1O5BB

Dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDACQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA)
pubmed doi rcsb
molecule keywords Urokinase-type plasminogen activator
molecule tags Blood clotting, hydrolase
source organism Homo sapiens
total genus 49
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5bB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5bB01
2G4UA 4CH8B 1J15A 5ETXA 3S7HB 1DSTA 1YM0A 2NU0E 3W95A 4M7GA 2A4OA 1WBGB 1LQDB 1SB1H 4B71A 5FBEA 2VINA 1BMAA 4X6MA 3UPEA 1NZQH 1D3PB 4MTBA 3TNTA 4DW2U 2O8MA 4IGDA 1UK4A 2XNIA 4XOJA 4OS4A 1MTWA 5F03A 1NRNH 3BG4B 4ISIH 3A81A 3U8TH 1ESAA 4KKDA 1CGIE 4ISLA 1BCUH 2G5VA 4Z6AH 3U8OH 1XXFA 3LJJA 5CE1A 2C8YB 3BTWE 3LH1A 1OPHB 3RXQA 1BHXB 1P2OA 4TWYA 1WSSH 1ETSH 3P70B 3PB1E 1C2EA 1WQVH 2EA3A 1NFYA 3QWCH 4FU9A 2ZPRA 1EASA 5FAHA 1LQEA 2AGGX 2VJ1A 3V12A 1A61H 1O2MA 1GJ6A 4ESTE 4Q7YA 1PYTC 4SGAE 1QQ4A 4ZXXH 2J4IA 4WH6A 2AGEX 1DANH 2PGQB 3E91A 1ZSKA 1DWBH 1TA6A 1W14U 1DWDH 3GISB 1SSXA 1W0ZU 1C2FA 2BY9X 1CVWH 2WV5A 3P8GA 3E90B 5T6DA 1HDTH 5C1XA 4INHA 4AGJA 2ODYB 2VB0A 7GCHG 1VCQA 2W3IA 1HIAA 1LHCH 2FPZA 2ZDNA 4IN2A 4JCNA 1OX1A 4I8HA 2CV3A 2YNAA 3BTME 4MPUA 1W0YH 2J94A 2ZHDA 3SQEE 1O5CB 1MH0A 3BTEE 3MU0A 2SNWA 1QQUA 1QRWA 3LOXA 5A0CA 2W5EA 1FY1A 1ZSLA 2QY0B 2ZP0H 1IQJA 5C2ZA 5L2ZH 3D23A 2WUCA 2A45B 3M5LA 3E6PH 2QF0A 1T4UH 4GLYA 4A1VA 4FUEA 1HGTH 1GBEA 1GBMA 1K1JA 4WVPE 2OCVB 4Y7BA 2GGVB 5FPYA 3EA7A 3Q3YA 1AY6H 1DS2E 1K9OE 1AKSB 4ABAA 1O2JA 4Y0YE 1C5ZB 4QT8C 3K6ZA 2OC7A 2VIDA 1OOKB 5T3HA 2VU8E 4Q7ZA 1KXAA 1KLIH 3FANA 3OU0A 5B6OA 4ZH8A 1V2OT 1Z1JA 1LKBA 1K1OA 3GY8A 3F68H 1QBVH 2O8LA 1KXEA 1TGSZ 4Y76A 5SGAE 2Z9GA 3A80A 3ENSB 1SLWB 1C5YB 4ISOA 1WAYB 3PMHB 1O0DH 1FQ3A 2C8ZB 1H8IH 1S85A 4FUFA 4ZHLU 4B75A 5IYTA 1ABJH 