 3F1KA 3BULA 5JEEA 4DB2A 3BR5A 1XTZA 4RH0A 2HTFA 5DCMA 4NJOA 4GPBA 3QP9A 3C6QA 1NX9A 3VEPA 2OHVA 2YY7A 4US2R 2CJYA 2PMDA 4KLAA 1NVAA 3I2HA 3RGWS 3FF1A 4A0XA 4I46A 1M1NB 4I5IA 5EVCA 4AZVA 1KJZA 4FOSA 5LHHA 4XQGA 1F6WA 3ZN2A 1XQYA 1O1YA 5B5EC 4AJHA 5HUHA 2YZGA 3DTYA 4CUKA 4LY3A 5LDDC 1C1XA 1LY1A 2C2BA 3JRGA 3DDUA 4CMEA 3U4QB 2Z3WA 4KXFB 3RVRA 1VJ0A 7AT1A 1OU0A 1QHNA 1H88C 1RFGE 3LQ1A 4KVAA 3UJPA 4BJHB 4D4IA 1FYXA 1XMVA 3SZTA 1MEEA 3W6KB 1DP3A 2R6DA 2XYHA 3J7AO 1NULA 3CGWA 3G6KA 4CIBA 4BB6A 2AI3A 2L01A 1T9HA 2B21A 2J5BA 1U0FA 4QICA 4RFSA 3KQKA 3HLTA 4KDCA 4PC1A 1RAHA 5LRSA 4HAVA 2CHUA 1D8KA 1U6IA 2R7UA 4K86A 1ZJ5A 4PGMA 5E4JA 5KDLA 1DQYA 3AZOA 4Y2GA 4XOTA 5GGXA 1P74A 2MH2A 4M3DA 5FO5A 3F90A 4LA4A 3BTVA 4M7RA 4PC6A 3RU3A 4MKZA 2IH4A 3DOIA 2MC3A 2R6HA 1F12A 1DIOB 1YFKA 2BFCB 3SYNA 1RIFA 5L3BA 1EWRA 2W2TA 4KITB 3LKDA 1M83A 3PI6A 5JT1A 4XONA 1MA3A 2V3VA 3WQBA 4C0KA 4AJ2A 3OCJA 4UAUA 5BMVB 4AUMA 1SUWA 1G20A 2ZTHA 3K9GA 4DMFA 5K0LA 2ZYWX 1KI7A 3BMOA 3HU5A 1WQ1R 3ROFA 1BGVA 2OBLA 2ENWA 1MA0A 1A6IA 1YA4A 4NU8X 5C7YA 621PA 3GLIE 2JLXA 1KHTA 1SH7A 2AOXA 1E8NA 2EOAA 2IXAA 2I4MA 2EJCA 2CFOA 2P3LA 3COPA 3GF4A 3A1NA 3NHWA 1E1MA 2DQSA 2C58A 1Z6RA 1S3IA 5ITZA 2F4VB 4BE0A 4GICA 1AC5A 5KHDA 3CXRA 1IZ8A 1AF7A 3VNAA 2J5RA 2VWHA 1WSUA 1G2QA 3IXMA 1NYQA 4ZGGA 2VDKB 5LVAA 1G8SA 1NG9A 1GADO 4U0YA 1LTHR 3W5JA 4HVAA 4F1JA 1HCRA 1F8FA 2OHJA 4JBLA 4B3FX 4OPMA 3IEPA 3IVGA 3KE8A 1YQUA 3E6AA 5LOVF 2KRHA 1IOVA 2OENG 2CU7A 3ODPA 4WV3A 4JJ6A 3GBVA 4LBYA 4RANA 5BUSA 1WMDA 3S3MA 3JAMA 3MKWB 3BR3A 1T1SA 2VS1A 3K9CA 3N2KA 3NEAA 1DBQA 2AJ8A 2CL0X 2KJBA 2PUJA 3KTOA 4GFDA 4MO7A 2C4VA 2W1OA 1IY8A 4PLZA 5B1IA 3RBXA 4LHZA 1XL1A 2LIPA 3CCLI 2NXCA 2VTVA 2BKXA 2GPTA 3KQMA 3ONNA 5DDIP 7REQA 5I7OA 1M74A 1CUDA 3C74A 1SRQA 4GDMA 4CLOB 1TPYA 3SJCA 4CV0A 3Q8MA 1CUYA 2RAUA 1NMEA 2BHTA 4V0RA 3DWEX 3ZIAA 5B2ZA 3PFNA 3W2GA 4LFAB 1B0AA 1Z07A 4M76B 5K5EA 3IH2A 4BLVA 3KDAA 2IVMA 3I59A 1RXUA 2L18A 5CHEA 2BXYA 3RJTA 1FQJA 3O94A 2B5VA 5A9SA 3L1UA 2WWYA 3QFTA 4HWOA 1GLVA 3M1LA 1KI6A 2OHIA 3OLZA 4FGSA 1OPCA 3LUBA 4A0QA 4CETA 4G0WA 2KJCA 3URKA 1K92A 1R6TA 2WIGA 2H6BA 3KUKA 4YN3A 3WRYA 4BNGA 1FXUA 4MNTA 1B76A 1J56A 5TDHA 1M1ZA 1S6LA 1P3DA 3IMFA 1F7VA 4EJVA 4B3TB 3QLEA 2GK4A 2H6EA 4I1RA 4MI1A 3I05A 4G1UC 4XICA 5ANRB 3W1EA 2YY6A 3FMFA 1JAYA 1M2KA 3LWZA 3WXMA 4II3A 1KSFX 1BZYA 1NRIA 4W99A 3RODA 4G4GA 2VC1A 4PLWA 1BVYF 1F51E 2CK3D 2R5ZB 1JHDA 2W7TA 1CNEA 2CYCA 4A3MJ 3O8QB 5T6MA 2XUKA 3E7LA 1SPBS 1ZMBA 1K8XB 1PRYA 3NTXA 1PS9A 4AD8A 2F3TA 4R0VA 3X2FA 1PT5A 1LE8B 1ZJYA 3D6NB 4IIJB 2BSQA 1IK6A 4ZU1X 3K6SA 5ERYA 5JPDA 1LZLA 1C9YA 5IT9Z 1RPWA 1M6EX 2WKRA 4GX5A 