1O5BB

Dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDACQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 49
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5bB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5bB01
4ZKSU 3HKIB 4X2WA 1W12U 2D2DA 3SUDA 4O97A 2QA9E 2ZQ1A 5K0HA 3QN7A 1CBWC 1C1NA 2Z9IA 1C1RA 2R0LA 1BBRE 2BDBA 1T8NA 2H5DA 1T7CA 1O2YA 1ZJDA 1GBJA 3PMJA 3E8LA 1HIAA 1TX6A 3ATMA 7GCHF 2XCNA 2K1QA 2PLXA 1MU6B 1ZLRA 4X2VA 3C1KA 4TPYA 4J2YB 5EW1H 3M7UA 1ZTLA 3SI3H 1FY4A 1QY6A 5HGGA 2GX4A 5C5NA 2ZA5A 1E0FD 1NO9H 1H1BA 1S81A 1EJNA 1O2QA 1AD8H 1V2OT 1L2EA 3P8NA 3RP2A 1O2XA 1YPLH 1O2KA 4YOGA 2QYIA 2QY0B 1ELAA 4K3JA 4AG1A 1GHWH 2O9QA 2A4RA 1AUJA 4MPUA 1BRBE 1NU7B 3LGTA 3GICB 3ENSB 1DLEA 1IQNA 4Y8ZA 2Y7XA 1J15A 1P12E 1FY5A 1EJMA 3LU9B 1NPMA 1QA0A 2J95A 3PYHA 1UTLM 3BIUH 4ZUHA 1LVBA 3AAUA 3GY5A 5ETXA 2BMGB 2BM2A 1O36A 2F9PA 3MOCA 5LPRA 1A3BH 5FBIA 1QR3E 1TMBH 1HLTH 1G37A 1TGTA 2GCHG 2FOAA 4BXSA 1K28D 4K69A 1QB9A 2ZU3A 3KIDU 4BOHA 5C1YA 5JB8S 3BG4C 1SGTA 1ARCA 2ULLA 1V2TT 2Q1JA 3NZIA 4ZAEA 1ABJH 4PROA 4FUFA 1DY9A 1Y8TA 1OP8A 4IMQA 2ZTZA 1FXYA 1SGNE 3UQOA 3TGKE 5DO4H 1HGTH 1AI8H 3E91A 3ZZ4A 1F0RA 2HNTE 2Q6DA 1AMHA 2ODPA 4OS2A 1VCWA 1TPPA 2SFAA 1P02A 1JWTA 4X1SU 1W7GH 1OYQA 3M7QA 5C5OA 1O3CA 2H9EH 1XVMA 1BTZA 1LKAA 1GHYH 1LVOA 4INKA 3UREA 5BRRE 1ZGVA 1T8MA 2ZFQH 2H5CA 2A0QB 3T5FH 1F5KU 3EE0B 1RIWC 1EZUC 1XX9A 1QB6A 3GDVA 2ZDNA 3M3SA 1LMWB 5DP6A 1HAOH 2WYJA 2YOLA 1KTSB 4NZQA 3ODFA 2OXSA 2A5KA 4GSOA 5EXNA 2BDYA 1YP9A 8GCHG 3ZZ5A 1K9OE 4D9RA 5B6OA 2ZKSA 1C1VH 1C5RA 1D3DB 1TA2A 1FIWA 4KTUA 1C5SA 1O3IA 2HNTC 4X1PU 1EB1H 1NM6A 1THPB 5C67A 4AORA 3SJIA 4O03A 1EB2A 2STBE 1NT1A 1UVPA 2B8OH 1BITA 1OYTH 1C5LH 3EDXB 2F83A 3RU4E 1RTFB 1MQ6A 1GMHG 2WUCA 1E38B 2BD9A 1TABE 1SGRE 3URCA 1QBOA 2FOFA 3RU4T 3BTME 1GJ8B 2BOHB 2V0BA 2FI3E 1FPHH 2Z9GA 4YTAA 1DUAA 1BTHH 3NCLA 3NWUA 1BRAA 4JZFH 3U69H 3VB3A 4BTIB 1O31A 3A8BA 2ZFPH 4XSKU 1GJBB 2ZDAH 3BTGE 3E90B 3BV9B 2FDAA 2Z9LA 3BTQE 3DFLA 1PPCE 1CHOF 4B2CA 1HDTH 1EP6A 3UR6A 5ESBA 3S9CA 1JRTA 5CMXH 2VWLA 1HRTH 2TIOA 1HAVB 3QX5H 3ZZ9A 2A7HA 2FTLE 2OP9A 2J4IA 3LC3A 1IQFA 1HUTH 1VJ9U 1TMTH 3TU7H 2WPIS 2ZU2A 1ELCA 4OS5A 3BF6H 1GDNA 2ZHFH 2HVXA 4CH8B 1A5IA 3ZVCA 1IHSH 4BAHB 1C1UH 1SQOA 1C1OA 2BDCA 1L4ZA 1A4WH 1O2LA 1KLTA 2RA0A 2VWNA 1DSTA 1O3DA 4CR5A 1UTKA 2P8OC 2ANKH 3LKWA 4Y0ZE 3M3TA 3PROA 2P93A 4A6LA 1TNKA 1SGFA 3U9AH 2YNBA 1AIXH 1C2GA 1GJ4H 2PFEA 3MO9A 4Q7YA 1MTSA 1P2KA 4JK6A 2TBSA 5HMAA 3TK9A 3A8CA 4X1NU 1V2NT 2GDDA 1GHBG 2HALA 1QHRB 3H7OA 6CHAB 2FOGA 1DWBH 1EATA 2HWLB 2QF0A 3OSYA 3LT3A 2AIQA 1ORFA 1UCYE 3F9FA 1O2GH 4MVNA 1C9PA 4CRFA 1GI5A 2ANMH 1N6XA 2BXUH 1O2MA 4D7FA 1D3TB 4CHAC 1AY6H 1DICA 4VGCB 4WMDA 3FFGA 1JOUB 3F9GA 2AGIX 3SBKA 2BX3A 2QV1A 1ETTH 2Y5GA 5FPTA 1YF4A 1S83A 1SB1H 1XKBC 2BLOA 4WJG2 2F9OA 1UTNA 2B9LA 5FX5A 2XTTB 3UUZA 4BTUB 4R8TB 4X8SH 4F49A 3VB5A 5DG6A 3SU6A 3NUMA 1GGDC 2ZU5A 3M36A 1P3CA 4NZLA 1NY22 3L6PA 5I25A 1G3EA 1GI3A 1YLCA 3ZZAA 1S0QA 3BTWE 5EPYA 1SOZA 3RXAA 2ZQ2A 3BN9A 1ETSH 3T26A 5EG4A 2VB0A 2BLQA 1GBCA 1MTNB 2ZFFH 1KDQB 1NFYA 4AB8A 1FIZA 1V2UT 5HM2A 1KXDA 1O38A 2P3FH 3BTHE 1Y3UA 1KXAA 1T8OA 2EI8A 2P16A 4K1TA 1CA0C 2BVXH 1DXWA 3P17H 3M5NA 2WPLS 5A0CA 4Y79A 4QT8C 1HAVA 1NS3A 1F7ZA 1O5AB 3JZ1B 3MO3A 1BBRH 3U8OH 4YESB 3QGNB 4BAKB 2FWWA 2Z3EA 3EA8A 1ESAA 4K8BA 4XE4A 1HAZB 3VGCC 1J17T 2QC2A 2GVFA 1V2LT 1VGCC 2PWXA 4ABJA 4NIYA 1IQIA 2PGQB 3CS7A 3ZVBA 1Z1IA 1IQEA 1KTTB 1P57B 5FHTA 2O8LA 3TK5A 3O8RA 2ZGCA 7LPRA 1AU8A 4NGAH 2AGEX 1IQMA 4AFZA 4MPWA 3TJUA 3QLPH 1RS0A 1WSSH 3D23A 4Z6AH 2TGDA 2FLBH 5EQRA 1CBWB 3E3TA 1HAXB 3SO3A 1P8VC 2FEQH 2XBXA 1UTOA 3A7ZA 1O5EH 3NKKA 1S84A 2QF3A 3CP7A 3P92A 3FZZA 1GVKB 1QTFA 2PKAB 3LJJA 5C2ZA 2TGPZ 1P05A 3FP7E 2RG3A 4ABDA 5FCKA 2STAE 3MYWA 3KHVA 1VITH 2H6MA 3UR9A 1VCPA 4FVDA 4I8KA 2FXRA 3SJ8A 5TJXA 3ELAH 1SHHB 1DLKB 3T28A 2CF8H 2EI6A 1NRPH 1GI8B 1PJPA 1YLDA 3KQDA 3QZQA 4U2WA 1ZTJA 1ID5H 3SJKA 4UFDH 1BB0B 4A1XA 1LHCH 1OWEA 2C3SA 3BSQA 2PKSC 3LONA 4CRAA 2Z94A 2RA3A 4ABAA 2PHBA 2WPMS 6GCHF 2TGAA 1F92A 1D3PB 1WOFA 1QA7A 1EUFA 1SQTA 1XXDA 1KSNA 1SQAA 1O2OA 1AWFH 1DXPA 1KDQA 1OWIA 1YCPM 6ESTA 4B73A 1JIRA 4XBCA 3S9BA 2C93B 2FTMA 1ZR0A 3SUFA 1FAKH 3TNSA 1CGHA 4INLA 4MNYA 1LCYA 4IBLH 2BQWB 3ZV9A 1OOKB 3BG4B 4CH2B 1AE8H 4ABFA 1CT0E 4X8TH 1ARBA 1ZSJA 1GI2A 3SZNA 1SL3A 4LOYH 1XXFA 3ZVDA 4FUHA 5A2MH 4ZKOU 1QQUA 4IMZA 3K6YA 1O3EA 2A4QA 1X7AC 1P9SA 5E8EH 1WTHD 1O39A 2J92A 3KN2A 1RGQA 5DP4A 4UEHH 3T25A 4TPIZ 1ANDA 2CJIA 2A1DB 2ZHDA 4X8UH 1GI4A 4B74A 1QQ4A 2GZ7A 4NWKA 4Z0KA 1C9TA 3SHCH 2IN2A 5C20A 5DP7A 1D4PB 2GT7A 1RIWB 2ZO3H 1SLXB 1THRH 2HLCA 1AFQB 4XBDA 4IN2A 3QUMP 4K1SA 1EAXA 1TLDA 3E0NB 1GHZA 1OKXA 4XOJA 3TJVA 1EPTC 1BDAA 5GCHG 4CBNA 3F1SB 2GCTC 4AYVB 1WU1A 1TQ7B 3PMHB 1W2KH 1TGSZ 5AF9H 2ESTE 4Q7XA 2GZ9A 4ABEA 4IC6A 2HRVA 1O3HA 4OS1A 1QRZA 2SNVA 1OWKA 4O9VA 2W3IA 2PKAA 1DUEA 2WPJS 1O2WA 5H4IB 2IPHA 1O3JA 1P03A 1EXFA 4NSVA 4ASHA 4MNWA 1BHXB 2ZDLA 3TJNA 4ABGA 3GOVB 2PUXB 3HKJB 2QXJA 1NRSH 2D8WA 2CV3A 3E16B 3OX7U 3LGWA 1QRXA 