1O58A

Crystal structure of o-acetylserine sulfhydrylase (tm0665) from thermotoga maritima at 1.80 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
293
structure length
293
Chain Sequence
HHMMERLIGSTPIVRLDSIDSRIFLKLEKNNPGGSVKDRPALFMILDAEKRGLLKNGIVEPTSGNMGIAIAMIGAKRGHRVILTMPETMSVERRKVLKMLGAELVLTPGELGMKGAVEKALEISRETGAHMLNQFENPYNVYSHQFTTGPEILKQMDYQIDAFVAGVGTGGTISGVGRVLKGFFGNGVKIVAVEPAKSPVLSGGQPGKHAIQGIGAGFVPKILDRSVIDEVITVEDEEAYEMARYLAKKEGLLVGISSGANVAAALKVAQKLGPDARVVTVAPDHAERYLSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of O-acetylserine sulfhydrylase (TM0665) from Thermotoga maritima at 1.8 A resolution
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords O-acetylserine sulfhydrylase
total genus 112
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1o58A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1o58A02
1J0BA 2CLLB 4HN4B 5IXJA 4H27A 1KFBB 4ZQCB 5C3UA 1A5BB 2PQMA 5B36A 1K8XB 2V03A 2GN2A 4D9KA 1BEUB 1K3UB 5JISA 5B53A 4D9IA 1KL7A 2EGUA 3FCAA 3DKIA 5DBHX 5I7HA 1OASA 4D99A 3CEPB 4JBNA 1J0EA 1VE5A 3PR2B 4L3VA 1C8VB 3TBHA 1K7FB 3PC3A 2TYSB 3AEYA 4D9EA 2ISQA 4D9GA 1RQXA 3PC2A 4D9NA 4F4FA 4ZU1X 1VE1A 2GN1A 3PC4A 5CGQB 5D87A 4AIRA 4OREX 3BM5A 5B3AA 5IWCA 4NEGA 5KINB 1TZKA 5DW3A 2C2GA 5DVZA 3L6CA 3V7NA 4IL5A 3SS9X 5I7WA 3DWIA 4L27A 1VB3A 3VSDA 2O2EA 2EFYA 1FCJA 4D9BA 4D96A 4COOA 1UBSB 4LMAA 1J0CA 2J9XB 3IQIX 1FUYB 3L6BA 2J9YB 1M54A 1J0AA 1PWEA 1QOPB 1TTPB 1UINA 1WDWB 2CLIB 5E0KB 1WKVA 1KFJB 1TTQB 2ECOA 1Z7YA 3AEXA 5I6DA 4NU8X 1D6SA 1TZ2A 4PCUA 2CLHB 1A5AB 4HO1X 1K7EB 2Q3BA 3IAUA 4HT3B 2DH6A 5DBEX 1K8ZB 3T4PA 1TDJA 1TYZA 3DWGA 4L28A 5T6MA 3X43A 4HPJB 4Y6GB 1CX9B 1J0DA 1P5JA 1QOQB 4JBLA 3VSAA 3VC3A 2ECQA 4D92A 2DH5A 5D85A 1TZJA 1V71A 4LI3X 3RR2A 2RKBA 3X44A 5J5VA 5D84A 5BW6B 3FGPA 2C2BA 4WX2B 1KFKB 5KZMB 5DW0A 3L6RA 2CLMB 1WBJB 2ZR8A 1V8ZA 2JC3A 4ZU6X 2BHSA 1E5XA 5J43A 1WTCA 4D9MA 2D1FA 2ZPUA 1UIMA 3VBEA 4D9FA 1C29B 2O2JA 4OFXA 4L0DA 5JJCA 2TSYB 4D97A 2RHGB 1BKSB 2TRSB 3IQGX 5I7OA 5HBGA 1CW2B 1JBQA 2CLKB 5B1HA 1TZMA 1TJPB 1Y7LA 5B1IA 1O58A 5I7RA 2CLFB 4AECA 5I7AA 5IW8A 3R0ZA 4LMBA 2RH9B 2ZSJA 3VSCA 1A50B 1C9DB 4QYSA 5D86A 4HPXB 4D9CA 5B55A 1Z7WA 4D8WA 2GN0A 1K7XB 1KFCB 3HMKA 3IQHX 3R0XA 3SPXA 1K8YB 1KFEB 1X1QA 2WSYB 4D8TA 3SS7X 1F2DA 2Q3CA 5EY5B 4I1YA 4D8UA 1A5SB 1V7CA 2CLOB 2J9ZB 3ZEIA 1PWHA 2BHTA 4KKXB 4XUGB 2Q3DA 5CVCA 2CLEB
chains in the Genus database with same CATH superfamily
2A0KA 4R2HA 2J3HA 4X84A 5DMXA 4DQXA 5KMGA 3GQBB 1NW3A 4WKCA 5IZCA 4G0UA 621PA 1EFTA 4KC0A 1U9CA 1X2EA 4MS3B 1YA6A 3NHPA 3EOAI 4TSRA 2D6FA 2G1UA 3V80A 4XIJA 1PD1A 4RKEA 1S0UA 1EGMB 2GRAA 1X7DA 2VNSA 5CCEA 2GKGA 3EVAA 3HU5A 5FHRA 2EJTA 5I4BA 1E1DA 2H2HA 2Q8NA 3EYAA 1YAHA 2ZAIA 2XYGA 3I76A 4UAJA 2P2CA 2QTGA 4UPVA 4X5OA 2CHUA 4Q9NA 4I9FA 4MVWA 4ENPA 2YHUA 2VPXA 1ULAA 3BSFA 4WDQA 1NLUA 1XTJA 2XMGA 2BYTA 2ZW9A 1ADBA 4FGJA 4H7HA 3QKIA 1T24A 3LLCA 3ZYZA 3FDXA 3EGXA 5FNVF 3T7KA 2CB9A 3UJ3X 4A3SA 1DCTA 5HYVA 1H5UA 2G70A 2O19A 4A5OA 3NHMA 1QK4A 1E3WA 1KP3A 5K3EA 2PFKA 1F0KA 2WP8J 2ZS7A 4R1TA 1KORA 3FUXA 4D9BA 3F1KA 3N6RA 1CSEE 1E9DA 1IG3A 1JVNA 3INTA 2QZPA 1SU4A 3A1CA 1RQPA 3H42B 4BRSA 4XVHA 1ZWKA 2R8RA 4GO1A 5DK6A 1PFWA 4JL6A 3JYLA 2GYVA 3TDNA 4DW8A 2BONA 2FDRA 1WABA 1H8HA 3KVYA 1VPTA 1LNSA 1G291 4S1PA 3AO0B 4GPZA 4PHFA 4RNCA 5CK4A 2ERXA 4A2WA 5IRCD 1BOFA 1JN0A 2HA7A 3ROZA 4DLAA 1T0JB 4EJFA 3HUDA 2YHIA 4F9GA 1ZH0A 3NTRA 4L22A 4YALA 1VCNA 3K09C 1SBNE 4DREA 3EQ8A 1PQUA 1D1TA 3RYCB 2MSWA 4BZPA 2NSDA 3LYAA 4BNDB 3EXHA 3QWHA 3CZ4A 5DSZA 3CZ5A 3AUXA 3IQFA 4J0GA 3V32A 3AP3A 3TOCA 1GZUA 4RETA 4RHEA 1Y8AA 3NIDB 4DQ0A 1NHWA 1E9BA 1BKDR 3TJMA 4N9QA 5HGXA 1RAHA 1FVHA 2H52A 1DAEA 2JH3A 1DTEA 2R7MA 3DR5A 5G2OA 4F72A 1JI0A 3OPYB 1C4XA 3OQHA 3AVXA 1PU2A 1JR4A 1E4EB 3FFBA 3OG9A 5K4HA 4I1PA 4LF5B 1XJ5A 2PD3A 3U3XA 4R7ZA 1R66A 2Y2UA 4BB5A 5F64A 2FE4A 2TECE 5FBWB 7YASA 2UU9B 3JASB 4CLHA 2WKPA 3KPJA 5A02A 4AP5A 3WDLA 1JA9A 4C03A 1OFGA 2VJMA 5JS7A 3ZKWB 4A9AA 4HBZA 5B1IA 3HA7A 1WDLA 4YAUA 1D6NA 4KNYA 1BS2A 2X8AA 3FOWA 3FCOA 1OAAA 3HUEA 1CQIB 1KDTA 1SCKA 5GPBA 1VP9A 5FWNA 1I30A 1VPDA 2Q6LA 3HY4A 3RCBA 1X80A 2NZ2A 3ZBTA 2PX3A 1E2KA 4BFYA 5BVHA 2E5WA 3SYMA 2G36A 1RWXA 3ZDAA 1C3VA 4MRRA 2V7VA 3O1JC 3IQDB 4J0JA 5HOEA 4Q47A 2B3DA 1HI9A 2EJBA 3HR8A 2YIMA 2ZSIA 4H60A 4LMPA 2C5GA 2X2PA 3X1JA 1QPZA 2HJHA 3SFTA 3ZYCA 2YWXA 4HMPA 5JNTA 3VR4A 3R7BA 1CQPA 4BZQA 5EJ9A 4G2TA 2XYRA 5GOTA 5LD2B 4DEXA 1RCFA 1L4MA 1P9OA 1CQZA 3PFFA 2PMFA 4PSVA 1OVGA 4DPMA 4EW3A 3H0EA 1ODCA 2DPXA 4N3GA 3EAQA 2H3HA 1A9ZA 3EA4A 3LHFA 2HRCA 2J3QA 1FP1D 1CC1S 4BGVA 4BO0A 1E1QD 1RJEA 2CUNA 4Z1OA 2FOXA 5BSKA 5CHYA 3I01M 3M6MD 4RDIA 1W2GA 2ZKLA 1T1GA 2C8KA 1CY1A 4JX8A 5IN5A 4UM9B 4HB3A 1V8OA 2JFYA 2ODQA 3OCXA 4OGWA 4JT8A 4NFLA 3QTBA 3UJAA 1DXYA 2EERA 1VIAA 3EMBA 1BS9A 4RMIA 1MV5A 1O4VA 1QGOA 2H59A 3LZCA 3E0QA 3Q7EA 4PVDA 1XMIA 3F1LA 3VOBA 2OGZA 1Z8NA 1MO5A 3EEFA 1ULTA 1DQYA 4AYTA 2Z6VA 5B4UA 1E92A 2FCRA 4G09A 4H0NA 2FPGA 2N9UA 4X3OA 1YJ5A 2A5GA 4HGOA 4COOA 1BCSA 3W5BA 1V5WA 3N2GB 5DP2A 3T9CA 3PFBA 1Y5MA 1RYDA 2WE7A 2GESA 3LX6A 3RC3A 1V9CA 