1O57A

Crystal structure of the purine operon repressor of bacillus subtilis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
270
Chain Sequence
KFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Purine Repressor of Bacillus Subtilis: A Novel Combination of Domains Adapted for Transcription Regulation
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords PUR OPERON REPRESSOR
total genus 78
structure length 270
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
A PF09182 PuR_N Bacterial purine repressor, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1o57A01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1o57A02
1FP2A 2NNNA 3B73A 4M73A 4S05A 1B6AA 2XKOA 1QCCA 2QQ9A 1NHAA 1QK4A 1S8NA 2KIMA 4IXAA 2EHJA 4N9IA 1J5YA 4FX0A 2HYGD 2GWRA 3HYIA 3MJDA 1REPC 4BHCA 5D8KB 2EA2A 1WKMA 5D4SA 2PFBA 3E6MA 2L3DA 1ZLKA 3RTRA 3EFHA 1J2XA 2A61A 1HW5A 4RHTA 3DEUA 4KIFA 3FMSA 2PQ8A 5ICEA 3ZMZA 3H3UA 1I0IA 1WQ2A 1TNSA 1ZN2A 1ECJA 5HDKA 1SFUA 3LPNA 2QLZA 2A68F 3CUQB 1GXQA 3HOSA 4M6XA 2E1CA 2P5VA 3F8NA 1IN6A 1OYYA 2OQGA 2Q0OA 2MLGA 4YFKF 1XB4A 4UUVA 1BI2A 5D5UB 2RN7A 2GXBA 4IHSA 2VN2A 2ISYA 4JQFA 3V8JA 4LGWA 2XV4S 3GEPA 2CGPA 2DQRA 2EFPA 3LFKA 4A6DA 2VE8A 5JV5A 1P92A 3HRTA 5LEKA 2L4MA 4EMSA 4B8XA 1XGOA 2R7FA 1U9YA 4FX4A 3WU1B 1XD7A 4HBLA 4HAMA 1USSA 3TDUC 3LSTA 4QWQA 4BHBA 4KN6A 4P80A 1OPRA 3EQLF 5E38A 2WC2A 1LDJA 3FX3A 1P6RA 3CLOA 2PBIA 4I98B 4U0VA 4WCGA 5FLXK 2HKOA 2VBZA 1OMIA 2DW4A 3DXJF 2CYYA 2ZFWA 1T0FA 4O3MA 2R3SA 3T8TA 5AIQA 2VONA 1IW7F 5CVIA 2B0LA 3KZZA 1ON1A 2LNBA 4O6JA 4RHUA 1KU3A 2CWEA 2ACJA 1YFZA 4CZZA 4KIBA 4EM0B 2PRYA 1CF7A 5D5XB 1R1UA 2XASA 2VBWA 1R3UA 1XCVA 4WXHA 4EJOA 4LK0F 3E6DA 1H9TA 5A2QZ 2FMYA 2UXNA 1W5SA 1KQ8A 1TTYA 5IT9Z 3IKTA 5L3DA 2EWNA 3VFZA 5IAOA 5JSQA 1DP7P 1YTYA 3T8RA 4YIIA 1FT9A 4L9TA 1DKUA 1QO0D 2LKPA 4ESFA 1FNNA 2GA2A 4RAYA 2W57A 3GFMA 2H6CA 3ACDA 3WE2A 1W5TA 3GW2A 3GFLA 4KN4X 1W4MA 2HOEA 4XBFA 3M9AA 1A3CA 5ED4A 2FSWA 1OYWA 4JLSA 1CGPA 1RNLA 4M9SA 1YS6A 2X0LA 5KAMA 3KE2A 3KP6A 3L00A 3GFJA 2IA2A 4YIFA 1LB2A 5BSKA 3RIRA 4LK1F 1CF7B 4KICA 4I2OA 1I27A 3R4KA 2JKZA 4EV0A 1ODDA 1YG2A 2STWA 2ZJ2A 3VOEA 5E1ZB 4LYGA 2VC0A 4XSXF 1W7PB 3ECHA 1Y0BA 4RHXA 4LLLA 3QRFF 2ESNA 4UHTA 5L3FA 2A6EF 4PCQA 3S5JA 4RB3C 1I5ZA 4LG0A 5FFZA 2KJBA 3KP3A 2IA0A 3L2CA 1G9TA 1ZN9A 3N97A 2GIVA 2LF7A 3GZ6A 2ZNYA 1R1VA 2GQQA 3I5UA 3COAC 4IJQA 2A07F 1XSXA 5HLHA 2DLLA 4ZZDA 2HR3A 2STTA 4ESBA 5E1XA 1VDMA 1KU9A 3LA2A 2E7WA 1YW8A 1LDKB 1HXDA 4XSZF 5HLGA 1BC7C 6PAXA 2CW0F 5CVRA 2DK8A 3NRVA 4RAOA 1BOAA 5H20A 1FOKA 3V7CA 3O6BB 4P82A 1ZH5A 5HIAA 1ZGJA 4CDGA 2NRAC 3OOPA 4RADA 5HS9A 2L4AA 3FHZA 2XAHA 1ZARA 1ZRCA 1A04A 3FWEA 3HRUA 2MH9A 2IT0A 5BPDA 2W25A 1ZN8A 2UWMA 1P17A 2Z9OA 4KA4A 1W30A 3RYPA 3IHUA 4IRIA 3CUOA 3FXUA 3E5UA 2JPBA 4RGXA 5LGTA 4M9XA 2E1NA 3GO5A 2CFXA 4HQEA 4OU0A 2EFQA 4I0AA 4M0PA 1SAXA 3W6KB 2O0YA 1I1SA 1KYWA 2UXXA 4L18B 2P7CB 4ZYDA 3IWZA 1O7LA 2XKPA 3MCZA 1ZAOA 3TO7A 3TQNA 1UHWA 3WTYC 3C7JA 2QYOA 3F8CA 3V8KA 1XN7A 2P7VB 3E5QA 2JRTA 4ASNA 2Z99A 2EFNA 4RAZA 1QB8A 5DCFA 2L01A 1SD7A 1FYMA 5KK1A 2V1XA 4OMYA 3GFIA 4PFQA 4M0KA 1VSTA 3Q5FA 2K27A 1XGSA 1O3TA 1U2WA 3K2ZA 1H9GA 2VBYA 4RAQA 2JBHA 3WTZA 5JR3A 4GO1A 3SHFA 5JHUA 1FSEA 1A97A 1EH6A 2IA1A 2HTJA 3BZ6A 5LGNA 2DI3A 1JGSA 2J5OA 3WTUC 2F5DA 2HS5A 3CUQA 1HBXG 3RKWA 4DNCA 4GXOA 3E6BA 1I5EA 3ACBA 1ZREA 5L3CA 5BRNA 2F5EA 1MJ9A 1XZNA 3QPHA 5E8IA 2FMLA 1IXSB 1SD4A 1U8RA 5ILSA 1JE8A 3KZYA 3GX4X 2K4BA 1LEAA 4CGZA 4AWXB 5F1RA 4M72A 3ERED 1QBJA 2D1VA 4P9FA 1SD5A 1SFXA 2QENA 4P96A 4N0BA 2HEOA 1T39A 1ZGAA 1R58A 4KT5C 1S7AA 4HF2A 4PAWA 1FYKA 4Q48A 1IRGA 3RKXA 1Y0UA 2RDPA 1IN7A 4OIQF 4EJUA 1R7JA 4GGGA 2PJPA 1WWXA 2J5PA 1XZ8A 1IF1A 1BI1A 4QYIA 4WX9A 2DO7A 4GCVA 3IRQA 2NS0A 2PS1A 4DQ2A 3F22A 2W24A 1HSTA 1ULYA 4L0YB 4RANA 1AWCA 5BQPA 1R22A 4IPAA 3F8MA 1YQAA 2QBYB 3QAHA 2A69F 3L7WA 2XUBA 1ZN7A 1YO5C 5HS7A 1XSDA 3ABUA 3MBIA 4YG2F 2VFAA 2M1BA 3B02A 4HX4A 2VOOA 1HMPA 1OKRA 3I0TA 1O3SA 1FC3A 4L9JA 1Z6TA 1MDMA 5LHGA 1KYZA 4BNCA 3ABTA 4P83A 5IT9K 2FA5A 2JSCA 2Q8KA 4P9UA 1XTUA 3KLNA 3F8FA 3QP6A 4LD5A 1OYIA 2PLYA 4KFCA 4K2EA 2FBIA 4PGGA 4RQAA 4KMFA 5ILUA 1TW3A 2YPRA 3U2RA 1E2XA 2KJCA 5IPFA 3ACCA 3ECOA 1MGTA 5F64A 4MTDA 1ECFA 3G6WA 4Q4ZF 3J80K 3BDDA 4A6EA 4G7HF 5DUKA 1P4WA 5E1WA 3TDZC 4U7DA 3WG9A 1S29A 3IKVA 4HX7A 4U7BA 4HX8A 4A5MA 1XDUA 5ILVA 5K5RA 1ZHFA 3DEZA 1SD6A 1LVAA 5E8GA 2Q2EA 2ZKZA 4YFXF 4LZOA 1O57A 3RI4A 3SZTA 5FGMA 5IT3A 3WGIA 1XCBA 2FXVA 1IN5A 1ZG5A 2AS5F 4WWCA 3RJPA 1PP8F 1UHMA 1Z1DA 3PQKA 1MDMB 1IN8A 3DMPA 3JTHA 4WMLA 2MLKA 3N2LA 3GWZA 2Z5UA 1T98A 3ZN0A 1DQNA 1I0LA 3E5XA 4GYGA 1QCDA 5FB2A 5LGUA 2KRFA 3FZVA 4IF4A 3H3ZA 4HA8A 4TWBA 5JFRA 3MFKA 1HSJA 2TDXA 4P84A 4S04A 2L02A 2FE3A 4RB0A 2FEZA 4I09A 1FBUA 1D6NA 1P18A 2FNAA 4ETSA 5D8LB 2VT2A 4IRGA 3LA3A 1FP1D 4JK1X 1G2PA 2G7HA 4U88A 2RGVA 2K4JA 4WF2A 5CYVA 4RV4A 2ESHA 2OZUA 1IXCA 5E18F 3HOTA 3E6CC 1TC1A 3I59B 2UZKA 1K78A 1ECBA 1UCRA 4Q5SF 1V4RA 4NHJA 5CLSA 1QPMA 3I53A 3T0YA 1PUEE 2DT5A 2IW5A 1Z7GA 2M5WA 2XROA 4CICA 4B09A 3HRSA 2EV6A 1K79A 5E20A 4BYYA 2OQRA 4ENNA 