3CE9A 4HQMA 3RPQA 1RUOA 2PG3A 2R8ZA 4WY8A 3IA2A 3JALB 1GA4A 1CUVA 3DEAA 2M98A 3R75A 4A2PA 1NE2A 3UMVA 2C7BA 4PPGA 3IQEA 3C48A 4U3JA 5FPPA 2IS1A 1GILA 1VYHA 3TVDA 1FNBA 4PZUA 3CQZJ 3USCS 2W8ZA 4AIDA 1YQXA 5LPNA 4WXPA 1JIIA 4NABA 3K4QA 3QIAA 4ZP1A 3VU3A 1JSXA 4LHYA 2RGRA 1G4HA 4LLGF 4NHJA 1ACLA 4RQBA 3PPVA 2RGWA 3BQMB 3EMDA 4G2TA 4D4MA 2W6ZA 2WNHA 1TQ4A 5E6UB 5CDYA 2XF2A 2IJGX 5HP4A 3I3LA 4DCSA 1N4AA 1X8JA 1NI4B 4B45A 1WHSB 3NXSA 1L7AA 1O2DA 4U5XA 1QE3A 2HRRA 2GD6A 3AB7A 1N5JA 2DO7A 2H4XA 4UEJA 2I7XA 1SR8A 4RNDB 5KIAA 4HWKA 3K53A 2VHJA 2HNKA 2Z5GA 3B7PA 3PSFA 5I9TA 3GMEA 1X15A 4EA9A 1LD3A 3FR8A 4FYHA 3QPHA 3I34X 4LUCA 2Q1SA 2UXDB 4HSTA 1E4YA 1E2MA 5EQFA 1HETA 4YRNA 2I54A 5U4QA 3GV0A 3SQXA 1P2DA 2B1JA 2YV5A 3EVZA 4GUAA 3SR4A 1PJQA 2QRPA 3FJOA 2QI9C 3QEJA 1T5OA 2N46A 3KT0A 4WGGA 3V7NA 2P5SA 1XRMA 3MS7A 4OBBA 2EIHA 2JL1A 2ODQA 1EB8A 4G36A 4UVGA 3RF7A 1CY8A 4Z51A 3RU9A 5A5FA 2TMKA 1BR4A 3K10A 4MJ7A 4QDUA 4ZEVA 2W2MA 1QH8B 2X0EA 1FSHA 2QVXX 4TTIA 3IVAA 3FSRA 1RXYA 4CLRA 5JR3A 3R9WA 4IG9A 4HJXA 1N4DA 1IHXA 4Y52J 4HA8A 4N0EA 2FNAA 4JYMA 3TP3A 2HLDA 4B1FA 2RB4A 1YE9A 1DPFA 3K9QO 1H9GA 4ZQEA 1BJRE 3GFRA 2R7NA 3K9FC 2GJKA 1FLNA 3VX3A 2WJ3A 4EJUA 1JXSA 1CUAA 1ZI6A 1GZ5A 2B94A 3M1CA 4K1LA 2DBRA 1EXDA 3A6HA 4RFLA 3PTLA 1HBXG 1ECBA 1PFWA 3EA4A 3GJSA 3P0JA 3WGHA 1D4AA 4FW8A 3WZ2A 1U7UA 4XZ3A 1M6VB 2HMWA 2IEIA 2VKQA 3TIXB 3MM4A 2PJRA 3AIIA 3LXRA 3VPCA 4JBYA 4MLZA 4IV8A 3DR5A 2GIZA 1P3JA 1E1QA 3Q85A 1KFCB 4H2DA 2WJAA 1ABFA 1PWYE 3R20A 2HEOA 3AH8A 3AEKA 3JZMA 1EUZA 4YX9A 3WWEA 5KREA 2YRFA 2YVQA 3JVDA 3CH4B 4DYVA 3DZKA 3TS1A 4F92B 3WGJA 4LNAA 5FTKA 3QVGA 2NU9B 2JLZA 4N41A 4RORA 2ZXJA 3CLOA 1GDDA 1SD5A 3B6AA 1KI1A 4JJEA 4BN0A 3ZGYA 2BEWA 2MIIA 2Z99A 2YQ4A 1ZWLA 3TQOA 4ARVA 1WGXA 2KYRA 1FUKA 2X8WA 4E5MA 1KS9A 2QAIA 1R3DA 1LJUA 1UC8A 1XK6A 1VI0A 3KOOA 4MW9A 2C8LA 3JQ6A 1PD0A 3TDUC 1Y48E 4QLAA 3WIEA 2HADA 1H22A 4ENWA 1QE0A 2BFMA 2H4FA 2G88A 2EFEB 3GDFA 4HZUA 5EFZA 5JS2A 1YHQI 4HR7A 4KK4A 3RS3A 1XVTA 5EHIA 1QQIA 5B1HA 1E3TA 3IULA 2C95A 1RRKA 3G5UA 4QEZA 4YALA 4ZQCB 5SZJA 4KQCA 1DMSA 1AXRA 4R2WA 1KNQA 3SC6A 1ZESA 4UAJA 1PDVA 2BFOA 1TXGA 2QZSA 1W46A 3DP9A 5FORA 4A10A 5AH0A 4CODB 4WOJA 1Y34E 1S3JA 4GMDA 4JXJA 1L5MA 3OICA 4JI4B 5HLIA 1A9RA 4J43A 1VFCA 4FDMA 3PFGA 2YMLA 2A05A 1UBHS 1GUFA 1X39A 2A69F 4OQ4A 5IW8A 1IWPB 1GGEA 1KPHA 3RQ4A 1Y98A 4M0PA 4F97A 4YMHA 4BNWA 5JCOA 4DTIA 5SZIA 1IL0A 4EUEA 1U9CA 5HFAA 4P9FA 1ZY2A 3K4PA 3H3ZA 3GTQJ 3P9QA 4FFBA 2XUAA 4BFCA 4D4KA 3QWFA 4Q3BA 4XUGB 5B6PA 2Q3CA 2VK4A 2IHVA 5SZHB 1GCAA 3KU1A 3B6MA 3K9NA 3DZFA 4R2LA 1NMXA 2JF0A 2PSJA 4ZI7A 3BX1A 2W4SA 1GD1O 2ZRIA 3IVCA 4IBOA 4HADA 1NY5A 