3A0RB 3NDJA 5JO9A 3EVGA 3LDUA 4E14A 3DXFA 4YGYA 4RL6A 5HG0A 1CB0A 1D5CA 1P2SA 1P7VA 4YUXA 1IK6A 4M7WA 1OAOC 5DNEA 2IITA 4DIFA 2D7JA 1YBVA 1YFZA 1G3MA 3DGFC 3C3XA 2ZBRA 2GPJA 3ZCTA 3TCXB 4D56A 2H18A 3CH7A 4QBGB 2CXOA 3GMDA 3BRCA 1KDYA 3EIEA 3RJTA 3NJ4A 4OJQA 3U48A 1V71A 4UHBA 1TU3A 4EJSC 5DYGA 3QPCA 4K9NA 1NVWQ 1U94A 1YVEI 3PNBA 5EE5B 1XCOA 5JZMA 3SU8A 1BG6A 4Y2XA 2DKFA 3CWQA 3GARA 5CH8A 4J2TA 1VMIA 1P4JA 1RPAA 1U5BA 1O9HA 1GU7A 4IOJA 3ZDYB 3UWPA 2NXNA 1Z16A 2NTEA 5CBPA 3LFHA 4JR2A 1HTBA 1QFJA 4DLNA 1UZMA 3W3AA 5ITSA 3QXGA 3THWB 4GMKA 5BQPA 2P5YA 3IR5A 3D6TB 3E9QA 4D81A 1NJ8A 4HLUA 3SM9A 2I7VA 2JLXA 4REQA 4YMTA 1VJ5A 3HCPA 3H5RA 3QTTA 4RF3A 3AM5A 1JXOA 2F1KA 3AKCA 1SO8A 3U7QB 3M4YA 4NENA 1T2VA 1XQ1A 2KBEA 3QJGA 1A8UA 3OKAA 4TLEA 5KAPA 4OCZA 3VSEA 4D4LA 3Q15C 3NT5A 4EG0A 1FLNA 1N2BA 2VT6A 4K0KB 4PYMA 4DC0A 3NBZC 1SGWA 2OG1A 3KPYA 3WRYC 1T5BA 4D9CA 1XNGA 4REQB 4LXXA 4Y98A 5AVJA 3SSOA 2O8FA 3L41A 1Z0DA 3R0XA 4Z5XA 4NBSA 4XJTA 4FUQA 2MU1A 1BZYA 1GLVA 4EFLA 5C18A 2B82A 1QGDA 3HABA 3VR6D 4B2YA 3WIVA 2FH5B 1DJPA 2AZTA 3KXLA 3AUJB 1EFUA 2RH4A 2CHFA 3O94A 4UATA 3M6LA 4GLFA 3KXKA 4KVGA 4PVCA 2AF3C 1V41E 4F0JA 1E6MA 5HKOA 4P33A 2ZE6A 3K3PA 3RFVA 5IC6A 4J1QA 1OA1A 3OQPA 5J5CA 1KVTA 3C14C 4MUKA 2R8BA 1RP7A 4RK0A 2XQJA 4UHEA 1UBUS 2O57A 1TC1A 2FEAA 3P4YA 1GGJA 4ASUA 2QJWA 2C7OA 2PT6A 3LP6A 4XA8A 1EXVA 2FY8A 1THGA 1ZOPA 2PMCA 2P3OA 1XT6A 1UT5A 5F51A 3PVSA 2EF1A 1VLLA 3F90A 1XUOA 2CBGA 2CCGA 3C48A 2FSPA 1FUEA 1ZUNB 3G02A 3R44A 2FSGA 3SM3A 5F9HA 5KC9A 2V65A 1PGPA 1UODA 1K98A 3P9NA 3W5IA 1XRQA 4L73A 1G3UA 4AY4A 1SU7A 2Z2IA 3AL3A 3KPWA 1V4VA 3QEMA 1MVNA 1PW7A 2B2CA 3LQKA 3P4XA 2VDUE 3OZUA 4LRQA 3HB4X 4DPKA 4ZTZB 2QS9A 5CNJA 4A1OA 2O7NA 5B6JA 4LY3A 4KYTA 3UGQA 3FUUA 2FF5A 3O3NB 2RGRA 1SKUA 2ZB8A 3QVVA 5E6SA 1K75A 5L3VA 1XA4A 4XTCS 5F5NA 2VZEA 1P61B 2PDAA 1X87A 2A30A 2WYOA 3KTOA 3C74A 4IGFA 4UDOA 3ZHRA 1DO2A 6REQB 5BQ5A 3FXAA 3V4ZA 4R7TA 3ZR4B 1NUUA 2C0CA 2YWRA 4IWYA 4NIMA 3IJEB 5AK5A 3VDNB 1EIWA 2JVKA 3DZHA 1IHDA 2NV2B 5F33A 5I6DA 5BSGA 1JQ3A 3RRFA 2V7WA 1WHTB 2Y71A 4UVHA 4YJHB 4CN9A 1NI4A 5JMTA 1FPMA 4DABA 1CZNA 1L5VA 2C42A 3K72B 3OH8A 1Q74A 2NO6A 3L0OA 5H81A 6REQA 5HM6A 1US8A 2XTMA 1WZUA 2OHGA 4LCJA 4LQLA 2WSMA 2CD7A 2Q0QA 1YOVB 3KZ1E 3PUXA 3OCZA 1LBQA 3REQA 4NBKA 3FBTA 4M9RA 3MPUA 5FL7A 5BW6B 3DZGA 3Q0IA 3LOUA 3T5BA 1VL2A 3O2SB 4IDNA 1YBMA 2XSZA 2TMYA 5BYBA 2QSYA 3EAGA 5EMNA 4A91A 1WBJB 4QAQA 4RGBA 1T36B 4CM9A 2PVCA 4W9NA 2BHSA 4MYDA 2P6PA 2YJ4A 1XQWA 3ZWQA 5F78A 3MERA 4AZSA 2OSBA 1KYQA 1DKMA 3AETA 4W99A 4PZDA 1FA9A 5A05A 3EZ2A 2FWPA 1Y8QB 4O2AA 5GADl 3R3SA 1SIBE 2MCFA 4ZI3A 4POOA 1XTZA 3L1UA 2QR3A 5BN5A 4KDCA 4RVFA 5UKDA 1V39A 2CB0A 1LPOA 3GWZA 2YNMA 1A76A 1RYHA 1VLHA 4LRSB 4CCYB 3PYLA 1G8PA 1QDUA 1RXCA 1V3QE 2IOYA 3GIDA 5FT9A 3R8XA 1A50B 4QXPA 1Q3HA 5IEBA 4M0EA 1XQXA 1N4AA 3RS8A 4UMDA 2VNJA 1GKUB 4DOMA 3OWHA 4O3FA 2AR9A 1QIDA 1FXSA 4CKWB 1QP4A 1KGSA 5AXCA 4J3JA 2QBYB 2G5TA 4UVEA 1YZYA 3DZKA 1NYLA 3Q6IA 2ANCA 2X0IA 3L7AA 4FQ5A 2H5IA 3IIEA 4GD3Q 1OXSC 4TL8A 4ECEA 1V7CA 2AFHE 4KMOA 2IOFK 3TOSA 3T7DA 4CMHA 1CYEA 3OE7A 3U1TA 1G63A 1J33A 2X7XA 3FVQA 2HJWA 1M2NA 4QHTA 3HI4A 4BGDA 1DKQA 3CW2A 1EEHA 4EGAA 2V9CA 4LXTA 2YWHA 1OFUX 1OWNA 3AHGA 3CWZA 4O8ZA 2IHBA 4RD1A 4YECA 2CXUA 2QQGA 4ZJUA 1YMQA 4J0IA 5E6UA 1S2MA 4RK6A 3GFQA 4TSKA 5FAXA 2VTDA 5JDIA 2GXQA 5T41A 1G19A 1P5FA 1HH4A 1DXQA 1EDDA 1ESCA 2Z43A 4P5DA 1T36A 2VKQA 4W5QA 1LLUA 3THYB 2M32A 3DL2A 1JHUA 3D3WB 3IT2A 4P2GA 4IVNA 3WLMA 1SHTX 1X70A 1BDBA 5AUNB 5JSKA 3D4NA 3TOZA 5LXTB 4A0HA 1NSTA 2OBYA 3OZBA 1G6Q1 2XI4A 1Q7RA 1OXVA 4WXRA 1BXRA 3L8FA 4L6CA 4GXQA 3CNNA 2GJKA 2A88A 4G5RA 4MS4A 3KR1A 4ITUA 1P6QA 4NG4A 4WLFA 4B48A 3L6BA 4B9EA 2QF7A 5A9RA 2GJ4A 1VIDA 4KXQA 4B9AA 1XTQA 2ZI5A 4OI2A 3UFXB 1IB6A 4PW0A 4UBIA 3S2EA 4RSRA 2X14A 4TVSA 1FIUA 3C87A 1QYXA 1D4AA 4K1XA 3K5HA 1JDTA 1XYYA 3MRTA 4YAGA 1T6ZA 2WD7A 4CXMA 2YV3A 2ILVA 4NJEB 1UMKA 3I6MA 1T8PA 1QYDA 1TUGA 2YY7A 3CUSA 4U2CA 5IKMA 5INTA 5HF9A 1N3YA 2AZXA 4KUHA 1VG0B 5JY6A 1CUGA 3WK4A 3VH3A 2CVFA 2Y0EA 3GA5A 4V1CB 4HGYA 1VJ1A 3DFKA 3MGAA 2C4NA 2GTPA 3EEYA 1PVDA 5C8YA 3LTNC 1YCGA 2D0DA 2JKZA 3OJWA 2UXDB 3F5MA 3P9QA 4DAEA 5ALIA 2VBGA 1YQDA 4WN9B 4ZI7A 4G25A 1H05A 3CCFA 3OU7A 3L9XA 1PE0A 2W2XA 1DOHA 2C57A 5ALTA 5EP2A 3OO1A 3SLGA 2H54A 2DT8A 5DW0A 2ZDGA 3ZJUA 3TW8B 4G5SA 3M2TA 1I7SB 3D4PA 4Q3CA 1K92A 1Z5WA 4R68A 1NVFA 3AFHA 4P82A 4DV7B 1OFIA 3O2JA 4LYEA 1WNFA 4TTPA 4UCWA 4W7SA 3ST7A 3ZCPA 1SIUA 4UDNA 3QQPA 1NOIA 4Q9HA 5J4LA 2XUHA 2Z8ZA 3OZCA 4JT2A 1PUXA 5H0IA 5DHQA 1O58A 2C96A 3FBGA 3GO4A 3OIGA 2CLFB 2CNNA 3S1AB 3LJKA 1EX6A 4ZZ1A 4TZKA 2HFKA 4XR4A 3A7EA 2NUTA 1N0VC 4MQFA 1ZD1A 5LKRA 2FSVA 2CDNA 4Z9AA 4G5QA 2P40A 2H5EA 1KYTA 3AUKA 5BR1A 2VUSA 2ZCVA 3IT1A 3MOGA 3CW9A 4KIUA 2WYWA 4P98A 1MT0A 4EY7A 1HORA 4W5RA 1NP6A 1O54A 4ILEA 4CCSA 4RJLA 2X0NA 3ND7A 1TEXA 1PZNA 4FIDA 4MUMA 2DM6A 1ESMA 2I2AA 1JKIA 4D45A 5C53B 2JH8A 3ZWYA 1PK7A 3U7RA 2VF2A 3W2HA 3JALB 2QYTA 4M87A 3KIPA 5JS6A 2EL9A 3QVUA 4AZ0A 1ZGJA 3ENKA 1GEGA 1TQHA 1OHHA 4EELA 5K99A 5HFJA 4QUAA 1SVUA 1NQ5A 5LBIA 4GOLD 1UC5B 1XEXA 3AEQA 3I9V6 2WV9A 