3EYYA 4G9YA 1DPUA 1IXRC 2A5YB 4PDKA 2FBHA 2FXAA 3GLXA 1ON2A 5HDNA 3NAGA 2FBKA 5CVJA 1YIOA 2P5KA 4HF0A 1B9NA 3BWGA 3HSRA 2JT1A 3D0SA 2MC3A 2FNPA 4A0ZA 4RS8A 1B4AA 3DPTA 1RIOH 4HV5A 1L1RA 2MD5A 1E17A 4GYIA 4UV9A 1BI3A 2F2EA 4EJWA 1ZRFA 4TV7A 1LJ9A 2P5LC 3U1DA 2XAGA 5ERIA 1STZA 5LHIA 2QWWA 1DDNA 1TLHB 4LG0B 1STOA 3K1MA 3ZQ7A 2QQAA 3KEQA 2PMHA 2W84A 4Q47A 4O5VA 1P19A 1IZ1A 1XGMA 1KU2A 3HUGA 4LJZF 4CO8A 3F6OA 3O2PE 1BD3A 1LEBA 4ZYEA 2FF4A 3WTXC 3GYHX 1D8KA 3AAFA 1R23A 5HKLA 1O7FA 3WE3A 2DU9A 2W85A 2V6CA 3K9TA 3WODF 4HDUA 2EB7A 3J81K 3RPUA 3WTWC 2KIFA 1IUYA 1W7PD 4U0WA 5CVUA 1VCHA 1TW2A 3ZP5A 1HKQA 1EV7A 1HKSA 4MEXF 1WI9A 5JI6A 2JI4A 5LLQA 1QZZA 2G9WA 3SFZA 3GGJA 1U9ZA 2CQKA 2GXGA 3T5XA 5LRSA 3QU6A 3V4GA 2CG4A 4MB6A 5AIPA 5L3EA 1JLSA 3ULQB 3KP4A 5K51A 4RACA 2ZO4A 3V7RA 1XSVA 2XAFA 3M3HA 1BN5A 1UFMA 4BHPA 1F5TA 4HOBA 3V7SA 1ZLJA 3ZMTA 2M45A 3M8EA 1UPUA 3TKYA 5EEHA 4RB2C 1BZYA 5CJ9A 3WU0A 2JKYA 2IJLA 2Y48A 4ZZLA 5HLIA 1JLRA 1B9MA 3HIFA 2HQNA 1D3YA 1P4AA 1IRFA 2HKXA 3KLOA 1K7AA 4MQVA 5FLXZ 3I4PA 1LQ1A 4R8HA 3OHPA 2RVCA 3LWFA 1QB7A 5FD5A 4OHCA 3GZ5A 2OD5A 3I71A 2QZ8A 1HW2A 3FXRA 2PMUA 3BP8A 5D4RA 4LB5A 2H27A 2BGCA 4LMYA 4EVIA 2HZTA 3ELKA 1NULA 4EQQA 1KU7A 3H92A 4EGYA 1F4KA 3PQJA 4JBAA 2FOKA 3LA7A 4WN3A 4QLCU 1XMKA 1MKMA 2JTVA 2DPDA 2VOPA 5A2QK 1WD5A 2O8XA 4RQBA 2GA1A 4M6YA 3ZMDA 1VTNC 1ECCA 4S2UA 2D1HA 1GVJA 1G4DA 1WRJA 3MEXA 3SZPA 4CXFA 5DUIA 3GUDA 2H06A 3MQ0A 3RPQA 2LSOA 1TQIA 3EETA 5FO5A 3C3WA 2FRHA 2BEOA 1R00A 3DP7A 3LAPA 2D45A 2OU2A 1D8JA 2VODA 4IRHA 1A4XA 3GGCA 1BIBA 2OBPA 4BH9A 1Z05A 3QW4B 2MA3A 1BBYA 3CUQC 3LRTA 1DUXC 4P3KA 5BMZA 1C0WA 5H6RA 2C6YA 2EV0A 3DQVC 1JXSA 2WV0A 3CDHA 3OZFA 1R5HA 1UPFA 2XRNA 5LEJA 5E17F 4IJAA 5DYMA 3Q9SA 3HTUA 2EFOA 5ICCA 2BBYA 3DF8A 2QUFA 1TC2A 5DEQA 1W7PA 2M30A 2OZ6A 3M1EA 5J6XA 1MD0A 4HF1A 4LYYA 2ZMEA 4IHTA 3FMQA 3F72A 1T2KA 3PFIA 2DK5A 2O6GE 1TNTA 1G3YA 1S7OA 1WSUA 3EYIA 5TJJA 3KFWX 3LAJA 2EV5A 4L5IA 5DD4A 1IN4A 2QBYA 1USTA 3R0AA 4M0UA 2PRZA 2O3FA 4FYMA 4OINF 3SQNA 4MTEA 1JHHA 3T1BA 3O7MA 1P4XA 4LLNA 1ZG3A 1TQPA 1XMAA 4G8XA 1T6SA 2DFIA 3CO6C 1BD4A 1T38A 4PZJA 3LQRA 4EM2A 2R7DA 3TGNA 5D5VB 4X44A 2M87A 2YX7A 4NQWA 2RV8A 4UVBA 2QVOA 4G7OF 2HFHA 3FF5A 3BY6A 4ZYGA 4Y17A 2LF8A 3DPLC 3BJAA 4XRFA 1GHCA 1J7JA 4BAYA 2XAQA 4P81A 4OIRF 4L0ZB 3IWFA 2NYXA 1O5OA 4N9HA 4MQ9F 2DPUA 1U5TC 5JVTA 2XAJA 2HQRA 3KEOA 4L9NA 2YX4A 3ZMUA 3P9IA 1TBXA 4HW0A 1XTVA 1OPCA 3P9KA 2OA4A 3R61A 3I58A 3L09A 1Z7UA 4LB6B 4AD9A 4XLNF 2H94A 1RUOA 2YSRA 3CTAA 4IVNA 4A12A 1XGNA 1BIAA 1XTTA 4HLYA 2RKHA 3BPVA 1OROA 3C18A 4MGRA 2FU4A 1UB9A 2Y0MA 3U9GA 1F9NA 1YLFA 3BOQA 3ISPA 3IL2A 2DQLA 2EJRA 4NB5A 4CYDA 1I14A 4WK8F 4AVPA 2DTRA 1J0RA 2F5FA 2V1DA 4A0YA 4AIJA 2GAUA 1YYVA 3TOAA 2HWVA 1MZVA 3GVAA 1J7KA 4Z1OA 4M71A 3HTSB 1GPH1 3E3VA 1XDSA 1HKTA 1BJAA 2BV6A 1MZBA 2KIUA 4G94A 3H83A 2P4WA 3N4MA 4HLXA 1G9SA 1ZYRF 3WGHA 2YU3A 1I13A 1UFRA 1IBSA 1L3LA 1ONVA 1U78A 1KA8A 4KDPA 1MJAA 1FPQA 1RZ4A 4Y15A 4F8EA 4I0BA 5DCMB 3OZGA 5DCMA 1BM9A 3BROA 5J8CA 2V1UA 2COMA 2RQPA 4QRIA 4ZYHA 1QNTA 3W6JB 3WGGA 2DBBA 3ML6A 2E55A 4P55A 4UNOA 1QK5A 1G3WA 1U5TB 2P6SA 5DV5A 5ESWA 3O3KA 4F7ZA 5BQTA 2ELHA 2G7UA 1QGPA 4L5JA 2VXZA 3ZN1A 2A3SA 1I1GA 1R5GA 5D6FA 5BPIA 5FFXA 5DDGA 4LZAA 3F6VA 2QQBA 5H6QA 1QK3A 3ZMVA 2ZXJA 4KN7X 1SMYF 4RGUA 1LH0A 4FHTA 2PI0A 5HVQC 4M9ZA 1HGXA 3KP2A 4RB1A 2XVCA 2BE5F 1MJBA 1QQIA 3VB2A 2ETHA 2HYFA 4P86A 1SMTA 3VEPA 1DBRA 1DPRA 3BPXA 2VC1A 4G7ZF 3FM5A 1DQPA 1SFEA 4Y13A 3L9FA 5HOOA 1G3TA 3KP7A 4LLGF 2HCRA 1Z9CA 3R60A 4ZH4F 2Z3YA 3JSOA 4L9VA 5LBQA 1PP7U 2ZCWA 4YFNF 2EFWA 2H6BA 2H09A 1KGSA 1YW9A 5BQOA 4JITA 2KKOA 5D6EA 2YZKA 3HVUA 3TOBA 4E70A 2EA4A 1U6GA 2IP2A 2JPCA 5HDGA 4A2UA 2BYVE 1K6OA 1FSHA 1GRVA 3JAMZ 4CHUA 5L3BA 3EDPA 1Z6RA 3FMRA 4KMUX 1R36A 1V3FA 3P7NA 5K5OA 1ECGA 1IAWA 1FY7A 4UVCA 3HHHA 1A95A 1S3JA 1BC8C 1BI0A 4OIPF 4EJTA 4RGSA 4R1HA 4RABA 2P6TA 1A98A 4OIOF 1A96A 5CVVA 2HDCA 1PZMA 4PGHA 4G6QA 4KYWA 3GEZA 1EH8A 3J7AO 4EM1A 1G6NA 1U5TA 3DFGA 2L54A 2ISZA 4UXNA 3RYRA 1JHFA 3D5LA 1Q1HA 2AXLA 1J75A 1FX7A 2WNSA 5HS8A 4I02A 3R6SA 3V8LA 2K86A 2VE9A 1KQ0A 2EK5A 2ZBKA 2P8TA 1P2FA 4HYEA 3DV8A 3BJ6A 4M74A 2XBUA 4KUMA 3CO7C 4WXDA 3MZHA 3SXYA 2A6HF 5J8FA 3I54A 3F21A 2VBXA 3QP5A 3S2WA 1OREA 2RNJA 3I64A 1L0OC 3HSEA 3WTSC 1V9SA 4HDVA 2ZNZA 5LRRA 1U3EM 3WTVC 1R1TA 3KB8A 1AO0A 4HV6A 4ENKA 3F8BA 4EGZA 4BQAA 1RI7A 1X3UA 4LZNA 3MZYA 4RHYA 2AEEA 3RDIA 2HGCA 3GF2A 2Z33A 5BOXA 2GZWA 3NQOA 2WWYA 4AIHA 2XGXA 1H0MA 4ENJA 2Y75A 2K7LA 2PN6A 3HSFA 3REOA 4A0XA 1FYLA 5F6FA 5AONA 2O03A 3F23A 3JW4A 4QYIB 1F1ZA 5LHHA 1S6LA 3ZMSA 2H07A 1G2QA 2IVMA 3J80Z 2K02A 2V79A 2CO5A 1ZG1A 4KIGA 4KNYA 2C4KA 2HTSA 5ICFA 3EUHA 4ESJA 3GXOA 3M7GA 3HHGA 3P9CA 1TQMA 4ENMA 2NNYA 2JZYA 2IGBA 4HZFA 1NONA 3QOPA 2WTEA 2M8EA 4R79A 4OMZA 2D2WA 4ZFNA 2VT3A 3G3ZA 3DAHA 3TO9A 3WTTC 3I59A 2PG4A 2OAZA 4I7HA 4XLPF 3M8FA 5BS6A 3MWMA 3K0LA 3BJOA 5KVRA 2XHKA 3DKWA 1O3RA 3JTGA 4UV8A 3K69A 1HW1A 2MBFA 5KAPA 3VODA 1G3SA 1GXPA 1AOYA 4MEYF 3HRMA 3CJNA 4X45A 5L3GA 2F5CA 1RUNA 2DAOA 3IRRA 2IPQX 2DY0A 3Q9VA 1QZYA 2H08A 2XIGA 1L1QA 1LNWA 1FSGA 2P1ZA 4MHGA 3R0JA 2V9VA 1CJBA 1D5VA 3LQQA 3FXQA 3IC7A 5K1YA 1I6XA 3J81Z 1LDDA 3ZPLA 4BXUA 1J9IA 2NAZA 1FZPB 2O61A 1EH7A 3E97A 1YW7A 5EUCA 3JAMK 1Z91A 3TO6A 1DKRA 1B59A 1PDNC 4HQMA 2YR2A 1FLIA 1O3QA 2PEXA 3K1PA 1FWZA 5ICGA 1B1BA 4WXCA 1FBQA 2ZMEB 2MH2A 3KCCA 3QPTA 4G6DA 1FBSA 2E7XA 3K1NA 3QU3A 5EEGA 4AIKA 1K78B 5DD8A 2CSOA 3JSPA 4EJVA 2GEBA 2X4HA 3RKYA 4P5OA 1YS7A 1YFHA 2FQ3A 5D5WB 3NEUA 1KQ9A 4ON0A 1HQCA 5K5QA 4U0YA 1J59A 4H0EA 3KP5A 2ADUA 3F3XA 4FT8A 1ZRDA 5ESXA 3G73A 4I01A 1OR7A 3ROUA 4RGRA 2IRFG 3FM3A 2QM3A 2LDUA 4Z2YA 2RC4A 4OOIA 3OV8A 4D0PA 5FD6A 4UVAA 3MAJA 4A5NA 5TRDA 3C1DA 3KETA 4LFUA 4MNUA