1MU8B 4B2AA 1NFXA 1GI0A 1HV7A 1E34B 2NWNA 1VJAU 4YLQH 3ZZ3A 2CMYA 1TGNA 2GTBA 4MNVA 2FM2A 3SJOA 4TY6A 1C1WH 2IOTA 4E7RG 1H9IE 3MU0A 1AB9B 1ZRKA 1XKAC 1HFDA 2SGFE 3QTOH 4OS6A 1UVOA 1AN1E 3O8DA 5JBTA 2BY7X 1GMDG 2G81E 3A81A 4X6OA 2XW9A 3F68H 1GI7B 3N7OA 1UCYH 2FLRH 1HBTH 3A84A 1YKTA 3KF2A 1OWDA 2VU8E 1V2VT 2RCEA 1H4WA 2C8XB 3VEQB 2QGRA 2OQ5A 1TOCB 3SJ9A 4O3TA 2SGQE 2O8WA 2P95A 2GCHF 3ATKA 1TNIA 3RXGA 4Y11E 3MHWU 2ZFSA 3PV4A 1BJUA 3NPSA 2ZCKP 2P8OB 4YLUA 5E2PA 2JH6D 2UWLA 4B76A 1QRWA 3SV2H 2ASUB 4AOQA 1Z8IB 1MKWH 1AO5A 4GAWA 3SW2B 5CHAC 2ZC9H 1K1JA 1GDQA 1T31A 3DUXH 5L2YH 1ANEA 2KAIB 3SUEA 1V2RT 5T6DA 1AVWA 3MH6A 2OC8A 5DP5A 1RRKA 2PV9B 1N1LA 2VH6A 3CENA 1L0ZA 1QJ1B 3H7TA 4J1YA 1HB0B 3MTYA 3RMMH 2A5AA 5JBAS 1O3KA 3FVFB 1C1TA 4CHAB 1TAWA 1SFQB 3Q76A 4YT7H 1YPEH 1W0YH 2ZCHP 4X2YA 3BTKE 2G5VA 1MZDA 1C5TA 1O5CB 2FX4A 1V6DA 3SGAE 3GY3A 3U8TH 3TH3H 4FUIA 4OS7A 8GCHF 1QIXB 5JBBS 3M61U 1ZHMA 4THNH 3VFEA 1PQ8A 2AEIH 2HGTH 1GGDB 5EW2H 3VB7A 1NROH 2C8WB 1NU9A 1DM4B 3LPRA 1NESE 2ZGJA 3ATLA 2FOEA 3I77A 1F0UA 4WWYA 1C4Y2 2AMDA 7KMEH 3TJOA 1O2PA 1AVXA 2A2XH 2QXIA 1K1MA 4WH6A 5IYTA 1GCDA 1MD8A 3FAOA 3SNDA 3V0XA 2R9PA 3MU8A 1GMHF 1ACBE 1P09A 3A7XA 4XFQA 1Y3WA 1C2DA 3MU1A 1NC6A 1TRMA 2ZF0H 1ZRBA 3SNCA 1QCPA 1ETRH 2F3CE 1BRCE 1CA0B 1MMJN 1ZTKA 4JYTA 1KXEA 1ZOMA 2ZG0H 1TE0A 1E36B 3SQEE 3T2NA 1OS8A 2DE9A 4LK4A 4CRGA 4BAQB 4ZROA 2WPHS 1PPFE 1S82A 1TQ0B 1FI8A 2VNTA 4JZDH 2R2MB 3UWIA 5F8XA 4NIXA 3VGCB 4AB9A 1BJVA 1CHGA 1ZMJA 3R3GB 1VGCB 1WYKA 1GVZA 1BTUA 1O5FH 1ELBA 1DANH 1IQLA 1G9IE 1A7SA 1BCUH 1P04A 3RM0H 4HGCA 4NIVA 2NU2E 3RUOA 2R0KA 2W7SA 3PMAB 5HYOA 2OTVA 1INCA 4ZH8A 3RXKA 1SGEE 1RXPA 1KLJH 1BMNH 1L1NA 1TRNA 1TMUH 3S0NA 1PQAA 4CRDA 1SR5C 2R2WU 3HGPA 4X0WU 1C5NH 2KAIA 4B71A 1Z71A 1V2ST 2Q6GA 1TNLA 2VGCC 2OC1A 4ZHLU 4DOQA 5LGOA 3OTJE 5GXPA 5A8ZA 3ZYEA 1GHBF 4GUXA 2C8YB 2AERH 1L1GA 1MUEB 3TGIE 1V2PT 2FIRH 2XC5A 4DIHH 7ESTE 4UDWH 2AS9A 3SU1A 1GJ9B 1TGBA 3BG8A 4WH8A 1ZZZA 4U30A 4GVUA 1O35A 2XC4A 2XWAA 2ZFRH 2AGGX 1UMAH 2XYAA 3UY9A 8LPRA 2BDHA 4NFEA 1XUGA 1OWHA 4CBOA 3RXHA 3VXEH 4ZKNU 1K1LA 2PGBB 4MNXA 5FX6A 5DJ7A 4D8NA 2PKSB 1PPBH 2HPPH 4H42U 1GBHA 1O2ZA 2UWOA 4X1QU 5LH8A 2C8ZB 5T6FA 1UCYK 3UFAA 1YYY1 2G4UA 4UFFH 1KXBA 2Y81A 3SGQE 5F6MA 3U1IB 3Q3YA 2IJOB 2FI4E 1GL1A 3ITIA 3MH4A 3ATIA 1O2NA 4I33A 1S6FA 4NG9H 4WY3A 1G3BA 1DPOA 1C5WB 1CSOE 1OPHB 2BB4A 1GI6A 1OSSA 1K22H 1C2JA 1BUIA 4TWWA 4FUJA 4BTTB 4JYVH 4DW2U 3OY5U 1TA6A 2BDIA 3EGKH 3EA9A 2A5IA 1O3OA 1NRRH 4AYYB 2ZPSA 1AHTH 2XRCA 2FO9A 1C2KA 1P2OA 2HNTF 1JBUH 1TB6H 1K2I1 3RMNH 1ZHRA 2J2UA 1B7XB 3RXOA 3AW0A 1FZZA 1AE5A 1FY8E 3QTVH 3A86A 2EI7A 4HTCH 1G3DA 1SGYE 1FN8A 1ESTA 4X6NA 1W0ZU 3V7TA 2XCFA 1A5HA 1O5BB 2GV7A 5IDKA 2QXHA 3TGJE 2ZI2H 1DFPA 3ZZCA 2VIQA 3STIA 1O3MA 3V3MA 1LVYA 3KQCA 4AGJA 1J14A 3EQ0H 4D9QA 4JZIA 3RMLH 3Q3XA 4FUEA 1DS2E 2J94A 1EPTB 1J9CH 1GMCG 2P94A 1MKXH 2GCTB 2OCVB 1A0HB 1LQDB 1Z7KA 5E0GA 3PWCA 1VITG 1P06A 3UOPA 1PPGE 3F9EA 1NTPA 2THFB 2QAAA 3MU4A 3VXFH 5C3NA 4WXIA 3FANA 3A7VA 5A8YA 1YC0A 4Y8XA 2ZDKA 1HAIH 2H9TH 3SORA 3RXRA 1O37A 4YT6H 5F03A 2HPQH 2QN5T 3KGPA 4DIIH 1T4VH 2OC0A 1IHTH 1DWDH 2GZ8A 1SSXA 1MD7A 3PO1C 1YCPH 4A92A 2VWOA 3RXFA 3UNSA 2ZECA 3EYDA 1P0SH 2O8MA 3GY2A 3H5CB 3GISB 1MAXA 4Y7BA 3BTFE 4A1TA 3GCTF 1G2LA 5FBEA 2ZGBH 2ZWLH 5EPNA 3ZZ6A 4ZMAH 1BA8B 1AFEH 3RLWH 2ZNKH 2JETC 2Z6BD 2G00A 5JPMH 3VB6A 1ZMNA 1NFUA 1LTOA 2Z9KA 5A8XA 5EU8A 1CE5A 1TPOA 1WCZA 3RXEA 3MH5A 4Y0YE 1A46H 2D26C 3BEIB 1WQSA 1HAYB 1IQKA 1UTMA 2I6QA 4MDSA 2P3TB 3M5LA 3B9FH 1SGQE 2W5EA 2GKVE 5TCAA 2QCYA 3RM2H 1YM0A 2BD7A 1UK2A 2JH0D 1G32B 2FS8A 4ZKRU 4X1RU 4K2YA 1CT2E 2PSXA 2TGTA 1P2QA 1DE7H 2Y82A 3RU4D 1WAYB 3ZVFA 1DDJA 4HI3A 5DP8A 2P3UB 2GMTC 2BXTH 2OBOA 4RSPA 2ILNA 1HXEH 3IITA 1EQ9A 2O8UA 5CHAB 1MCVA 1QNJA 2WUBA 1P2IA 4ISIH 4JZ1A 4A7IB 1EAWA 2BD8A 3QK1A 2B7DH 1BOQA 3UIRA 1TPAE 4A5TS 3GCTG 4UD9H 4AFUA 3LGUA 2ZGHA 3ZVGA 1UTQA 1KY9A 1A3EH 2LPRA 2BDAA 4Y10E 2CF9H 1K21H 2VIPA 3HGNA 2ZFTA 5JB9S 4GPGA 2QXGA 1EPTA 3SV7A 1GWAA 1Q31A 1UVTH 1TX8A 1QJ6B 1SLWB 3VPKA 1T8LA 3EA7A 3ZZ7A 1SBWA 2YNAA 1IQGA 1BTYA 1YPKH 2A32A 3LIWA 2AFQB 1C1QA 2VIVA 4FUGA 1O2JA 5EOKA 5EODA 1H8IH 5GCHF 2ZP0H 3SNAA 2BZ6H 4IC5A 3ZZDA 4K60A 1UHBB 2PTCE 3ESTA 4YO9A 2XWBI 2BY8X 4U01A 1Y3XA 1MBMA 3L3TA 2G4TA 2ZHEH 2BD5A 4ZXXH 3RXVA 3SI4H 2ANYA 3RC5A 4A1VA 4JYUH 4TWYA 4IW4E 4UONA 1DT2A 1LO6A 1O3GA 2Y80A 4NCYA 3PB1E 3DT0H 1S5SA 2BD2A 2BY5X 1SLVB 1GG6C 3MFJA 1CO7E 1J8AA 2F9UA 4ISOA 3P70B 1GJDB 3RXBA 1KXFA 1UK4A 2WINI 3QWCH 1QBVH 1UK3A 2BD4A 4X8VH 3MMGA 1GBFA 3D62A 3QGJA 1AGJA 5EQSA 3CS0A 3SU4A 3BTEE 2EA3A 1Y5AT 5EQQA 2ZGXH 1GBKA 1T4UH 4ABIA 1MH0A 3F6UH 1GMDF 2BLVA 3ATWA 5A0BA 2PW8H 3P8FA 1SGCA 1O5DH 1OXGA 1SGPE 2VIWA 5LPFA 1PQ7A 5JDUB 2F9VA 4ESTE 2A4GA 2AYWA 4Y8YA 1QURH 5AFZH 1LHFH 1F0SA 3GY6A 4DURA 2A7JA 5L6NH 1YGCH 3MI4A 2H2ZA 2ZPQA 2SGDE 5DKMA 1W10U 1GBEA 3Q3KA 3SV6A 2Z7FE 1QL8A 1QFKH 2ODYB 1LHEH 2F91A 3BIVH 2GP9B 3RDZA 2Q6FA 1G2MA 1ESBA 2VGCB 1QB1A 5J4SA 1C5YB 1BTXA 3PWBA 1WQVH 5BPEA 1LVMA 3AASA 3UTUH 2BX4A 1O2IA 1ELDE 