2BD2A 3OSYA 3RC5A 2WPJS 3SNBA 1THSH 3I77A 3RLYH 4IC5A 1Y5BT 1ACBE 2CGAA 2BD8A 2HNTF 3LGIA 4K3JA 2UWOA 1MZAA 1NM6A 1SFIA 3K65B 4X2WA 4A5TS 1DICA 2H9EH 1SGYE 1BRCE 4AFQA 1AVGH 4CHAB 1NY22 1GJCB 3LGYA 2H1UA 1TNHA 3EE0B 1TBRH 1MQ6A 3M35A 1GJDB 2G8TA 3RC4A 1L2EA 3C1KA 1O38A 2H5DA 2P3UB 2P93A 3M5OA 5A8YA 2VH6A 1IQLA 2TGTA 1RGQA 1O34A 3SO3A 2AS9A 1UHBB 4YLQH 1VITH 1G2MA 1FAKH 4B76A 1GBFA 1O5BB 1SOZA 3ZVDA 2BMGB 3Q3KA 2Z3EA 1C5UA 1TBQH 2R9PA 1S81A 1UVPA 2R0LA 2KAIB 4GCHF 6ESTA 1V2WT 3U1IB 4IMZA 2J38A 2UUKB 2FDAA 2QF3A 3E0PB 3RMLH 2IN2A 2AGIX 5EG4A 5C3NA 2A2XH 2GT7A 3MI4A 3GYLB 1O3DA 1MU6B 3WY8A 3UREA 2GV7A 1OYTH 1NRRH 3LGWA 3KQDA 4JMYA 3P8FA 1PPGE 1N1LA 3A88A 1BRUP 3M37A 3RXJA 3OTJE 3TITA 1JMOH 4ABJA 2GTBA 2V3OH 1TNGA 2BY7X 5JB9S 5F6MA 5FCKA 2FLBH 1MBMA 2NU4E 1KTTB 1O3LA 4I31A 4CBNA 1P03A 3QTVH 4X6NA 1NFUA 2F9NA 2P8OC 2H5CA 1FMGA 1C5LH 1NRPH 3MU1A 3A84A 3SI3H 2A4GA 1FY5A 3M3SA 1T8OA 2BQ6B 1D3DB 3RP2A 2P3FH 1P2JA 1C9TA 5A09A 1HCGA 2HPPH 1SPJA 5AVDA 3UNRA 1CT0E 1NU9A 2FOMB 1GJ5H 2GDDA 1GBCA 1K28D 5LPEA 1G3DA 4NWKA 4WMFA 3BTGE 1C5QA 1AD8H 4CRDA 1P09A 1TRYA 2WYGA 1GI8B 2HVXA 1HBTH 3PWBA 2FEQH 4IBLH 1J8AA 3JZ2B 1RIWC 1FPCH 1HJAC 5ESTE 1Z8IB 4BOHA 1W2KH 3ATWA 5T6GA 4A6LA 4YOIA 1GJAB 2JH0D 2EC9H 3NZIA 2ILNA 2CHAC 4U01A 1WUNH 2A7JA 3MO9A 2OP9A 2BX4A 2ZI2H 4O3UA 2ZGCA 4Z0KA 1GBLA 2TIOA 4D9QA 1UCYH 4DVAU 2YNBA 1ANEA 2F9UA 5GPIB 1UJ1A 4MPXA 1NROH 1BT7A 1HV7A 2PKAA 2VIOA 5TCCA 1H1BA 1O3KA 2CXVA 1EJAA 2ZU3A 1GBAA 1UTLM 1S5SA 2BOHB 2ZIQH 2ZQ1A 3E0NB 5FHTA 3SORA 1WOFA 2XBXA 4AFZA 2F9OA 1SGRE 1TQ7B 3SW2B 4ZMAH 2ZDKA 1FI8A 3E3TA 4Y8YA 3TK6A 1O2NA 2F83A 1ZSJA 4Y10E 2Y5HA 3PO1B 3STJA 3ATMA 4Y79A 1CA8B 2WUBA 1Z8RA 2UUFB 3EQ0H 2SGPE 2TPIZ 1L1JA 2BYAX 2FOGA 3RXFA 1W13U 4Y11E 1TNIA 2BM2A 4CH2B 1BTZA 1IHSH 