2XW6A 4REOA 1ZG1A 4P5DA 2XD4A 3N2LA 3DOCA 4V02A 1TAUA 1WNTA 5F3RA 3HDVA 3OIUA 4XR6A 2ZIXB 3WICA 5K99A 4ZOLB 5DNCA 1E6WA 4LYGA 1P44A 5C53B 2DLDA 4D80A 1FSZA 4XJXA 1EFCA 5K0CA 5J2UA 5E17F 1K4KA 3QOYA 2BKAA 4ZVQA 4C5AA 3NMUF 5ALJA 4DVGA 5FOXA 4IXMA 2A58A 2K85A 3T8RA 2EC5A 2R7SA 2WUEA 5HBGA 2YL2A 4CIXA 3JATB 2LTPA 1D2AA 3JRXA 1IZYA 1F1BA 3LOUA 3NGLA 5CYOA 6YASA 3T0IA 1T5DX 4EYOA 3GJZA 2D5AA 3BWCA 2VWPA 2WC1A 1QRAA 3HOUJ 2F17A 3EW9A 1EK0A 3IEIA 4E5KA 3OZFA 2QRJA 2J9RA 4KSBA 4EHFA 1K83J 1CQXA 1GGFA 4US0R 1RM0A 4UW9A 4QFMA 1VQKI 3OY2A 4CEHB 1R5ID 1GNSA 3ZY5A 1U1EA 3NOOA 4IIUA 4ZHQF 3LBNA 2BW3B 4O1IA 1MBKA 3O21A 2UWMA 2ZQYA 3G79A 4FT4A 2FW0A 3A4LA 1XWIA 4R9SA 1ABEA 2VYFA 5JS7A 1Z6QA 3PSAA 4X60A 5TARA 3WIVA 2LP4Y 3TG2A 5IT9A 2QTCA 1V37A 2PFGA 1V4VA 2H06A 1R2QA 3EZNA 3L7MA 3UG6A 2QM7A 3OMWA 4YCBA 4BPRA 4Q1CA 1D2CA 2DT6A 1CZKA 1I3OA 3A36A 4S35A 4MUEA 1A7JA 4F4UA 4L5JA 5C81A 2X9GA 2RGVA 1E0SA 4U00A 2VEDA 2RGUA 1C7IA 2JCGA 4LTMA 2IEDA 4X65B 2GF0A 4CDRA 1KZGB 1NQAO 2EEZA 4TWZA 2KP6A 3TBKA 4Y13A 4KXUA 4FEEA 4B81A 1VIAA 3GZ4A 1RJFA 1LUAA 3U17A 2WFZA 3BQNB 3K4JA 1CDOA 1ADJA 2FPLA 4QQFA 1BQEA 5AK4A 5BORA 5L7TA 1N33B 2GVZC 4X1KA 3VBEA 3H1FA 4F6RB 1Z2CA 2OB1A 2WINI 3A4IA 2QTLA 5GY7A 2HNAA 4KQHA 4BMSA 2I3BA 3ZU2A 1KL7A 2QUZA 1L2TA 2XB6A 3NHAA 5FKJA 2W82A 1W5SA 4AMZA 1WB4A 2VP5A 4IXWA 3JSXA 4YGYA 5K09A 5KSOA 3ZWPA 3R3UA 2ZRFA 3TL6A 5HZKA 2ZI9A 1QKIA 3LFKA 2CS3A 2JFOA 2Y1KA 3WDMA 5IVHA 3U4MA 4NFHA 3CZ6A 2HY7A 1YIJI 2UZIR 3PI7A 2FG6C 2D1TA 2QT9A 2RHWA 4OQNA 1DQZA 1QPIA 3B1WA 4D3SA 1KY5A 2YZKA 4IHJB 4W1UA 4O5OA 1GUUA 2VQLA 2X4HA 3OF3A 3ZIAD 4HAZA 3PXXA 2SKCA 1WJGA 4J19A 1LFDB 1IXCA 3S17J 1BMFD 1CDZA 1S96A 3ITNA 4M0UA 2C54A 2O5VA 3PE4A 4D43A 3ZRGA 1ZM2A 3KEGA 5DISB 5C4IA 2HYJA 5CYVA 1Z7YA 2QHXA 3AMVA 4P5EA 3DTVD 3S5UA 5JH7B 3U7HB 1ZCBA 3OD5A 3LA2A 4BJ3A 4PGHA 5EKXA 1BRMA 5K0SA 2BOVA 5TQJA 2E87A 4BCBA 5K0TA 4G9YA 5AOAA 2ZZNA 1W7PA 2HDWA 4NCNA 2J0UA 3EXFA 3G2IA 2Q6VA 1BEZA 1FLVA 4C4PA 3C24A 3LQFA 2PS0A 2RGAA 2Z8YM 3IMEA 4GKBA 2ZBQA 5TXGA 5DVZA 2AG6A 1A27A 1DUSA 1ENOA 1DRUA 1ZRNA 2J09A 1ETHA 4OP3A 4YYZA 4RTQA 3X1JA 4LF5B 3A4VA 1DG9A 3GLHA 2B30A 3PWTA 2Y0BA 1ZEJA 1RJWA 3G1OA 2XMPA 2ZT7A 3CLSD 2EIMH 2D1RA 3A7EA 3ZEIA 2W00A 2BEUB 2RHDA 4QYIB 3DE6X 3B1KA 2ZXEA 4DF3A 1Y8QB 1ZK1A 2Z4RA 3ESZA 4MW5A 4CE6A 2WADA 1QANA 4IUYA 3DWGA 4XASA 1H3EA 4KSCA 4JJZA 4XQEA 5DM2A 5BNZA 1LF0A 3TGNA 3ESYA 4DM7A 1M7GA 4ND5A 1L7RA 4M1MA 4ZYAA 1CJUC 2WG1A 3H8SA 1WW3A 4JCCA 2XKJE 4Q93A 1WCXA 1P7IA 4N8DA 2DH6A 5BR4A 4HAMA 4MTEA 3HRTA 1M2HA 1Y9DA 2CCJA 3H5OA 1V35A 1U4OA 2OFXA 2OOSA 3U3MA 3ZVNA 1OH5A 1U6JA 4C2BA 4EYKA 2B1QA 2PX5A 5FPHA 5HX7A 2XWPA 