3KQBA 3SNBA 2M5TA 3E1XB 1MAYA 1XUJA 1TRYA 4Q2KA 1CA8B 1BBRK 2XBYA 1VZQH 5JBCS 1O3FA 3T62A 1W13U 4DCDA 4WVPE 4BANB 3OYPA 1CT4E 2UWPA 2NU3E 3TIUA 1EZQA 1LPGB 3K9XB 3A7TA 4K1EA 1MZAA 4Y76A 4K8YA 1K1IA 2VJ1A 1NRQH 1FAXA 2PTNA 2Z9JA 2A7CA 1TBZH 1O3BA 3MO6A 2ZPRA 1UHBA 8KME2 5A09A 1UJ1A 1QBNA 4LXBH 2JH5D 4Y71A 3A87A 2ALVA 3A8DA 1AZZA 3M37A 1FONA 1O33A 4HFPB 1W7XH 4F4OC 1C1MA 3V13A 1F0TA 3RC6A 1T32A 1CU1A 2O8TA 2C4FH 3LC5A 1JXPA 1V2WT 5C1UA 5GJ4B 3BTTE 1P2JA 2BLWA 3GYLB 5L30H 1YBWA 1O3LA 2FOHA 1IQHA 1GJ7B 3SN8A 1C2EA 3LDXH 3T29A 2I6SA 1RTLA 1Q3XA 1ZGIA 3K65B 1RD3B 2OINA 1D9IA 2BHGA 4KP0A 1ELGA 4XDEA 3TITA 2WV4A 4Y6DA 4OGYA 1TNGA 2UUYA 4E05H 2AIPA 5ABWA 2A31A 1S85A 1K1NA 1Y5BT 2DE8A 4WXVA 4I8HA 1PQ5A 2FYRA 3W95A 2JKHA 3MNXA 1HAPH 6LPRA 1B0EA 4OS4A 1HJ8A 1ZJKA 3TPIZ 3A83A 1O2VA 4FU8A 1QL9A 3U8RH 4AGKA 1K1OA 2ALPA 1SLUB 3RC4A 3BEUA 3GDSA 2FI5E 4GCHG 3RXIA 4E7NA 1N8OC 1BT7A 4DJZB 1O2HA 2SGEE 3TK6A 4KTCA 3P95A 1P2NA 2FP7B 2TPIZ 2AMQA 4MG3A 4KELA 3K6ZA 5TCCA 5EGMA 1GHAG 3E0PB 2F9NA 4AFQA 3UQVA 1AQ7A 3R0FA 1HAGE 2ZHQH 2WPKS 1MCTA 1GBIA 3T27A 1ANCA 5T6GA 1MTUA 1AUTC 3ZVAA 4GLYA 1B5GH 1BMLA 2FMJA 1XUHA 2FOMB 1FNIA 2FOBA 3SV8A 5F8TA 1L4DA 5GPIB 2C90B 1EKBB 2ZTYA 3KNXA 7GCHG 1Z8GA 1G36A 2B0FA 2J38A 3A80A 4O3UA 3S69A 1H8DH 4NSYA 3PO1B 1C5VA 1GI1A 2Y5FA 3TVJB 1MTVA 2VIOA 1C4U2 1G3CA 1LPKB 3KL6A 4ABBA 3FP8E 1VCQA 3IG6B 1SMFE 1FN6A 1WBGB 1V3XA 1C5QA 1YPJH 1D6WA 1LDTT 3D65E 3UWJH 3UNRA 3AVZA 5G4BA 1GBMA 1C5MD 1OWJA 1Z6JH 1MBQA 1K1PA 1W8BH 3ODDA 2EC9H 2PSYA 4FXGH 1V2JT 3DA9B 2NU4E 4ZHAA 1YPHE 2JETB 1THSH 1P3EA 1HCGA 2ZIQH 4B1TA 1CVWH 3RXUA 3LH1A 1HJAC 4AN7A 1TOMH 1AFQC 4UFGH 1TWXB 1RJXB 3RXCA 1GCTC 1ZPBA 3I78A 2H1UA 4BXWA 2SGAA 5AHGH 4FU9A 4NIWA 1NN6A 4I8JA 2GD4B 4GHTA 1O30A 3ZYDA 2ZEBA 3KQEA 5C1XA 2F9BH 1D3QB 2OC7A 3UOUA 4ISHH 2GMTB 1A1RA 1GBTA 2BVSH 2CHAC 5CE1A 2CXVA 1WTGH 5FCRA 1SFIA 1OP2A 1SGDE 2RDLA 1FY3A 2PR3A 1YPHC 2FPZA 1VR1H 9ESTA 3BEFB 3A7WA 1O2TA 2BTCE 3RXPA 3PTNA 3U1JB 4TY7A 4XBBA 1O3PB 5GDSH 1AVGH 1SG8B 2V35A 1KLIH 5DK1A 1F5RA 1PPEE 4SGBE 3M35A 1RTKA 2BDGA 1Y59T 2BYAX 5A0AE 1L1JA 1BTPA 1SVPA 5I46H 1AB9C 2Y6TA 5GIBA 3MNSA 1TBQH 1YPMH 1BMAA 4RKJB 2ZDVH 1FY1A 1XM1A 4MQAA 1XUKA 3SU2A 5K7RA 1C5UA 3A88A 5FAHA 2CGAA 1GMCF 2UUJB 1GBBA 2FYQA 2V3HH 5DP3A 1VITF 3GCHC 3ZZBA 3PM3A 3GCNA 3O8CA 2OUAA 4I7YH 3I29A 2FOCA 1DITH 4JMYA 3KCGH 3AAVA 3PLBA 1EOJA 1J16A 1C2IA 1AKSB 2A2QH 1A5GH 1AZ8A 3PMBB 1GJCB 1DVAH 4Y7AA 3HPTB 1MKWK 1C4V2 2ODQA 3WY8A 1HYLA 3NXPA 3ZV8A 1W14U 3W94A 1CGIE 1D6RA 1C5XB 3E6PH 1ZYOA 2FESH 2Z3CA 1GG6B 2QIQA 5E0JA 4DVAU 1MQ5A 3GY4A 2GV6A 3HK6B 5ESTE 3RXMA 1RFNA 2J34A 3C27B 2A4OA 1BQYA 4X6PA 1BHXF 4FUDA 1GL0E 3O8BA 2EEKA 1GVLA 3DD2H 4JZEH 1BIOA 2G55A 1CHOG 1V2MT 3SV9A 1Y3VA 1F5LA 4NFFA 2W26A 1N6YA 4X6MA 3RXTA 4CRBA 3TLOA 2P59A 3MH7A 3UNQA 4FUBA 1XUFA 3A8AA 1TPSA 4AG2A 3P8OA 1GBDA 1O3NA 1PFXC 3MNCA 3TH4H 3M7TA 3MWIU 2NU0E 1LPZB 1KXCA 1O32A 5J4QA 2VWMA 4NWLA 5F8ZA 1A2CH 1O3AA 1M9UA 2V3OH 1PYTC 3S9AA 1IQJA 1FLEE 4DT7B 4ZHMU 1UTJA 5PTPA 2UUKB 2ZU1A 1ELVA 1TALA 1DSUA 3RXJA 1JRSA 2J9NA 1XUIA 1EJAA 3A7YA 2GDEH 1KYNA 1AWHB 1SHYA 3K2UA 4AFSA 4DG4A 1O2SA 2WYGA 4UFEH 1BTWA 1HJ9A 4D7GA 1B0FA 2BQ6B 4TYDA 2V6NA 2OD3B 1WUNH 4B75A 2XC0A 4I8LA 4KGAA 4X2XA 3SQHE 2VH0A 1C5OH 1ANBA 1A0JA 1GI9B 1FDPA 1HPGA 2GGVB 3IWMA 1P9UA 1W3CA 1TYNA 2FZZA 5E0HA 1CGJE 3SOSA 1C1SA 3A85A 5FXLA 2XNIA 5FPYA 4Q7ZA 5FPSA 1F2SE 4RKOB 4I8GA 2OLGA 1LQEA 1P01A 1C2LA 1GJAB 4ABHA 1AKSA 4I31A 2VIDA 4MPXA 3A89A 4UE7H 2G8TA 3G01A 3URDA 2AH4X 2BQ7B 1GDUA 1EX3A 4NA8A 1FUJA 1GHVH 1H9HE 2VVUA 1Q2WA 5DGJA 4AX9H 1PPHE 1OP0A 4LZ1H 2Z3DA 1BZXE 1W11U 1A0LA 1GBAA 4ISLA 2ZTXA 1IOEA 1G30B 3EAJA 1O2RA 1GPZA 2ANWA 3LJOA 1ZSLA 3MNBA 4BNRA 3LH3A 5SGAE 3RXDA 1P10A 2CN0H 3LGIA 4H4FA 3A82A 1TX7A 2OQUA 5AFYH 3JZ2B 3TH2H 3Q00A 1GHXH 1ZPZA 1MTWA 8ESTE 1SOTA 4GHQA 1E35B 4Q80A 2VVCA 2UUFB 4R0IA 4WF8A 3RMOH 2OBQA 3SU0A 2ZZUH 4FVBA 3P8GA 4CR9A 3GDUA 2ZCLP 3OU0A 4OGXA 3B23B 1EOLA 3F9HA 3D49H 1O2UA 1LHDH 2W7UA 2AMPA 3QO6A 1O34A 1ZMLA 1EZXC 4IS5A 4DY7B 4MTBA 1S6HA 5HM9A 1N8OB 4ZXYH 1SI5H 4MPVA 1Z8JB 2Y5HA 1FPCH 1V2KT 3PTBA 4I32A 1Y5UT 4JCNA 4H6TA 1DWCH 1NZQH 2BVRH 2ZU4A 3GYMA 2ZDMA 3SNEA 4LZ4B 2D1JA 3MU5A 4ISNA 2FODA 3DFJA 3KEEA 1H9LB 2TRMA 1UVSH 1V2QT 2R3UA 3RXSA 1TNHA 1XMNB 3VB4A 1NFWA 2GT8A 1DY8A 1GBLA 5HXFA 3LGVA 1EASA 1TONA 1HXFH 1DOJA 2A45B 5AVDA 1OX1A 1Z1JA 1ZHPA 5E2OA 3GY8A 1BRUP 4HZHA 1QL7A 5DPAA 6CHAC 3SGBE 3U98H 3M5OA 3SU5A 2R3YA 4MLFB 4FU7A 3OY6U 5EXMA 3NK8A 1LHGH 4YOIA 3Q77A 3GY7A 1HIAB 1ZSKA 5L2ZH 3GCOA 3SUGA 2B5TB 4YZUA 2G5NA 1EAUA 1EZSC 1TBRH 2BY9X 4VGCC 3UPEA 1PYTD 1P2MA 1O5GH 3B8JA 1FQ3A 2G51A 1U6QA 1UVUH 1SPJA 1C1PA 2FX6A 1ABIH 2WV5A 4INHA 2VVVA 4U32A 2G52A 3LOXA 2FS9A 1GJ6A 1WV7H 3HATH 1FMGA 1GJ5H 2ZHWH 1SGFG 5GWZA 5DP9A 6GCHG 1HJAB 2BD3A 3DHKH 3PLKA 1E37B 1MKXK 3LGYA 4IGDA 1HNEE 1GCTB 3RXLA 1ELEE 4E06H 1TGCA 3P6ZB 9LPRA 1Z6EA 2SGPE 4SGAE 1DX5M 4YM9A 4NA9H 2BY6X 2Y7ZA 2DUCA 3M5MA 1JIMA 1QJ7B 1C2MA 1DWEH 1SGIB 3S7HB 4M7GA 1CQQA 1BMMH 3ZZ8A 2BOKA 2LNCA 3BTDE 1MTNC 4AZ2B 1FJSA 4H6SB 4BAMB 1P11E 1LKBA 4KKDA 3PLPA 4KTSA 2PUQH 2W3KA 1EP5A 1IAUA 1EAIA 1PPZA 1C5ZB 1TNJA 2CHAB 1S0RA 1QGFA 4D76A 2H9HA 1C2FA 4CRCA 1YCPK 2VINA 1NRNH 1TFXA 3QZRA 2XBVA 5JYIA 1ZPCA 4CREA 3FZDA 4B2BA 4JK5A 1Z8RA 3FP6E 4DGJA 3AW1A 1XVOA 3L33A 4IN1A 5T3HA 1ELFA 3HK3B 5LPEA 1C5PA 3RLYH 1SC8U 2XXLA 4K5ZA 1KIGH 3S7KB 4BAOB 3V12A 2SNWA 4GCHF 1O0DH 1JMOH 1Y3YA 2BZAA 1ELTA 5EXLA 3M3VA 1FV9A 1YPGH 2NU1E 3STJA 4RN6A 1UTPA 1HAHH 3QDZB 4WMEA 3ZVEA 4FUCA 4NA7A 1GHAF 3TNTA 2XBWA 2HOBA 1UO6A 4WMFA 3SU3A 1A61H 1C2HA 1TIOA 3GCHB 3SHAH 4YOJA 3RXQA