1DOAA 2BFBB 1ZJYA 2OXTA 4DL9A 1XROA 4N01A 5BV2P 5CFZA 4H4EA 1QZTA 1UPCA 1ZCJA 2XB2A 1E62A 3QYJA 5C37A 2AE1A 3P20A 3ZDCA 4U2KA 2N1MA 3AILA 1AKUA 5JQGF 4BQIA 2ZRLA 1D04A 1HLGA 1GPH1 2D7DA 1USKA 5AI8A 3D2BA 2F9LA 3GJTA 5D87A 3OQ6A 3SQDA 5ESDA 3RVQA 1TU0A 2O52A 1A9YA 1OLUA 1Y3IA 2B20A 3H5AA 4EI8A 3AIMA 4LYAA 4DSNA 4CMJA 4BNXA 3H3FA 3TJRA 2WVAA 1ABEA 4I1OA 4LYGA 1SNYA 1QIGA 3QE3A 1XNJA 5C31A 2QV7A 5DTEA 4BCDA 3UGJA 1P80A 3TZBA 1PV4A 1OX6A 1TVKB 3DMTA 4LE1A 4NYIR 3Q72A 3KKMA 4KR9A 1AHPA 4BO4A 1LFDB 5BR7A 2CE7A 2FZCA 3C3MA 1I01A 1U11A 3DOIA 3G0BA 3ONVA 4K6GA 3SSNA 3UJCA 4UUAA 4UHKA 3T1VA 1CUCA 2R6ZA 1Z17A 1LNQA 4DCUA 2O07A 3TKLA 2VNIA 4KR3A 3OE1A 4HUJA 2J59A 3HSKA 4JQZA 4EB6B 4O4JB 1JLHA 2ORIA 5T7BA 2BBTA 5LA6A 1AB5A 1Z07A 2ZJ3A 3I4FA 3N8HA 4PO9A 1ZJWA 3CEMA 1QHEA 4AKIA 4YPOA 3NVKI 4B6OA 1APBA 1ZAYA 1C7FA 1VCMA 2NUPB 4IF6A 4HDKA 2I7DA 4OUDB 5D85A 5KNDH 4MHTA 1ZNXA 1PR3A 1F20A 3AZPA 3OBIA 2PS0A 5LC1A 1L5FA 2Y05A 2J6IA 3QMVA 3IXMA 4CM6A 2VNAA 2J0UA 1MVOA 5I8ZA 1JH8A 1TYBE 2JLUA 5I7VA 3GLHB 3SBXA 1NBHA 4HL6A 2B92A 3AXSA 3LQRA 3KRTA 3D31A 3K0BA 1PJ2A 2YCBA 3PUKA 5BNZA 1C7ZA 3DEFA 2OQ2A 2G9NA 5MFZA 1L7VC 5IVHA 1U1IA 1UMCA 1QB7A 1II8B 2CD9A 2KLHA 3AUSA 3BGOS 3HFRA 4KK4A 4Q6WA 1KPIA 1Z6XA 2COEA 1VDZA 3T3EA 4BN5A 3WLPA 1YCFA 5GV8A 3O0DA 4HNSA 4GZLA 4ZVLA 3TEJA 5LWQA 4BO9A 3LUHA 4BX8A 1U3DA 3C4QA 3O90A 3C5HA 2HPVA 4LY0A 4H7JA 4EATA 1FRFS 1Y8CA 1CUFA 2FSUA 4I8XA 2QAGC 9ABPA 2D1RA 4Y1EA 4IGAA 2Z09A 2R7NA 3LBNA 4GBJA 2WF9A 3UQZA 1T13A 2P30A 4L95C 4Q21A 1TW2A 2Y0CA 1K7XB 3HJBA 3SHQA 1RTTA 3V48A 3RS2A 1F8GA 4BBZA 4DDVA 4PN7A 1M34E 2BR5A 3IUEA 4B80A 4MYRA 4H0CA 3Q3GE 3LVRE 1AUXA 1YUMA 3U4HA 4D8UA 3BZUA 1E9RA 1X38A 5TV2A 3RBVA 2W8ZA 1EP1B 2B2XA 3GAAA 4JT4A 1BWQA 5H02A 1CUIA 3LC2O 4G1BA 2WEKA 4MLPA 3D8NA 3RRZA 1A2QA 4HDRB 3DL4A 4B3HA 4O08A 5DYTA 3ILYA 1KJIA 1X0XA 3GUYA 3RNOA 5FOQA 3MJCA 5JSFA 1NRWA 3ET4A 3JSXA 4AUKA 4G0PA 4M99A 2DY0A 3MMXA 1B3BA 1UXHA 1BIFA 2E82A 3WLSA 2H08A 1DAOA 1TVMA 1KDRA 1K5GA 1S8NA 1XRPA 1ZVKA 1BVYF 4IIJB 4ZO8A 1R5OA 1U28A 1UEJA 3PNVA 4AMZA 4NYJR 2XMPA 4XQ0A 5KJCA 1N9GA 1C7EA 2HRRA 1D9XA 1DRJA 1IMOA 2BGMA 1P2BA 5CDFE 5IWCA 1O1YA 5CTAA 3V7NA 1ZZEA 2W70A 1J90A 2FPSA 1T6BY 2PSSA 3LX8A 4M60A 2XA2A 1I7QB 4X66B 1PV2A 3GZJA 4KO3S 1R6XA 3O8BA 2X5KO 3OA2A 2ZIEA 3E05A 3KXDA 2W71A 2RJ3A 3C6BA 4MKFA 4P4SB 1Y48E 4WXYB 1P9LA 5AR1A 3GMSA 2VG8A 3HB9A 4KWHA 4MULA 2JI8A 3F46A 5BV8A 1U2QA 2JI7A 4C0LA 2ZM5A 1Y5NA 3IULA 1B0PA 2X0EA 1Z35A 3WL5A 2PKXA 5I7UA 1R16A 1RSZA 1Z6AA 2R48A 3AP1A 2I6TA 4RM2A 2GVDC 4YRDA 3QU2A 4YMLA 4HQRA 2GVZC 3ZDEA 4DJJA 4FSDA 5IJ9B 1CF4A 4NMMA 1MZVA 1WVIA 3JVVA 1P1KA 1W49A 3I2FA 1SXJB 3SC4A 4UXIA 4DDTA 1IVYA 2H7YA 3TL6A 4UKDA 3TSZA 2V4ZA 3TSAA 1KE2A 3N0RA 1UBEA 4RK4A 5AW3A 3RIXA 1NWHA 3O21A 3NO4A 3GPDG 3AQ4A 4CF4A 5EUMA 1MCZA 2Z95A 3FTQA 4P3NA 3V1TC 3MT7A 1TX4B 3RG2A 4YQFA 3CLTD 3PNPA 5HJ2A 5KDDA 1EWYA 1W25A 4L5CA 3HKEA 2IGTA 3UXEA 1X1EA 2R6DA 5SY4A 3T7SA 4PZZA 4D6YA 3SJ7A 2ESRA 3ZV5A 3WG9A 7REQA 3VO1A 1I2BA 3AI1A 4LW8A 2BHRA 3T7TA 2J8ZA 3F9RA 4JB0A 2C88A 4AJ9A 3GRAA 5FTLA 4MDFA 1EVZA 4A2PA 2M6SA 1N7GA 4YUYA 2ABWA 4HLNA 3A4VA 1Y4ZA 2AOTA 3GCXA 4F93B 3B38A 4E5YA 3QITA 4TV9A 1W4CA 2WM3A 4RPIA 4DCGA 5AVRA 3PRJA 4IJ5A 1UPUA 2UYQA 5DM60 4GYWA 1NMZA 1WMSA 3VPAA 1YJQA 3ZLTA 1TPZA 3KLNA 4GM1A 4YT2A 3FYDA 3UPDA 1ZUIA 2VK4A 3Q9LA 2GN8A 3HCEA 3O8OA 5ERYA 4EUHA 1FSSA 1XTSA 1OKKD 3K4QA 4OAQA 4OK3A 1YI8A 3V1UA 4AZTA 5IG2A 1SWWA 2NMVA 5HE9A 4Y18A 4BFCA 5TR9A 4M1EA 1CUZA 4HAIA 1W94A 1JJBA 3VTZA 5GMOA 2JLWA 1SKYB 5IT5A 3WYAA 3QELA 2A57A 1PF7E 2P8SA 4ID3A 3JAWB 4LS3A 4Y9RA 1Z47A 1QYVA 1Z8HA 3DMFA 1RRGA 3UA3A 4MI9A 4BCCA 2QAIA 5L6MB 3ZHXA 5HJEA 2IYRA 5JSZB 3TSWA 3CF2A 3QLVA 3PJEA 3EFOB 1ULSA 3R5SA 1EDOA 1GHTA 3FTFA 2VAWA 1XTIA 2XOKA 1L4HA 4OFWA 4B6PA 2E89A 3DBOB 1JLSA 1XQ6A 4KQ2A 3VV2A 2OAP1 4QTUB 5DEIA 2GN2A 3ZHCA 5AKEA 5TX7A 2OCDA 4F1WA 1RRVA 5I3CA 2MT9A 1OF1A 2BELA 5B2EA 1IK4A 1X1RA 5HJ5A 4JBNA 4UFNA 5DXFA 1DG3A 4CV1A 1USWA 4PX5A 3JCZA 3UJ9A 4DJFC 2R47A 2OAQ1 2YIJA 5KJ6A 3X1ZA 1HKHA 5ALLA 2QJTA 3MCZA 1GLNA 4MR8B 1TMOA 4LZLA 3STVA 4K87A 4OP3A 4ZOLF 1JEOA 4C07A 4F3RA 4QT4A 4BO3A 5EKDA 5G4LA 2RGBA 3FLEA 3WI7A 1GM5A 5DJ5A 1U2TA 2EEZA 4HNTA 2RHLA 1FDSA 1E3LA 3R3VA 1JEQA 1PJ8A 2PZJA 5K20A 1QP0A 5FWXB 5AW9A 3ABIA 1MH9A 3LT1A 2WQ7A 1CZLA 1ID1A 4EFNA 4BNNA 2FUG1 1G5HA 1GDTA 4HTFA 3PXUA 5KHOC 3AF6A 3HUFA 3LRTA 5EKUA 1J7JA 1HBJA 1K27A 1BU5A 2C0PA 5ENDA 4XD7A 2X2OA 3KSRA 5C46F 5HFNA 4WLUA 2FW6A 4IIGA 3DHWC 2Q4OA 2XKJE 3JD3A 5J9FA 2NU9A 1ZBQA 2XMQA 1KI6B 1NFFA 2J3EA 5KYYA 2IUYA 2CHEA 3ED1A 2H4XA 3I8SA 3D2LA 2GBGA 3LQFA 4AJIA 1A0OA 3JQAB 2ZJ7A 2FKNA 1J06A 1WUTA 4M9QA 5C5IA 2PUAA 4CDRA 5LKAA 2GYWA 3IGFA 3Q40A 1T6XA 4UBJA 1BDMA 3HHPA 2VT3A 1KQPA 3WS7A 4E5SA 3FOAA 3RR2A 4V0MA 1FQJA 1JKMA 1P39A 5I5EA 5E9JA 2J32A 2JARA 2NO5A 3H5IA 3MBIA 3GH1A 5KYTA 4BPBA 2DRIA 3GLVA 2ZT5A 2OYSA 2PGXA 4FMDF 1R0XA 3AIOA 4PGHA 4BN0A 4BVHA 4ZJPA 2GEVA 4TXLA 4TZ0A 5A0TA 2HTFA 4G23A 5GJWC 4EYEA 1UKEA 4KQXA 4XGKA 4YNBA 4DA6A 3FYUB 1H3EA 1QS0B 1FFXB 4LBZA 3T1NA 1J20A 2Q9BA 4NMHA 2PX4A 3WY9A 4BN4A 5IJWA 4MRSA 4BECA 