4TZTA 4H16A 3U7QB 2WOJA 3GFQA 1Y0BA 1ACMA 4C7BA 1R0ZA 3AHEA 4GWLA 1XZNA 5IZ4A 1ZOLA 5A2QZ 1KZ1A 1MRNA 1R66A 2R5WA 2CNBA 1NDQA 2JFQA 1YE3A 1P29A 3EYWA 3FYSA 3PHJA 1CVRA 2BLLA 3SXPA 1MHPA 3E6MA 1GZHB 3BGVA 3A1SA 2GHIA 3NIWA 1PS8A 4I9FA 1JN0A 4JAVC 4LSWA 4Q1FA 1L5OA 1XD9A 5EJEA 3GLGA 3CA8A 2J85A 3ANYB 3AXTA 3WYGA 2QPOA 2GBLC 4TWJA 1H6BA 5HJ7A 3B48A 3U9LA 3D5RC 4HDCA 3EDQA 3WOVA 4NCIA 3MUEA 3QU2A 4NLLA 4RHEA 4AZTA 5KWIA 2F9FA 1GKUB 3H2IA 4QDZA 2FD5A 5LNK6 1MZPA 4JB2A 3BEDA 4BCCA 4C21A 1TUBB 1SB8A 4GM1A 1E2QA 2QVOA 3PEEA 5KSPA 2QRVA 2VLAA 3TAHA 2EVWX 1XZDA 1CEXA 2NVUA 2F2EA 2IS2A 1PNQA 1V1RA 2I9PA 2O8VA 2XNKA 3M7GA 1CNFA 4PJ0C 4GVXA 4HXFB 1N6HA 4TSRA 2HJGA 4U2BA 3ULKA 3W4IA 3JRNA 1J99A 4IFBA 4HAUA 3EUFA 1MJNA 4KBFA 2Q9CA 2ZANA 2HVRA 1BROA 4GZ5A 3PEYA 3O3CA 1GLGA 2YHSA 3SDBA 3CE6A 4B1RA 3QYPA 5KJ6A 1WZIA 1SRRA 1C29B 1L5RA 2WDZA 2HPHA 2W2LA 3KQVA 1VZ2A 5CM2Z 1JHRA 1NI3A 5EZHA 4EQ6B 3P26A 2R4QA 3NDPA 1YQAA 2MSEB 2SICE 1CF7A 1FTSA 1M2NA 3EC7A 5CT6A 3K9LA 2I6QA 3TK1A 3ZW8A 5EG0A 3THSA 4CMKA 1TYBE 3EVBA 4OXQA 4JWKA 1H2BA 2W24A 1RR6A 2CLEB 4IV5A 4LJYA 4YDSA 4DV1B 2DBYA 3CKLA 1LFBA 2AXNA 3MGGA 4K8RB 1ETKA 3DE2X 5HIMA 4DLKA 3FRIA 5A02A 1RWKA 2BFWA 3GROA 1OFTA 5D5UB 4NC9A 2EQBA 4HZGA 3KO8A 3CMMA 1DXYA 1EFUA 3DMDA 5CT5A 2E6UX 5K3CA 3EWIA 4MYCA 5EMHA 1Z9CA 1G0NA 1Z88A 4CMEC 3ABIA 1C5KA 5JZMA 4JROA 1EP3B 3KUCA 4BQSA 4KGZA 1Z73A 1JH9A 3K2BA 2O7OA 1P9WA 4M1WA 5FLYA 3BIJA 2ZM5A 4HUQB 4RD1A 2Y76A 1LVAA 1PQWA 5BS6A 2A6TA 1F60A 4ARAA 3KVNA 1FUUA 5BN4A 2VPPA 2WJIA 4O4IA 1G5HA 1U6KA 2J7PD 3IBGA 2XYVA 4Z7NB 3OKAA 5JADA 1USUA 3AVQA 3HFGA 4K6GA 3GRUA 3IUPA 4FXOA 2BEVB 3CF4G 2VXBA 3KV3O 4EKEA 1FFYA 2QQ5A 1YGYA 1KE2A 1JHHA 5B30A 3ISVA 1J8QA 3TDNA 4B71A 1QORA 3PZRA 4ZAZA 4CEIB 5LZ7A 3RM3A 1ZD1A 1WOYA 1O9HA 1TKCA 3EOAI 4WK2B 5CT4A 5HDGA 2LXNA 4QXQA 4R68A 1JYSA 1RJ9A 2GWHA 3O1LA 3GGGA 3OJWA 4FISA 4IICA 5D3QA 5FTLA 4ZO4A 4UHDA 2R9VA 4I02A 1YX5A 4MYHA 3KD3A 4JNKA 4TLLB 1BJKA 4AO8A 3FMGA 2W9XA 1L3IA 1DEAA 4KWIA 2QLLA 4L9SA 3V6MA 4UUSB 2ICWG 4YUVA 4IQGA 2PUBA 5DM6F 1H05A 2QA5A 1N0HA 4YMLA 2F59A 1N57A 4LCJA 1TDJA 4HNTA 1ZK3A 3DXYA 4N9WA 2BGRA 1BVRA 1ISGA 2VBFA 3EQZA 2IY9A 2CMDA 3Q3JB 4UHBA 2LFBA 1P4RA 2XHZA 1DU4A 5EF6A 2DY0A 4R98A 4K6CA 3DLAA 2AJLI 1M8GA 2W2NA 2JHCA 1XCBA 1CRWG 4PGGA 1HE4A 1P7VA 2BKUA 1LZKA 1FFWA 3DBLA 1D1CA 5F5LA 3QX9A 4UY8I 1PL8A 1SU4A 3J7ZI 1EFRA 1D2EA 1E6MA 1XVUA 1RYFA 1IJFA 4NYIQ 1OLOA 4AL4A 6GPBA 1J09A 1RKWA 2GK6A 4IDGA 1DJQA 2FF7A 3QBEA 4ZOAA 5AR1A 4Z4EA 5CNJA 4LV5B 4B3SB 4RWEA 4ZKDA 4OGGA 3BAZA 3P7MA 3FZNA 3KFVA 1SANA 5B3JC 2IHYA 4MDEA 2BGKA 1L4LA 2VYCA 3D3EA 4MQFA 1AS3A 4QYTA 1EFPB 1ZD8A 4FFPA 