2GCTB 1EP5A 3FVFB 2BLWA 5HM2A 2XTTB 3BEFB 1EUFA 1K21H 1KDQB 1EZXC 2FOHA 2ZDMA 3M7UA 4K5ZA 3BTDE 1VITG 3RLWH 1GI2A 3MWIU 4NIWA 5EXLA 1ELEE 1F0SA 1HUTH 1FONA 1P8VC 1UO6A 2DE9A 2A1DB 3ZZ9A 1C2GA 1S83A 3A7XA 1C5MD 3MU4A 4IC6A 1LVOA 3KQCA 1XKBC 2BHGA 4R0IA 2RA3A 1THPB 4AB9A 5L30H 1QURH 4NSYA 2A2QH 2O8TA 2P3TB 2GP9B 3BV9B 2PUQH 1C1UH 1YC0A 2FOFA 1ZGIA 1DXPA 3LIWA 1VJ9U 1L1GA 4HTCH 3ZZ3A 4BAQB 1C5VA 1BHXF 1FIZA 1GVKB 2VIWA 5GWZA 3RMOH 1QA7A 1EX3A 1YPGH 1F5LA 5ESBA 3SU2A 1YCPM 1UTPA 1EJMA 1O5DH 3RXBA 5I25A 4MNVA 2A0QB 3I29A 1HPGA 1Y3YA 3C27B 1XVMA 2R0KA 1AU8A 1O3IA 1PPZA 4IS5A 4X8SH 4TPIZ 2DE8A 1QBNA 1XUJA 4NSVA 1HXFH 2OC0A 2BDYA 1VR1H 2D26C 5GXPA 1THRH 7GCHF 1P2KA 1BBRE 4MLFB 2WPHS 3B9FH 2QIQA 3UQOA 1OSSA 2XBWA 3BEIB 1V3XA 3FP7E 1D9IA 3GY2A 1MAXA 1C1NA 1LDTT 2WPIS 3FZDA 1ZHMA 2B0FA 1O2XA 2GKVE 3VFEA 1FXYA 2GX4A 1V2UT 4MQAA 5F8TA 8ESTE 3BG8A 4BAHB 4YT6H 1P9SA 4JK5A 4ABIA 5C5NA 1AFQC 2PV9B 1O30A 4X1NU 3ZZ8A 3ZZ4A 2ZFQH 3ZYDA 1PQAA 1O5FH 4CR5A 2YOLA 1A5IA 1V2NT 2F91A 1XX9A 3FP8E 3MU8A 1K1NA 1O37A 1Z1IA 3UOUA 1OP8A 1C1SA 5FCRA 3TH4H 5E2OA 4E06H 3PO1C 3LDXH 3TJOA 1TX8A 1MCTA 1UVUH 3SNEA 1SGPE 1UCYK 2VVCA 1Y3VA 4Y0ZE 4O03A 2BXUH 3U8RH 3RM2H 1V2RT 1UTKA 2JH6D 4AG1A 1RXPA 2WV4A 2AMQA 2Z6BD 1HAZB 3QN7A 4X8VH 1CO7E 5DP7A 2Y7ZA 2C8XB 3ZZ5A 3MNXA 1O3MA 3M7TA 2FI5E 1FN8A 1Y5UT 1ANCA 1TOCB 1EOJA 1TNLA 2FYQA 4U30A 3TGJE 1TB6H 2EEKA 5EXNA 2ALPA 1WTHD 1ZJDA 4I8KA 4WXIA 1ZRBA 3TNSA 1GBHA 1C1RA 2NU2E 2W26A 1BMLA 5HGGA 3HPTB 3SJ8A 2XRCA 1NS3A 3VPKA 4AG2A 1SGIB 4XBDA 3CS0A 3RDZA 2GCHG 2VNTA 5JBBS 2J34A 1KIGH 5A8ZA 4AZ2B 1P05A 2ZDAH 1E38B 5GCHG 3UY9A 2WPLS 1ETTH 1QGFA 2CJIA 1FY8E 1ARBA 1MCVA 3E16B 1N8OC 1V2KT 3O8DA 1NPMA 3TJVA 1L4ZA 1O3FA 1PQ8A 2ZDVH 3GCTF 2V35A 4X2XA 1YPMH 3SOSA 1KLTA 2UUJB 4NIXA 1TQ0B 2JETC 