4H6PA 3ETGA 4MDEA 1GG8A 4EA9A 2X4GA 2C92A 1UJMA 5JJ5A 3MJSA 3K8QA 3PE6A 1YQXA 2OZVA 4LXUA 1CUAA 1DO0A 5GJVC 2B98A 1LZLA 4Q9DA 4HG2A 4MRPA 4C4YA 1C3OB 4GQAA 4QU0A 1O95C 1UM9A 2W6CX 1ZK2A 4RV4A 4ZDKA 4HRVA 3L79A 4HPXB 2O2YA 5AJXA 3T7EA 3UT0A 1QP7A 4I9HA 2A0FA 1VGVA 3AU9A 3LPCA 4TUYB 2J0VA 4PCAA 3JAMA 4P7JA 4RJTA 3PT9A 3F8TA 3RF6A 2GMWA 3SS7X 3HS3A 4B33A 4E94A 3PPVA 2CVQA 4KBYA 4NU0A 2CL6X 2PZ8A 3X2FA 4WESA 1NM5A 2O2ZA 4BRUA 1XLVA 2O1SA 3H97A 4X41A 1XRNA 3HYNA 4Z8XA 4BWYA 3DEZA 2P9BA 3N8DA 3MF4A 1B93A 3QFCA 3W2EA 2I91A 4C78A 2G83A 2GETA 2Q3JA 4R2IA 3ZXUB 4DIMA 4IICA 4DNQA 4AD8A 3N2IA 4NHOA 4Q9JA 2PNJA 1O0CA 4GQIA 2XD4A 4JA0A 4IDQA 2MYTA 5E3JA 1JPVA 3S2ZA 5B7PA 1UPBA 3ZH2A 1Q14A 2IIVA 3GAFA 5DBHX 2I4LA 5JECA 4IDEA 4MVCA 1ZUHA 4UNSA 2QPLA 2R6HA 3F78A 3ORSA 3CLTC 4UM5A 3TQSA 3L93A 3T5CA 4UHFA 2XRMA 4XSVA 5KYWA 3RT9A 1JJFA 4O2BA 1Q0PA 1UFKA 1UKVY 2H11A 1L5NA 4FYWA 3WIUA 3VKGA 2A0YA 1NQAO 3KTDA 1JAYA 1H85A 3H8JA 3P97A 3ESRA 4DR7B 2AJ8A 3D02A 1PL0A 4OL0A 2C99A 4OGFA 1EFCA 4GKKB 4IZHA 2AH5A 3ELDA 1Y1QA 2K7FA 1W5EA 4AJNA 5KYWB 3FCXA 4B4DA 4E03A 3VZPA 4IJWA 5THXA 5IVPA 3QEMB 2JHFA 1T43A 5JSYA 2XB6A 4XQCA 4EFDA 4ZHQF 1XZPA 1U2EA 2WU3A 4I9NA 4IDDA 1HEYA 4C7JA 5F3RA 3K6SA 4GI2A 1G3IA 1V7PC 2ZJ5A 3KLPX 5AM2A 4I50A 1YS6A 1NI3A 3GLIB 5LU8A 1SKYE 3PKZA 2JVIA 1RZRD 5JYDA 1GP2A 5DWQA 4JJAA 3A2NA 1LSSA 2HADA 5J63A 4M7OA 4Y6GB 4DT1A 3KVNA 4L9RA 2HGSA 3ZCRA 1X7YA 1KZ6A 2VP6A 3MMZA 4D92A 4DZTA 1ZN7A 2PRYA 3TFWA 2PSFA 1F2UA 2YXLA 5J4YA 4X92A 1VG1A 4KEAA 3PENA 4NECA 5CNMA 3AFNA 3VNBA 2FQWA 2FX2A 2R5NA 4WX2B 4EPVA 5FBVB 5KOJA 4LOJA 1ZOIA 1A8QA 5ENVA 3RWMB 4X65B 4DR4B 3PD7A 1IXZA 1PJ4A 3JQPA 3WNCA 1W7AA 1IOWA 4F9FA 4JNKA 1C14A 3HJGA 1E5XA 2X6QA 1WTCA 3Q3HA 5CBKA 4DLSA 4AKHA 5HFAA 5E4TA 8MHTA 1CIJA 1ZEJA 4BKMA 1PJZA 3TINA 1A9PA 2ZXEA 4MMZB 4CKEA 2TSYB 3GCGA 3L46A 1L5OA 3M6FA 1OB5A 2DFVA 1V95A 5G0WA 2NP7A 1RTKA 2NLOA 3I6BA 4FUTA 2Q5CA 4C0BA 3QKUA 1FOEB 5BSMA 2WTNA 4DQVA 3VM6A 1S3IA 2P2GA 3PDIA 3HVHA 1SUAA 1NN1A 4NCKA 1BHJA 4MS4B 2Q29A 1ISFA 4ER7A 1GCAA 2QW0X 3H1TA 4A36A 4D4MA 1FS4A 4PINA 1DE0A 3B1JA 3QOWA 4YV2A 4YUAA 4P3OA 3ZV4A 5JIBA 3O75A 2FPRA 4GVXA 2BFEB 1X7XB 3EJWA 4KAXA 5EYPB 3OHSX 2B78A 2C7VA 2WWFA 1WD7A 3MHPA 2GM4A 2V1UA 3SLRA 3E9NA 1BN7A 3AR9A 3AHCA 4B3IA 4ZYYA 1HYBA 1L3IA 2ZRGA 3BB1A 3MRXA 3NS7A 1AMUA 1VLJA 1OTXA 3AJEA 5KSPA 2CZCA 3ZWNA 3KD2A 3SQNA 3NM6B 3GEIA 4CT4B 4QQNA 2UYHA 3WKBA 2AOVA 2WD8A 1P1BA 1NQVA 1V8DA 3NBXX 3IA2A 3K35A 4FZVA 1AQLA 3CINA 3UAXA 3IIKA 4DJTA 5E9WA 1QONA 2A5JA 2JHPA 2IKQA 4IS3A 5JXHA 3WSWA 2CY0A 1ACLA 4YMGA 4V3BA 2XUDA 4V24A 1RVV1 4ZU3A 1BEEA 4EF4A 3JYQA 3TRIA 5JV5A 1P19A 2GH1A 2ZQ5A 5JR3A 3OOWA 5HX7A 5AVOA 3PHHA 1HPLA 3EUAA 3QBVA 2EEPA 5T4HA 1OX4A 5K0JA 3WGYA 1T2FA 3OQ1A 1NDHA 3DH0A 3OZTA 3BD9A 3H2GA 1Y8RB 4OQZA 1SH7A 2QKYA 1WKBA 2A9OA 2XMZA 1FNNA 3HGQA 3A0UA 3UO8B 3RODA 2AEFA 2WPNA 4U3JB 5LU9A 1J5EB 2RAUA 3C98A 3DEIA 1U3CA 4QDTA 3NTLA 1L5KA 1FLVA 1NLYA 2NVBA 1ZD8A 2GHTA 1NN3A 1CQWA 4PYJA 4RLFA 3CU5A 5FFMA 4E09A 1MFPA 4QVIA 1O95D 4V03A 1PX0A 2FN7A 2H57A 2HU8A 3EXG2 3GFPA 3I2GA 3RYTC 1H2AS 3K9BA 3UB4A 2RGDA 1Z7YA 4C4RA 1KSJA 3LQ2A 3NAMA 3QH4A 1I7DA 3F2VA 1CDEA 2W2VA 2KPOA 1KH2A 4OHXA 3WLKX 3X3HA 3GP3A 2IYUA 1HYHA 2WVHA 5J23A 1V16B 2J9RA 4FBLA 3I1YA 3HP1A 4QE3A 1XZMA 3GJRA 1B14A 1IOVA 3PX2A 3T61A 4GBGA 2OCAA 3HM2A 3IP7A 3QXSA 3HYSA 3T8YA 4CQJA 3ROGA 3LAWA 5FOVA 3A2LA 4E07A 5JMOA 3PRKE 4M0PA 1SUCA 4LV5B 4YMSA 1SU6A 4OATA 4EUFA 2IV3A 1PT9A 1J9EA 2OBXA 2GZSA 4CIDA 5L3SA 2FMUA 5TJHA 2YWCA 1TIPA 3W8NA 5FI5A 2NU7A 4FEEA 4Z3KA 5HQ3B 2G9RA 1JEEA 4WPGA 4JB8A 5KBYA 2WFLB 3WLAA 2R2GA 4M9UA 5HIIA 2A0XA 3T5AA 4W5NA 1VMKA 4OO3A 4QOFA 1GNRA 4J29A 1WHSB 2BHLA 1ZO8A 2WZDA 3HMQA 2B8EA 5KPDA 2HH9A 5IARA 1LS1A 2D00A 3OBBA 4MP6A 4BS9A 3BMOB 3ETLA 4WZAA 3K0EA 3GBSA 4YCBA 1L6IA 1THZA 1XO1A 4LOAA 3W8FA 4CDNA 3GD7A 4OSOA 1R0LA 4OYLA 4PWZA 3T7IA 4DN6A 5A7FA 4BTVA 3D2AA 3FVTA 3T3GA 3WGLA 1EAMA 5F7XA 4IQGA 3N7AA 4IWNA 3JX9A 2E4XA 5I4IA 1OWPA 2P79A 5ICSA 4X94A 1L1RA 1U8CB 4X63A 2R65A 2W4QA 2EW2A 1UWCA 2ZRJA 2FW8A 1XZLA 3EWNA 4H7IA 2ZUTA 4WKPA 3SJCA 4XI9A 4ETNA 2HPAA 1YBAA 2GD6A 3FMIA 3JQAD 1AVTA 3KYBA 3NEPX 3DJFA 1IRIA 2OXFA 2DLDA 1X7XA 4HGNA 4B84A 4QJ3A 1Z5VA 1NVVQ 3RAGA 2B4QA 2AZMA 5EXTA 1J0BA 3RVJA 1PK8A 5AOVA 2J41A 3GU3A 3AUTA 1U8XX 4US0R 1Y5IA 3FI9A 4AWBA 1L3CA 1QU3A 4AQ7A 1DDGA 2FPIB 3N58A 2BISA 2Z2ZA 3DBLB 3EH2A 3U26A 4IVRA 3ES9A 4PNEA 2WABA 1TF5A 3IAM1 3OKFA 4LBYA 5K8UA 5F5XA 2QZJA 1MNAA 2HSEA 2QN2A 1BHO1 3S2YA 1A97A 4QYTA 2JCSA 4UC0A 3T5GA 3ZXSA 2YINC 3E84A 3NHAA 5CEFA 3OUTA 3DDHA 4CKZA 1YUNA 4MAMA 1Y3FE 1J24A 3N8GA 4M1OA 1ILEA 3HY3A 1O57A 1V11A 5AK4A 5FTJA 3O4IA 2CJXA 4EHNA 1P60A 2R1VB 3IUJA 3DGEC 2EFEB 2HA6A 3KE8A 2VT7A 1LVGA 3N7UA 3G0DA 1RFGE 1ZN2A 4HF7A 5JBNA 2A1UA 2ZBQA 2X86A 1BXGB 2XODA 1F7UA 1EG7A 3ZGVA 3TIXB 4NFYA 5FO1A 4BVKA 3PRHA 1GZ7A 3IQIX 4WGGA 1YF3A 2RJOA 4PPGA 4OQQA 3U3DA 4AK9A 4D8TA 1ODLA 1OIVA 4UU7A 1RYNA 5KVAA 1I36A 4I81A 4MA4A 4EJ2A 2Y99A 4IS2A 2DB3A 5JU6A 2GAJA 5LMUB 3BJMA 3CR3C 1Y4AE 4CLXA 1RYFA 4OXRA 1X9GA 4EW6A 3PXXA 1OA0A 5KWVA 3PWZA 1NQUA 2BKEA 3A70A 3Q7RA 