chains in the Genus database with same CATH superfamily
1FP2A 3B73A 3L1JA 1PCXA 4OQYA 4B7UA 4IDEA 4NFLA 3D3KA 1Z37A 1L5HA 3ZHVA 5DNUA 4AYBN 1HLPA 2H85A 4DMCA 3K9BA 1W48A 2YFKA 1EVJA 4RNDB 2VA9A 3C3MA 4OYRA 1GRRA 1QCCA 1Z3IX 2RBEA 3DAPA 4JVLA 4LFAB 2J07A 2CHUA 2QQ9A 1QK4A 1KI8A 1C1YA 2YN0A 3D59A 3O8OA 4JSYA 2EHJA 1OFVA 1T8PA 4ZCRA 1J5YA 1SBYA 2OZEA 2WF5A 2B5VA 4US0R 5JT1A 5K01A 1TAUA 1OXXK 3ZE6A 3E3NA 5A3RA 3VI4B 2HYGD 3DEJA 1U2DC 4PLGA 5LLDA 2P30A 1Z3YA 4BHCA 1R88A 2GZSA 3I39X 3O3CA 5D8KB 1MAHA 2DWOA 1XPXA 1OYOA 1S1CA 1KJIA 1WCYA 3ID6C 3VPAA 4B6RA 1NLYA 4R1UA 5KSZA 1G38A 4PLPA 3HN6A 5FLYA 1PG0A 1N2GA 5AJHA 1EMDA 5K3FB 3O9MA 3AESB 2HU9A 1K0FA 3DBHB 4B84A 4U5XA 3I4NJ 2GLUA 3O8DA 3UT6A 1L4UA 3BJZA 5DEIA 2M0MA 2HYJA 2EC5A 4KIFA 3R7DA 3F49S 4EUHA 3H4TA 4K9RA 4AJKA 4V2UA 5ICEA 1SC1A 3OP1A 5C0OE 1SVMA 4H3HB 1F8FA 4ARSA 4JV5B 4M8SA 2C88A 2AFRA 3FNFA 3MGCA 3BTCA 1Y3DE 2CC2A 2JIDA 4OHXA 4WN9A 4BLVA 3QIAA 1NUPA 1BDMA 3CCUI 4HRAA 4EZBA 4F46A 4JXJA 3QX8A 2HQ5A 3T7TA 3QOFA 1ECJA 1UJNA 1QQAA 4B6SA 1MG5A 1QUFA 5KOYA 3UMYA 3RYCA 2QUAA 3VPDA 1DBPA 1OCEA 2VOJA 3MD0A 3TCXB 3S3NA 2E60A 5DMXA 1G5PA 3QI7A 1P4GA 3R9WA 3LHDA 1GXQA 2VPLA 3KQTA 4JB0A 3CRMA 1IVYA 2C8KA 2O8EA 1WW3A 3EVNA 3K4NA 1FK8A 2W2NA 1U31A 2F4MB 4PM4A 3S40A 4B3JA 3CMCO 3OC6A 5CITA 2AGVA 3USZA 4BO6A 5IS2A 4K46A 3EH2A 1JHXA 2O23A 3UY4A 3N3AC 3HP7A 2OQGA 2Q0OA 2JH8A 2NV0A 2E6KA 2MLGA 4YFKF 3K0HA 1HXHA 1D6JA 3OKCA 3RVBA 2XZTA 4HAVA 1DP3A 4PHFA 4DMUB 5DTMA 4TUYA 3ZTWA 3ABKH 5D5UB 1G7SA 1V48A 2GXBA 3GFPA 4PIVA 3LX6A 4Z0NA 3PDCA 1DAOA 1XE3A 3R5SA 1GA6A 4HUTA 3F1KA 3R8FA 3OPVA 4X1KB 1XAGA 3BWXA 2Z95A 3KHSA 2WPDA 4RFVA 3TJMA 4D43A 1PQWA 1TMGE 4G07A 4MAFA 4CCKA 2BGIA 4J94A 2H29A 3OCVA 4NI5A 4QVGA 3GEPA 2CGPA 1V6CA 4JIGA 2VZLA 5ETJA 4E2XA 3RG8A 2EFPA 3CW8X 3PHGA 3EXEA 1I2ZA 5BT8A 4GAEA 1R0LA 1TTPB 1TO2E 4AX8A 4NMHA 1MMGA 1P92A 1HTBA 5LEKA 1LDGA 2SCUB 4V2IA 2L4MA 1QHEA 1E7SA 4AYXA 2GOMA 1INLA 3ZX4A 5C8VA 1E9FA 2WJ6A 1JUSA 2I7DA 1TZBA 2JAPA 2H51A 4CKCA 1V45E 4W7HA 1Z36A 2JBAB 4ILKA 1Z6QA 1S2OA 1DADA 1Y1RA 2AK3A 2BD0A 3DVQX 3EJWA 3U9SA 3P0FA 5KS2A 3FCUB 1T2DA 3WU1B 5GADl 2DKFA 3TH5A 5UKDA 3JRHA 4XGIA 4L72A 1X38A 3BWCA 3C3XA 2J5BA 1WW2A 2VR1A 2CUEA 1E1RA 1PX0A 4BL5A 1OB5A 1WOMA 1LNQA 4CODB 2Y0PA 3GLVA 2K3PA 4G01B 3A02A 3T95A 5AIBA 1EB9A 3F74A 1NLFA 4QWQA 4BHBA 1U7PA 2OBFA 3DU6A 3Q7SA 4JT9A 4ZAWA 3DOCA 1U3GA 2L5QA 4MYRA 5B6IA 2X6XA 3Q0VA 1KI6B 2AN9A 4P80A 5EKXA 3TPCA 2FWNA 2FGJA 2QEQA 5L53A 1G3RA 4E94A 5JYBA 1P7JA 3C5HA 3MXOA 2EJBA 5ALUA 1TFRA 2QGZA 3TD6A 1V1JA 2WC2A 1B74A 1B7GO 1LDJA 2I6GA 4LYHA 1RD4A 2XR1A 1P6RA 1DBWA 1GGNA 3EARA 4MS3A 3CLOA 1P1CA 2NT3A 4AD8A 1ENOA 3OL3A 4U0VA 2XF6A 4H77A 4NH4A 2VBZA 3K0FB 1FX0A 4O3FA 2IW3A 3VR4A 4F52A 1KP3A 3RQSA 1CF2O 4KSYA 2DW4A 3K70B 4XX0B 3LPCA 2HO4A 3SMQA 4ABYA 4F7WA 4ZMRA 1KP2A 3OR1C 4U2DA 1T0FA 1ORVA 2OO3A 4DABA 3PENA 3N2IA 1T1GA 1SB9A 3OJWA 3HCDA 1JHMA 1YITI 1K3UB 1SXJE 2NUAA 3IDAA 2I1WA 3S2FA 3SF8A 2Z5LA 4P3PA 3OMXA 3ZHZA 5C1DA 3V33A 2R8YA 4RPHA 1GY8A 3NV7A 4K5QA 7GPBA 4OHPA 5CFRA 3CLSC 4FWTA 1S9DA 1XGKA 2R4QA 2YC2C 5EIOA 3TXXA 4B3CA 4CQMB 2CWEA 3DB1A 3NT5A 3EB9A 2RKBA 2ACJA 1UCFA 4DC9A 2Y68A 1G8JA 2PZGA 3AKCA 1TVCA 3QWLA 2G76A 2KMLA 4WBNB 4EM0B 1JHQA 2PRYA 4ALLA 1CF7A 2B2CA 1WBBA 3HV0A 5IJXA 3TOZA 3WLLA 2DUUA 4AI6A 4KH0A 2XASA 1L4HA 1QGED 4M6WA 3BUSA 1Y98A 3HJRA 1KZHA 2OGUA 3C7TA 2Q2VA 5EZHA 3BMQA 4EJOA 3D3QA 3NH6A 4XGKA 1RQLA 4LK0F 2BKEA 3ICPA 5G1PA 5CFPA 2FUCA 1CQWA 1P29A 3OOHA 5A2QZ 1EDDA 4MJLA 2UXNA 1UFQA 2FOIA 4DA9A 3FOZA 5GADJ 1VECA 2OXCA 2XYVA 3AQ4A 3K9HA 3TZQA 4CL0A 1MC8A 2HVRA 4XYEA 5E1BA 4OHYA 4R98A 4GOMD 1SUSA 1FTZA 4ND5A 1IAVA 2XQIA 5B12A 5SZJA 1WQ1R 2KT0A 3PU6A 3ZQQA 2SKCA 3G7UA 4ROTA 3EISA 4RVHA 5FJIA 5JFOA 3PZBA 1NC1A 3QENA 1PJQA 5JSQA 2C83A 3PPXA 3PHHA 4D2IA 1XD8A 1L5QA 1ZH8A 1PN3A 3N6RA 4LQ4A 2X6TA 5CX1A 2VJMB 2E5FA 1DP7P 4RKRA 4X71A 3SM3A 3ZE2B 1OLXA 3ASOH 1VQ8I 1J56A 2GBLA 3UW1A 2ZU0C 3T8RA 3X2EA 3HO1A 1VZ3A 4IG4A 5A3QA 3HRHA 4LMAA 5GJBA 4I8XA 5JBIA 1TWGJ 1T3TA 3QTLA 2JH9A 2R7UA 1UF9A 1S5PA 3NWBA 2QAGA 3G85A 4L9TA 3S93A 1TVEA 2ZDQA 4MKZA 4NFYA 4KXLA 1EUCA 4UDXX 3ZWOA 2Z83A 4D9HA 1NBOA 1RM5A 4F2DA 4IIDA 5L4NA 1NSFA 4RF4A 1IULA 2AXNA 2D8MA 3KQOA 3CKYA 3O5AA 3JQQA 3NI2A 1Y1TA 4N6NA 4DE5A 1O4VA 1PQYA 1SK8A 1RPTA 2WWRA 2P6NA 4LBWA 5JH7F 3HVKA 4K6MA 4R3NA 4AAYA 3OO0A 4I36A 2XB0X 1L7QA 3PQ5A 1VQPI 2AE2A 2CSUA 3U16A 4CN9A 4UVEA 4LRXA 2BGKA 4M36A 3R3WA 