1W94A 5ESXA 1RPJA 2ZR7A 4C6TA 4BZWA 2VJ5A 2HU7A 4XA8A 5KINB 2R8BA 4TKVB 3KNZA 3GFPA 2Q5QA 1P6RA 1H6CA 2UAGA 1T9DA 4HDNB 4L2IA 1OR7A 2OZ6A 4TYMA 4MHOA 4OD0A 1P5FA 1YB6A 2NO9A 3LSMA 2A5LA 1W36B 2M0CA 2Y1DA 2JS7A 4G1EB 4UUMA 4BIMA 4QUJA 2VF5X 1ZTRA 1DGRM 5K7FA 2NPOA 2QN3A 3G89A 3QX7A 3W8DA 4N6OA 3KZZA 1VQ7I 3NTVA 2FSVC 3FXKA 4OB7A 2C84A 4MWCA 3UJHA 4TZ6A 2ECQA 3FJYA 2DBQA 4M7WA 2J87A 2YYSA 3ZZ1A 1PVDA 3U61B 5HM6A 3DTKA 1WKBA 1CJBA 2CVHA 3BT9A 1BXGA 3FDIA 1SOWA 3NFYA 3G4SI 1USKA 2Y0SN 2WTEA 1T1JA 4PPQA 4S12A 4EUNA 1R36A 2A88A 2FJPA 2XMQA 2GN6A 5KBYA 1E4EB 2R8EA 4P98A 3MMXA 3E03A 4XDZA 4BLRA 2QL5A 3UIEA 4B6FA 1E1QD 2DQLA 1O3RA 1Q3TA 1W0KD 2FB9A 4U4AA 3UCFA 4PG8A 1LC0A 3MWFA 3LA7A 2YIDA 2GYYA 3FXJA 1YKSA 3LECA 1K6XA 4HDAA 2MGQA 5CJPA 4XM0A 3FE2A 4W9NA 1O95C 2BVMA 2EW1A 4S2EA 3IV5A 3NHRA 4PYNA 4ZEOA 3RNOA 1RPAA 1MJBA 1XGNA 4FN4A 2R1ZA 4N5MA 3I1FA 4CZ2A 3N58A 3CCBA 3EF0A 3K8YA 1AK1A 3KE9A 3B13B 4XVHA 4ZPJA 3SN6A 4O4JB 2IRFG 1QV9A 2R2AA 2Q5LA 1MZVA 3RFVA 4WSOA 1RTKA 3RS8A 2SECE 5BSHA 4YJGB 1RTTA 3SHFA 4FQ8A 2XT9A 3P9YA 2X86A 3NBAA 4B80A 2TMYA 1JKIA 1HYQA 2MYNA 3DHYA 3K5IA 3NOXA 3SBEA 4NHEA 4FZVA 1ND5A 4D1YA 3U4QA 2ZWOA 2C7PA 2DFKB 2WYIA 3R2JA 4Q3DA 7MDHA 4YO8A 2V55B 2XXAB 2L19A 5KYTA 1GKYA 1J8VA 5L3RA 1Y1WJ 1DX4A 3AXSA 1IQUA 4B4KA 4RENA 4LX8A 3UH1A 2QYOA 2B5WA 2ZCJA 2Z5UA 4UOQA 4GSYA 2BEKA 1UOQA 4F0JA 1WJCA 2DFIA 1T3TA 3HUDA 1B42A 1PK9A 3OIVA 3ITEA 1RI5A 1OI4A 4G0NA 5DEQA 2JN6A 2J9YB 2PUWA 3MTAA 1HQDA 1R15A 3PUHA 3L8YA 3IQHX 1T0PA 3GJXC 3L0CA 3HB7A 2AFIE 4BP9A 5F4ZA 5CJ2A 3O92A 1TLLA 4MCJA 3QHAA 4O1HA 4EY4A 3DC2A 4G8BA 1QP7A 4RZUA 3JQAA 5FUWA 1ZGCA 1QHFA 2XOXA 2QTVA 4XIDA 1B8PA 2G4LA 2PRKA 4YFYA 4CKWB 1TCUA 4H4CA 1VJCA 5IC4A 3SYLA 1L4KA 1JQ5A 5AXAA 2IIPA 3QPDA 1BCRA 3AONB 4AO7A 3HOVJ 1FVXA 4QPNA 3D6TB 4CM7A 4HO1X 2BISA 3HSSA 3S29A 2QCOA 5DCWA 4G5GA 3WR5A 4M54A 4DHWA 1U81A 4IIDA 3NNDA 4KXQA 5LGUA 2ZXIA 5GP1A 5B3JA 5K0NA 4OKNA 4BDSA 1BC5A 2CNKA 4M1YA 5IKEA 1IVSA 3ELKA 1T15A 2H2DA 2UUOA 3ESQA 3IRUA 4WN9A 1ZOIA 3GIWA 1NE7A 3E2IA 4JELA 5L3QB 5ALOA 3IAXA 4ZPXA 2WBMA 3F67A 5J9FA 3ZQIA 4R8LA 1WUIS 3MELA 3KEOA 3N6VA 1IHUA 5DBIA 4IHWA 2OMKA 5E4FA 4DBRA 1QYCA 4FGLA 4CYDA 3E3AA 1SZCA 4I19A 4MYSA 3RSZA 2HWUA 4LTDA 3VNRA 1XMIA 3ILXA 1VPEA 3C2BA 2O2XA 3M6UA 4LXXA 4OMCA 2PV7A 2Q4DA 3E5MA 5FPYA 1D8AA 2WJWA 1YBHA 3HYSA 4V0OA 2XIGA 3I9FA 2ODBA 3MAAC 1ZUNA 2QRGA 3ANXA 3BK2A 3OYDA 3NIDB 4AUEA 2Q3JA 3NZEA 2MDTA 4RTSA 1P1BA 3PHCA 2IA1A 3DSRA 3FUWA 4R0MA 3NH9A 3GFJA 5JNTA 3UN1A 4CM4A 3I04A 3D6AA 2A92A 1N25A 2HYDA 3D6HA 3L4BC 3M34A 1C7QA 4MCAA 3R7LA 4GM0A 1ZQ9A 4WOKA 1ZW1A 1SAYA 3M6VA 2M8EA 1YOVA 3I55I 4EEFG 1VXRA 1PR6A 