4PRZA 4QDKA 3P94A 5K0NA 1Q16A 2B34A 4EI2A 4RPKA 1Z5ZA 3EBOA 4YRKA 1BCSB 1M0SA 3K70C 2EYQA 2PKEA 5DX1A 3TLGA 5AVZA 5JAMA 3HO1A 3E3MA 3Q8LA 4JLMA 1L5SA 2OP1A 2XF2A 1G8JA 4PICA 2ZUDA 4LI3X 2MOKA 4LV6A 2FB9A 1UAAA 4U9IS 1EBFA 2LNDA 2I8AA 3GFRA 4S2EA 3M8KA 5EJAA 3LW7A 3W4JA 5FEUA 4C29A 5HKKA 4FWTA 1XIVA 1WZIA 1PJCA 2QVGA 4NABA 3CR8A 1SURA 3TRJA 5HJ7A 1I0ZA 2E87A 2VF4X 4QBKA 1G4UR 5DNUA 3L0BA 3PFIA 4LOKA 3STUA 3QVOA 1R37A 5AW5A 3FWYA 1JIIA 1LLFA 3D4OA 4DC1A 2BUAA 4ER6A 1RXSA 3R75A 3WB2A 1AKTA 4Y9SA 4YRBA 3BWEA 1FYWA 4LWOA 2P9YA 4OFXA 1OT3A 5KMGB 2PUHA 3PI7A 3M9WA 2HJVA 3OP4A 3P7MA 2FQYA 4QYXA 1BKSB 4DBLE 1MA3A 2WI8A 5EHXA 3PITA 5JAOA 3CVYA 4ZT6A 5ALNA 5DYWA 2DULA 1W44A 3ETCA 4JBIA 2EIHA 3QENA 1CEYA 1N7HA 4HQ0A 4X7PA 3K5PA 1YZNA 4HRAA 3S3TA 1KMIY 3KV1A 4NV1A 4AECA 4HZGA 1VCIA 4BNFA 2HWWA 4CMEA 4CTMA 1GGMA 1SC3A 4ZVQA 1DXOA 3ZBUA 2X1HA 4D4HA 1KEKA 3G2JA 4TS4A 5EXDA 3KB2A 3SIPA 2LW7A 3WAGA 2IFTA 2J0UB 2WFAA 3ORFA 5TARA 3M3HA 2EL7A 4EO4A 2FZWA 3PFHA 1B3RA 2FJ0A 1E5LA 3GGCA 221PA 3RSHA 3PWKA 4Q9IA 1X1SA 2X6TA 4KOEC 1EUCA 2A1TS 2XBLA 5JC8A 1J1IA 3CRW1 2JJ1D 3INRA 5AI5A 4OXQA 5B1DA 2F43B 4DV2B 1MQ9A 2YXBA 1X19A 2Q8PA 3FUVA 4UM8B 3JARA 1I9GA 1IWOA 3T7RA 3A3OA 3HKBA 1RJGA 3OA0A 3DZJA 3FR8A 4FXOA 4U7FA 5E0OA 4RTPA 2QN3A 1GAWA 5BV0A 1KK0A 2Q3LA 2GUGA 3H83A 5AM0A 3SDZA 3ZY4A 1GZSA 4A23A 1L8QA 2X4LA 1SCUB 4BMOB 1CJVC 3TCNA 2W2LD 2PBZA 1KHHA 1ZNZA 3SKYA 1QVVA 1T4BA 2OHHA 4G5HA 1ZMOA 1YGPA 1P4AA 4LDNA 2R1TA 4PXAA 2C03A 2APJA 1ZM9A 2D54A 4R83A 4AIRA 1EDBA 1G9SA 5JI2E 1ZGZA 4ND5A 4DKJA 1JJIA 5DW3A 1NBIA 2HMSA 5KQRA 1Q15A 1GLGA 2PY6A 5EIBD 3UHAA 4LZPA 1PIWA 3WO1A 2PNFA 1PKEA 4FT4A 4QUHA 3VMMA 3WWDA 1PL7A 3DQZA 3FLAA 4E5MA 4HUQB 1QH1A 1ST2A 5ADWA 3J81A 5KSOA 1IOLA 3B5IA 3RV3A 3OT1B 1AB6A 4O4HF 3WJ7A 1NI5A 3GDFA 4AG6A 3COWA 1K0UA 1IEVA 3V46A 3RTBA 4PQYA 5I7EA 1NAIA 2I9PA 3KC2A 2CHGA 3JD0A 3USCS 3DDCA 1KO7A 1W0KD 3RIHA 1TZ2A 2DWOA 1FP2A 2NVWA 5JCXA 3AU8A 2B0CA 4MYHA 5LQKA 5GINE 3D59A 3SE7A 2UVQA 2B25A 2EFGA 1NBME 3HKEB 3KWMA 1TO1E 5ALPA 3ZGOA 2PSEA 3RPEA 4INJA 2GA9A 4BQRA 1CCWA 5BWCA 3GN2A 3RVDA 1Q1GA 1WIWA 2JFFA 4MW6A 4JBLA 1TCVA 4IOMA 2J9FA 2X40A 2ZTUA 4LDRA 3UOWA 1X92A 2VJQA 2VA9A 2QYSA 2O14A 3Q7IA 4GMFA 3B1FA 3IKVA 4I1RA 4KMRA 4RJ2A 4YJ2A 1WQ4A 4MVJF 4YMHA 3JYPA 5KTYA 3NXSA 1H3FA 4F21A 2B5OA 1CDZA 4EW1A 1ELOA 4PN3A 3LUFA 2IHNA 3CH6A 2G77B 3GG2A 4Q1VA 4IDFA 3NBMA 4K9OA 5FPYA 1CLEA 1G5FA 3PR1A 3SGLA 2M1XA 3WQHA 1OBCA 4E3ZA 2P6MA 4UPDA 4GX2A 4K6CA 2GLTA 2I78A 4QJBA 3CS3A 1RE1A 2FW7A 2EWMA 2YXNA 1JEQB 4OLAA 3I37X 5DHRA 1R8XA 2RC5A 3WFIA 1P44A 3L1HA 1BFUA 4QOHA 4RANA 2BFMA 4JLKA 4YDRA 1N2JA 2D3TA 1DLJA 3I2IA 4WLOA 3TZKA 5K0EA 3T1HB 1S7CA 1N36B 4IH1A 3I6IA 3E9DA 1A69A 4AKGA 4JLWA 4LMRA 3C24A 5I01A 3BD7A 1ULZA 2P35A 5IXSA 1N6KA 1KZGB 2GAFA 3HL4A 4RU1A 3UGTA 2EP7A 5EJ8A 5E1BA 2GXAA 4IDOA 1R88A 3IKLA 4I1YA 2NPFA 4ZDIA 1LPMA 1MU0A 3P5SA 1TZBA 1YS2X 2ROQA 4EM6A 2I3DA 1U9JA 4JUIA 3SZUA 3WK9A 5EHQA 5J2TA 2DBVO 1DINA 2CNKA 4QULA 4TT3A 3EIXA 3AKDA 4MWSA 1GGVA 1ISRA 4AMBA 2PD6A 2Q9UA 1JUDA 2VBCA 1WVMA 5M5BA 4KIGA 2BMDA 4Q24A 1KWGA 4ECAA 2P4SA 5HZMA 3GAZA 1DV2A 3NU1A 2GKOA 4WNIA 1PS9A 1LBIA 4LC1A 4MWTA 3IDSA 2V6GA 3LWZA 5CMLA 3RROA 4KX5A 4F5EA 2D1YA 2Z04A 2YHSA 3DKIA 1KNQA 2BCJQ 2W6JD 3SAJA 2EOAA 3P9PA 2RK4A 2G17A 3UN1A 3CZRA 3QLTA 3ZGLA 1TAUA 5D8DA 2WHEA 1P2FA 5LYJA 4H3SA 3BBLA 2PMBA 4F2HA 4MP3A 5H3HA 1HFWA 1J2UA 1VCHA 1PL8A 4OREX 4TLBA 3KYJB 1L4NA 4A2QA 4HEA6 4KITB 1Q3KA 2RHMA 1EKXA 3GJ4A 4MUIA 4MV9A 4KXFB 1C3OA 1ESNA 4OK6A 3UXHA 4A73A 3DULA 1AK1A 1YRQA 3EVBA 3CF6R 3GZNB 4Q39A 2FA9A 3TTSA 4G0OA 4Y6RA 1HNXB 3M5CA 4PLGA 4OJMX 3QLJA 5B6IA 4EJ0A 2Q5HA 3QRWA 1QSGA 4WDRA 4LBVA 4DZZA 3D4IA 5JQGA 3M4ZA 5I9BA 1V7ZA 2ZAGA 4DG5A 4OEHA 2WZBA 2ZI9A 3BGVA 2GT1A 3BPSA 4OHBA 3DUFA 4KMMA 2VDVE 4JI5B 2O2GA 5AXAA 2GNAA 3R7AA 3N2NA 4DSAA 5BYAA 2EJWA 4DHEA 1FTWA 3S40A 2H0AA 3UMVA 2AUNA 3FWNA 5ELMA 5A3RA 1HEUA 1RMTA 4MWZA 2YFQA 2YJZA 3E2MA 3I3SR 4KXWA 5AI6A 3C3DA 4AJ2A 1XKLA 4TWIA 5CITA 1LCIA 1A8HA 1E61A 1KC3A 1MEOA 1B8PA 1TNDA 1JHMA 1X74A 2IK8A 3AESB 3CNBA 4TLCA 1P18A 2JHGA 5IJ0B 2Z4SA 4MJLA 2AMFA 2ZYUX 2X2FA 4FS3A 2I67A 4ZU6X 3SR3A 2J0SA 4KV9A 3GRVA 5AKJA 3GEEA 4ME6A 2F9MA 5FA6A 2ZTSA 5JRZA 3LLUA 4BLRA 3UAGA 3COJA 3MYYA 1N2HA 3DP7A 5FUVA 2BGTA 2ZE8A 4C21A 5A4AA 2VOEA 1RE0A 3ID6C 4LGYA 3LFTA 1IONA 1J5XA 1EUZA 3QZUA 4EKGA 3HCNA 4DJAA 4QWWA 1R8QA 4YJGB 4DLTA 1MAUA 4DQUA 1EVEA 1N6LA 3NWJA 4B81A 2G6BA 3GXOA 3OQVA 4TKVB 1LLCA 3WSVA 3JW8A 3CKMA 5FNZA 2C7BA 1Y5RA 3KQPA 3BZWA 1B6TA 1ISMA 4N8DA 3U3MA 4Y2RA 4YFVA 4M89A 3QPVA 3TQQA 3OJXA 3ZDRA 3QNUA 4BZZA 4Z0NA 3NJ8A 3S8YA 5JAZA 1C1XB 1BGXT 2IEBA 3TLAA 3W7AA 1AMNA 1KGDA 4MQEA 1ENYA 5LLSA 4HHEA 3EMDA 4NX2A 4WK6A 1WUYA 4WNAA 3H1GA 4ZRMA 3C1AA 3PEUA 3QVMA 1YASA 4URHA 821PA 1VRCA 1LI7A 2ZIXA 4ZVUA 3I92A 4YUZA 1XDZA 4IYRA 2JIZD 3JQ9A 2IXBA 3KT3A 4KLRA 2C1XA 1GJRA 2VP4A 1WUIS 4CUKA 4FZ5A 4E33A 4J7AA 3SXUB 4BNHA 5KOHA 3HA2A 1NGSA 1X7GA 3T35A 1S8FA 4B35A 2WIJA 3RAFC 2JH9A 3MJRA 2I1LA 1UQRA 1LJ8A 2GCEA 2V7XA 4IILA 4EKYA 4ZZIA 1Y1TA 2ZP1A 5AH0A 4GL4A 4J90A 1ZWLA 4WTOA 2ZKIA 2XT0A 3PZRA 