4M0CA 1BOBA 3I9KA 3JZIA 3LSYA 4FFBA 5AXCA 1OYWA 4JLSA 1OCOH 1F5SA 2JVKA 4X8LA 1YS6A 4UE3S 3VDRA 1UWKA 1UK9A 3ME5A 4OQXA 2X0LA 2DMQA 1TA9A 2P2ZA 3CVJA 3CDLA 4G0VA 1ITZA 1CJKC 3HFSA 4FEAA 1XZBA 1CVLA 4C87A 1LE8B 2UUAB 5KTPA 4YP1A 2H0RA 3KP6A 2FRDA 2I71A 2WHXA 3ZGKA 4YIFA 1Z2CA 1ANKA 4M7PA 1WKVA 4NYMR 2HA3A 2YHAA 3VZBA 1ZA1A 4LSMA 4EYQA 5JDIC 1FMFA 2EIJH 1CF7B 1JBQA 1RIIA 3PX7A 2AT1A 2HBYA 1I27A 2IT1A 2PS9A 3GDFA 3U7EB 4CLRB 4EG0A 4HNVA 5ARCA 1FRFS 2XZDA 1EWRA 2ERCA 4WCFC 4NKRA 3H0GJ 1BSVA 1DJOA 1E4EA 2AFIB 4NG4A 1M54A 1GG9A 4ZALA 3QLUC 1CR6A 1W7PB 1VJ5A 3WNCA 4IIXA 2ZIUB 4OBBA 4LOCA 2WMDA 1G16A 1NC3A 3WGUA 1OA1A 1QHGA 3WLSA 2YYSA 5J2TB 5JS8A 3S27A 3F6EX 4C4TA 5AK5A 3QRFF 2XCUA 1YX3A 2ESNA 1NA5A 2IYPA 1NR1A 3PIOF 2XDWA 2ZLBA 2HNBA 3L06A 3FHLA 5CPFA 4ZZ1A 1NN1A 4PX9A 1MAUA 2QSZA 3CZRA 4Z3DA 3URKA 3BR0A 1QZXA 3S5JA 3X1WA 4IQ4A 4R68A 4LWQA 3I01A 2O20A 4L78A 1N0UA 2NS7A 3QWAA 3HCEA 4CKEA 2IAIA 3OLVA 2XNHA 1RWXA 3LCVB 1BE8A 3LK6A 3HXMA 3SQXA 2IYLD 1M8JA 4DZZA 3PE4A 1IGNA 3LUGA 3RLFA 4GLLA 2LF7A 5JAUA 2EKQA 1OXSC 2AG0A 3OA0A 4LSGA 3TAHA 2H4XA 3O7WA 5TGZA 1R16A 3JWJA 1JE0A 3JCUC 3GVHA 2VCYA 1DIBA 2A07F 1EG2A 3A10A 2OV3A 4FQ8A 4IJQA 4ND8A 2X42A 4FYYA 5ALNA 5DO9A 1XSXA 4MUIA 2CNNA 2O5CA 3OCCA 4HDNA 2NVUA 4ZZDA 1DIGA 1P2BA 3MA0A 4ZCMA 4HWSA 1SZPA 3OE4A 5TEVA 5CT8A 4Y3UA 5BO5A 4CEIA 4CCMA 2G5PA 4ZYUA 3I01M 3WK7A 4D81A 5KQMA 5IM4A 4G1CA 4Y2HA 2EL9A 2YHSA 4AX4A 3AHGA 4GWGA 2QVBA 4L75A 4HN4B 4LHXA 1M2VA 3OFVA 4MLOA 2G1JA 4GX5A 4JJAA 3QVWA 3LK7A 3EMVA 4R0MA 4EPRA 2O3RA 1GQYA 3WL8A 2BCJQ 3EAGA 4A03A 1K68A 4X63A 3A1YA 5LKRA 5I7SA 4LG1A 2EKPA 2M34A 1A0OA 4AG5A 1O94D 4BVHA 1A2QA 2LNDA 4INPA 4B7ZA 1CPYA 4M83A 3HDJA 3SYKA 1K1EA 3NBAA 4H3KB 2AWOA 2AYXA 1I0ZA 2CFRA 4IGAA 2WFLB 4IFEA 3TJZA 3DCFA 1K97A 2DK8A 1NRIA 2BFCA 3NRVA 5LZ8A 3QEKA 2I3DA 4XD7A 3ZWPA 4U7GA 4JI4B 3D7KA 1C0IA 1W87A 5H20A 1FU8A 4OKSA 3FIWA 4UULA 4H7IA 1GPKA 3QVGA 3AR8A 3CVOA 1D8TA 2QN1A 3CTMA 3LZ6A 3HWSA 5I7RA 1T5BA 4P82A 3HACA 3OS2A 1KH1A 3FBIB 3WR5A 1WNTA 2QE6A 2EU8A 4Y6PA 3VJMA 1E2UA 2XD4A 3QP9A 5FBLB 3T94A 2PCJA 1SA0B 2J5RA 2Q1XA 1RACA 2VPYA 3VC1A 1G5TA 1ICEA 1K9VF 4DDKA 2M6LA 4B31A 2D1YA 4EEXA 1ZARA 1HL3A 3ABMH 1H93A 5EI5A 4K81B 1JP7A 2IUSA 2W6OA 2ZRCA 3QFFA 4GIBA 1RRMA 5FOXA 4CMEC 1HE1C 2C96A 3W2AA 1L5SA 2PFGA 4QG3A 5CDTA 3M4OJ 2J6HA 3P20A 1L9KA 3AFHA 3EUEA 2FW8A 1K4MA 1KQGA 2VQFB 2CB0A 2VVTA 2NP7A 2RGBA 3G0DA 2W25A 4L8WB 4MGYR 1ZN8A 3JRCA 4M3NA 1P17A 2P3SA 2NSLA 1IG0A 1LRLA 4JLBA 3RYPA 3CXUA 3MINA 3GJ6A 1IXYA 2VG8A 1JI3A 2Y67A 3Q9UA 1O96B 4UZFA 2CVZA 4CCSA 1GUUA 1VMEA 1YJAA 1PTJA 1YOVA 3PA8A 2Q7DA 2G9NA 4D4MA 5KAFC 2DFHA 3KNZA 5KYVA 4J0KA 1IBMB 4U7PB 2OYRA 3RG2A 4XQEA 5KHLB 1JALA 3IVCA 1EVQA 3HL2A 2BY1A 2JCYA 2ZYGA 2EZUA 5JUWA 4M9XA 2CQQA 1R3DA 3GGDA 4LYAA 2IELA 2CXOA 5D3QA 4HQEA 3UQYS 4BZXA 1GU1A 4OU0A 2XF7A 4KZPA 4ZQCB 4C4PA 1WZEA 2EFQA 2DSNA 2VAMA 4PYLA 5HJ7A 4AU7A 4B47A 2I2FA 4MV0A 4YAWA 3V4FA 1JI8A 2ZR9A 1BKDR 2H54A 2VNJA 4JA2A 1I1SA 2DMRA 1GNSA 2P7CB 2G0AA 2VUSA 4K8RB 3BM5A 2D5BA 3K0KA 3SI7A 1F8GA 1QV7A 3TO7A 4YAIA 4NOJA 3TQNA 2WKRA 3E7FA 2JCXA 4R54A 4Q9NA 1XEWX 1N2SA 4YJ3F 5CP8A 4X7MA 3PQ3A 1QZEA 4Q3EA 4CCYA 4FYKA 3ICQB 2EIMH 3PQ8A 4PQFA 1QE3A 4IJUA 2VPIA 1OKKA 3VR0A 4ZVLA 1AUPA 4DOZA 3I9JA 2W42A 3OIPA 1IOVA 4ZO4A 3UOWA 3OM9A 2HPIA 1A7UA 1CIJA 3DT9A 1RLOA 4JWTA 3AY3A 3G8YA 3X1ZA 4CMCA 4U3JA 2JRTA 4ASNA 4FE4A 1MC1A 2NX2A 5FUMA 2RHDA 3AYXB 4ABTA 1H2YA 3PP8A 4KR3A 3ZDXB 3ICEA 1S01A 2P77A 1W581 2L01A 2OMKA 2VQSA 5CYFA 5BQ5A 1PL6A 2DQ4A 2OGZA 1KU6A 4ENPA 4RM3A 4UHBA 2FETA 3ZR8X 1YRYE 4QPOA 2D7CA 4PG5A 5DISB 3RIGA 1XCOA 4RPKA 5JS2A 1V26A 1J0AA 3AW9A 4B45A 2H9AA 2CT8A 4BE9A 3WDKA 2AXPA 1GCOA 4GM4A 1SXGA 1NKVA 4V03A 2V1XA 2O8FA 1X13A 3TD2A 1E3WA 1VSTA 2GD0A 3OQVA 2PX4A 1AT1A 1XGSA 4HX9A 4YYEA 5JLAA 4KR6A 3JYOA 3LDUA 3UYKA 1AS2A 1VB5A 4L5EA 1VBMA 4MWGA 1H9GA 1T1SA 2VBYA 2BEUB 1D4FA 1Q6YA 4LZJA 2FQWA 2IKQA 4WLUA 3ITKA 4BDYA 1WDWB 3QEBZ 4OQFA 4WK2B 2E2HJ 1DWPA 2D1RA 4EAAA 2VDOB 2ZUSA 5L3QA 3SHFA 5JHUA 3FPGA 2HW8A 1ZICA 5EGSA 2C2OA 1N6PA 4ARZB 2QLMA 2X5XA 4OYYA 1IC6A 1K8ZB 4UUQA 3TLKA 1M0SA 3S32A 4L8VA 4BNYA 2O1XA 4XLHA 3BZ6A 4X91A 3JATA 1A5ZA 1JGSA 1OBOA 3GEMA 3WTUC 1IY0A 2HS5A 2QJRA 3A9RA 3LCCA 4AJLA 1HBXG 1QS0A 1ODLA 2VEOA 2JVHA 4DNCA 3UGQA 1E79A 3VU1A 1CZNA 2EL7A 2GLXA 2PH3A 4JBHA 4PONA 1PVDA 3QKSA 4RHEA 4OH1A 4UAGA 5H81A 4KPFC 1I5EA 2CVHA 3DL0A 3L0YA 1XEXA 4WKBA 3T3DA 1H69A 4I55A 2RHHA 1ZREA 2OWEA 5C5EA 2H8KA 2F5EA 1JKPC 1KFKB 3D43A 3ODPA 4AJOA 2JH3A 3D6FA 4BJ5C 2WYOA 4RTJA 2IY9A 3QPHA 2GB4A 2G0NA 5E8IA 2AG6A 3NTXA 4Q4JB 4B4UA 2CD9A 3KTAA 3SZUA 1NM5C 1U8RA 3C45A 4PZEA 4DA6A 4DBVO 1PT7A 1E1LA 3OJXA 4PLYA 1ORWA 3WWOA 1GA1A 1TK9A 4Q02A 1ETYA 5FRNA 1E99A 3F96A 4GSLA 1FU4A 2V7UA 2Y92A 3RFUA 2XQKA 1E4OA 1EQAA 2PMEA 2AFVA 2WY8Q 1GADO 3RC2A 4CT4B 9ATCA 2CDRA 3AL0C 1KNQA 1MFPA 2L18A 3EFOB 3EQZA 4M0FA 2K4BA 1QGUB 2PJZA 4MUFA 1TQ2A 3ZNNA 4R51A 1LEAA 2VRCD 2VO1A 3LXUX 4A5SA 4OH7A 1TMKA 3PUVA 5ELXA 4YDQA 1HKUA 4QBTA 2W2LA 3EXHA 4NATA 3PNTA 4W5HA 3RTDA 3OZCA 1PT8A 2ZRPA 3IUYA 4EGQA 4UY8I 1SD5A 4FI3C 3LC1O 