1S2OA 3HUFA 1J8FA 2ECKA 4QU5A 1Z2DA 3CH6A 2IJLA 3NQ41 1MV5A 4LKRA 4ARIA 2H2AA 4RTRA 4HPJB 2O4CA 3RIXA 2H11A 4FCVA 1Y0UA 1SBCA 5HF5A 3HCFA 1YTUA 2FSUA 2F55A 5FOVA 5E8JA 2P81A 3DXFA 2II6A 3HY3A 2M45A 3S1AA 4DIBA 4ER0A 3PDIB 5BNIA 4MQLA 2EP7A 2VE8A 3PFWO 2ADFA 4R4JA 1N0VC 5H6RA 5IBRA 3OYCA 3WHKA 2CQKA 3TDZC 1K68A 2PX2A 3H4IA 1JPUA 1KEPA 2WIFA 1JFVA 4P4TA 4PIMA 3EAGA 4RVCA 3D6JA 5BRAA 2ZVQX 1U3CA 1T98A 2VVTA 3WTTC 3QU3A 4URHA 4L0YB 1L8XA 3U4GA 1ZRFA 1THTA 2A57A 2AI1A 3WO0A 2C03A 3NKVA 3SF0A 9MHTA 3Q7RA 1X3SA 2HHCA 4RY8A 4DDVA 3VRHA 1O7FA 1Z4OA 3FCUB 3CWZA 3AFMA 2PEXA 1M2OA 2YW2A 3DO8A 4II2A 4AUNA 3FK6A 1JQAA 1YJBA 5CB4F 4YRIA 3FHJA 1E8DA 4ZTJA 2FSFA 2F3QA 2GEFA 1SK8A 2Z4TA 4IDDA 5KOHA 4OHYA 1UMCB 1Y8RB 4HSRA 1TQDA 2D8AA 4YLGA 3S68A 3TQTA 4CIDA 3RTBA 3SM3A 3V4VB 4YXWD 1WF6A 3I9LA 4CQMD 1ZARA 1EK1A 2ODPA 3VZBA 1Y9JA 1KU7A 1X8XA 3EE6A 3VZSA 1FZTA 2BZ0A 2W71A 5K5OA 3OYMA 1QFYA 2XSJC 1GPJA 3RSCA 2WT8A 4C14A 1JMVA 2NS0A 1DLIA 3OQVA 3O3OB 3ZWYA 1GFWA 1BM9A 1I1HA 3S15J 2PFSA 2GMWA 2IELA 4E30A 2ZE7A 1G3MA 2ZS9A 4Y9SA 5FNVF 3DWFA 2FWAA 3IAAA 1VHTA 1WZUA 3EARA 2NZ8A 3IC5A 1ESDA 5AJHA 5FO0A 3ESWB 4B4CA 2Y2VA 4YA6A 1VTKA 2E2IJ 5CNMA 1DAPA 3HZHA 1DPRA 4BO0A 4J29A 3T3EA 1SUDA 5DCMB 1IPFA 1P19A 3IH5A 4ILEA 4NDNE 3VSBA 4BHTA 1ETYA 1C14A 2H52A 1Z15A 3I1JA 5JQGB 4Q7MB 4XXHA 3OJEA 3BRCA 4JIGA 4Q19A 1OWLA 1REQB 4CCSA 1OVGA 2M7AA 2IOFK 2C0QA 1I1QB 3UB3A 1X8KA 5LQDA 4CEJB 2J3QA 4XB2A 1AUOA 2WRZA 3K4MA 4EJSB 1A69A 3P0FA 3WK6A 3ZYZA 4LDQA 3RADC 5C8DA 2LYCA 1J00A 3HVIA 3V8MA 3QEOA 4P84A 4F86A 1VXOA 2HA4A 3A31A 4KWEA 1TWFJ 1H2HA 1TIKA 4XR4A 5CVVA 4QIWN 4CF6A 1QIKA 3EVCA 3VZDA 3WWDA 4CFYA 4P9UA 1EP9A 2YDXA 1KIFA 2Q2EB 2B8WA 3EA5A 6PAXA 1CPYA 2FVYA 4YROA 1APLC 4Z6KA 2EH3A 3Q3SA 5GP9A 3LH5A 3RUFA 5L4LA 4BNJA 1Z25A 2UZ0A 1K3FA 2ATCA 4JT2A 4MRSA 5DHAA 5H68A 3I5MA 1ARZA 1ADFA 1PW5A 5IY5H 1YDWA 2FN9A 2FP3A 2ODAA 2VDPB 2AOVA 3K6KA 4ZANA 2QGUA 4RH3A 5CX1A 3HYCA 5K7ZA 3KM0A 4RY0A 5D4SA 2AQKA 1ON2A 5BSEA 1O96B 1R0LA 1RSZA 2R6ZA 1UDXA 2B4KA 3MD0A 4G25A 2J0UB 4LXYA 2JIQA 5CFOA 1NPYA 1RLUA 1SHUX 1OCEA 4TMFA 1L1RA 2R7VA 4TYPA 1Z5ZA 3E4DA 5J5AA 4D4HA 4KMRA 1CS0B 1KMCA 1MJHA 1PK7A 2IU6A 2P4QA 5EXTA 3U13A 2BJVA 2R00C 2ZWVA 1TKAA 1YDFA 1BE0A 3GVXA 3FXUA 3OZAA 3AF6A 3RS2A 5JSUA 2HTEA 4JMPA 1XCGB 4DSTA 3L02A 3IJRA 4B2IA 2C5GA 2UV8A 5B3LA 3BHJA 1OX6A 1ZKGA 3VZCA 4PU0A 1X80B 4IF6A 4I8IA 1V5GA 4IRUB 4D9HA 3WKAA 1MNEA 3PJFA 4LJSA 2ORVA 4IVNA 3I04M 3KSMA 2ZYTX 4O63O 3M9AA 1H1LA 1IH8A 1UXKA 2MT9A 2OCAA 4I55A 4NV1A 4EMSA 1FXWF 2O0MA 1K7SN 1U80A 1P5JA 3IX7A 3K8ZA 1NUQA 3VXKA 3Q9VA 1Z4IA 4JC4A 5CCXA 3WA7A 2NQTA 4LWZA 1U4SA 4JA2A 3DXJF 2VATA 5HE9A 