4IX9A 4JQSA 1HDOA 2EBFX 2Z08A 2J7PA 1B73A 2OPHA 1NPTO 3U7IA 4DTCA 1GTMA 1QG4A 4MKXA 3U81A 2Q99A 1UH5A 2C9DA 4ZOLB 1KERA 5EJEA 2XTAA 1UPTA 9ATCA 3BM5A 1AIPA 1XA3A 2Q2OA 2BBWA 4L7QA 3ASVA 3GPBA 4R7GA 5P21A 2G80A 4RVGA 1QHNA 2BKVA 3ZHUA 3IEPA 2OZLB 1DARA 4MR9A 4JBWA 1AKNA 4NMWA 4G4IA 1WPRA 3EDQA 4NYMQ 3RGWS 4JUFA 1B0UA 1GFIA 1TUBB 4AN1A 2I3GA 2OLKA 1E9AA 3DQPA 4ZAZA 1YI1A 1CE8A 3MOIA 4WQMA 1WKVA 2Y2VA 1FDUA 3KU1A 3Q3EA 4EJMA 3ZGXA 4DILA 5CDTA 3WGIA 4IQ4A 1ECLA 1OBOA 4U2DA 3TF5A 4HDQB 1SAYA 2WPDA 1D0SA 3KPUA 1PRYA 4NULA 1ZH6A 1UBOS 2CVHA 1MBZA 3I2HA 3RSCA 3WGUA 1R0SA 2D5IA 1FJHA 2OECA 1ZJZA 4DNOA 1OXXK 2D8AA 1LPNA 3R9WA 1U8ZA 2BEVA 1E1RD 1O5OA 5H68A 1EWKA 1VTKA 1JT2A 1QGYA 3QE2A 2WMYA 3OLCX 3FWPA 4NTZA 4ICIA 3GA0A 3VH4A 1GQQA 1A1VA 3JTEA 4ZYLA 2F4VB 4NU5A 5ES4B 5BXQC 3CMMA 4Y6LA 3DBRA 3H2JA 4EKEA 4FMDB 4MEBA 2CXRA 1MAVA 3B6EA 4WOKA 1FK8A 2P5TB 5H3CA 1XMJA 3CT6A 3P19A 1YTLA 5T64A 5T8KA 2ZR7A 1JF8A 3L7JA 1YFJA 4L0DA 1X7ZA 2EBWA 1JPNA 3GGPA 1R4NB 3KQMA 3N39C 1TLTA 5DB4A 3TRFA 3AGPA 2P9EA 1CBUA 4G4SP 3H8SA 4KZKA 5FRDA 4ZEMA 3N6XA 4DA4A 3ZLUA 3CX3A 4RVOA 3HU3A 2HLNA 2WNSA 4FFDA 3VSCA 1MA0A 4H59A 1HETA 2QUBA 3HB7A 1T4CA 4Z9YA 3VX3A 1YR1A 2UVPB 4AJ1A 4RH3A 4CFSA 3D3WA 4MCJA 2WF6A 4W9MC 3R9XA 1JDVA 3GDHA 4DQDA 3UKDA 2VRCD 1QH0A 4PPFA 4QC2A 4WT7A 3RSZA 5AVYA 2G04A 5EHZA 4F2WA 2F1JA 1PN3A 3DVSX 1HK7A 1IQ0A 4N6GA 4CL3A 4FGZA 3KB8A 3STTA 1Y34E 3DL7A 3PUJA 4IM7A 4F6LA 2WUDA 1NR7A 2HSWA 1E69A 3D6HA 2IV2X 2IHZA 4NBVA 1NYQA 3UUEA 3DE1X 3VZBA 2EZUA 5C8YB 1E2LA 4BYGA 4JI1B 3C8UA 3GLGB 4FYXA 2PYDA 3L7NA 2OY0A 4FGUA 2A5YB 2PHZA 3I04M 4ZAYA 1OY1A 3ICVA 3NBKA 2NO7A 4UTXA 4OVKA 3RVMA 2QT9A 3R4CA 2BFFB 1T1SA 2Z58A 3F96A 2WFLA 2WKQA 3MAGA 4DNXA 2GF2A 2NO9A 1GVNB 2ASEA 2J5KA 4BP3A 4CU5A 3LZ6A 4X61A 3IPRA 3M4NA 4LC0A 3LMKA 3K1TA 3A25A 3P26A 5K3BA 3HYTA 3RF7A 3S7ZA 2IYFA 2Q2WA 2R2AA 2PMWB 1U2RA 3IRVA 3L7MA 2QM3A 3AEYA 2XPCA 2DX7A 1TYCA 3PQ8A 3Q3VA 2ID8A 2R5FA 2V59A 3DV0B 4HAYA 5EWJB 3TLYA 2PK3A 2ZRQA 3TSOA 1OLXA 3TVDA 4BLWA 1MT3A 5LYJF 2GZDA 1RI4A 3DKKA 2EWVA 1M75A 3WWEA 5CB4F 4U7DA 5DVZA 4BQEA 3F74A 1JDJA 2OOKA 3DWIA 3GFTA 3MSXA 2XE4A 2IWRA 2RC6A 1QKIA 1SCIA 1XTUA 5IDVA 3N05A 1FJXA 2ZRNA 1SA0A 3DTTA 2O2XA 2XDQB 1BVUA 1Y7PA 2WIBA 1J0CA 2VR1A 3GR6A 1VLVA 5CGZA 2ZIAA 3TM5A 3TW8A 4DS3A 1UDCA 1JKJB 1N2IA 4LGCA 4MPDA 1MTZA 1E66A 3ELUA 3WNDA 2E49A 5FTWA 1O94C 4L6AA 2M6KA 3NFYA 2WG0A 5K3FA 3BCRA 1TXGA 3H5OA 2Q5OA 4MV0A 1UP7A 1IN7A 1UDXA 2QUAA 1V3UA 3H3XA 5CX1B 3B85A 5KTSA 2CBZA 5BT8A 3PEEA 2ZIFA 4PO1A 5T6MA 3RIYA 1CP3A 1KI3A 4CTNA 2E55A 4EFMA 4F5DA 5LSAA 2ZJ4A 2B4KA 5EQJB 3E5NA 1G5QA 4OBEA 4KRFA 1UPAA 2C7QA 1BRTA 2HB6A 3K9GA 4FE3A 3P2IA 5U4QA 3KDPA 2WF5A 1MD9A 2P5UA 3C8ZA 4H7EA 1HQCA 4CE6A 4E4YA 2Q45A 3GUUA 2C4VA 2FPKA 2XHEA 3N3BC 4JELA 4L9SA 2JJQA 2YCLA 3F98A 2ZR8A 3S4YA 4JXJA 3B51X 1DQNA 1EINA 4UULA 3VTAA 1CFJA 2XWJI 4CIBA 3O9VA 5JADA 3UMCA 2PRJA 3CRMA 1UIMA 2X8JA 4MH0R 1DZIA 3JWPA 1PFQA 1W0JA 3L8GA 5JATA 3ZE0B 3PUZA 3WOHA 1K9VF 2BT4A 2HPHA 1I6LA 4WFIA 5TF4A 3KCNA 4XEHA 4DGQA 2CNWD 3A1EA 1Q84A 4AS1A 4QIHA 1NOKA 1Y7LA 3C7TA 5GJBA 2ZR9A 1XCGB 4DBZA 4B3GA 4CQMB 5JZOA 3IUYA 4B2IA 4HNHA 4QFCA 5COBA 1J2RA 2HZBA 5E4YA 4GBED 3ZWPA 1UBKS 1LWNA 1ADGA 3KTAB 4ILKA 1LC3A 3KOMA 1KRHA 4KQFA 1DQZA 4WLNA 3G1UA 2ZVQX 3UGKA 1QO0A 3AYXB 3N0TA 4ZZ3A 4BE4A 1P9WA 3K16A 3H6KA 5DBIA 4N5NA 4IIVA 1P3Y1 2B9EA 3NGXA 1U0SY 1D2EA 2PO7A 4WW0A 4EL5A 5ELXA 1XVIA 4Y1GA 5LIRA 4BEJA 3S81A 2XGJA 3CGWA 2G4CA 1SHUX 1YOVA 4AQDA 1MX9A 5CK5A 1BO6A 4MA0A 2VHXA 3WLHA 4QPZA 2WSIA 5GONF 1Z68A 1HQYE 1OYVA 2PT5A 5HS4A 5JISA 1NATA 3ILVA 4WEQA 5A04A 4XWWA 3ESCA 3P1JA 3MRVA 3D43A 5IUNC 1YDEA 4FMCB 5HF8A 5FFNA 1MC4A 3NALA 3T5DA 4QGSA 2L19A 1GO2A 2H1IA 2VJCA 3ORRA 4C0KA 4GI1A 4MSUA 5KCZA 5ALUA 2HF2A 1DC3A 4KO2S 1L7OA 3TBHA 3I9JA 1FFYA 3HVUA 1SG6A 2ENUA 1Z2PX 4BLPA 2VRWA 5ED0A 4GPEA 1DO8A 3RT7A 3E8MA 3OJEA 1RQNA 2XUQA 4QDJA 4Y9DA 2QAGB 3D5TA 3I4LA 1RCTE 4RVDA 5DYIA 4E5UA 1V7QA 4F3NA 5AVWA 3NBQA 2FGJA 1VL6A 1TUEA 5L3SB 2KHZA 3SD7A 4L07A 2BMJA 3A6DA 3U17A 5JAHA 2QYHA 4L8GA 3EULA 4ZHSA 1EE2A 1MO2A 2B35A 3L7IA 5J2TF 1ZR4A 3ITEA 3CA8A 1WXXA 3STYA 1F17A 1J0AA 2XBUA 2DOKA 1RQGA 1YVDA 5AJHA 4RORA 3A6EA 5HMLA 5JPCA 2FZGA 2A9VA 5M04A 1ZXBA 1FU7A 2FDCA 3CNOA 4RX1A 2JD2A 4WKBA 4MRMB 3EOBI 1E3JA 3FLBA 3P2OA 3OPXA 1HURA 5CJPA 5G0SA 2V4UA 1XVUA 3WYFA 4BUJA 1X86B 3KT8A 4MS1B 1L5WA 2AI3A 1JKFA 1G5RA 1W93A 3O74A 4V0ME 2CJWA 2HQBA 5BSWA 1IXRC 1FVXA 3AHIA 1XNHA 2G09A 2Y0DA 4H7KA 1NVMB 1RJWA 2G0TA 3FDZB 4F3YA 3B5EA 1FQWA 3M9XA 2FG6C 4JT9A 1TZJA 1M0TA 1OR8A 4YJ3B 1V4BA 5JROA 2X23A 2P9QA 3LLMA 5D84A 5IUKC 2J1LA 4O2RA 1AN0A 3E53A 2HJRA 2IDZA 2K2QB 1QVAA 1V47A 3B3JA 4J1TA 4I55B 1BDHA 2O0LA 1R4AA 4Z49A 3PUYA 3A9WA 4PG8A 4RTJA 5ALRA 5KTRA 3VKHA 5HEKA 2B8JA 3IDOA 3MK31 3N5CA 3WZ2A 3C16C 4KSYA 3WHLA 1UXJA 1SB8A 2FMFA 2GPNA 3EIQA 1PJLA 3D7MA 3IAM6 1QRSA 5F9FA 2R6CA 3KSDO 3V4OA 4ZKDA 1IQRA 4UOEA 4DM4A 2ZYDA 2KBFA 4G01B 1E0DA 4XDHA 4ZCTA 3PX7A 3OX3A 1AZSC 4MQ4A 3WYEA 1H1LA 1QC5A 1IZ8A 2OVFA 3LHKA 4RK5A 2WNIA 3O83A 1RWVA 1GKYA 3A3PA 3D9QX 3W06A 4HNRA 3WLTA 3OEYA 4AUMA 3PXGA 4KACA 4EA7A 