3USES 3EH1A 4I08A 5EFOA 5HWSA 4N7RA 3OYEA 2BFFA 1Q0QA 1L9XA 1N1EA 2JGDB 1P0PA 3NM6B 2QENA 2OFWA 4NDZA 3SM9A 3SG0A 3V1YA 2P7IA 4EH1A 1KEUA 4H15A 5JXJA 5BN4B 1SHZA 3G2NA 2F8TA 3OR2C 2KQRA 3LM8A 3O8RA 2V55B 3B9BA 1COWD 3K6KA 4GGMX 4Y33A 2H2IA 2QVCA 3CF5F 1UMCA 4DPMA 2C1ZA 3NC4A 5CEEA 3UJ7A 5AKGA 1M1ZA 1BR1A 3KSZO 2J8ZA 3KT8A 3PQ6A 1J70A 3AY6A 5CNKA 4MPTA 4CNBA 4LAFA 2OFPA 3I1FA 3R7NA 1TB4A 2DECA 4LI3X 1QVTA 2DMPA 2NNWB 3CLUD 4QELA 4HF2A 3K2AA 1A35A 2RB4A 1JIVA 1U5BB 2VT7A 3GP3A 4YCBA 2A9KA 1DO8A 2FI1A 2HJHA 2Q3EA 3VOSA 1N2CE 1IRGA 3CCFA 3HOZJ 3RKXA 3B5EA 1PL7A 2DHCA 3Q7IA 5DI3A 2Q3JA 3K4QA 3OT1A 1MRNA 4BMPB 3TYXA 4P36A 2RI1A 2DOEA 3ESCA 4UTZA 5SICE 3WWZA 1QORA 2BGLA 3JY6A 4TM7A 4NCAA 4UVIA 3G2OA 4ZMBA 3HRKA 4TV8A 3JD1A 1R7JA 1J5PA 3I4FA 5AW1A 2VUIB 1FUYB 3NHKA 4PR3A 2XADA 4YRVA 1J49A 4AZWA 3EDCA 4RA9B 1UM9B 3FXKA 1HORA 1NI3A 2OQIA 3TZKA 3CONA 1WXFA 1YB7A 3ZKWB 2QG9A 3AJ9A 3BFVA 4BVLA 3GRKA 1KO8A 2AOTA 3PEEA 4GE0A 4MVCA 4QYIA 1PU2A 4RIGA 3GBVA 5EP2A 2HD4A 3IRQA 2HIAA 2QAGB 1ZD2P 4CG3A 4N4AA 3OZIA 2W24A 1ODFA 4FZ5A 4LFBB 5KNDH 2BP7A 4JBLA 3S44A 1O08A 2W00A 2FEXA 4L0YB 4Q4JA 5ECYA 3K32A 1RXIA 1AWCA 3KPYA 1O95C 1K4TA 1R22A 4IPAA 1XRQA 3GUZA 3TLXA 3F8MA 2WHEA 4UCQA 2F3PA 2KBEA 2XA9A 1NF9A 1SVNA 3LPMA 4PGFA 3SC4A 4BECA 1N33B 5CVTA 3QAHA 4HPQA 2A69F 5KNLA 4RKQA 4ZZ2A 1KKMA 2CHEA 5FPKA 4CEJA 1T26A 4LZPA 3FDYA 4QU5A 4MR8A 2D59A 4JQYA 2SKDA 2HSZA 1BC5A 3ABUA 5IULC 2ZBUA 1Z6PA 2R751 4GVPA 1MHPA 1V96A 2NU7B 4DGWB 1BQ3A 5IOZA 1L5GB 2CFSA 2V4MA 2VFAA 2RAPA 5E4TA 1RCUA 4QWWA 3DLBA 3ZJVA 3SS8A 1W7AA 2M1BA 1GJRA 4C2MJ 1QYXA 2I5PO 2Q3FA 2WJVA 3BRWA 3OUUA 3PTZA 4Z4CA 1PEDA 1KVTA 5IYZA 2V97A 2GXSA 3QHPA 1W49A 1YR8A 4UBKA 3CCLI 3S2UA 4QARA 1MDFA 3BWMA 3MF4A 4AIRA 2QRJA 3I0TA 3OZXA 1E5LA 2RKWA 1ORRA 1O3SA 3IAS6 4CH7A 3L8EA 1CS0A 3QF7A 4KV9A 1Z6TA 4HRVA 4D6XA 5EXTA 3EBLA 4G5YA 3ABTA 1D7OA 1BA2A 2JSCA 1YRLA 2PUHA 1GLNA 1XTUA 3EPPA 4HADA 4AC9A 4DW8A 3TGPA 1XRSB 1KONA 1NIJA 3KLNA 2HPZA 3VZQA 4EHDA 2NMVA 3X1JA 4B40A 3B2QA 3Q2OA 1ZUNB 4IOJA 1ZVQA 4XVUA 1EB8A 3F8FA 3PDJA 1A8SA 2FE4A 4LD5A 4F8YA 2PLYA 4IXWA 1E3WB 1GU0A 4KFCA 3HB1A 4K2EA 1V3VA 2AOUA 3K0CA 1LX6A 1P7YA 2Z5VA 3DFFA 2IDKA 3CMYA 3LS2A 4KMFA 3MERA 3OQBA 3QF4A 4O8CA 5JH7B 5ILUA 5L6MB 1EUCB 1QPBA 3TZEA 1QGUA 2G04A 1E5QA 1RR8C 3DE4X 4W1RA 5F1YA 1OXTA 1JHOA 3WB1A 3BD6A 4OX9Y 1XEFA 2QTLA 4ARBA 3ZQGA 1CQTA 3ACCA 2L9VA 2CCKA 2FB9A 1JKOC 3H6GA 4FJ1A 3RJ9A 3UH0A 4DMRA 5B2EA 4X66B 1P60A 4V0NA 1OC2A 3IAFA 4AJ2A 3OOUA 4MTDA 2C94A 4TLEA 2LCQA 3G6WA 3SHWA 3J81k 4Q4ZF 4Z0HO 3BILA 4QUBA 2RAEA 1OSNA 4ZOCA 2L2OA 4A6EA 1WY5A 2OK8A 1YIAA 2VDJA 2ZB3A 4YB8A 4YCLA 3PEWA 1KH3A 4EKYA 2FPSA 2GO1A 4EUEA 1A2BA 2R84A 1WULS 4AURA 3Q11A 2KPMA 2VZ9A 4J0IA 1V1RA 3A32A 2VAWA 5JAHA 3H9EO 2WUVA 2V7FA 5FPYA 1W0JD 2ID6A 4I1PA 2IYWA 3BE5A 3KIOA 3PUKA 3QE0A 1Z7WA 4V24A 4RCYA 1NQOA 4IV5A 3BMQB 4YO7A 4U00A 1HYBA 3VV3A 5ILVA 3HOYJ 1XYVA 1LPSA 4OY3A 1ZHFA 1IE3A 1ZIOA 1V7ZA 3DDZX 5CFMA 3L4BA 2G40A 1SD6A 1ISRA 4XL9A 1FOEB 2B36A 4QTTB 1SUCA 3UB4A 1ACJA 1O5TA 4Q5IA 4MIMA 1OI4A 2G5CA 1XMVA 4WZBE 3TP3A 2AEFA 2R8PA 1JI0A 1SZJG 1VGVA 1KARA 1L4GA 1WZCA 4JEUA 4CLHA 1FMCA 1SNYA 1ZNZA 1YI0A 2P0AA 1O57A 2WFAA 2X3UA 4LZOA 4OL0A 3KBOA 4AO8A 3OL4A 1T1EA 1FEXA 3BZKA 2CQ7A 2O48X 5FGMA 2R7RA 4UJ5A 3N28A 3DBRA 5AD1A 3GLGB 2PJUA 2ECOA 3KD2A 3UK6A 5E3OA 1G20A 4OKNA 2FXVA 4AO6A 4OJTA 5AVWA 4ON9A 1ZG5A 2AS5F 3IMFA 1J8FA 3JQAD 2GK4A 4O4IB 2K9SA 3F5DA 5MN5A 3E7XA 2B4RO 1X8JA 3RJPA 2YBDA 1PP8F 2HMYB 4BDZA 2UYGA 4HDRA 2HQSA 4JL8A 4KVAA 1IN8A 5CB4B 1KR2A 2GDZA 3K0AB 1TGYA 4C2AA 2HYIC 3G8CA 4V0ME 4AUEA 1T9AA 4QGSA 2C4UA 4CDRA 2EGHA 1T98A 1DQNA 2FZ4A 3I0MA 3W4JA 5TMPA 5ALXA 2XHZA 3QVJA 1NMQA 1TXGA 2YN2A 4YQEA 1JA9A 3R8CA 2EFCB 5HQ3A 3HLKA 2RH8A 3GUCA 3OMLA 4RGVA 5FB2A 4UM9B 3RYFB 4KRFA 4M1KA 5LGUA 1C29B 3HU2A 4P08A 4WVLA 3PC8C 4XB2A 3A4LA 3CBGA 5EWJB 1ZMTA 2Q0HA 4LYEA 2C3UA 5JE8A 3R7SA 3GX1A 3H5LA 3EZ2A 4NHEA 2X0IA 5EIEA 1IQUA 1LLDA 4CQLA 2BTQA 2JGEA 2VF4X 1GZSA 3OEWA 5D85A 2B5OA 2XXAB 1XAHA 3LSKA 3H0EA 4HA8A 3D3NA 3EIHA 3JRNA 3PNQA 3R0XA 5DM2A 2ME0A 3RWMB 3G0OA 4E1VA 1G8XA 4CF3A 5ANRB 2QT9A 3G1OA 3T3NA 3TFOA 1ZONA 1R6TA 1WU7A 3J80A 3M4NA 3MKZA 2ME6A 1GPAA 4ZC1A 1K6IA 2TDXA 2FZ5A 2PZKA 3ABOB 3O73A 4QRDA 3UCFA 3W05A 2UDPA 4AWXA 4C20A 1N5MA 1P3JA 2D7JA 1H2HA 3WK8A 3GELA 2VYVA 4HWGA 2FE3A 5FPSA 4OHZA 3WYFA 4IXNA 1Y5NA 4NYIR 5A62A 4FHCA 2Q4DA 1Y6ZA 3LLVA 3DF7A 4QBKA 4R3UC 2P9FA 3DUWA 2FNAA 2JASA 1GVHA 2MWMA 3RYTC 3M4YA 2D0DA 4EG6A 2CV2A 1M3SA 3IIIA 4EKEA 3O1IC 3STYA 1SZDA 1SKAA 3L49A 1FP1D 1DIAA 2M98A 4X24A 5DRTA 5EE3A 3ST7A 2BJWA 1Q5PA 4WINA 4EQ6A 3ENVA 2AJ8A 2R44A 3WJ1A 3GP8A 5CYVA 1J8MF 5KVCA 4FFOA 3WLKX 5F3WB 1Y4SA 5JMTA 1G4UR 1X9GA 4KDEA 3X1XA 3FGNA 2KM1A 1NBME 3O2JA 1HNNA 1TC1A 5DW3A 4KLNA 1T4MA 1YULA 4FNGA 2FLKA 2NZXA 3E22B 1DNPA 2HM7A 3IBYA 2PO7A 3R6DA 4DUPA 5CDGA 1XDDA 1DT5A 1YKSA 3B20A 3GRZA 4KQ2A 1UCRA 1MJNA 1RYNA 1ZH2A 1IM2A 1H94A 1YQTA 3B2EA 1MJHA 2WP8J 4NHJA 5CLSA 4R2MA 3AG2H 3DDWA 4WUTA 5A5VA 2DT5A 1DEXA 4XUGB 1QSGA 4L2IB 2V6BA 4A0SA 2M5WA 5KSYA 3VHXA 1L5HB 3FTCA 3KKQA 