chains in the Genus database with same CATH superfamily
4ZKSU 3HKIB 4X2WA 1W12U 2D2DA 2V7QD 3SUDA 4O97A 2QA9E 2ZQ1A 5K0HA 3QN7A 1CBWC 1C1NA 2Z9IA 1C1RA 2R0LA 1BBRE 2BDBA 1T8NA 2H5DA 1T7CA 2QF5A 1O2YA 1ZJDA 1VKYA 1GBJA 3PMJA 3E8LA 2OK5A 1HIAA 1TX6A 3ATMA 7GCHF 2XCNA 2K1QA 2PLXA 1MU6B 1ZLRA 4X2VA 3C1KA 4TPYA 4J2YB 5EW1H 3M7UA 1ZTLA 3SI3H 1MABB 1FY4A 1QY6A 5HGGA 2GX4A 5C5NA 2ZA5A 1E0FD 1NO9H 1H1BA 1S81A 1EJNA 2KCAA 1O2QA 1AD8H 1V2OT 1L2EA 3P8NA 3RP2A 1O2XA 1YPLH 1O2KA 4YOGA 2QYIA 2QY0B 1ELAA 4K3JA 4AG1A 1GHWH 2O9QA 2A4RA 4F48B 1AUJA 4MPUA 1BRBE 1NU7B 3LGTA 3PV5A 3GICB 3ENSB 1DLEA 1IQNA 4Y8ZA 2Y7XA 1J15A 1P12E 1FY5A 1EJMA 3LU9B 1NPMA 1QA0A 2J95A 3PYHA 1UTLM 3BIUH 4ZUHA 1LVBA 3AAUA 3GY5A 5ETXA 2BMGB 2BM2A 1O36A 2F9PA 3MOCA 5LPRA 1A3BH 5FBIA 1QR3E 1TMBH 2KFWA 1HLTH 1G37A 1TGTA 2GCHG 2FOAA 4BXSA 1K28D 4K69A 1QB9A 2ZU3A 3KIDU 4BOHA 5C1YA 5JB8S 3BG4C 1SGTA 1ARCA 2ULLA 1V2TT 2Q1JA 3NZIA 4ZAEA 1ABJH 4PROA 4FUFA 1DY9A 1Y8TA 1OP8A 4IMQA 2ZTZA 1FXYA 1SGNE 3UQOA 3TGKE 3VG8A 5DO4H 1HGTH 1AI8H 3E91A 3ZZ4A 1F0RA 2HNTE 2Q6DA 1AMHA 2ODPA 2PP6A 4OS2A 1VCWA 1TPPA 2SFAA 1P02A 1JWTA 4X1SU 1W7GH 1OYQA 3M7QA 5C5OA 1O3CA 2H9EH 1XVMA 1BTZA 1LKAA 1GHYH 1LVOA 4INKA 3UREA 5BRRE 1ZGVA 3CNRA 1T8MA 2ZFQH 2H5CA 2A0QB 3T5FH 1F5KU 3EE0B 1RIWC 1EZUC 1XX9A 1QB6A 2J5UA 3GDVA 2ZDNA 3M3SA 1LMWB 5DP6A 1HAOH 2WYJA 2YOLA 1KTSB 4NZQA 3ODFA 2OXSA 2A5KA 4GSOA 5EXNA 2BDYA 4P00A 1YP9A 8GCHG 3ZZ5A 1K9OE 4D9RA 5B6OA 2ZKSA 1C1VH 1C5RA 1D3DB 1TA2A 1FIWA 4KTUA 1C5SA 1O3IA 2HNTC 4X1PU 1EB1H 3WWBA 5C17A 1NM6A 1THPB 5C67A 4AORA 3SJIA 4O03A 1EB2A 2STBE 4Z1MD 1NT1A 1UVPA 2B8OH 1BITA 1OYTH 1C5LH 3EDXB 2F83A 3RU4E 1RTFB 1MQ6A 1GMHG 2WUCA 1E38B 2BD9A 1OHHD 1TABE 1SGRE 3URCA 1QBOA 2FOFA 3RU4T 3BTME 1GJ8B 2BOHB 2V0BA 2FI3E 1FPHH 2Z9GA 4YTAA 1DUAA 1BTHH 3NCLA 3NWUA 1BRAA 4JZFH 3U69H 3VB3A 4BTIB 1O31A 3A8BA 2ZFPH 4XSKU 1GJBB 2ZDAH 3BTGE 3E90B 3BV9B 2FDAA 2Z9LA 3BTQE 3DFLA 1PPCE 1CHOF 4B2CA 1HDTH 2RDEA 1EP6A 3UR6A 5ESBA 3S9CA 1JRTA 5CMXH 2VWLA 1HRTH 2TIOA 1HAVB 3QX5H 3ZZ9A 2A7HA 2FTLE 2OP9A 2J4IA 3LC3A 1IQFA 1HUTH 1VJ9U 1TMTH 3TU7H 2WPIS 2ZU2A 1ELCA 4OS5A 3BF6H 1BMFD 1GDNA 2ZHFH 2HVXA 2M2AA 1A5IA 4CH8B 3ZVCA 1IHSH 4BAHB 1C1UH 1SQOA 1C1OA 2BDCA 1L4ZA 1A4WH 1O2LA 1KLTA 2RA0A 2VWNA 1DSTA 1O3DA 4CR5A 1UTKA 2P8OC 2ANKH 3LKWA 4Y0ZE 3M3TA 3PROA 2P93A 4A6LA 1TNKA 1SGFA 3U9AH 2YNBA 1AIXH 1C2GA 1GJ4H 2PFEA 3MO9A 4Q7YA 1MTSA 1P2KA 4JK6A 2TBSA 5HMAA 3TK9A 3A8CA 4X1NU 1V2NT 2GDDA 1GHBG 2HALA 1QHRB 3H7OA 6CHAB 2FOGA 1DWBH 1EATA 2HWLB 2QF0A 3OSYA 3LT3A 2AIQA 1ORFA 1UCYE 3F9FA 1O2GH 4MVNA 1C9PA 4CRFA 1GI5A 2ANMH 1N6XA 2BXUH 1O2MA 4D7FA 1D3TB 4CHAC 1AY6H 1DICA 4VGCB 4WMDA 3FFGA 1JOUB 3F9GA 2AGIX 3SBKA 2BX3A 2QV1A 1ETTH 2Y5GA 5FPTA 1YF4A 1S83A 1SB1H 1XKBC 2BLOA 4WJG2 2F9OA 1UTNA 2B9LA 5FX5A 2XTTB 4ACAA 3UUZA 4BTUB 4R8TB 4X8SH 4F49A 3VB5A 5DG6A 3SU6A 3NUMA 1GGDC 2ZU5A 3M36A 1P3CA 4NZLA 1NY22 3L6PA 5I25A 1G3EA 1GI3A 1YLCA 3ZZAA 1S0QA 3BTWE 5EPYA 1SOZA 3RXAA 2ZQ2A 3BN9A 1ETSH 3T26A 3FKSD 5EG4A 2VB0A 2BLQA 1GBCA 1MTNB 2ZFFH 1KDQB 1NFYA 4AB8A 1FIZA 1V2UT 5HM2A 1KXDA 1O38A 3OTPA 2P3FH 3BTHE 1Y3UA 1KXAA 1T8OA 2EI8A 2IJD1 2P16A 4K1TA 1CA0C 2BVXH 1DXWA 3P17H 3M5NA 2WPLS 5A0CA 4Y79A 4QT8C 1HAVA 1NS3A 1F7ZA 1O5AB 3JZ1B 3MO3A 1BBRH 3U8OH 4YESB 2L74A 3QGNB 4BAKB 2FWWA 2Z3EA 3EA8A 1ESAA 4K8BA 4XE4A 1HAZB 5CHBA 3VGCC 4F55A 1J17T 2QC2A 2GVFA 1V2LT 1VGCC 2PWXA 3U28C 4ABJA 4NIYA 1IQIA 2PGQB 3CS7A 3ZVBA 1Z1IA 1IQEA 1KTTB 1P57B 5FHTA 2O8LA 3TK5A 3O8RA 2ZGCA 7LPRA 1AU8A 4NGAH 2AGEX 1IQMA 4AFZA 4MPWA 3GS9A 3TJUA 3QLPH 1RS0A 1WSSH 3D23A 5C0UA 4Z6AH 2TGDA 2FLBH 5EQRA 1CBWB 3E3TA 2WZQA 1HAXB 3SO3A 1P8VC 2FEQH 2XBXA 1UTOA 3A7ZA 1O5EH 3NKKA 1S84A 2QF3A 3CP7A 3P92A 3FZZA 1GVKB 1QTFA 2PKAB 3LJJA 5C2ZA 5EJZA 2TGPZ 1P05A 3FP7E 2RG3A 4ABDA 5FCKA 2STAE 3MYWA 3KHVA 1VITH 1K0HA 2H6MA 3UR9A 1VCPA 4FVDA 4I8KA 2FXRA 3SJ8A 5TJXA 3ELAH 1SHHB 1DLKB 3T28A 2CF8H 2EI6A 1NRPH 1GI8B 1PJPA 1YLDA 3KQDA 3QZQA 4U2WA 1ZTJA 1ID5H 3SJKA 4UFDH 1BB0B 4A1XA 1LHCH 1OWEA 2C3SA 3BSQA 2PKSC 3LONA 4CRAA 2Z94A 2RA3A 4ABAA 2PHBA 2WPMS 6GCHF 2TGAA 1F92A 1D3PB 1WOFA 1QA7A 1EUFA 1SQTA 1XXDA 1KSNA 1SQAA 1O2OA 1AWFH 1DXPA 1KDQA 1OWIA 1YCPM 6ESTA 4B73A 1JIRA 4XBCA 3S9BA 2C93B 2IPQX 2FTMA 1ZR0A 3SUFA 1FAKH 3TNSA 1CGHA 4INLA 4MNYA 1LCYA 4IBLH 2BQWB 3ZV9A 1OOKB 3BG4B 4CH2B 1AE8H 3DSGA 4ABFA 1CT0E 4X8TH 1ARBA 1NBMD 1ZSJA 1GI2A 5KECA 3SZNA 1SL3A 4LOYH 1XXFA 3ZVDA 4FUHA 5A2MH 4ZKOU 1QQUA 4IMZA 3K6YA 1O3EA 2A4QA 1X7AC 