2B0JA 4HXGA 2WWTA 1Y81A 5TPWA 4EG5A 3NP9A 1BMDA 1QFYA 1GTVA 3PNYA 4KP7A 1TMKA 4WBXC 1O2DA 3JVDA 1QLWA 1GG5A 4TVOA 4HB4A 4KQGA 1QHGA 2GHRA 1VHQA 2QD1A 3NNSA 4NXNB 3IJPA 3NI2A 5DYYA 3SQMA 3UZUA 3FGNA 4D3XA 1XD2B 1S02A 2LCIA 2MYUA 3U2QA 4ML3A 1NXXA 2I4TA 2RHRA 3SFZA 3I42A 4YJ3A 2I4NA 3TX2A 1GPAA 1J21A 1U28C 4QLOA 3G88A 3TLZA 3LCCA 2DE0X 3IB3A 4N76A 1VJCA 3BXPA 2C98A 4Q37A 4TQAA 2D3WA 1UWLA 4OUKX 1N1MA 5DTIA 1N5DA 4M0CA 2PRIA 4NOMA 3D3NA 4E15A 1P4SA 5ER9A 1QDLB 1UUFA 2ODNA 2B1IA 1OYOA 1YZGA 2PPVA 2VSFA 3VAZA 3KXPA 4GDMA 4AJEA 1PNQA 2NUAA 3A4YA 1V1RB 1OH8A 4BKOA 5I4CA 1W5AA 2AT1A 2N1BA 3FUTA 3MD0A 2I03A 4UMFA 2O8BA 3K20A 5LM3A 1KJQA 3B89A 5G3ZA 2GQ0A 4MVXA 2QHXA 2LD4A 1B8NA 4HGPA 2DZDA 2G9QA 3WSTA 2NUAB 2Z9BA 3BGIA 3HPQA 1PKXA 4H9GA 1O94A 1DHRA 3TN7A 3TQHA 2F3RA 1X8XA 1YR7A 1V5IA 3SF8B 4GUDA 1EK6A 4ZV4A 1IY2A 3UQYS 2C2YA 3N2KB 4P54A 3UWDA 4AICA 2Q50A 3OUUA 1F3OA 5A4FS 4JYCA 2I3ZA 1DIHA 2WU4A 2IDJA 2IV7A 5G1NA 1XVTA 3NCHA 2GHIA 1CR1A 2ADOA 4HRYA 3HJFA 1WM1A 4RZIA 1VSQA 5CLLA 1N2OA 3B1KA 4DVGA 3R5FA 2OD7A 1Z0UA 2RGNA 5C0OE 3NONA 3FTCA 3PDHA 1JFTA 2TMDA 4D26A 1XN4A 3FKSD 1GYRA 1ES9A 2YICA 2C97A 1ZCAA 5IKEA 1ZQ1A 3HLYA 4EHKA 4J1NA 3U7HB 3OM1A 4PYOA 2Z5FA 4WXPA 4CYMA 1GRVA 1HZZC 4QQFA 1QAOA 2IL1A 3LCVB 1AN9A 2Y0PA 4GMHA 2BJVA 5F3WB 3FDIA 3B36A 5T4FA 3AF2A 4UU1A 2PUGA 3C6XA 1MR3F 3DBIA 4PYQA 5AXDA 4EG7A 3ZE7A 5EZYA 2D5LA 2X9NA 3QPWA 3RABA 1G17A 3IBYA 1EHYA 3HU1A 1WXIA 1W35A 3IXQA 3PCXA 4HWKA 4INAA 3UT5A 3O4GA 2CXNA 3DOJA 3JWIA 2JCGA 1Q83A 3MQ2A 1U31A 4JYPA 4WCVA 3SF0A 1ZXXA 2DEUA 1L1FA 3V1YA 3FNFA 3GYGA 1JWLA 2C3OA 3KEGA 3JAWA 1Z29A 1Y6GA 2DPHA 2PBRA 5HZHA 3GLFB 1OD6A 3GZ4A 1W19A 1OLSB 4EY8A 2E21A 3H9GA 3OJFA 4LXIA 4BO8A 2EX4A 1URPA 2WYIA 3AINA 3CPEA 1MRZA 2DFPA 3D3KA 5FPSA 2JGDB 4KZPA 5IKOA 3WMGA 4JOSA 2PUDA 4RA6B 3VI4B 2FW9A 3KQYA 3GY0A 1Z5NA 1C7QA 3RJZA 3NB0A 2RIPA 4PZYA 4CKYA 1XXHB 1V0JA 2BHTA 3ZBPA 2WHPB 3AERA 2QLTA 2CLEB 4UZFA 4ZPJA 5H70A 3F8WA 2BGJA 1VLZA 1DPFA 2ACEA 3CSSA 4KWEA 4R9SA 4TMKA 5IS2A 3C8DA 2GK3A 3MGGA 3PQ4A 1PFVA 5HNKA 3GJ3A 3GJXC 5IH3A 3I0MA 1GV0A 4FKBA 5CDGA 3KG2A 1I33A 2QOEA 4A92A 4ROTA 5EXEA 3KJZA 1TJ5A 2R0QC 3ZV3A 1Z8FA 3DE2X 3EWAA 3GVPA 1DQPA 3NC1C 2C20A 2NT3A 2IZ7A 2PAFA 2Q1UA 4KNVA 5B58C 4W1QA 3ZHOA 1T3SA 1E4EA 1E6KA 5DX8A 4B2PA 1LPAB 2CNLA 3LPNA 2HMWA 3U44A 1FNSA 1KZ1A 2FN9A 3HG7A 4D42A 3K1ZA 4G07A 3ER6A 4RENA 4WNYA 5BT9A 2CXPA 1XCPA 1KF0A 1ID8A 1YB4A 2AI1A 3CTPA 3PEVA 3K1YA 3C41J 4EPRA 3ZV6A 3TKYA 4BUCA 4EF5A 5KKCA 1PWZA 1M6NA 5EZ6B 4FGKA 1RXWA 1GAEO 1XVLA 1AS0A 2ORWA 2Y1XA 3G6KA 3QVGB 4MDHA 4ZODA 3IS3A 2YW2A 4BO1A 5BNTA 2YJ5A 3IDFA 4NG5A 1GSIA 1JAXA 2MINA 3L7CA 4O4HB 1SUFA 1VKJA 3U7JA 3K9CA 5ALVA 4PLZA 5FI1B 1KSFX 4YMUA 4YCLA 5AI4A 4GH5A 1OI3A 1X1DA 4NDNE 3VO2A 3FOBA 3ACCA 1DMSA 2JJ2D 5TLSA 4AY5A 4L2IA 5J1TB 4F6CA 1JG1A 3L8MA 1OJLA 1VKRA 3AHJA 2NAFA 5KWJA 3FNIA 2FUCA 2NSHA 2POCA 3QYFA 4RVHA 2WG2A 3GJ5A 2G0NA 3I83A 4WCDA 5DCLA 3VSAA 4CCYA 4XX0A 2LP4Y 1Y33E 3TTXA 7GPBA 9MHTA 2FRXA 4X95A 4XPIA 4BL5A 4RKFA 1NF8A 3AXTA 5HTKA 1DEXA 1EB8A 2O3QA 1CTQA 2QM0A 1YHYA 2OCYC 2DGDA 4K6FA 5DBGA 1XZHA 2ZSBA 3A1DA 1XEAA 3OE4A 3SJAA 4N5MA 2WZCA 4Q0MA 4ENVA 4URVR 2F8TA 2NO0A 1H1TA 1R6DA 4WINA 1WA5A 2BM1A 4AO6A 5AKGA 4M6WA 2RJNA 3VPFA 2A92A 3BGWA 3HVKA 3U44B 1AKEA 1YR3A 2FUKA 1U7PA 2CEKA 3GL9A 3BQMB 4MUHA 4TS1A 3ZHYA 1DX9A 2FX3A 3ZUGA 1DFHA 3OFJA 2OK8A 1KNXA 2PL5A 3K15A 3UUGA 1PDVA 1M66A 4C5CA 4QREA 4G3XA 4F6RA 1S2IA 2JIOA 5C8YF 2BR3A 4NV0A 1K6MA 4ERXA 5LN1A 3E35A 2XZTA 2PX5A 4QXAA 1GPNA 3ZW7A 2JGAA 4Y2YA 2ZFUA 4CMIB 1YE5A 1ZHHA 1NVXQ 4GRDA 2VP2A 1FYXA 3OTIA 1NBEA 2VLBA 3P2JA 1ZI8A 2BGKA 5BXYA 1E5DA 3L01A 4D4IA 3H2KA 4TSFA 2CZQA 3WP0A 5BW5A 1NBMA 2D13A 3IOBA 5LMCA 4A0FA 2XRZA 1KAHA 4ND8A 1ZI9A 2PV7A 2OXRA 2R6FA 2XHZA 2G1KA 8AT1A 4HNAB 4D3FA 2AE2A 3BAFA 4A8JC 3OEHD 3OF5A 2NNLD 1PNTA 1C8BA 1WF3A 1YACA 3BDAA 1GA1A 2OA0A 3SNHA 5IPFA 3OTOB 4HLDA 1WEHA 1RD4A 5DLQC 1J7KA 4XR9A 3R5HA 2JK1A 1WMBA 2FWJA 4TL9A 3CLVA 3RANA 3RS0A 4G1VA 3GLGE 2WR8A 4YK7A 5ALEA 2OQVA 1TLFA 2BM9A 4I50F 3T3PB 2BFNA 1W96A 3PSAA 3RASA 4DSOA 2RH5A 2G7MC 4M8KA 1WAMA 4HNQA 4X3PA 4EO7A 1Z7EA 1FB5A 4F45A 2G28A 1X1AA 2PXXA 4KH1A 5E3HA 3OSZA 1USUA 4EW2A 3T0IA 1N32B 4IIBA 4ODIA 1VGQA 2QRNA 3CPJB 2PUWA 3CLSD 4BTLA 3QY0A 2I2XB 1PWYE 3SX2A 2J5RA 2XMRA 4HB0A 5CFQA 3LRPA 3N9IA 3QLUA 3SZMA 5H9VA 4BRWA 4UVDA 4MQEB 1EFPB 1UK6A 1T4MA 2YRFA 4CZ2A 2SCUB 2SKCA 5KINB 3FHTA 1I13A 4HAXA 4P3KA 3AVTA 3BMCB 5DV9A 4BLOA 2MIIA 2PJZA 2I29A 2QG9A 4HY3A 4J7CA 4Y9TA 1K88A 4Z0PA 5B1SA 2X3UA 4MI3A 3EDRA 2EFHB 3IUBA 1RJFA 3MCAA 3ETHA 3DTVD 2OQIA 1N6PA 2ZT6A 3HHEA 2IC5A 3Q88A 4R41A 1U2PA 4X00A 2X5NA 1Y3BE 2P6UA 4PPQA 4OHWA 4OI0A 2IHTA 5CT9A 1SC4A 3EXIA 3WLNA 2UVPA 4V0RA 4V0NA 3V8BA 3WLEA 1UT8A 3L4EA 2B1QA 3ZE2B 3THXA 1KZ7B 4C0JA 4MUJA 4S1TA 1R6TA 3DYVA 2BFDB 2F59A 3LUAA 4JJ7A 2ZYAA 2AFIB 4OYYA 3A04A 3SQLA 3ZY5A 1UJ5A 3TQOA 3ILXA 5HRCA 1XAJA 4RF5A 2LR0A 3GFOA 5JNVA 5TT1A 2I34A 4PE5B 1E96A 3VFDA 1EP9A 1XDSA 1H6AA 2V8OA 4ZK2A 2WJZB 2HJ9A 4ZMRA 1JB9A 2ZLBA 2C04A 3VC3A 1C2TA 3C5EA 3O73A 3PDCA 4IJVA 1G60A 1BOOA 3JD1A 2BY4A 3R3XA 2BFDA 