1DMRA 3BD9A 3TLBA 1GAWA 1W8DA 2DCEA 3A1EA 2LH9A 2IPXA 5DZSA 1AN9A 3FNQA 4MRRA 3OM0A 1CUBA 1DEHA 2ZBGA 2EV6A 1MJFA 3PWTA 4FK8A 4NEQA 3GNLA 3TNDA 3WQBA 4AT1A 1M6NA 3DHYA 4OGGA 1A72A 2VWPA 2UV8A 1O5IA 1R6BX 5KI6A 2OQRA 2H4YA 3EYYA 3U3OA 3WSWA 1CJUC 1QE5A 2PZBA 5BN4A 2D74A 5LA6B 1H8HD 3H6KA 4BWGA 4HN9A 1J33A 1NSTA 3SKYA 3BQYA 2QZJA 3MWDA 3OLCX 4Q1CA 3PX2A 2VH1A 3CPHA 3IOYA 4KL8S 3C5VA 1JQ5A 1EK1A 2WOOA 2IF2A 3FJ1A 4KTVE 4MQEB 1ISIA 1TQ6A 1IXRC 1V2HE 3SICE 3OQJA 3QODA 2R6R1 4MMZB 2XZLA 3NPAA 3RUIA 1VCMA 1E4EB 2AFIA 4PHTA 4BACA 2M1ZA 4GZ5A 1OZHA 2FXAA 3GLXA 2CMHA 4UUOA 3RYHB 1PEKE 5HDQA 4ZT7A 4DR5B 3B2NA 2QGNA 2FBKA 1C1HA 3JXEA 1F8UA 4RD2A 4M55A 4P4GA 5B1BH 5GAGJ 5CT9A 2NVYJ 3BQZA 3M2PA 3V4RA 3WRXA 1I94B 2R00A 3SZ3A 1MJGM 4J7XA 5AK4A 5T3UA 5L45A 3ORSA 4MIYA 2JT1A 3D0SA 1DU4A 2F1HA 4J0DA 1UJ8A 3S1RJ 1UC8A 1FMWA 1Y37A 3IOBA 2QTZA 4HQFA 3H18A 3VPFA 1KEPA 5CDSA 2ZMEC 2AEMA 2ZYRA 3JALB 4J90A 4R0NA 4RS8A 1XZDA 2WUGA 3AH8A 4GKKB 1AQJA 5ALDA 4UQOA 1PNVA 5AI4A 1E3QA 1SUFA 4GX1A 3CJRB 1ZRSA 3DUFA 3ED5A 4J4HA 2WB1N 3DPTA 3HL0A 4PRYA 3ZD8A 1L1RA 3DP9A 4PYNA 2MD5A 1B8IB 3MILA 1DEKA 4GZ3A 4UHJA 1JHYA 2EWVA 5DM1A 4BO7A 3QVKA 2JN6A 4UV9A 4NE7A 2M4KA 4PEVA 2C2WA 5ALOA 2F2EA 4EJWA 5AM4A 3MJFA 5DBGA 2E1RA 4TV7A 1LJ9A 4NC8A 4YHBA 5ERIA 1US8B 3NEPX 1RFGE 4V19K 3JAKB 2QD3A 3IJ5A 1EUYA 1RADA 3HYCA 3I5AA 5JD5A 1XMJA 3UK7A 4AY3A 3DR3A 1P2TA 2ZBFA 3KOXA 2NUTB 2D06A 4J76A 4HEA2 3K1MA 4ND6A 4ZCLA 1U2QA 3WLIA 2I67A 3I76A 4K9OA 1JPUA 3QU7A 1MBZA 3R3XA 4YWHA 4Q47A 4U2FA 5D3ZA 1U1EA 2CN1A 4GFDA 4I8IA 4O8ZA 1P19A 1G3UA 1IZ1A 3IH4A 4CEHB 1XGMA 4LX0A 2WAXA 2KMUA 4HNQA 5K7HA 3AIMA 1Z2EA 2RG7A 2HK9A 2HIGA 2ID8A 3CRVA 4ZOLA 2BM1A 3J7AC 5K8LA 4OL9A 3V8VA 4JZKA 2L7FP 4L85A 2HEGA 4H4EA 4V1CI 5T8KC 3TRIA 5F78A 5D1HA 1G8PA 4Q3DA 2IQIA 2HXOA 1GGJA 1I4DD 4JLOA 4ZYEA 4A8JC 3C3DA 1PZXA 1QH1B 4YV1A 4RAGA 4MQUA 3RVSA 3X43A 2CBZA 2MD0A 4KSBA 2X40A 4B7AA 4BVGA 1R8QA 2ZE8A 1X1RA 5JZOA 3CLSD 4TZKA 4ZARA 4WBNA 5CBKA 3I32A 2O9JA 1XWIA 2YNMD 3LH5A 5GVSA 3AVUA 2J9ZB 2NZ2A 5DHQA 3ND6A 2O8BA 2Y3IA 1R23A 2FTKE 5HKLA 3HJFA 1VPEA 2W5UA 3JARA 1O7FA 2PQ0A 4YJGB 2DU9A 3U6KA 3KR2A 4MUAA 2V6CA 4QQNA 1KQPA 4EI8A 3K9TA 3C7CB 6ABPA 2HSWA 1DKMA 2FEAA 2C29D 2XUOA 4HDUA 1S2DA 1UFOA 3W5HA 1SD2A 3MTAA 2EB7A 1ZNXA 1RXSA 3J81K 2O52A 1JBEA 3PIIA 5DHSA 1V95A 3RPUD 2IGNA 1Z6XA 5I9TA 3P9RA 5IXYA 4K0RA 5CVUA 1VSVA 3KLBA 5FBWB 4ETIA 1RXWA 4DZTA 3ROGA 1BS2A 4XVRA 5H3HA 1TW2A 2Y69H 1A8UA 1FU7A 4IDAA 1YQXA 2QUHA 4IRMA 3BK2A 5HF8A 3SIWA 5K0NA 4M60A 2VDWB 3CY6A 4NEHB 1RXVA 1S7GA 1EV7A 2RJOA 4MEXF 1ORHA 1XOIA 3HM9A 5LLQA 3IR6A 4CBVA 1GUBA 2AKYA 3ND7A 1X8LA 2H57A 2K5UA 2H31A 2NNLD 3CW2A 2R0QC 3EVZA 3C0KA 1FE8A 1DAMA 3RWOA 2ODWA 2QTBA 2WSBA 3CR7A 3VPHA 1QKIA 3EDYA 5IH7A 2VP4A 3T5XA 1Y33E 3HCAA 3QPLA 1S72I 1UBGA 4HAUA 3MRVA 3ORFA 3QSGA 4MUYA 4NZMA 3V4GA 3S68A 2XH8A 4LXTA 1B6GA 2EJTA 5GOZA 3DKPA 4D9MA 3S16J 4I99A 2MINB 4HPXB 4L5BA 4D9BA 4KISA 2X19A 2LR0A 2VSNA 2WYVA 3P96A 2Q50A 2RBGA 2IF0A 1JLSA 1UBHS 2E6UX 5JO9A 1J2UA 2ETXA 4TKZA 1RI5A 1TMOA 1V1RB 1P1FA 2H1FA 4RACA 4CG0A 3VR2D 4YR9A 5CTAA 1YF3A 4TTPA 4U39A 2G07A 4I6ZA 3V7RA 3KAJA 3ZCPA 2KWIA 5KAIC 1EQUA 1FXWF 2XAFA 2H5EA 4IIEA 4KBFA 2NUPB 2QQ8A 1KTIA 4MLPA 3LOPA 1L7XA 2DHEA 2TRSB 4RHCA 4NUBA 3B52X 3RS2A 4FEEA 3W5AA 3V7SA 1KMNA 5BOSB 5KHAA 3M8EA 4AYBA 3GLHE 3LYLA 3GTKJ 3FPKA 1N2CA 4LE2A 4IDHA 4RB2C 2GYYA 4Z99A 2IHYA 3LYHA 4MYTA 4OO3A 5HM8A 3KDAA 1PL8A 3W2TA 2GHTA 1FSPA 5FNZA 1B42A 3DLIA 3KZCA 5FPHA 1GPLA 2VHTA 5TMBA 3TUIC 4KOAA 5IX8A 2YH2A 2VHWA 1NRWA 4X84A 2XSZD 3TIGA 3LO5A 4BO5A 1DG9A 2RCYA 2FMHA 2X0EA 4PGMA 2J1LA 2HCTA 3JZDA 3T1OA 1W36D 1JLRA 3E9YA 1KTVA 3ROKA 3HIFA 4C07A 1VM6A 2JA5J 4FNMA 1XS9A 4HDSB 1YJBA 1O6BA 1IJWC 2HKXA 2CMKA 2XOKA 4MGHA 5FFNA 3FK7A 3KLOA 1V11B 5GZ6A 1K7AA 1AJEA 1AKHB 2CXXA 3DT8A 3RTCA 5K8TA 1GUYA 5FLXZ 3KSUA 1KERA 3A6HA 3BMNA 4HLUA 3I4PA 1LQ1A 5IP6A 3R5XA 1Y7HA 1YHZA 4QGAA 3QK7A 4R8HA 5EXSA 1T4CB 1THMA 3R9XB 5IDQA 3IAEA 4F21A 1GXSB 2RVCA 4Q4HA 3II6X 1PYOA 4FCCA 3HXPA 2LXNA 1E1DA 1Z5ZA 2GCOA 3KR9A 3ZXIA 1E6CA 4ZZ3A 3K4LA 1QB7A 4UEKA 2IOQA 2Y0EA 4PZ0A 4MO7A 2MYPA 1AURA 4G09A 2OXFA 3BDAA 1YZYA 2YS9A 3HWRA 2OD5A 3WMGA 4CG1A 1HW2A 1XMIA 3FXRA 2ZKLA 5BV0A 1C0LA 2P40A 4A3DJ 4AF7A 3G88A 5I4CA 1AA9A 4G9EA 3CVXA 3FM9A 4EVIA 2CLOB 5G4KB 1RZRA 4BGUA 4UM8B 3I9OA 3BBLA 1NULA 4MRSA 2I8AA 3E8MA 5TT1A 2QPOA 5AVUA 5ITVA 3IO5A 3PFKA 1QF6A 3SR0A 3BK7A 5A2QA 1Z6GA 2FOKA 5EEAA 3IQFA 4Q9JA 3F8TA 5FOWA 3U37A 4QTUB 3LA7A 3UWOA 4BU1A 2EFJA 2Q45A 2WVGA 3BXPA 3EIXA 3FR8A 3HEBA 1MKMA 1N5LA 2EDCA 4PAMA 3AI3A 4POAA 3X1MA 4C43A 1QHSA 4C7VA 4G1BA 2O8BB 1QHHA 2ZJPF 4YGYA 2LW7A 1FDWA 4UEQA 1FSFA 4URYR 3CXRA 2VOPA 1T8IA 1ZQ9A 3FMVA 4P38A 4DT1A 3L7OA 1D4OA 5FOUA 4WLFA 3TS1A 3HK2A 1WD5A 1D7AA 2CW7A 1DELA 1A31A 2PEYA 4DBLC 4LJSA 3AUXA 4RQBA 3A9WA 4ZYZA 4A36A 1VTNC 4KSCA 2BL4A 1Q1EA 4S2UA 4GVXA 5LUBA 3DKYA 1OD6A 2FFHA 2H4FA 4J00A 5GTHC 2E19A 1CQPA 4MR9A 4GGOA 4IQ8A 5DVZA 4NBQA 2D2IA 5EJFA 3UAOA 5C18A 1N8NA 1JJVA 1NF8A 3CEPB 3PYXA 2A0FA 1VHLA 2WU8A 3UGKA 4AK9A 2ODAA 5A6SA 3MQ0A 1T4DA 3LQKA 1J00A 