4C89A 5CKTA 1C0PA 2CL5A 4LWOA 2Y3IA 1OBCA 3D4BA 1SKYB 4H3VA 2EV6A 2JGDB 1RHJA 1PWHA 1GQYA 1MAVA 2Q0SA 4OHZA 1GSOA 5IKMA 2VAWA 2ZNYA 4NNJA 2FPIA 3D43A 3P2EA 2FN3A 2IL1A 2RI0A 4ESJA 4UAGA 4RAYA 2AQHA 2XASA 4ERNA 3TD2A 2K9LA 2NOJB 2E7ZA 2FUCA 3FXAA 2JZNA 3V8EA 4MUFA 2YKGA 4KFUA 4KQMA 1H4QA 3EK2A 3PBKA 2X3YA 3R5XA 1FOXA 3WHPA 3WHCA 4N5LA 5EQTA 1UFQA 4XGNA 2HYGD 1U7XA 5HGJA 1YFZA 3ZEAA 3OL3A 1GNTA 3DO6A 4UHKA 4Q6WA 3E5XA 4UXIA 2WE8A 4WFKA 5KX5B 4FCCA 1QTIA 4LGMA 2XZTA 3K0FA 5KNCD 4KPEC 2XBMA 4DKJA 2C9BA 1H9CA 5THQA 1XRSB 2NV6A 3DVQX 1QCDA 2LMDA 2VUTA 1G2PA 1V1RB 3RSOA 3X1MA 4Q1AA 5EJ4A 5KTSA 3ZGNA 4BO9A 4OOEA 2QQ0A 4P32A 3TKAA 3S2DJ 2OSBA 3UT5A 5I7VA 1WMSA 1QK3A 2PT7A 3QEAZ 1O94C 3QKIA 5BN1A 1JLMA 1JTYA 1EU1A 1JUDA 1V3FA 1T8PA 4XSGA 3GEGA 1SOUA 4QPQA 1G7SA 2DSNA 5DGXA 2PZAA 3OE4A 1BTOA 1MFZA 1XVVA 3GARA 4C06A 2V26A 1N2IA 3DBOB 1JEYB 2NVOA 2V5AA 3CLKA 2V0NA 4KAAA 4RXMA 5CJJA 3RE1A 7MHTA 4ZO6A 1KI3A 2WBLC 2XB0X 4GU5A 2R96A 2QJTA 4F93B 5J2UB 1L8LA 5JMPA 3K4BA 4LE2A 4J0EA 3A05A 3H0CA 3DVAA 1FBSA 2WM8A 2BM1A 3CX8A 4MKXA 5TQVA 2P8SA 4Y0VA 4E7KA 5ECGC 1MD9A 5HWSA 5KCMA 2DQRA 3HRMA 5DO9A 3ZHSA 1PGNA 2YZ7A 2KJQA 3O8QA 1BQ3A 1GNLA 1OH8A 4JKYA 2NUTB 1KBOA 1G5PA 3W0LB 1UEXC 2OBPA 4C3HJ 2LD5A 3BK1A 3STYA 2D0OB 4QVIA 2WF6A 4OQQA 2HQRA 2AQIA 4EM2A 4XPIB 2DUUA 3PL5A 2R3SA 2STWA 1T6XA 3D7SA 3G5MA 3HXPA 3SJUA 3DW3X 2HC9A 3V33A 4A8JB 4OIQF 2MINB 4ND8A 4RMNA 3T3HA 4BIIA 2WMDA 3IUQA 2GX6A 3E22A 3ZDQA 1FQWA 3C8ZA 4M1QA 4TKLA 4H7PA 5JSZB 5GTHC 1UDRA 2X6XA 3I0ZA 1MIJA 1MBFA 3BKWA 4TVSA 1B1CA 4EG0A 1OB5A 3BR2A 3OOEA 3R7SA 4L8WB 2Z2YA 2DOKA 2V9KA 5FA8A 3TL4X 4EHBA 1ENHA 2KI5A 1YQTA 4C1NA 4QYSA 3AG4H 4FUTA 4RA2A 2Q8QA 1G20B 4QGSA 3HM5A 4YECA 1Z4NA 1J70A 4RK7A 1R0KA 2BEOA 1HOTA 1PV1A 1QHEA 1Q7EA 2DY1A 2H00A 2AOTA 3OU6A 4IMPA 3RUCA 1IQRA 3QFCA 1OR7C 1ZM7A 1SVWA 3QA3E 1TVCA 1YAHA 3WQQA 4BATA 2V9CA 4C05A 2EZ8A 2YOHA 4OHBA 4N3CA 1R0WA 1W2GA 4Q03A 3CEMA 2GNAA 3WIUA 3W5UA 2DERA 1PGOA 2IUSA 2PQ0A 1FTTA 4QUGA 2QZPA 4IHSA 3B1YA 4TT8A 5G1PA 1GZSA 1WSWA 2XGEA 4KQ9A 4A8HA 1OBOA 1U3DA 3FLAA 4R40A 4DY4A 4D98A 4BXXJ 4LWPA 1ZM3A 4ZCSA 2IXGA 5EDNA 3HKEA 1MEOA 1B8IA 5A6SB 1ODCA 1PNTA 2ZB2A 2ZUVA 4JBIA 1EV7A 3LLMA 2Y8EA 1Y3DE 3L0BA 3PQ7A 2J1LA 2IBTA 1R58A 1QF6A 5FA5A 2VHTA 4XR9A 1SQ6A 1A98A 3FGOA 3CCCA 2GKOA 2E85A 1P7YA 1VSTA 4GOND 3MSCA 1KI4A 4OK5A 2R86A 5EIBC 5CIYA 3SJZA 1Z63A 3HCEA 1SD6A 4RU1A 1JJVA 1T1IA 3FLEA 4X41A 1AXEA 4JU9A 3PNTA 1DG1G 2AWNA 3VOEA 4JP0A 1YBVA 2J59A 3PNMA 5BWNA 1NBME 2WHYA 4F3QA 1FS4A 1MMGA 2IUFA 3VNSA 1LEAA 3EXFB 4OHCA 3GD7A 2JARA 4E5DA 2CUTA 3ESCA 3FPGA 1XQWA 5CR9A 5JMTA 3L7JA 1VSBA 2D7JA 2PXXA 1P4GA 2H17A 