4WF8A 2HALA 2XCFA 1GHAF 1AKSA 2PHBA 4WXVA 2CF9H 2PKSC 3ZVAA 4ZKOU 2G5NA 3GICB 3TJNA 4D7GA 2Y6TA 4ZKSU 1LVYA 1HFDA 2P95A 1RTFB 1ZPZA 4RSPA 4E05H 1GGDC 1P3EA 4X6OA 2Y82A 2ZHFH 4DOQA 3MYWA 3BN9A 4OS1A 3F9FA 2BX3A 1GI3A 1Q31A 1B0EA 1WTGH 2XWBI 4D8NA 1GMHG 5JDUB 1F0TA 2JKHA 1O3AA 1MKXH 3RC6A 4NA7A 2V3HH 1TPPA 1HAYB 1NN6A 3S0NA 4UFGH 5JBAS 1O5EH 5DG6A 4A7IB 2ZQ2A 1JOUB 3T25A 1DX5M 5EU8A 2RG3A 4FUIA 1EZSC 8KME2 3MH5A 4GSOA 5C20A 3DFJA 3CENA 4ZAEA 1QRZA 3SV2H 1YLDA 3P6ZB 1VZQH 4INKA 2EI7A 2ZFFH 3OYPA 4D7FA 3KCGH 1O2YA 2C93B 3E8LA 4JZEH 1W3CA 1NO9H 1CQQA 2ULLA 4UFDH 4ZROA 1BZXE 1GCDA 3P95A 4DT7B 2PSYA 3LC3A 2P8OB 2BOKA 2ZFPH 3GY7A 3SN8A 1EAUA 3SJOA 1P2NA 3MFJA 1HAVB 1MQ5A 3GY3A 2FO9A 3NWUA 4OGYA 2A7CA 1GL1A 4JZDH 1J16A 1GBDA 1TGBA 1AUTC 3RXEA 2AEIH 1GHXH 4ISNA 3M36A 4Q80A 2GZ7A 4JYTA 7LPRA 1GJ4H 5BRRE 2O8UA 3BIUH 2KAIA 3D65E 2RCEA 4RN6A 3KL6A 3OY6U 3K2UA 1GMDG 3P17H 3AW1A 4H6SB 1DWCH 4ZKRU 2CF8H 2ZGHA 1S6FA 2FWWA 1QA0A 2HNTE 1RIWB 1BJVA 3L3TA 3NCLA 3QX5H 4RKOB 4MNYA 1YF4A 1HJAB 2ZEBA 4HGCA 3GCNA 2B7DH 1HRTH 3A7ZA 3KIDU 1AMHA 2EI6A 3Q00A 2ZDLA 5E8EH 3MNSA 2C4FH 3GCHC 1BUIA 3S69A 1FPHH 3T26A 2CHAB 4CRAA 2ZTYA 1HAPH 3A7TA 1OWDA 1SMFE 1P3CA 2PTCE 2ANMH 1YPHE 2PGBB 7KMEH 2BLVA 1BTYA 4YO9A 1O2LA 4FVDA 3IG6B 3UOPA 1D6RA 1O36A 2SNVA 5EW2H 1V6DA 3G01A 1ELCA 1ZOMA 4ZUHA 3AAUA 1RS0A 3SV7A 1ZR0A 1Z7KA 2C3SA 1LCYA 2AH4X 2OTVA 2AERH 3MMGA 3ATIA 1RJXB 1BA8B 2BD9A 2FTLE 4BXWA 1O3EA 2BDHA 1GI0A 3BTKE 4RKJB 4JYVH 1HIAB 1T7CA 2XC5A 3ATLA 3GOVB 5FX5A 1VITF 1HJ8A 2AMPA 1MU8B 3MOCA 2GD4B 1CSOE 2Y7XA 2IOTA 2VWMA 5GIBA 4AYVB 3D49H 4JZIA 1P04A 4AB8A 1O2QA 2O8WA 1ZHRA 5EQRA 1W8BH 1MTVA 4X8UH 5GJ4B 3LPRA 1A4WH 5C1YA 1H9LB 1O3NA 6CHAC 1DY8A 1W7GH 1F5RA 1TE0A 2GVFA 1A0JA 1QR3E 4J1YA 4ABEA 1O2TA 5DP9A 2W7UA 3VB7A 