2AQKA 1RI1A 4Y9SA 1G0NA 1H2EA 1PK9A 3HJTA 1GPUA 1WEKA 3VYTB 1FCJA 5FO5A 1P80A 3C3WA 2P0WA 4L9SA 2P1DA 2W2VA 2BR4A 3WX0A 1JKXA 1MB3A 4PIPA 2GBYA 1K8XB 1YVPA 3I9V1 4R9UC 5AT1A 5TR9A 1NVEA 4L4ZA 3DWEX 1ES9A 3ZIUA 3ZZTA 4JX5A 3A1SA 3GGCA 4QTXA 5DKFA 3K6SB 3R7AA 2CMPA 2NVUB 1NDUA 2NO0A 1W4CA 2X8LA 3L5KA 4NOMA 4WASA 1YRAA 5CNIA 4AP9A 2JRCA 4Q9HA 2J85A 2ZJ6A 5BR4A 1P2SA 3DO6A 3FX2A 1E20A 4J29A 4NU0A 1IUOA 1YMVA 2VZ0A 3K4KA 4BEHA 2FX3A 2RDMA 2PPVA 1VJGA 1Y4DE 2O05A 1NUSA 1P7ZA 2HKIA 4YI3A 5LIRA 3LBNA 4Q05A 1TJ4A 4LS3A 4Y2VA 5DMHA 1DUXC 2GVNA 3KTFA 4EJSC 4QIHA 1M2WA 1MGOA 4I1OA 4P3KA 4DRYA 2XEDA 4CUKA 2AX4A 1B3RA 4OHVA 1YCFA 4N82A 4ARCA 5LU9A 2EV0A 3DQVC 4ND4A 3H4IA 3IXQA 4NECA 4ER3A 1H66A 4HLCA 4XJXA 3IIEA 4RDCA 4N5DA 5FWXA 1WCXA 3KJIA 5U9CA 3RS8A 1T6YA 2QW0X 1K83J 2XRNA 1PZEA 5ALYA 1R8YA 2AN3A 5EKTA 3RFVA 3AR9A 1AU7A 5LMCA 2Z6QA 2ORED 4WLEA 4L0MA 1M6EX 3B13B 1TD1A 2P6OA 2C77A 2Y27A 2OFFA 3V8EA 4P54A 2AOWA 1TC2A 3TR6A 5DEQA 2QRVA 1MHTA 2M30A 2HO5A 2PDAA 1Y48E 1ZUIA 4UD6A 3RFFA 3SF0A 3WHKA 1RWVA 2Q1TA 3B3QA 4F84A 5KQSA 5IYCJ 1VQ9I 1EVZA 5J6XA 1VQ6I 1LBIA 1T0PA 3ZWQA 4OHWA 3HGGA 1IDZA 3SP1A 1SCUA 1MD0A 1LA2A 3NONA 4OM8A 4TZ6A 4RYDA 3S2IA 1BTOA 4S3MA 2ZMEA 4IHTA 3FMQA 1ADGA 1GRQA 1IEXA 1HDCA 2C95A 3A1WA 1T2KA 3GT3A 5D5QA 1WUJS 5HF9A 2CLSA 3SX2A 2DK5A 3WLFA 4GSYA 4HBGA 4YT2A 1ETXA 2OV7A 1BJZA 1QKJA 2CRGA 1T9GS 2G83A 3LKDA 1RWMA 5EMKA 4DCPA 3QKUA 3N59A 3FFWA 3DDNA 3B1JA 3T7JA 4RQTA 2D0OB 4QX6A 2B37A 1EE9A 4E11A 1LJUA 1Q1QA 1Z7EA 2VP2A 5GTDA 3RUEA 3IAM6 3TZCA 3FWHA 4DMMA 3WMWA 1SUEA 4B4DA 3EXAA 1E0DA 4PX5A 3ZCVA 1L8QA 3KALA 4AXBA 1RHJA 2WJGA 4FUTA 1WHTA 5FTWA 2D2VA 5H82A 2FJUA 3RSFA 3WAJA 1CE8B 3L2OB 1SKYB 3FXJA 1OX4A 2IOFK 2XMCA 4GBGA 4RA6B 5IJ0A 3ZQUA 5JNSA 4P3OA 4OIMA 1IN4A 4EW2A 2QBYA 2BGUA 1USTA 1A9PA 4XXHA 4AP5A 3LFUA 1MSEC 3CPEA 3I2JA 4M0UA 4FDMA 4JC0A 2DFPA 3L3BA 4YX9A 3ZNOA 1MTZA 2WWVD 3ZD9A 4JB3A 3HA5A 2O1EA 1Y3IA 3FISA 4B3HA 5K0GA 3MTJA 2HJVA 3PVZA 3PFYA 4TRMA 4MTEA 1FTNA 1JHHA 1ZK4A 221PA 4JJZA 3UAXA 2E21A 2F4NA 2FZCA 3V1LA 3ZGVA 4DLSA 4II2A 3ZZNA 1P4XA 3KQLA 2O06A 5KWVA 1I3NA 3PRJA 4IHQA 1A9RA 1FC0A 4HQNA 2VAXA 5JQWA 4RS3A 2NXNA 2CD7A 1AZTA 2ZB2A 3AETB 4KLAA 4A8JA 1JSLA 2OF7A 1DG3A 3BH0A 3AM3A 1N0VC 3PSAA 4IH1A 1HFWA 1QFMA 3NWTA 1T38A 3ZW9A 3BF8A 1R0SA 3O82A 4IS2A 1TPYA 4UBIA 5D5VB 3GFTA 1WUTA 3FSGD 4BLUA 5KNDA 2M87A 3VSLA 4D0SA 2PA0A 3O8HA 4TMWA 5ADHA 5IT9A 4B6PA 1M0EA 3M4ZA 3GGOA 4OI4A 4KC0A 1CEXA 1OXBB 4MRVA 2VTEA 1KEWA 4E21A 4EI9A 5F98A 2E1MB 1BHQ1 2EBHX 2AL7A 2OD9A 2NAFA 4RD3A 4DHWA 4G6TB 1HOXA 1KZ1A 4IIFA 5KYWA 3TWOA 3K2IA 3E27A 4F5ZA 2W1OA 2HOTA 2FK8A 1PZHA 1A5JA 3KYJB 4JLUA 2E89A 2MMCA 2OP1A 3A9UA 1CERA 1ZD8A 2YCBA 5JFGA 2IBSA 1LNZA 1Y39A 3AB7A 3V48A 3VH2A 1QRRA 2GT1A 3O9VA 1T8YA 2EBIA 4MUBA 3AF3A 4O4IF 4D4LA 5B55A 2OESA 3UKOA 1K6YA 1Y8RB 4BAYA 2EKZA 3LLUA 3UBMA 3O26A 1KY4A 2OP0A 3C3CA 1DOZA 3A01A 1SBIA 1EE2A 4A8TA 3RVQA 4ML3A 4F5DA 2NQTA 4HLDA 2EIKH 4L0ZB 1HDOA 5JLXA 3I4MJ 4G5OA 4E5MA 4PJLA 2E7ZA 3Q0TA 1AKEA 1JDBB 2UKDA 1LGYA 3G71I 1SEVA 2ZSKA 4YACA 3W5IA 5K0BA 3A4NA 1NNLA 1AO3A 2PZ8A 2UZIR 3HCOA 2IWRA 1OVMA 3PNMA 4MQ9F 3VYVA 5JAOA 4YQZA 3TFQA 4CQMA 4QOHA 1L1FA 1OLSA 5JVTA 4D5EA 1Z67A 3IEUA 4BVBA 2O2IA 1KWKA 2JK3A 1JHUA 2HTEA 3ROMA 3T54A 1HR0B 3ONVA 1OFTA 4J1NA 3RVPA 4L4UA 3H3VK 1Z83A 2D62A 3CJQA 1WHSA 3GEIA 5F3DA 4ANFA 4DLWA 2IX3A 4MRPA 3IUPA 3IESA 1REQB 4Y6LA 5TQ2B 4CKBA 3NWPA 4HWRA 1YL6A 1SG9A 3A0HC 3DTKA 2IEZA 3FKJA 1DMSA 3OIYA 4JB8A 5GQSA 1JPJA 4HNUA 3L79A 3I58A 3CEHA 2QU7A 2XZPA 3L09A 3HDHA 2DY1A 4IEEA 1P2UA 4NS1A 2JHGA 2NXEA 1TKCA 1WCIB 3K0CC 2NTNA 2K2WA 3O21A 4LV5B 4YJFA 2CFCA 3WRYA 5ARBA 1EDOA 3AHFA 2VBFA 2OHXA 3COVA 3DTTA 3FB1A 3KKEA 3PFGA 3RRNA 4F5EA 3CKMA 4TRNA 3ZQ4A 4X7PA 2HWXA 1S8AA 2QMYA 2BGTA 1KK1A 4LJYA 2Y2ZA 5DHUA 1LSSA 1X1TA 3V6LA 4D9GA 3TG8A 2Q6LA 1VHQA 2RHGB 3L6OO 3OFND 3VKUA 3VYWA 1ISJA 4J6EA 1WPQA 4UHEA 1VLVA 3CTAA 2BUCA 2IXEA 1DCFA 1KMCA 4IVNA 1ZCZA 4A12A 2C2GA 3ESBA 2QSJA 1JFVA 3P0JA 4FZRA 4IGEA 2FPOA 2OLJA 4BFVA 3STTA 3ANYB 4ZT3A 2MFZA 5K0SA 3HL4A 4QUHA 3M1IA 3GUVA 3OQPA 2QP3A 3HZJA 3C18A 2VTDA 3DOUA 3NBFA 4KQIA 1V4VA 5D7BA 4K9SA 2VXBA 3TW4A 3FF4A 1UB9A 4DRZA 1M2GA 3ZCUA 1Q0UA 5T4EA 1EM8B 1R6VA 3ZJ4A 4ZJZA 1PBNA 4PYJA 1ZQ1A 2AI2A 1PNOA 2HYDA 3U7RA 1VMDA 1F9NA 1YLFA 2AZMA 5JMWA 2EF1A 1GNQA 1SMKA 5TRTA 4CMHA 4MFDA 2VKQA 4RA6A 3TECE 1BEUB 1D04A 8ADHA 1ZPDA 3PNVA 2EJRA 2SCUA 2GPTA 3FW1A 3KKMA 2ENWA 1GDDA 1EFLA 2QAGC 2RGCA 5BWOA 1X8XA 4P32A 2VQEB 4QTYA 5G4LA 1J0RA 2XQVA 2XT0A 2F5FA 3I92A 1JG4A 2V1DA 1HA3A 2X0RA 1CQXA 3QPSA 2X9GA 3CX6A 3EVCA 4JX6A 2DULA 1NY6A 1NXQA 4PFKA 5DX1A 1SEPA 3L93A 4HH3C 5IOYA 4EEZA 1QRTA 3MFQA 4Y98A 2Q4RA 4JLMA 3G5AA 4K6HA 3PUFA 5K0TA 2MC4A 1LLFA 1S3IA 4IGFA 5GTIC 2HWVA 4H6PA 4K9NA 1W76A 2HXYA 4ENWA 3QPDA 3OYMA 1CZKA 1K0UA 3RKSA 1FTQA 1WDTA 1X1BA 4M71A 1GPH1 3C98A 3KU4A 3BQNB 3VR1A 2NU7A 3HE3A 4HD8A 1VQLI 2Y2VA 5AKEA 3GTMJ 5IKMA 1SKYE 3P4YA 2RREA 2KIUA 5K0LA 2ACEA 4UUPA 1DTSA 2AMLA 2G4CA 4H4KC 1CY1A 2HDOA 3EN0A 4EO4A 3TBHA 2YRFA 3PGXA 3N4MA 1ZYRF 3WGHA 2YU3A 3RLIA 3TKLA 2OCDA 2A59A 1RZRD 