1P9SA 5E8EH 2HVYB 1WTHD 1O39A 2J92A 3KN2A 3PV2A 1RGQA 5DP4A 4UEHH 3T25A 4TPIZ 1ANDA 2CJIA 2A1DB 2ZHDA 4X8UH 1GI4A 4B74A 1QQ4A 2GZ7A 1EFRD 4NWKA 4Z0KA 1C9TA 3SHCH 2IN2A 5C20A 3FN8A 5DP7A 1D4PB 2GT7A 1RIWB 2ZO3H 1SLXB 1THRH 3DCLA 2HLCA 1AFQB 4XBDA 4IN2A 3QUMP 4K1SA 1EAXA 1TLDA 3E0NB 4B6FA 1GHZA 1OKXA 4XOJA 3TJVA 1EPTC 1BDAA 5GCHG 4CBNA 3F1SB 2GCTC 4AYVB 1WU1A 1TQ7B 3PMHB 1W2KH 1TGSZ 5AF9H 2ESTE 4Q7XA 2GZ9A 4ABEA 4IC6A 2HRVA 1O3HA 4OS1A 1QRZA 2SNVA 1OWKA 1UW7A 4O9VA 2W3IA 2PKAA 5EJLA 1DUEA 2WPJS 1O2WA 2EQNA 5H4IB 2IPHA 1O3JA 1P03A 1EXFA 4NSVA 4ASHA 4MNWA 1BHXB 4RT0A 2ZDLA 3TJNA 4ABGA 3GOVB 2PUXB 3HKJB 2QXJA 1NRSH 2D8WA 2CV3A 3E16B 3OX7U 4P02A 3LGWA 1QRXA 1MU8B 4B2AA 1NFXA 1GI0A 1HV7A 2JJ1D 1E34B 2NWNA 2K0QA 1VJAU 4YLQH 1H8ED 3ZZ3A 2CMYA 1TGNA 2GTBA 3N99A 2FM2A 4MNVA 3SJOA 4TY6A 1C1WH 2IOTA 4E7RG 1H9IE 1FX0B 3MU0A 1AB9B 1ZRKA 1XKAC 1HFDA 2SGFE 3QTOH 4OS6A 1UVOA 1AN1E 3O8DA 5JBTA 2BY7X 1GMDG 2G81E 3A81A 4X6OA 2XW9A 3F68H 1GI7B 3N7OA 1UCYH 2FLRH 1HBTH 3A84A 5EIYA 1YKTA 3KF2A 1OWDA 2VU8E 1V2VT 2RCEA 1H4WA 2C8XB 3VEQB 2QGRA 2OQ5A 1TOCB 3SJ9A 4O3TA 2SGQE 2O8WA 2P95A 2GCHF 3ATKA 1TNIA 3RXGA 4Y11E 3MHWU 2ZFSA 3PV4A 1BJUA 3NPSA 2ZCKP 2P8OB 4YLUA 5E2PA 2JH6D 2UWLA 3WWFA 4B76A 1QRWA 3SV2H 2ASUB 4AOQA 1Z8IB 1MKWH 1AO5A 4GAWA 3SW2B 5HKKD 5CHAC 2ZC9H 1K1JA 1GDQA 1T31A 3DUXH 5L2YH 1ANEA 2KAIB 3SUEA 1V2RT 5T6DA 1AVWA 3MH6A 2OC8A 5DP5A 1RRKA 3NRLA 2PV9B 1N1LA 2VH6A 3CENA 1L0ZA 1QJ1B 3H7TA 4J1YA 1HB0B 3MTYA 3RMMH 2A5AA 5JBAS 1O3KA 3FVFB 1C1TA 4CHAB 1TAWA 1SFQB 3Q76A 4YT7H 1YPEH 1W0YH 2ZCHP 4X2YA 3BTKE 2G5VA 1MZDA 1C5TA 1O5CB 2FX4A 3OEHD 1V6DA 3SGAE 3GY3A 3U8TH 3TH3H 4FUIA 4OS7A 8GCHF 1QIXB 5JBBS 3M61U 1ZHMA 4THNH 3VFEA 1PQ8A 2AEIH 2HGTH 1GGDB 5EW2H 3VB7A 1NROH 2C8WB 1NU9A 1DM4B 3LPRA 1NESE 2ZGJA 3ATLA 2FOEA 3I77A 1F0UA 4WWYA 1C4Y2 2AMDA 7KMEH 3TJOA 1O2PA 1AVXA 2A2XH 2QF4A 2QXIA 1K1MA 4WH6A 5IYTA 1GCDA 1MD8A 3FAOA 3SNDA 3V0XA 2R9PA 3F0PA 3MU8A 1GMHF 3N7EA 1ACBE 1P09A 3A7XA 4XFQA 1Y3WA 1C2DA 3MU1A 1NC6A 2F4LA 1TRMA 2ZF0H 1ZRBA 3SNCA 1QCPA 1ETRH 2F3CE 3H09A 1SKYE 1BRCE 1CA0B 3AK5A 1MMJN 1ZTKA 4JYTA 1KXEA 1ZOMA 2ZG0H 1TE0A 1E36B 3SQEE 3T2NA 1OS8A 2DE9A 4LK4A 4CRGA 4BAQB 4ZROA 2WPHS 1PPFE 1S82A 1TQ0B 1FI8A 2VNTA 4JZDH 2R2MB 3UWIA 5F8XA 4NIXA 5C0TA 3VGCB 4AB9A 1BJVA 3UAIC 1CHGA 1ZMJA 1COWD 1VGCB 3R3GB 1WYKA 1GVZA 1BTUA 1O5FH 1ELBA 1DANH 1IQLA 1G9IE 1A7SA 1BCUH 1P04A 3RM0H 4HGCA 4NIVA 2NU2E 3RUOA 2R0KA 2W7SA 3PMAB 5HYOA 2OTVA 3FO8D 1INCA 4ZH8A 3RXKA 1SGEE 1RXPA 1KLJH 1BMNH 1L1NA 1TRNA 1TMUH 3S0NA 1PQAA 4CRDA 1SR5C 2R2WU 3HGPA 4X0WU 1C5NH 2KAIA 4B71A 1Z71A 1V2ST 2Q6GA 1TNLA 2VGCC 2OC1A 4ZHLU 4DOQA 5LGOA 3OTJE 5GXPA 5A8ZA 3ZYEA 1GHBF 4GUXA 2C8YB 1WDIA 2AERH 1L1GA 1MUEB 3TGIE 1V2PT 2FIRH 2XC5A 2J97A 4DIHH 2KM0A 7ESTE 4UDWH 2AS9A 3SU1A 1E1QD 1GJ9B 1TGBA 3BG8A 4WH8A 1ZZZA 4U30A 4GVUA 1O35A 2XC4A 2XWAA 2ZFRH 2AGGX 1UMAH 2XYAA 3UY9A 8LPRA 2BDHA 4NFEA 3KYGA 1XUGA 1OWHA 3OE7D 4CBOA 3RXHA 3VXEH 4ZKNU 2AHME 1K1LA 2PGBB 4MNXA 5FX6A 5DJ7A 4D8NA 2PKSB 1PPBH 2HPPH 4H42U 1YY3A 1GBHA 1O2ZA 2UWOA 4X1QU 5LH8A 2C8ZB 5T6FA 1UCYK 3UFAA 1YYY1 2G4UA 4UFFH 1KXBA 2Y81A 3SGQE 3PRBA 5F6MA 3U1IB 3Q3YA 2IJOB 2FI4E 1GL1A 3ITIA 3MH4A 3ATIA 1O2NA 1W0JD 4I33A 2XNDD 1S6FA 2V3MA 4NG9H 1G3BA 4WY3A 5HIZA 1DPOA 1C5WB 1CSOE 1OPHB 2BB4A 1GI6A 1OSSA 1K22H 1C2JA 1BUIA 4TWWA 4FOUC 4FUJA 4BTTB 4JYVH 1KMHB 4DW2U 3OY5U 1TA6A 2BDIA 3EGKH 3EA9A 2A5IA 1O3OA 1NRRH 4AYYB 2ZPSA 1AHTH 2XRCA 2FO9A 1C2KA 1P2OA 2HNTF 1JBUH 1TB6H 1K2I1 3RMNH 1ZHRA 2J2UA 1B7XB 3RXOA 3AW0A 1FZZA 3PRDA 5GNDA 1AE5A 1FY8E 3QTVH 3A86A 2EI7A 4HTCH 1G3DA 1SGYE 1FN8A 1ESTA 4DT4A 4X6NA 1W0ZU 3V7TA 2XCFA 1A5HA 1O5BB 2GV7A 5IDKA 2QXHA 2JJ2D 2ZI2H 1DFPA 3TGJE 3ZZCA 2VIQA 3STIA 1O3MA 3V3MA 1LVYA 3KQCA 4AGJA 1J14A 5DSFA 4B6EA 3EQ0H 4D9QA 4JZIA 3RMLH 3Q3XA 4FUEA 1DS2E 4M9FA 3F2FA 2J94A 1EPTB 1J9CH 1GMCG 2P94A 1MKXH 2GCTB 2OCVB 1A0HB 1LQDB 1Z7KA 5E0GA 3PWCA 1VITG 1P06A 3UOPA 1PPGE 3F9EA 1NTPA 2THFB 2QAAA 3MU4A 3VXFH 5C3NA 4WXIA 3FANA 3N7DA 3A7VA 5A8YA 1YC0A 4Y8XA 2ZDKA 1HAIH 2H9TH 3SORA 5CDFE 3RXRA 1O37A 2K8IA 4YT6H 5F03A 2HPQH 2QN5T 3KGPA 4DIIH 1T4VH 2OC0A 1IHTH 1DWDH 2GZ8A 1SSXA 1MD7A 3PO1C 1YCPH 4A92A 2VWOA 3RXFA 3UNSA 2ZECA 3EYDA 3F3BA 1P0SH 2O8MA 3GY2A 3H5CB 3GISB 1MAXA 4Y7BA 3BTFE 4A1TA 3GCTF 1G2LA 5FBEA 2ZGBH 2ZWLH 5EPNA 1WXRA 3ZZ6A 4ZMAH 1BA8B 3OFND 1AFEH 3RLWH 2ZNKH 2JETC 2KZ4A 2G00A 2Z6BD 5JPMH 2LP6A 3VB6A 1ZMNA 1NFUA 1LTOA 2Z9KA 5A8XA 5EU8A 1CE5A 1TPOA 1WCZA 3RXEA 3MH5A 4Y0YE 1A46H 2D26C 3BEIB 1WQSA 1HAYB 1IQKA 1UTMA 3OAAD 3F2HA 2I6QA 4MDSA 2P3TB 3M5LA 3B9FH 1SGQE 2W5EA 2GKVE 5TCAA 2QCYA 3RM2H 1YM0A 2BD7A 1UK2A 2JH0D 4AC9A 1G32B 2FS8A 4ZKRU 4X1RU 4K2YA 1CT2E 2PSXA 4XD7D 2TGTA 1P2QA 1DE7H 2Y82A 3RU4D 1WAYB 3ZVFA 1DDJA 4HI3A 5DP8A 2P3UB 2GMTC 2BXTH 2OBOA 4RSPA 2ILNA 1HXEH 3IITA 1EQ9A 2O8UA 5CHAB 2KX4A 1MCVA 1QNJA 2WUBA 1P2IA 4ISIH 4JZ1A 4A7IB 1EAWA 2BD8A 3QK1A 2B7DH 4OM9A 1BOQA 3UIRA 1TPAE 4A5TS 3GCTG 4UD9H 4AFUA 3LGUA 2ZGHA 3ZVGA 1UTQA 1KY9A 1A3EH 2LPRA 2BDAA 4Y10E 2CF9H 1K21H 3KQ5A 5HIYA 2VIPA 3HGNA 