3RXUA 2GT8A 1AE8H 1T32A 1V2LT 2BD3A 3D62A 2A5AA 4WWYA 5I46H 4ABFA 1YBWA 4A1TA 4KGAA 1JBUH 3SI4H 1QL8A 4TY7A 2W7SA 3ITIA 1YKTA 1TPOA 2OD3B 1A5GH 4IW4E 2SFAA 1GBKA 1CGHA 3ZVEA 2WINI 5DO4H 2J95A 1P2MA 1GJ8B 1GMCF 2QC2A 1F0RA 2BDGA 1IQGA 4BTUB 4ASHA 2XXLA 1EPTC 1O3PB 4KP0A 3ODFA 4UE7H 3NUMA 2Q6FA 1V2MT 1BTWA 2WPKS 1AUJA 1V2QT 2ZGBH 1EQ9A 2AIQA 1IQKA 3MNBA 3RXIA 1C5SA 2ZO3H 5DK1A 5CHAC 1KYNA 2QCYA 3PYHA 4FU7A 1GI9B 1LPKB 2FX6A 5AFYH 3U98H 1SGEE 1UCYE 2ZNKH 1ELAA 1KDQA 1UMAH 1SVPA 2VGCC 5C5OA 3ESTA 1HNEE 3EAJA 3BTHE 3GY4A 3KGPA 4DGJA 1DVAH 4MVNA 5FXLA 4B2CA 3U1JB 1GBTA 1JRSA 1EKBB 1QTFA 1P9UA 3SBKA 1G3CA 3GDUA 1AFEH 1CHOG 1MMJN 4KELA 1FAXA 3W94A 1J9CH 2XC0A 3TIUA 4DIIH 1AE5A 1JXPA 1LHDH 1LHFH 2ZWLH 3RU4D 3BTTE 1ZRKA 3ZZCA 1C5TA 3IWMA 2Q1JA 1TX6A 2ZPQA 1F7ZA 1SOTA 4CRBA 2C90B 1OP2A 4R8TB 2G51A 4GAWA 1C2KA 1IHTH 2A31A 2VWNA 3DUXH 2ZA5A 3QZRA 1KXFA 2TRMA 3M5NA 2PWXA 1DWEH 1MKWH 3DHKH 1ANDA 1AFQB 1TGCA 4NA9H 3VB4A 2ESTE 1EB2A 1O2KA 1ZPCA 3SU3A 1DLEA 4K69A 4YOGA 3EA9A 1XUHA 3RMMH 3VB6A 1TMBH 4I33A 4O9VA 1G32B 2BY8X 2D8WA 3U9AH 3M3TA 4U32A 1AWHB 4ZHAA 5EGMA 1BTHH 3TH3H 1GG6B 1O3GA 1TYNA 1EAIA 3H7OA 1ZJKA 1F2SE 4AN7A 1RRKA 2VH0A 2XW9A 4X8TH 2ZTZA 1X7AC 1SHHB 4BAMB 3MU5A 2QXIA 3NK8A 1ZMJA 1OWJA 2BQWB 1C1QA 1W12U 1LO6A 3ATKA 1OYQA 4ABDA 3RUOA 1YGCH 1HXEH 2TGPZ 1C5PA 3RMNH 2LPRA 4AYYB 1XXDA 1F5KU 2F9BH 4TWWA 1K1IA 2GCHF 5AFZH 1TOMH 5J4SA 1DT2A 2NU1E 2ZU5A 3Q76A 3S7KB 4YM9A 1KTSB 2PFEA 1O31A 4DIHH 5GCHF 2WYJA 2BD7A 1J14A 3MH4A 1VGCC 1GVZA 5DP3A 3F9EA 3LC5A 3KEEA 1O2GH 4BTTB 1GCTC 1W11U 5DP8A 4YT7H 3QLPH 3S9CA 1C2DA 1OWEA 1O2VA 3O8CA 2OC1A 5HM9A 6GCHG 4FUGA 1L1NA 1GJ7B 1QB1A 1UVSH 1SR5C 5L6NH 1D4PB 2ZKSA 5E0JA 1C2JA 3PMJA 1EOLA 2R2WU 2FMJA 4VGCB 1TGTA 1O3HA 3QGNB 1AHTH 1T8MA 1V2TT 5EPNA 3T29A 