3VO1A 1TZKA 3JQBC 1ODKA 4LCBA 3E7DA 5JDIA 2CNWD 1B0ZA 3ZDZB 4N54A 1TQ8A 2P2LA 4BE1A 1OASA 2SKEA 3ITDA 3CQZJ 2O2CA 3NBKA 1LZKA 1YZHA 2I8DA 2M7AA 2IYSA 1MD9A 3QLTA 1YUBA 5E0OA 3G2IA 4PC2A 1JQBA 5EP3A 1I6LA 1NWHA 2B25A 2HLDD 2NACA 3A4MA 2QR2A 3GMTA 5H4GA 5DCMA 5JVGF 2BZTA 3GGGA 2BP7B 3TN7A 2QAIA 3KXDA 4C01A 1ZK2A 1K89A 2JAUA 2PNFA 2QG6A 4RK1A 1NX6A 1CP2A 4R1OA 2GD2A 2COMA 2MIIA 5E3MA 1WHUA 2CLMB 4ZYHA 3B7GA 3P9QA 4QRIA 1P5FA 1XRRA 3U7FB 1UQRA 1N3LA 1PUJA 5HW0A 1POXA 2BJVA 3ZKWA 1NT2A 4XKBA 1K7FB 1PSWA 1LK0A 2VP9A 2YJTD 3FSGA 1KJ8A 3OE1A 4JUFA 4MS4B 4TWIA 3Q12A 3M6LA 2XC7A 4F86A 3KSAC 2WQ7A 3DNFA 1BVUA 4FOTA 1GITA 3DOFA 2DBBA 2B1QA 2FN3A 2FW0A 2HT6A 3K5HA 2X48A 3WJ2A 4A0HA 2OK7A 4MUNA 3COPA 1FRQA 5ADVA 1WVMA 4P55A 2OORC 1MXFA 1LXCA 1DKQA 5K8VA 2DQSA 4UNOA 1DC7A 1G6HA 1XNHA 2H59A 3FOEC 1BAPA 1LKXA 4B4VA 1RQNA 4AL4A 1G3WA 1U5TB 2P6SA 1WR8A 5A2GA 4A3GJ 3O8OB 3T52A 1JECA 5TMEA 3V2GA 1NVDA 3U4HA 1OT3A 1EFAA 3K05A 3H2HA 5FEMA 2G7UA 2Y0BA 3GB9A 1Z4NA 3N8NA 4CIDA 1SXJB 5L7YA 2Q3CA 1QGPA 2DMUA 3R8XA 4QDOA 3CC4I 2W0SA 5JQGA 3B6JA 3UUFA 5ALSA 4N47A 1FFAA 4BFCA 4FCVA 5DDGA 3HM2A 5AW6A 1OFIA 5LOVA 2YQZA 3LRXA 5J4KA 4RAFA 1II8B 2XGDA 3CX4A 4DV1B 3F6VA 4NCNA 3UKDA 1IPEA 3EUFA 2QQBA 4TS3A 5K9ZA 4BAUA 3AI2A 4MEJA 3V7YA 2ZC2A 1JDNA 1ZUNA 1F8YA 2DTDA 4MR9B 4LXIA 3B48A 3ROZA 4JXXA 1HRKA 3ZMVA 1ZA2A 2V8BA 1QYWA 4HDKA 5LDHA 4FHTA 4ZT6A 2IPMA 3LKVA 2PI0A 4GMGA 4EJMA 1X7YB 1Z8HA 4Q3LA 3FXLA 2ONZA 4TV9A 5KVSA 1TF5A 4E5YA 4B3SB 2HSDA 3DCIA 3E5HA 2DFTA 1SHKA 2J3HA 3M34A 2O2DA 4K87A 4RB1A 4DCJA 2JW5A 1IG3A 2YDXA 4GXTA 2Z0MA 3J7YJ 2E0IA 3B6ZA 3EFBA 2Q5JA 4EVQA 4UTXA 2XVCA 2PXHA 2IDMA 4B3AA 3H04A 5KOJA 1UBSB 5FWDA 4BP8A 4EGAA 4ZDWA 5JZMA 3QX3A 3GAAA 2XYGA 4O2RA 1N5RA 4II3A 3IMCA 3VC7A 1U1CA 4ACBA 4BO8A 2HPMA 1JTYA 3VB2A 1UC9A 2GASA 2HYFA 2BBTA 2H2GA 3IA2A 3KUUA 1W44A 4J03A 1M33A 3TW7A 2KJQA 5AOVA 5H5JA 1OI3A 5B4TA 2C7QA 4AKHA 4DZPA 1FYDA 4LCJA 4BQOA 4B6FA 4ZDOA 1VSBA 3FTEA 5IAGA 3R0IA 4G7ZF 3O2NA 4LHZA 1AK2A 4PJMA 1DQPA 3MPOA 1SFEA 4WDQA 5H68A 4Y13A 3GPBA 3P0RA 3V6MA 3WK6A 2FF7A 5HOOA 2I7VA 5KWEA 3HS3A 2WZQA 3ILHA 3NCHA 3MMPA 4J3JA 4IVRA 2VBGA 3KP7A 4LLGF 3WRXC 1MX3A 2Y77A 1Z9CA 1BA5A 3I04A 4KQJA 2OG1A 3SQMA 3WTBA 1MO6A 4BKOA 2WTNA 3R60A 2K2QB 2BFDB 1PYDA 4Y9RA 5FO0A 3QGMA 3TW0A 1C50A 1VBFA 2HMAA 4R5HA 4W5JA 1TD9A 2IA5A 1ZRMA 2QK4A 2OECA 4XVHA 3U19A 2OGTA 4BAZA 1KJWA 1MW8X 4W99A 3WISA 2A33A 2LV8A 1S89A 3W9BA 4I1YA 1N77A 3DT6A 3NUQA 2EZ8A 2AX3A 3QFTA 1IXKA 3FWKA 4X1IB 3DH0A 2A88A 3OBBA 2BXYA 1S4MA 3DAFA 4LYDA 2XB2A 2H2AA 2I3AA 4JITA 3RC8A 2A9JA 2WQZA 1ZXXA 4U6NA 1JH9A 4DLBA 1XNQB 3FHCB 1YS1X 4LDNA 5EHNA 1TNDA 5JRJA 3TOBA 3CO0S 3LA8A 3SEQA 1OI7A 1L5WA 3P2MA 5JZSA 1YZVA 4RMNA 2H17A 4JI6B 2Q5EA 4DV7B 2FMKA 4YT5A 1PR0A 1VJ1A 3H1PA 4P92A 4RPLA 4LA4A 5EXDA 3VBCA 3ZH9B 6REQA 1UKVY 521PA 5HTKA 1N2BA 1F6BA 3DB2A 3JAMZ 1KJ9A 3DPSA 1YB4A 4ZOLF 2NOJB 1Z4LA 1RDFA 1JKMA 3EDPA 1SJ9A 4PR0A 4QYSA 3K9QO 4XR4A 3FMRA 2BI8A 1E92A 4C3ZA 3HWWA 4F6RB 3W5BA 3OWTA 4BXOB 1P4JA 1YRQA 1YH3A 3H1CA 3ZHTA 4Y1FA 4XJSA 3R7FA 4JLVA 1LS6A 1KKLA 2PH7A 2WKQA 2ZIVB 1FY7A 4UVCA 1OTHA 3G5TA 3K1YA 4FZJA 3RYIB 4PJ0C 1UPXA 3SS9X 2QN3A 5JBNA 2B9EA 3SVTA 1GA4A 4BVEA 1VJTA 4UXJA 1PLJA 3V4LA 4FZ3A 3SQOA 2CY0A 2TCTA 1OLSB 3WIDA 1UHSA 1ZJWA 3FHJA 2ZG6A 1BI0A 2EOAA 2H7YA 4FONA 1HDZA 4I19A 2X85A 1S0UA 5TT0A 2D7DA 3ZG6A 4M3BA 3P5BA 4URWR 1AHIA 1CEQA 3N2ZB 4LN1A 4LJRA 1XTRA 5KTTA 4BUPA 1NE7A 1RAEA 2B20A 2AWNA 2FPIB 2BHYA 4KEAA 4RENA 2ZSIA 2H1CA 5CT4A 5CAEB 1P62B 5DASA 3V3TA 2OLKA 2NUAB 1A96A 5CVVA 1PZMA 2D5AA 3KB2A 3K6GA 1TZMA 4FHDA 4HGPA 4HSEA 4KDRA 2TSYB 1CZLA 3GVPA 4PGHA 5EJMA 3TMOA 3RARA 2HA5A 5HFAA 1K7EB 4HQRA 4Q3NA 2IH2A 1E9VA 3GEZA 3FCYA 3AF5A 2V1NA 3GFSA 4BE0A 1VSUA 1J22A 1WP9A 3OOWA 2ZT5A 4HYTA 1G6NA 2JZOA 3PGJA 4WJZA 2GEKA 4MWZA 4A4DA 5FA6A 2L54A 2AOVA 4BFTA 1Z3CA 4YIHA 1GTL1 2XTZA 3W9UA 2IYQA 4A8PA 3N86A 2AXTC 1RHKA 5D00A 3WL3A 5JHHB 4XOUA 4IFIA 1JHFA 5CG1A 4CETA 4GPTA 3I9MA 1VI0A 1MB9A 1R1DA 3AKDA 2G0EA 4NVRA 2NWQA 4I55B 5TC4A 5INTA 1W4ZA 2C7GA 5JARA 1AGXA 4R7TA 1C3JA 5T41A 1FX7A 2WNSA 2R4UA 5DULA 3VKVA 3TAXA 1UG0A 5CLFA 2WAMA 3E2MA 1XMQB 4QXRA 3UVEA 3COJA 3NALA 1ZI6A 3IEIA 3R6SA 1P5RA 4CLOB 2Q6IA 2XMZA 3RVLA 4OHUA 3CNOA 4YJGA 1ULAA 3LZDA 1EGQA 5L3ZA 3BSFA 4LNUB 4JX4A 2AYYA 1UFVA 2OCIA 2C3MA 2ZBKA 2I1VB 2JFZA 1P2FA 2WIBA 3KJEA 3LY8A 2FH5B 4HZGA 4XB1A 1N0HA 1QNFA 4GLOA 4QWMA 4HYEA 1N32B 3DV8A 2BAGA 4A0RA 3PFBA 2J59A 2ZAOA 4M74A 4R8VA 2IEDA 4JUDX 3REQB 5JC8A 1IWBB 1R5JA 4QDTA 2P9CA 3JRXA 2G72A 4YPFA 3ZOKA 4D5GA 2HPVA 3GOQA 1AQYA 3P26A 2EQ5A 3QH4A 1KAOA 1TC3C 3HGTA 4Q7QA 1TWHJ 4MRMB 4MVJA 3RBXA 2PRIA 5IFLA 3IV6A 5B30A 4NC7A 3Q8MA 2DA6A 3BHIA 4QOIA 3I54A 2MYSA 4DVGA 3MB8A 2BTEA 4V2FA 1PFYA 4ZVPA 3S2WA 5EA2A 2Z98A 3I64A 3P1JA 1HDEA 3GCMA 3HSEA 1XJ5A 2LCIA 4K6KA 4HDVA 4NOLA 4ME6A 4FJ0A 5ALIA 3T7EA 1T24A 2O2JA 3EXHC 3M70A 3FCEA 4JI8B 3BG3A 1KVSA 2ZJ8A 3KB8A 2CV1A 2VKTA 2WFMA 5I9SA 3K5IA 2Z6UA 3ND8A 4FBLA 4UU7A 4CM5A 2MOKA 4YMHA 2VK1A 3OS1A 2R7SA 5F4ZA 4DUGD 2CZQA 3CWZA 3V4PB 3MZYA 1MMFB 2QI9C 3O4HA 1CRZA 4EK9A 3RDIA