2ZFTA 5JB9S 4GPGA 2QXGA 5C94A 1EPTA 3SV7A 1GWAA 1Q31A 1UVTH 1TX8A 1QJ6B 1SLWB 3VPKA 1T8LA 3EA7A 3ZZ7A 1SBWA 2YNAA 1IQGA 1BTYA 1YPKH 2A32A 3LIWA 2AFQB 1C1QA 2VIVA 4FUGA 1O2JA 2W6ID 5EOKA 5EODA 1H8IH 5DN6D 5GCHF 2ZP0H 3SNAA 2BZ6H 4IC5A 3ZZDA 4K60A 1UHBB 2PTCE 3ESTA 4YO9A 2XWBI 2BY8X 4U01A 1Y3XA 1MBMA 3L3TA 2G4TA 2ZHEH 2BD5A 4ZXXH 3RXVA 3SI4H 2ANYA 3RC5A 4A1VA 4JYUH 4TWYA 4IW4E 4UONA 1DT2A 1LO6A 1O3GA 2Y80A 4NCYA 3PB1E 3DT0H 1S5SA 2BD2A 2BY5X 1SLVB 1GG6C 3MFJA 1CO7E 1J8AA 2F9UA 4ISOA 3P70B 1GJDB 3RXBA 1KXFA 1UK4A 2WINI 3QWCH 1QBVH 1UK3A 2BD4A 4X8VH 3MMGA 1GBFA 3D62A 3QGJA 1AGJA 1QZ8A 5EQSA 3CS0A 3SU4A 3BTEE 2EA3A 1Y5AT 5EQQA 2ZGXH 1GBKA 2JDID 1T4UH 4ABIA 1MH0A 3F6UH 1GMDF 2BLVA 3ATWA 5A0BA 2PW8H 3P8FA 1SGCA 1O5DH 1OXGA 1SGPE 2VIWA 5LPFA 1PQ7A 5JDUB 2F9VA 4ESTE 2A4GA 2AYWA 4Y8YA 1QURH 5AFZH 1LHFH 1F0SA 3GY6A 4DURA 2A7JA 5L6NH 2YMSC 1YGCH 1E1RD 3MI4A 2H2ZA 2ZPQA 2SGDE 5DKMA 1W10U 3SYJA 1GBEA 3Q3KA 3SV6A 2Z7FE 1QL8A 1QFKH 2ODYB 1LHEH 2F91A 3BIVH 2GP9B 3RDZA 2Q6FA 1G2MA 1ESBA 2VGCB 5EJ1A 1QB1A 5J4SA 1C5YB 1BTXA 3PWBA 1WQVH 5BPEA 1LVMA 3AASA 3UTUH 2BX4A 1O2IA 1ELDE 3KQBA 3SNBA 2M5TA 3E1XB 1MAYA 1XUJA 1TRYA 4Q2KA 1CA8B 1BBRK 2XBYA 1VZQH 5JBCS 2LELA 1O3FA 3T62A 1W13U 4DCDA 4WVPE 4BANB 3OYPA 1CT4E 2UWPA 2NU3E 3TIUA 1EZQA 1LPGB 3K9XB 3A7TA 4K1EA 1MZAA 4Y76A 4K8YA 1K1IA 2VJ1A 1NRQH 1FAXA 2PTNA 2Z9JA 2A7CA 1TBZH 1O3BA 3MO6A 2ZPRA 1UHBA 8KME2 5A09A 1UJ1A 1QBNA 4LXBH 2JH5D 4Y71A 3A87A 2ALVA 3A8DA 1AZZA 3M37A 1FONA 1O33A 4HFPB 1W7XH 4F4OC 1C1MA 3V13A 1F0TA 3RC6A 1T32A 1CU1A 2O8TA 2C4FH 3LC5A 1JXPA 1V2WT 5C1UA 5GJ4B 3BTTE 1P2JA 5KGOA 2BLWA 3GYLB 5L30H 1YBWA 1O3LA 2FOHA 1IQHA 1GJ7B 3SN8A 1C2EA 3LDXH 3T29A 2I6SA 1RTLA 1Q3XA 1ZGIA 3K65B 1RD3B 2OINA 1D9IA 2BHGA 4KP0A 4TSFD 1ELGA 4XDEA 3TITA 2WV4A 4Y6DA 4OGYA 1TNGA 2UUYA 4E05H 2AIPA 5ABWA 2A31A 1S85A 2WHXA 1K1NA 1Y5BT 2DE8A 4WXVA 4I8HA 1PQ5A 2FYRA 3W95A 2JKHA 3MNXA 1HAPH 6LPRA 1B0EA 4OS4A 1HJ8A 1ZJKA 3TPIZ 3A83A 1O2VA 4FU8A 1QL9A 3U8RH 4AGKA 1K1OA 2ALPA 1SLUB 3RC4A 3BEUA 3GDSA 2FI5E 4GCHG 3RXIA 4E7NA 1N8OC 1BT7A 4DJZB 1O2HA 2SGEE 3TK6A 4KTCA 3P95A 1P2NA 2FP7B 2TPIZ 2AMQA 4MG3A 4KELA 3MQKC 3K6ZA 5TCCA 5EGMA 1GHAG 3E0PB 2F9NA 4AFQA 3UQVA 1AQ7A 3R0FA 1HAGE 2ZHQH 2WPKS 1MCTA 1GBIA 3T27A 1ANCA 4Q4LA 5T6GA 1MTUA 1AUTC 3ZVAA 2QE7D 4GLYA 1B5GH 1BMLA 2FMJA 1XUHA 2FOMB 1FNIA 2FOBA 4RI0A 3SV8A 5F8TA 1L4DA 5GPIB 2C90B 1EKBB 2ZTYA 3KNXA 7GCHG 5F53A 1Z8GA 1G36A 2B0FA 2J38A 3A80A 4O3UA 3S69A 2WV9A 1H8DH 4NSYA 3PO1B 1C5VA 1GI1A 2Y5FA 3TVJB 1MTVA 2YMSD 2VIOA 2WSSD 1C4U2 1G3CA 1LPKB 3KL6A 4ABBA 3FP8E 1VCQA 3IG6B 1SMFE 1FN6A 1WBGB 1V3XA 1C5QA 1YPJH 1D6WA 1LDTT 3D65E 3UWJH 3UNRA 3AVZA 4ACBA 5G4BA 1GBMA 1C5MD 1OWJA 1Z6JH 1MBQA 1K1PA 1W8BH 3ODDA 2EC9H 2PSYA 4FXGH 1V2JT 3DA9B 2NU4E 4ZHAA 1YPHE 2JETB 1THSH 1P3EA 1HCGA 2ZIQH 4B1TA 1CVWH 3RXUA 3LH1A 1HJAC 4AN7A 1TOMH 1AFQC 4UFGH 1TWXB 1RJXB 3RXCA 1GCTC 1ZPBA 3I78A 2H1UA 4BXWA 2SGAA 5AHGH 4I86A 4FU9A 4NIWA 1NN6A 4I8JA 2GD4B 4GHTA 2W6JD 1O30A 3ZYDA 2ZEBA 3KQEA 5C1XA 2F9BH 1D3QB 2OC7A 3UOUA 4ISHH 2GMTB 1A1RA 1GBTA 2BVSH 2CHAC 5CE1A 2CXVA 1WTGH 5FCRA 1SFIA 1OP2A 1SGDE 2RDLA 1FY3A 2PR3A 1YPHC 2FPZA 1VR1H 9ESTA 3BEFB 3A7WA 1O2TA 2BTCE 3RXPA 3PTNA 3U1JB 4TY7A 4XBBA 1O3PB 5GDSH 1AVGH 1SG8B 2V35A 1KLIH 5DK1A 1F5RA 1PPEE 4SGBE 3M35A 1RTKA 2BDGA 1Y59T 2BYAX 5T1VA 1L1JA 1BTPA 1SVPA 5A0AE 5I46H 1AB9C 2Y6TA 5GIBA 3MNSA 1TBQH 2L6OA 1YPMH 3SZEA 1BMAA 4RKJB 2ZDVH 1FY1A 1XM1A 4MQAA 1XUKA 1YLNA 3SU2A 5K7RA 1C5UA 3A88A 5FAHA 2CGAA 3DSPA 1GMCF 2UUJB 1GBBA 2FYQA 1YWUA 2V3HH 5DP3A 1VITF 3GCHC 3ZZBA 3PM3A 3GCNA 3ZIAD 3O8CA 2OUAA 4I7YH 3I29A 2FOCA 1DITH 4JMYA 3KCGH 3AAVA 3PLBA 1EOJA 3FOAA 1J16A 1S6LA 1C2IA 1AKSB 2A2QH 1A5GH 1AZ8A 3PMBB 1GJCB 1DVAH 4Y7AA 1NBME 2GJGA 1MKWK 1C4V2 2ODQA 3HPTB 1HYLA 3NXPA 3WY8A 3ZV8A 1W14U 3W94A 1CGIE 1D6RA 1C5XB 3E6PH 3F0OA 2VBCA 1ZYOA 2FESH 2Z3CA 4XRNA 1GG6B 2QIQA 5E0JA 4DVAU 1MQ5A 1W0KD 3GY4A 2GV6A 3HK6B 5ESTE 3RXMA 2HLDD 1RFNA 2J34A 3C27B 4TT3D 2A4OA 1BQYA 4X6PA 1BHXF 4FUDA 1GL0E 2CK3D 3O8BA 2EEKA 1GVLA 3DD2H 4JZEH 1BIOA 2G55A 1CHOG 1V2MT 3SV9A 1Y3VA 1F5LA 1SQRA 4NFFA 2W26A 1N6YA 4X6MA 3RXTA 4CRBA 3TLOA 2P59A 3MH7A 3UNQA 4FUBA 1XUFA 3A8AA 1TPSA 4AG2A 3P8OA 1GBDA 4YXWD 1O3NA 1PFXC 3MNCA 3TH4H 3M7TA 3MWIU 2NU0E 1LPZB 1KXCA 2YMSB 4ASUD 1O32A 5J4QA 2VWMA 4NWLA 5F8ZA 1A2CH 1O3AA 1M9UA 2V3OH 1PYTC 3S9AA 1IQJA 1FLEE 4DT7B 4ZHMU 1UTJA 5PTPA 2UUKB 2ZU1A 1ELVA 1TALA 1DSUA 3RXJA 1JRSA 2J9NA 1XUIA 1EJAA 3A7YA 4ZCNA 2GDEH 1KYNA 1AWHB 1SHYA 3K2UA 4AFSA 4DG4A 1O2SA 2WYGA 4UFEH 1BTWA 1HJ9A 4D7GA 1B0FA 2BQ6B 4TYDA 2V6NA 2OD3B 1WUNH 4B75A 2XC0A 4I8LA 4KGAA 4X2XA 3SQHE 2VH0A 2EY4C 1C5OH 1ANBA 1A0JA 1GI9B 1FDPA 1HPGA 2GGVB 3IWMA 1P9UA 1W3CA 1TYNA 2FZZA 5E0HA 1CGJE 3SOSA 1C1SA 3A85A 5FXLA 2XNIA 5FPYA 4Q7ZA 5FPSA 1F2SE 4RKOB 4I8GA 2OLGA 1LQEA 1P01A 1C2LA 1GJAB 4ABHA 1AKSA 4I31A 2VIDA 4MPXA 3A89A 4FETA 2G8TA 4UE7H 3G01A 3URDA 2AH4X 2BQ7B 1GDUA 1EX3A 4NA8A 3EE7A 1FUJA 1GHVH 1H9HE 2VVUA 1Q2WA 5DGJA 4AX9H 1PPHE 1OP0A 4LZ1H 5B6LA 2Z3DA 1BZXE 1W11U 1A0LA 1GBAA 