2XMSA 1EWQA 1QHXA 1ZM9A 3KIOA 1SIWA 4MS1A 2Q4TA 2OILA 3KB6A 1JPVA 3GLFA 2P5UA 3KYCA 1GZ3A 3HB1A 4BEJA 2FWRA 1PT8A 3F6OA 4QUHA 4UMEA 1Z0SA 1J23A 1XGSA 3UAOA 5DLQC 3SSAA 4DVJA 1OQYA 1K4TA 4OI4A 2V7WA 4F3RA 3U7RA 3KEFA 1ETUA 3C45A 2HMSA 3JAWA 2NU9A 1PUXA 2G0AA 2H8RA 2IEYA 2P90A 2X2EA 3DO5A 3GX1A 3NBYC 5DIFA 5TMDA 1NVWQ 3RAGA 1BX1A 3RRXA 4GUDA 4DG5A 5IYZB 5G1NA 2FLWA 3EXIB 3TIIA 3TXYA 4EY3A 4XIFA 3C7JA 4A1OA 5CYGA 3RK4A 3ELBA 4QU9A 3UTDA 4LRQA 3E27A 4OUKX 1HH4A 1QLWA 4XSZF 3BRSA 1XG1A 1VMIA 2E7XA 4HZUB 3OX4A 3RSQA 2XUQA 2D5CA 3MLEA 5C31A 4KICA 3PUBA 3MJVA 1ONVA 3QHQA 3GAFA 5AOCA 2YPRA 2FW9A 3BXGA 3EXAA 5B2EA 1M75A 2GRAA 3V80A 2KPMA 2NTJA 2CBZA 3SDZA 2K7FA 1SG6A 2H9YA 1IHDA 2Y67A 3ASZA 5HK9A 3CLUC 3H42B 1F5SA 1UFOA 2C31A 4HNUA 4QTRA 2GB4A 3FNGA 5HCUA 3RJ5A 3SY8A 3EGWA 1R5JA 4G94A 3ST7A 1OXUA 3FPFA 2ZULA 3S3NA 1CQZA 4G5SA 4G67A 4WFJA 1GFIA 2QP9X 4Z3KA 3ZX5A 3ZH9B 1JVNA 1XGOA 1JAZA 1YUBA 2XNJA 3F8WA 2ZU6A 4LW8A 5JBQA 2AH5A 2HMAA 4PR0A 5AVKA 3D7LA 3CCSI 2RG1A 3CDLA 1PU2A 2WSBA 3ZMTA 2RREA 5H3HA 3CVWA 4GLOA 4P5PA 4Q66C 2L2QA 3T94A 2LH9A 2VZEA 2KPOA 2J6CA 2CVFA 4N39A 3KVOA 3MCVA 3REFA 3FN4A 1Z47A 2J41A 3WMXA 4KLRA 3ZHOA 4AJIA 4MV4A 3DV0B 2ZXFA 1T0BA 3LA6A 1FTZA 4QASA 2CYAA 1HKHA 1OZGA 1JV2B 1JX6A 1HSOA 4DM3A 2ZO4A 1UMKA 3E7PA 3VHLB 1PZGA 4W8HA 4DANA 2HTJA 2Z3ZA 3C2GA 2W2PA 4FYKA 3KBBA 2D62A 4MRVA 1TW3A 1U1DA 1T9GS 5KJCA 2EBHX 1NV9A 2HHAA 3F3YA 1KNXA 1Z75A 2PU5A 4RO0A 2PT5A 4YT5A 2YWHA 1Z91A 4A69C 1WI3A 5JLAA 2IKSA 2AE2A 1W4CA 1A9TA 4EUFA 5HJEA 2N9UA 1HYBA 1YMQA 2GRUA 4BE7B 1UOPA 2R7AA 3CJTA 3ESRA 3RS0A 2PD4A 3X0DA 4GKJB 2RKHA 1A96A 4MP3A 3N86A 3JQ7B 1U8EA 3K2QA 3FSEA 3PXBA 4RACA 3AVVA 4WK0B 2RQQA 5CNIA 3QPBA 1N1EA 3O8OB 1ML3A 3NCTA 1LJLA 3TEJA 3Q9SA 3CB2A 4CXMA 2LCIA 4TSFA 2V45A 2Z56A 5D85A 3ELUA 2ZEJA 2IZ1A 5K51A 5DT2A 4JQYA 1GQRA 5K0JA 1I80A 3NVKI 3ZMVA 3WNQA 3GCWA 3A6ZA 1LVUA 3D2BA 1SULA 3OQJA 4RNCA 1E5XA 4QBGB 5TRTA 1RHMA 4XDYA 1QRUA 2VHVA 3FDZA 3NAGA 3OQOA 2V6MA 2Y27A 3Q0EA 3QUBA 1V55H 3WI7A 5SY6A 4IEFB 5HK8A 5EXXA 4WINA 3AY3A 3COVA 4U8GA 2KHMA 1XTQA 1Y4UA 2GGSA 1TLHB 2WU0A 4GS5A 5FL3A 4UOZA 3TZHA 1MORA 3VVMA 4CXFA 5CRIA 4L28A 1L4HA 1JHYA 4HDKA 3AKDA 3HYIA 1FX1A 4LHSA 1QIIA 2BI8A 1VSVA 1ZD4A 4BEVA 3ESBA 4HDVA 3E3LA 4RE6A 5AKZA 3FB4A 3WRYC 3WYDA 4AN0A 1JHMA 2PL9A 2XMGA 1AWCA 2CXNA 4OYRA 5H9VA 2VRCD 2QWWA 1UJ4A 4WCFB 2JB9A 4CKBA 4E5UA 1XDWA 3EPHA 5F1YA 5BQPA 4B9EA 3I2GA 4CN8A 5HKAA 1CU1A 1NTCA 4Y2SA 5FBHA 5E1ZB 4XEHA 1DP7P 3ELWA 3QQPA 4BUPA 2LR0A 4C0WA 3FH0A 1YJ5A 2N0SA 1G8KA 1T9BA 2FQXA 4IHJF 1EFLA 4ZAWA 5F08A 2P6OA 3OH8A 1SD7A 4DDMA 1J2YA 1HE5A 2QAGB 5L6LB 4A6PA 1F2UA 2N3ZA 2ISCA 4DW6A 3LZ6A