3ZZ6A 2HPQH 1AZZA 1HAIH 1D3TB 2SGAA 4MNXA 5BPEA 1QB6A 4BAKB 1TBZH 1U6QA 3AVZA 1N8OB 1P0SH 1AGJA 2VIQA 4FUDA 1K22H 3SUEA 3QK1A 3U69H 3VGCC 4I8GA 1BB0B 4IMQA 2ZHEH 1IQIA 1OWHA 3TK9A 2Y80A 1V2PT 2JETB 2W3KA 2FZZA 2NWNA 1BDAA 2QV1A 4O97A 3L33A 3SU1A 1SL3A 5FPSA 5GDSH 4K2YA 3T28A 2PKSB 3A8DA 1GMHF 1DFPA 1OWIA 1YCPH 2Z3CA 1TLDA 1HAOH 1D6WA 2ALVA 4WY3A 1UK3A 3PROA 3UR6A 4YOJA 2ZGJA 1A3BH 4XDEA 3VB5A 2PKAB 2AYWA 2D1JA 3URDA 1GGDB 1CGJE 2Y5GA 4UEHH 4ZXYH 3M7QA 4E7NA 4HI3A 4WMDA 1AI8H 3PWCA 4ZKNU 2ANYA 4K8YA 3RXHA 3RU4T 3UWIA 3A89A 2BDCA 5FBIA 2BVSH 2H6MA 4OS5A 3QGJA 4CRFA 4B2AA 4OS6A 1DUAA 1KY9A 4NWLA 3HKIB 4UFFH 1O3OA 1NT1A 2XWAA 1TFXA 1G3EA 2SGQE 2SGEE 1VCWA 5F8XA 3SGAE 1GI5A 1QBOA 1FZZA 3MTYA 2ASUB 1AB9C 1ELFA 1ELVA 1O3BA 1A3EH 2HWLB 5LPFA 3SU5A 5LGOA 3LKWA 3R0FA 4GHQA 3QZQA 1P57B 1MAYA 1HJ9A 2R2MB 3O8BA 4X2YA 1C9PA 3TVJB 1KXCA 1GG6C 4NGAH 3PLPA 1BRAA 1IAUA 3LJOA 3BIVH 3ZV9A 2ZF0H 5F8ZA 1C2HA 1EB1H 1IOEA 4Y71A 3ODDA 1MKWK 1GMDF 3NXPA 1P11E 2FESH 1UTNA 1QJ6B 2OXSA 3Q77A 1UTOA 4K8BA 1C1TA 5EQQA 1BBRH 3DFLA 5HMAA 1AWFH 4TYDA 1FY4A 1O2HA 1IQFA 1EAWA 1NU7B 3SHAH 2HNTC 4HZHA 1O3JA 1QHRB 4UFEH 1IQHA 3H5CB 1CHGA 3H7TA 3SU0A 4KTUA 1K1MA 2A5KA 3SHCH 2K1QA 4XFQA 1SHYA 2OBQA 1GDQA 2ZCKP 2J92A 1K1LA 1PQ7A 4I8JA 3ZZAA 1GBIA 1PYTD 2QXJA 4FUJA 1N6YA 4JYUH 4OGXA 1ZGVA 1J17T 1H9IE 3SUDA 5CMXH 1O2PA 1C1MA 1AQ7A 1OWKA 1C5NH 1YPHC 3LGTA 4VGCC 1SGDE 1DE7H 1YPKH 3DD2H 3PV4A 3T27A 5ABWA 2V6NA 1CA0C 4Y8XA 4YZUA 3GCHB 4X1SU 2THFB 2G55A 3RU4E 2OQUA 4TPYA 3SV8A 1ZTKA 1HAVA 2BLQA 1C4Y2 1XVOA 2BDAA 1Z8GA 2GV6A 1O2ZA 1UTMA 1C5XB 2B9LA 2P59A 2PSXA 1FDPA 2RA0A 2WPMS 1TNKA 2GMTC 4Q2KA 5DPAA 5JPMH 1TONA 3A83A 1XMNB 5TCAA 1Q2WA 8GCHG 1C5OH 4LK4A 1H8DH 2F9VA 2BZ6H 4DG4A 3QTOH 4NA8A 1WYKA 1GHBG 2GDEH 2STAE 2R3UA 1E35B 