4ISLA 2ZTXA 1IOEA 1G30B 3EAJA 1O2RA 1GPZA 2ANWA 3LJOA 1ZSLA 3MNBA 4BNRA 3LH3A 5SGAE 2XOKD 3RXDA 1P10A 2CN0H 3LGIA 4H4FA 3A82A 1TX7A 2OQUA 5AFYH 3JZ2B 3TH2H 3Q00A 1GHXH 1ZPZA 1MTWA 8ESTE 1SOTA 4GHQA 1E35B 4Q80A 2VVCA 2J98B 2UUFB 4R0IA 4WF8A 3RMOH 2OBQA 3SU0A 3DSOA 2ZZUH 4FVBA 3P8GA 5FL7D 4CR9A 3GDUA 2ZCLP 3OU0A 4OGXA 3B23B 1EOLA 3F9HA 3D49H 1O2UA 1LHDH 2W7UA 2AMPA 3QO6A 1O34A 1ZMLA 1EZXC 4IS5A 2KCYA 4DY7B 4MTBA 3F2GA 1S6HA 5HM9A 1N8OB 4ZXYH 3KYFA 1SI5H 4MPVA 1Z8JB 2Y5HA 1FPCH 1V2KT 3PTBA 4I32A 1Y5UT 4JCNA 4H6TA 1DWCH 1NZQH 2BVRH 2ZU4A 3GYMA 5KEDA 2ZDMA 3SNEA 4LZ4B 2D1JA 3MU5A 4ISNA 2FODA 3WW7A 3DFJA 3KEEA 1H9LB 2TRMA 1UVSH 1V2QT 2R3UA 3RXSA 1TNHA 1XMNB 3VB4A 1NFWA 2GT8A 1DY8A 1GBLA 5HXFA 3LGVA 1EASA 1TONA 1HXFH 1DOJA 2KCPA 2KR7A 2A45B 5AVDA 1OX1A 1Z1JA 1ZHPA 5E2OA 3GY8A 1BRUP 4HZHA 1QL7A 5DPAA 6CHAC 3SGBE 3U98H 3M5OA 1H8HD 3SU5A 2R3YA 4MLFB 4FU7A 3OY6U 5EXMA 3NK8A 1LHGH 4YOIA 3Q77A 3GY7A 1HIAB 1ZSKA 5L2ZH 3GCOA 3SUGA 2B5TB 4YZUA 2G5NA 1EAUA 1EZSC 1TBRH 2BY9X 4VGCC 3UPEA 1PYTD 1P2MA 1O5GH 2F43B 3B8JA 1FQ3A 2G51A 1U6QA 1UVUH 1SPJA 1C1PA 2FX6A 1ABIH 2WV5A 4INHA 2VVVA 4U32A 2G52A 3LOXA 2FS9A 1GJ6A 1WV7H 3HATH 1FMGA 1GJ5H 2ZHWH 1SGFG 5GWZA 2JIZD 5DP9A 6GCHG 1HJAB 2BD3A 3DHKH 3PLKA 1E37B 2WPDD 1MKXK 3LGYA 4IGDA 1HNEE 1GCTB 3RXLA 1ELEE 4E06H 1TGCA 3P6ZB 9LPRA 1Z6EA 4Q63A 2SGPE 4SGAE 1DX5M 4YM9A 4NA9H 2BY6X 2Y7ZA 2DUCA 3M5MA 1JIMA 1QJ7B 1C2MA 1DWEH 1SGIB 3S7HB 4M7GA 1CQQA 1BMMH 3ZZ8A 2BOKA 2J98A 2LNCA 3BTDE 1MTNC 4AZ2B 1FJSA 4H6SB 4BAMB 1P11E 1LKBA 4KKDA 3PLPA 4KTSA 2PUQH 2W3KA 1EP5A 1IAUA 1EAIA 1PPZA 1C5ZB 1TNJA 2CHAB 1S0RA 1QGFA 4D76A 5IK2D 2H9HA 4RT1A 1C2FA 3UB0A 3W1EA 1YCPK 2VINA 4HG6A 4CRCA 1NRNH 1TFXA 3QZRA 2XBVA 5JYIA 1ZPCA 1E79D 4CREA 3FZDA 4B2BA 4JK5A 1Z8RA 2RFKC 3FP6E 4DGJA 3AW1A 1XVOA 3L33A 4IN1A 5T3HA 1ELFA 2KCOA 3HK3B 5LPEA 3OEED 1C5PA 3RLYH 1SC8U 2XXLA 4K5ZA 1KIGH 3S7KB 4BAOB 3V12A 2SNWA 4GCHF 1O0DH 1JMOH 1Y3YA 2BZAA 1ELTA 5EXLA 3M3VA 1FV9A 1YPGH 2NU1E 3STJA 4RN6A 1UTPA 1HAHH 3QDZB 4WMEA 3ZVEA 4FUCA 4NA7A 1GHAF 3TNTA 2XBWA 2HOBA 1UO6A 4WMFA 3SU3A 1A61H 1C2HA 1TIOA 3GCHB 3SHAH 4YOJA 3RXQA
chains in the Genus database with same CATH topology
4ZKSU 3HKIB 4X2WA 1W12U 2D2DA 3SUDA 4O97A 2QA9E 2ZQ1A 5K0HA 3QN7A 1CBWC 1C1NA 2Z9IA 1C1RA 2R0LA 1BBRE 2BDBA 1T8NA 2H5DA 1T7CA 1O2YA 1ZJDA 1GBJA 3PMJA 3E8LA 1HIAA 1TX6A 3ATMA 7GCHF 2XCNA 2K1QA 2PLXA 1MU6B 1ZLRA 4X2VA 3C1KA 4TPYA 4J2YB 5EW1H 3M7UA 1ZTLA 3SI3H 1FY4A 1QY6A 5HGGA 2GX4A 5C5NA 2ZA5A 1E0FD 1NO9H 1H1BA 1S81A 1EJNA 1O2QA 1AD8H 1V2OT 1L2EA 3P8NA 3RP2A 1O2XA 1YPLH 1O2KA 4YOGA 2QYIA 2QY0B 1ELAA 4K3JA 4AG1A 1GHWH 2O9QA 2A4RA 1AUJA 4MPUA 1BRBE 1NU7B 3LGTA 3GICB 3ENSB 1DLEA 1IQNA 4Y8ZA 2Y7XA 1J15A 1P12E 1FY5A 1EJMA 3LU9B 1NPMA 1QA0A 2J95A 3PYHA 1UTLM 3BIUH 4ZUHA 1LVBA 3AAUA 3GY5A 5ETXA 2BMGB 2BM2A 1O36A 2F9PA 3MOCA 5LPRA 1A3BH 5FBIA 1QR3E 1TMBH 1HLTH 1G37A 1TGTA 2GCHG 2FOAA 4BXSA 1K28D 4K69A 1QB9A 2ZU3A 3KIDU 4BOHA 5C1YA 5JB8S 3BG4C 1SGTA 1ARCA 2ULLA 1V2TT 2Q1JA 3NZIA 4ZAEA 1ABJH 4PROA 4FUFA 1DY9A 1Y8TA 1OP8A 4IMQA 2ZTZA 1FXYA 1SGNE 3UQOA 3TGKE 5DO4H 1HGTH 1AI8H 3E91A 3ZZ4A 1F0RA 2HNTE 2Q6DA 1AMHA 2ODPA 4OS2A 1VCWA 1TPPA 2SFAA 1P02A 1JWTA 4X1SU 1W7GH 1OYQA 3M7QA 5C5OA 1O3CA 2H9EH 1XVMA 1BTZA 1LKAA 1GHYH 1LVOA 4INKA 3UREA 5BRRE 1ZGVA 1T8MA 2ZFQH 2H5CA 2A0QB 3T5FH 1F5KU 3EE0B 1RIWC 1EZUC 1XX9A 1QB6A 3GDVA 2ZDNA 3M3SA 1LMWB 5DP6A 1HAOH 2WYJA 2YOLA 1KTSB 4NZQA 3ODFA 2OXSA 2A5KA 4GSOA 5EXNA 2BDYA 1YP9A 8GCHG 3ZZ5A 1K9OE 4D9RA 5B6OA 2ZKSA 1C1VH 1C5RA 1D3DB 1TA2A 1FIWA 4KTUA 1C5SA 1O3IA 2HNTC 4X1PU 1EB1H 1NM6A 1THPB 5C67A 4AORA 3SJIA 4O03A 1EB2A 2STBE 1NT1A 1UVPA 2B8OH 1BITA 1OYTH 1C5LH 3EDXB 2F83A 3RU4E 1RTFB 1MQ6A 1GMHG 2WUCA 1E38B 2BD9A 1TABE 1SGRE 3URCA 1QBOA 2FOFA 3RU4T 3BTME 1GJ8B 2BOHB 2V0BA 2FI3E 1FPHH 2Z9GA 4YTAA 1DUAA 1BTHH 3NCLA 3NWUA 1BRAA 4JZFH 3U69H 3VB3A 4BTIB 1O31A 3A8BA 2ZFPH 4XSKU 1GJBB 2ZDAH 3BTGE 3E90B 3BV9B 2FDAA 2Z9LA 3BTQE 3DFLA 1PPCE 1CHOF 4B2CA 1HDTH 1EP6A 3UR6A 5ESBA 3S9CA 1JRTA 5CMXH 2VWLA 1HRTH 2TIOA 1HAVB 3QX5H 3ZZ9A 2A7HA 2FTLE 2OP9A 2J4IA 3LC3A 1IQFA 1HUTH 1VJ9U 1TMTH 3TU7H 2WPIS 2ZU2A 1ELCA 4OS5A 3BF6H 1GDNA 2ZHFH 2HVXA 4CH8B 1A5IA 3ZVCA 1IHSH 4BAHB 1C1UH 1SQOA 1C1OA 2BDCA 1L4ZA 1A4WH 1O2LA 1KLTA 2RA0A 2VWNA 1DSTA 1O3DA 4CR5A 1UTKA 2P8OC 2ANKH 3LKWA 4Y0ZE 3M3TA 3PROA 2P93A 4A6LA 1TNKA 1SGFA 3U9AH 2YNBA 1AIXH 1C2GA 1GJ4H 2PFEA 3MO9A 4Q7YA 1MTSA 1P2KA 4JK6A 2TBSA 5HMAA 3TK9A 3A8CA 4X1NU 1V2NT 2GDDA 1GHBG 2HALA 1QHRB 3H7OA 6CHAB 2FOGA 1DWBH 1EATA 2HWLB 2QF0A 3OSYA 3LT3A 2AIQA 1ORFA 1UCYE 3F9FA 1O2GH 4MVNA 1C9PA 4CRFA 1GI5A 2ANMH 1N6XA 2BXUH 1O2MA 4D7FA 1D3TB 4CHAC 1AY6H 1DICA 4VGCB 4WMDA 3FFGA 1JOUB 3F9GA 2AGIX 3SBKA 2BX3A 2QV1A 1ETTH 2Y5GA 5FPTA 1YF4A 1S83A 1SB1H 1XKBC 2BLOA 4WJG2 2F9OA 1UTNA 2B9LA 5FX5A 2XTTB 3UUZA 4BTUB 4R8TB 4X8SH 4F49A 3VB5A 5DG6A 3SU6A 3NUMA 1GGDC 2ZU5A 3M36A 1P3CA 4NZLA 1NY22 3L6PA 5I25A 1G3EA 1GI3A 1YLCA 3ZZAA 1S0QA 3BTWE 5EPYA 1SOZA 3RXAA 2ZQ2A 3BN9A 1ETSH 3T26A 5EG4A 2VB0A 2BLQA 1GBCA 1MTNB 2ZFFH 1KDQB 1NFYA 