1QS0A 1YRAA 2YRXA 1XDDA 4FLEA 4B43A 4M1QA 1REQB 3JR3A 1KRXA 3DYIA 1EGVB 3S8EA 1ZC4A 4P8RA 4TRMA 3FMGA 2IXFA 4II2A 4ZAGA 4NYIQ 2OYCA 1RXEA 5EIAA 3R24A 3NEAA 4EAAA 1W4BA 5KHAA 4RA9A 1CR2A 1NVVR 3IAHA 2ZSFA 5U4XA 1KETA 2D4AA 4F3CA 3RH0A 1REQA 4JGBA 4NESA 5DHFA 4D9FA 5BN4A 1ESDA 2ZUFA 1UDRA 2N47A 2Y76A 2ZWVA 2Q27A 5DGIA 1M1YE 2Y4OA 3Q8KA 4Y2QA 5JAIA 2CDRA 1Y82A 1TRHA 5LOVB 4CEIA 2VQ6A 4K3VA 1PVVA 1C0EA 4KWIA 3NOOA 1V5FA 1RXVA 2ZSUA 3BDIA 4ALKA 2A2ZA 1G8SA 4O0MA 4TGLA 2XVZA 5HF5A 1KU0A 2PLNA 4MJ7A 5HSGA 1M2JA 1Z4QA 1P77A 3Q3IA 1M6WA 4EG1A 5AUOB 2CT8A 3PI6A 3NBAA 2GZHA 2HV8A 2QN8A 4JSTA 1ADJA 1DEAA 1U3WA 3QHQA 4FMCF 4I4TF 4N41A 4U7TB 5EIEA 3GP8A 4MOWA 3DB1A 4LOIA 4X8LA 2FEWB 1F4VA 2VYNA 1U0GA 1D07A 1K63A 3PNQA 5ALJA 2LKCA 1IATA 1UBNA 3IURA 5DN6A 3ZWKA 5ALQA 5JD4A 4GHWA 3ZEIA 1EVKA 1TYDE 1G2QA 2QLFA 4XUGB 2DQSA 4C1BA 1EIZA 4WD3A 2O3UA 4M49A 1Q6YA 3H2SA 1W29A 4CUJA 4AY6A 2BMEA 3FVVA 2AR0A 1CB7A 1ONPA 4YJDA 3G9UA 3PUWA 3KQLA 3QF7A 3KEMA 3CY6A 4QTXA 1ZD2P 1E0JA 5EE9A 3RS5A 3QVXA 4BAGA 4EHBA 5CFMA 1FTGA 4GSKA 1ODFA 2P4EA 4B44A 4WNCA 5EVCA 3GLUA 4C6HA 3KYCB 1Z5GA 5B57C 4BU1A 2JZOA 4KV7A 4GYJA 3PR3A 2HSGA 3BCUA 3N5KA 1IH8A 1KDOA 5CX1A 1ZUD1 2KE5A 2PPLA 1COZA 5FO0A 3WLLA 2ZRCA 3PC2A 2OBNA 2EX0A 2WICA 3B1ZA 3DZIA 4HFMA 5FOUA 3ZJ5A 3DG9A 3NWPA 4I5IA 4Q4JB 4BGUA 2OFFA 4FYPA 4QELA 3ROXA 4JKIA 4G1EB 1P81A 1PDOA 1RW4A 4J4TA 4KK3A 3LXMA 1P75A 4LJLA 3G0IA 2CJFA 2O2EA 1NV8A 4QTZA 4D80A 1SKAA 2YMQA 1DDOA 1UC8A 4EPXA 1T2CA 1EG2A 1UJ6A 5DGCA 1Z83A 1HDRA 2Z9DA 3GLGA 2AN1A 3VTFA 1DUIA 3H9QA 4FYKA 1XTRA 4LIPD 2ZWIA 4PZCA 3OESA 1X7WB 2Z56A 4PO8A 2UUOA 1W8DA 2DSTA 4XB1A 2IDKA 3VR2A 3SXPA 3A6JA 4D8XA 3CVJA 1GQ2A 1W0CA 2WF7A 2Z8YA 1CNEA 3MS4A 3PD1A 4RFSA 4UNNA 5E4FA 2WTUA 1D09A 4QYWA 3I30X 1EMDA 3L0SA 4UBNA 2GBIA 4E1VA 3ZTWA 3VHXB 5HW0A 3VI3B 4WXHA 3DPUA 3I62A 1BYIA 2XR1A 1UJ4A 4OBXA 3ZWBA 1EXNA 5L3ZA 2AX4A 2QK4A 3ND8A 3WJ1A 3MXTA 3CCBA 1SEVA 3A36A 5CYPA 3RVSA 2BH9A 5EIFA 2YRWA 1FTQA 5BRNA 1JR3D 4FD3A 4C2UA 3MRSA 2C58A 2Q1WA 5ULLA 1RRMA 2OM2A 5A3JA 2PLAA 4B4KA 4DV3B 2ZZMA 4V0OA 3LUGA 2VSNA 3R3JA 5KYKA 1TVKA 2X4IA 5HUJA 1KJWA 4HQNA 2GZRA 4RZ3A 3S2UA 1ZHFA 1Y6FA 2P4HX 3LPAA 1VQ1A 1EU1A 1TCAA 1W5TA 1Z4MA 4EUNA 5JYBA 1NBWB 1N9ZA 1N7IA 3QPAA 1O6BA 3ZU2A 2BDTA 2LTAA 4J43A 3L7YA 4GR5A 4CG1A 2YUIA 1YMUA 2N42A 2P9ZA 2JIMA 3RARA 5F23A 5EGNA 2GZ2A 2FRVA 2VP0A 3HLTA 4PPYA 4Z7OB 1KQGA 2OGWA 1SUDA 1Z6YA 2Q6OA 4QBTA 1LUAA 2A35A 3DTYA 2C5FA 3GFSA 4D43A 2BN4A 1L0BA 1QQ5A 5BPFA 3DA8A 4LJ5A 3DO5A 4G0QA 3ZX5A 2GCGA 2IEZA 4B3MB 4TMZA 1ZN9A 1ZL0A 1GCUA 2FP3A 4PYRA 5ES3A 3WOVA 2EQAA 5K03A 1T2EA 1W36C 1ORVA 4C76A 4H6WA 3GRUA 2W8BB 2WT4A 1A5ZA 1MDBA 1Y6JA 3K9FC 3FA2A 4GM0A 3SVTA 5ILOA 4DR2B 5J2UA 4EYKA 5BW8A 3HKCA 3FSGA 4MVJD 1DUVG 3ZHBA 4YRMA 1ZA2A 4TS3A 3TI7A 3EC7A 2PZKA 3FMOB 3KXIA 4OIMA 4QUKA 1LPPA 1RQ2A 3RRYA 3X2SA 3U19A 1JE0A 2BV3A 1STOA 2C3PA 4YJFB 2GPSA 2XGGA 1FVOA 5FUYA 4HFRA 2V6FA 3FN4A 3BMXA 1Z4KA 1BFKA 5IDWA 4KFCA 2R8XA 4FHGA 1RWKA 4O2LA 4HDNA 3RADC 2VYVD 1U2DC 1GYQA 1YRHA 2ES4A 2VBIA 1JDBC 1E60A 3CIOA 1IHYA 4RDHA 2ZWAA 4I1IA 1RYYA 4L16A 2PIAA 2GEDA 1EDZA 1NFQA 1ZXLA 2F3QA 4KQMA 1XLWA 2JI4A 4LJ9A 5CVVA 3C6ZA 4MVJH 3WHIA 1LJLA 1VKZA 1QTRA 2CJPA 1BJTA 3ICOA 3W78A 1GAXA 1D1SA 1UOEA 2AXEA 2CYCA 1SXJD 3IX7A 4K8OA 4RL4A 4C2TA 1NDUA 1XNQB 1RLOA 3WAKA 4C87A 2Q28A 2YJ6A 1GNLA 1QGZA 1TO6A 3F7NA 1OROA 3UAOA 2J9XB 4DQLA 2I7CA 1M72A 2HA2A 1F8YA 1GA6A 2XKBA 4XEUA 3PFWO 3NRJA 1KKLA 1H6DA 1ORDA 3FPLA 3OMXA 5BMVA 4F46A 3BJZA 3Q41A 5ALXA 5JYEA 4CGYA 3A05A 3BIWA 3QSYA 4Q34A 4COKA 1Z6TA 3ISTA 4OD0A 3L0IB 5C4IA 2VJLA 2PT9A 4HP8A 1Z0SA 4PSAA 3KFVA 5BSTA 4C89A 1RC0A 1U4OA 3NHSA 1WSAA 2F90A 3A1TA 4WN3A 1AD2A 3UPUA 5L7YA 3ACBA 1E0KA 4UBOA 4G8JA 2GM9A 5C80A 1JG3A 3KZCA 3C2QA 1VYUA 4KDRA 4QOJA 5FLEX 3ZEAA 1NJFA 2QMUA 1N6IA 2H3EA 2WLSA 4S05A 5TT0A 2C94A 2YYZA 1HSOA 1U7DA 2FPLA 3AJRA 4FZRA 4GMGA 2EVWX 3NPAA 2FSHA 2MHCA 4ZOAA 3SOZA 5BMVF 4C7XA 5JSZA 4PAOA 2E3JA 1NBOA 1ORWA 1KO5A 1UBGA 5F1YA 5H82A 4C1NA 4KQ1A 2HRQA 5AW8A 4MGZR 1JJ7A 1XRLA 3PE3A 5LQCA 2ZRHA 1K08A 2AN4A 3EVZA 5EFOA 4F4JA 1M0EA 1YZKA 2MYNA 2QLLA 4L3OA 4QTTB 5CB6A 1RHUA 3A6LA 3EF0A 3OOHA 5SZIA 4C01A 4AX8A 1JZTA 3COZA 2VCYA 1NHGA 3LNCA 5F5LA 2ORVA 2OFWA 5TS3A 3VGJA 4DCNA 3MLBA 1YD7A 4G86A 1XCBA 1C9JA 1IBMB 1FRZA 3TVYA 3RDPA 2IYYA 4R0NA 1UBHS 2CYAA 1LRKA 4BVAA 3HCFA 1DWPA 2ZJ1A 2XNHA 3ZI7A 3KKQA 1ZX1A 1ZJ5A 2Q1SA 5JRJA 4L51A 3SF8A 1EUDB 3EMVA 3TE6A 1QFXA 4YASA 3H65A 1LRJA 4TLMB 3KQWA 4X7RA 3WMWA 1Z45A 3KSBC 1TA0A 1JHVA 4HH1A 4EYSA 2ZR0A 4H18A 5KVSA 1QF7A 2DFLA 1EBBA 3SSMA 3F4LA 3HKBB 2O3JA 2I62A 1PEAA 4HN4B 1IZ9A 5F1KA 3V33A 4BBJA 1CWUA 3MIIA 3GDOA 4GR9A 4KXYA 1SCUA 2J3DA 4MQBA 1XZAA 3LV8A 2F3UA 4R3NA 1EI9A 2C1EA 1JLRA 1FUKA 3FSJX 3K31A 4PHHA 1XKXA 3UAWA 3U4QB 1D7AA 1XZBA 1PJRA 3OY2A 2O7SA 3BWXA 3P2YA 3QUTA 3P0EA 4IF4A 4NZPA 5BUQA 5JZ9A 5DOVA 1YNSA 4FINA 5F1PA 3WV4A 1CULC 3EG9B 4JHLA 5KNCD 3QSGA 2WHQA 1JU4A 4Q1BA 4D9GA 1O6ZA 5ECGC 5H4GA 5SZHB 4BEBA 3MUFA 2EDAA 3EXFB 2HHJA 3JAKB 2WSSA 4PF1A 1S5PA 3DD1A 1GN9A 5B3AA 1W4LA 4KYIB 1JEYA 3MWDA 5A71A 1XLTA 2Q1TA 5KI6A 4NZOA 1MW9X 4R1UA