1SLUB 3EDXB 3KF2A 2M5TA 1LVMA 5DGJA 1TWXB 1S0RA 5IDKA 1TX7A 2OBOA 1GJBB 3T62A 1O5GH 1PPBH 4YLUA 1ZTLA 3UTUH 4OS7A 5AHGH 1SG8B 1O2RA 5EW1H 3A85A 1TALA 4UONA 3RXPA 3ZZ7A 1GI6A 1W7XH 3TJUA 2FOAA 3TK5A 1YCPK 1XM1A 4Q7XA 1N6XA 4FUBA 6CHAB 3HGPA 3RXAA 4KTSA 2BD5A 1K1PA 4CREA 2Z7FE 3SQHE 1FNIA 1GI1A 3SNDA 3HATH 1WV7H 2H2ZA 1ZTJA 2ZGXH 2VWOA 1GBJA 1C5RA 4NFEA 2B8OH 1MTSA 2ZPSA 4BTIB 1DPOA 2TGDA 4F49A 1LPGB 1SLXB 2Z94A 4MDSA 1YPLH 1OP0A 3A82A 2Z9JA 3PLKA 4D9RA 1PPEE 4NG9H 3RXGA 2QAAA 2ZHWH 3A7YA 1JWTA 3HK6B 3MHWU 3LT3A 5EODA 4NCYA 1EPTB 4X1QU 1CBWC 1GVLA 1TRNA 4BAOB 5C1UA 2OLGA 1ZYOA 1O33A 1TGNA 1SGFG 5JBCS 3IITA 3FAOA 3QDZB 3A86A 3P8NA 5AF9H 1UHBA 5E2PA 1CHOF 2ZTXA 2UUYA 3DA9B 1IQNA 3BF6H 3QO6A 3A8AA 3MH6A 4THNH 2ZHQH 3SJIA 4E7RG 4WJG2 1JIRA 5CHAB 1DXWA 5TJXA 3N7OA 6LPRA 3BSQA 1BQYA 3HKJB 1Z71A 4F4OC 3F6UH 2R3YA 1M9UA 4PROA 3RXRA 1GDUA 3K6YA 5JBTA 2VGCB 2FM2A 3A8CA 2Z3DA 1FV9A 3GYMA 2BLOA 4CRGA 4NIYA 7ESTE 3NPSA 1C2IA 1C1OA 3DT0H 4SGBE 4B73A 1C1VH 1G37A 1C1PA 3B23B 3K9XB 4BNRA 5LH8A 2STBE 1B7XB 1BBRK 2Z9KA 4Y8ZA 3ZVBA 3T2NA 1DY9A 1ZLRA 1NRSH 4INLA 2HRVA 1S84A 1HLTH 1QB9A 1CT2E 1SFQB 1EATA 2AIPA 4GUXA 2FODA 4XSKU 1IQMA 1GHZA 4DCDA 2BB4A 4GPGA 2ZFSA 1SQAA 3RXSA 1BOQA 1A7SA 2XBYA 1LPZB 1DDJA 3STIA 3UNSA 1CT4E 1FN6A 3A87A 3MNCA 3BTFE 1QY6A 1O5AB 5EQSA 4I7YH 1SGNE 1B5GH 1QL7A 1P02A 3UQVA 1VCPA 4NZQA 1PFXC 2FOEA 1S82A 5E0HA 2J9NA 5A8XA 2F3CE 5JYIA 2FI3E 3KHVA 4FXGH 2QA9E 2ODPA 3SNCA 2FI4E 1G9IE 4AX9H 3BG4C 1C1WH 2Q6DA 3PMBB 2FYRA 1DOJA 2CN0H 3UFAA 1ORFA 3LONA 4X2VA 4X1RU 1E36B 4YESB 3L6PA 1GHYH 5A0BA 1F0UA 2DUCA 2P94A 2PLXA 6GCHF 2QYIA 5L2YH 3HK3B 1ANBA 2Z9IA 3AW0A 1F92A 2FS9A 1QNJA 3GCTG 5PTPA 3ELAH 2QXHA 3S9BA 1A46H 1QRXA 3S9AA 3GDVA 2O9QA 3P8OA 2Q6GA 4AORA 2I6SA 4XBCA 1HAHH 3SZNA 1AZ8A 1GHAG 