4AB8A 1FIZA 1V2UT 5HM2A 1KXDA 1O38A 2P3FH 3BTHE 1Y3UA 1KXAA 1T8OA 2EI8A 2P16A 4K1TA 1CA0C 2BVXH 1DXWA 3P17H 3M5NA 2WPLS 5A0CA 4Y79A 4QT8C 1HAVA 1NS3A 1F7ZA 1O5AB 3JZ1B 3MO3A 1BBRH 3U8OH 4YESB 3QGNB 4BAKB 2FWWA 2Z3EA 3EA8A 1ESAA 4K8BA 4XE4A 1HAZB 3VGCC 1J17T 2QC2A 2GVFA 1V2LT 1VGCC 2PWXA 4ABJA 4NIYA 1IQIA 2PGQB 3CS7A 3ZVBA 1Z1IA 1IQEA 1KTTB 1P57B 5FHTA 2O8LA 3TK5A 3O8RA 2ZGCA 7LPRA 1AU8A 4NGAH 2AGEX 1IQMA 4AFZA 4MPWA 3TJUA 3QLPH 1RS0A 1WSSH 3D23A 4Z6AH 2TGDA 2FLBH 5EQRA 1CBWB 3E3TA 1HAXB 3SO3A 1P8VC 2FEQH 2XBXA 1UTOA 3A7ZA 1O5EH 3NKKA 1S84A 2QF3A 3CP7A 3P92A 3FZZA 1GVKB 1QTFA 2PKAB 3LJJA 5C2ZA 2TGPZ 1P05A 3FP7E 2RG3A 4ABDA 5FCKA 2STAE 3MYWA 3KHVA 1VITH 2H6MA 3UR9A 1VCPA 4FVDA 4I8KA 2FXRA 3SJ8A 5TJXA 3ELAH 1SHHB 1DLKB 3T28A 2CF8H 2EI6A 1NRPH 1GI8B 1PJPA 1YLDA 3KQDA 3QZQA 4U2WA 1ZTJA 1ID5H 3SJKA 4UFDH 1BB0B 4A1XA 1LHCH 1OWEA 2C3SA 3BSQA 2PKSC 3LONA 4CRAA 2Z94A 2RA3A 4ABAA 2PHBA 2WPMS 6GCHF 2TGAA 1F92A 1D3PB 1WOFA 1QA7A 1EUFA 1SQTA 1XXDA 1KSNA 1SQAA 1O2OA 1AWFH 1DXPA 1KDQA 1OWIA 1YCPM 6ESTA 4B73A 1JIRA 4XBCA 3S9BA 2C93B 2FTMA 1ZR0A 3SUFA 1FAKH 3TNSA 1CGHA 4INLA 4MNYA 1LCYA 4IBLH 2BQWB 3ZV9A 1OOKB 3BG4B 4CH2B 1AE8H 4ABFA 1CT0E 4X8TH 1ARBA 1ZSJA 1GI2A 3SZNA 1SL3A 4LOYH 1XXFA 3ZVDA 4FUHA 5A2MH 4ZKOU 1QQUA 4IMZA 3K6YA 1O3EA 2A4QA 1X7AC 1P9SA 5E8EH 1WTHD 1O39A 2J92A 3KN2A 1RGQA 5DP4A 4UEHH 3T25A 4TPIZ 1ANDA 2CJIA 2A1DB 2ZHDA 4X8UH 1GI4A 4B74A 1QQ4A 2GZ7A 4NWKA 4Z0KA 1C9TA 3SHCH 2IN2A 5C20A 5DP7A 1D4PB 2GT7A 1RIWB 2ZO3H 1SLXB 1THRH 2HLCA 1AFQB 4XBDA 4IN2A 3QUMP 4K1SA 1EAXA 1TLDA 3E0NB 1GHZA 1OKXA 4XOJA 3TJVA 1EPTC 1BDAA 5GCHG 4CBNA 3F1SB 2GCTC 4AYVB 1WU1A 1TQ7B 3PMHB 1W2KH 1TGSZ 5AF9H 2ESTE 4Q7XA 2GZ9A 4ABEA 4IC6A 2HRVA 1O3HA 4OS1A 1QRZA 2SNVA 1OWKA 4O9VA 2W3IA 2PKAA 1DUEA 2WPJS 1O2WA 5H4IB 2IPHA 1O3JA 1P03A 1EXFA 4NSVA 4ASHA 4MNWA 1BHXB 2ZDLA 3TJNA 4ABGA 3GOVB 2PUXB 3HKJB 2QXJA 1NRSH 2D8WA 2CV3A 3E16B 3OX7U 3LGWA 1QRXA 1MU8B 4B2AA 1NFXA 1GI0A 1HV7A 1E34B 2NWNA 1VJAU 4YLQH 3ZZ3A 2CMYA 1TGNA 2GTBA 4MNVA 2FM2A 3SJOA 4TY6A 1C1WH 2IOTA 4E7RG 1H9IE 3MU0A 1AB9B 1ZRKA 1XKAC 1HFDA 2SGFE 3QTOH 4OS6A 1UVOA 1AN1E 3O8DA 5JBTA 2BY7X 1GMDG 2G81E 3A81A 4X6OA 2XW9A 3F68H 1GI7B 3N7OA 1UCYH 2FLRH 1HBTH 3A84A 1YKTA 3KF2A 1OWDA 2VU8E 1V2VT 2RCEA 1H4WA 2C8XB 3VEQB 2QGRA 2OQ5A 1TOCB 3SJ9A 4O3TA 2SGQE 2O8WA 2P95A 2GCHF 3ATKA 1TNIA 3RXGA 4Y11E 3MHWU 2ZFSA 3PV4A 1BJUA 3NPSA 2ZCKP 2P8OB 4YLUA 5E2PA 2JH6D 2UWLA 4B76A 1QRWA 3SV2H 2ASUB 4AOQA 1Z8IB 1MKWH 1AO5A 4GAWA 3SW2B 5CHAC 2ZC9H 1K1JA 1GDQA 1T31A 3DUXH 5L2YH 1ANEA 2KAIB 3SUEA 1V2RT 5T6DA 1AVWA 3MH6A 2OC8A 5DP5A 1RRKA 2PV9B 1N1LA 2VH6A 3CENA 1L0ZA 1QJ1B 3H7TA 4J1YA 1HB0B 3MTYA 3RMMH 2A5AA 5JBAS 1O3KA 3FVFB 1C1TA 4CHAB 1TAWA 1SFQB 3Q76A 4YT7H 1YPEH 1W0YH 2ZCHP 4X2YA 3BTKE 2G5VA 1MZDA 1C5TA 1O5CB 2FX4A 1V6DA 3SGAE 3GY3A 3U8TH 3TH3H 4FUIA 4OS7A 8GCHF 1QIXB 5JBBS 3M61U 1ZHMA 4THNH 3VFEA 1PQ8A 2AEIH 2HGTH 1GGDB 5EW2H 3VB7A 1NROH 2C8WB 1NU9A 1DM4B 3LPRA 1NESE 2ZGJA 3ATLA 2FOEA 3I77A 1F0UA 4WWYA 1C4Y2 2AMDA 7KMEH 3TJOA 1O2PA 1AVXA 2A2XH 2QXIA 1K1MA 4WH6A 5IYTA 1GCDA 1MD8A 3FAOA 3SNDA 3V0XA 2R9PA 3MU8A 1GMHF 1ACBE 1P09A 3A7XA 4XFQA 1Y3WA 1C2DA 3MU1A 1NC6A 1TRMA 2ZF0H 1ZRBA 3SNCA 1QCPA 1ETRH 2F3CE 1BRCE 1CA0B 1MMJN 1ZTKA 4JYTA 1KXEA 1ZOMA 2ZG0H 1TE0A 1E36B 3SQEE 3T2NA 1OS8A 2DE9A 4LK4A 4CRGA 4BAQB 4ZROA 2WPHS 1PPFE 1S82A 1TQ0B 1FI8A 2VNTA 4JZDH 2R2MB 3UWIA 5F8XA 4NIXA 3VGCB 4AB9A 1BJVA 1CHGA 1ZMJA 3R3GB 1VGCB 1WYKA 1GVZA 1BTUA 1O5FH 1ELBA 1DANH 1IQLA 1G9IE 1A7SA 1BCUH 1P04A 3RM0H 4HGCA 4NIVA 2NU2E 3RUOA 2R0KA 2W7SA 3PMAB 5HYOA 2OTVA 1INCA 4ZH8A 3RXKA 1SGEE 1RXPA 1KLJH 1BMNH 1L1NA 1TRNA 1TMUH 3S0NA 1PQAA 4CRDA 1SR5C 2R2WU 3HGPA 4X0WU 1C5NH 2KAIA 4B71A 1Z71A 1V2ST 2Q6GA 1TNLA 2VGCC 2OC1A 4ZHLU 4DOQA 5LGOA 3OTJE 5GXPA 5A8ZA 3ZYEA 1GHBF 4GUXA 2C8YB 2AERH 1L1GA 1MUEB 3TGIE 1V2PT 2FIRH 2XC5A 4DIHH 7ESTE 4UDWH 2AS9A 3SU1A 1GJ9B 1TGBA 3BG8A 4WH8A 1ZZZA 4U30A 4GVUA 1O35A 2XC4A 2XWAA 2ZFRH 2AGGX 1UMAH 2XYAA 3UY9A 8LPRA 2BDHA 4NFEA 1XUGA 1OWHA 4CBOA 3RXHA 3VXEH 4ZKNU 1K1LA 2PGBB 4MNXA 5FX6A 5DJ7A 4D8NA 2PKSB 1PPBH 2HPPH 4H42U 1GBHA 1O2ZA 2UWOA 4X1QU 5LH8A 2C8ZB 5T6FA 1UCYK 3UFAA 1YYY1 2G4UA 4UFFH 1KXBA 2Y81A 3SGQE 5F6MA 3U1IB 3Q3YA 2IJOB 2FI4E 1GL1A 3ITIA 3MH4A 3ATIA 1O2NA 4I33A 1S6FA 4NG9H 4WY3A 1G3BA 1DPOA 1C5WB 1CSOE 1OPHB 2BB4A 1GI6A 1OSSA 1K22H 1C2JA 1BUIA 4TWWA 4FUJA 4BTTB 4JYVH 4DW2U 3OY5U 1TA6A 2BDIA 3EGKH 3EA9A 2A5IA 1O3OA 1NRRH 4AYYB 2ZPSA 1AHTH 2XRCA 2FO9A 1C2KA 1P2OA 2HNTF 1JBUH 1TB6H 1K2I1 3RMNH 1ZHRA 2J2UA 1B7XB 3RXOA 3AW0A 1FZZA 1AE5A 1FY8E 3QTVH 3A86A 2EI7A 4HTCH 1G3DA 1SGYE 1FN8A 1ESTA 4X6NA 1W0ZU 3V7TA 2XCFA 1A5HA 1O5BB 2GV7A 5IDKA 2QXHA 3TGJE 2ZI2H 1DFPA 3ZZCA 2VIQA 3STIA 1O3MA 3V3MA 1LVYA 3KQCA 4AGJA 1J14A 3EQ0H 4D9QA 4JZIA 3RMLH 3Q3XA 4FUEA 1DS2E 2J94A 1EPTB 1J9CH 1GMCG 2P94A 1MKXH 2GCTB 2OCVB 1A0HB 1LQDB 1Z7KA 5E0GA 3PWCA 1VITG 1P06A 3UOPA 1PPGE 3F9EA 1NTPA 2THFB 2QAAA 3MU4A 3VXFH 5C3NA 4WXIA 3FANA 3A7VA 5A8YA 1YC0A 4Y8XA 2ZDKA 1HAIH 2H9TH 3SORA 3RXRA 1O37A 4YT6H 5F03A 2HPQH