1H9HE 1VGCB 5FPTA 3ZZBA 1YLCA 3ZVCA 5G4BA 1BJUA 1FLEE 1DITH 2BQ7B 2G52A 3F9GA 3UIRA 2BY5X 4Y6DA 1GCTB 1FIWA 1SGQE 4CR9A 4H4FA 3VXEH 5J4QA 3UNQA 1FJSA 1INCA 1NESE 1QL9A 1K2I1 4GVUA 1GI7B 2I6QA 3TGIE 2BVXH 1D3QB 3SGBE 1SQOA 2P16A 4A1XA 1NRQH 1MKXK 1W10U 3UR9A 2C8WB 1ZZZA 4A92A 1ELGA 2IPHA 1TRMA 5A2MH 1QJ7B 1XUGA 3SV6A 2CMYA 1KXBA 1LTOA 3TPIZ 1UTJA 4JK6A 5JB8S 1CE5A 3GY5A 3MO6A 4NIVA 4J2YB 3MH7A 3F1SB 1AO5A 3RXCA 1P10A 3VGCB 1NC6A 1RFNA 3SU4A 3JZ1B 1HB0B 4UD9H 1WCZA 1RTLA 2JH5D 1GPZA 2VIPA 3PTNA 3KQBA 3KNXA 3CP7A 3T5FH 3A7VA 1SLVB 1TPSA 1V2VT 2G00A 1ARCA 3TLOA 2GZ8A 3LGUA 1GL0E 1DM4B 5A0AE 3A7WA 4B74A 1EXFA 3O8RA 1BTUA 2FX4A 3LU9B 4X1PU 3RXKA 2AMDA 4KTCA 3UUZA 3Q3XA 2BDIA 3RXVA 1C2LA 3NKKA 1LKAA 2A4RA 1EJNA 3ZVFA 5DP5A 4WMEA 1UTQA 2ZU2A 3BEUA 3M5MA 1O3CA 4AFUA 1G3BA 3GCOA 3VB3A 1GHWH 1BMNH 1HAXB 5EXMA 4MG3A 1BIOA 1YPEH 4AOQA 1RD3B 4NFFA 9LPRA 3SUGA 3BTQE 3RXOA 4X6PA 2H9HA 3LH3A 1UVTH 2EI8A 1WQSA 2VWLA 4WH8A 3TGKE 2ZCLP 1A5HA 1H4WA 1C2MA 1T8NA 2ZU4A 1ZPBA 2FLRH 1Y3WA 4XBBA 2SGDE 1AB9B 3PTBA 2BXTH 1PPFE 1V2JT 4U2WA 2SGFE 1GDNA 2OUAA 1E37B 2D2DA 3RXDA 3URCA 1AIXH 1UVOA 1YPJH 4ISHH 3VEQB 1T4VH 5DKMA 3SJ9A 2TGAA 3KN2A 1C5WB 2B5TB 3ZYEA 5HXFA 1ZMLA 1NFWA 2BD4A 3PM3A 3RXLA 3ZVGA 3PMAB 2PR3A 4CHAC 4BXSA 1IQEA 4ABBA 3I78A 1ELDE 1MBQA 2PUXB 1O2SA 2PW8H 3V0XA 1Y3UA 1P2IA 1TA2A 1GWAA 4IN1A 3SU6A 5DP4A 4NZLA 1B0FA 2ZG0H 1JIMA 4FVBA 1Y3XA 3EGKH 2XYAA 5HYOA 1HAGE 5H4IB 3GY6A 4CRCA 1E0FD 1FUJA 1T31A 1Y5AT 2ZECA 4B1TA 1TABE 3VXFH 1GJ9B 1ESBA 1Y8TA 4CBOA 3GDSA 1MD8A 3SGQE 3SNAA 2VVUA 2ODQA 3TH2H 1O2IA 4B2BA 4I8LA 3FFGA 2FXRA 1BRBE 5DJ7A 1MTNB 1UK2A 3SV9A 2ZCHP 3FP6E 1A0HB 1JRTA 1Z8JB 2UWPA 8GCHF 1WU1A 1CU1A 1PQ5A 1PPHE 1A2CH 1BMMH 1O2UA 4AGKA 1GHBF 4K1SA 5DP6A 1CA0B 3A8BA 3PLBA 4FUCA 2HOBA 1P12E 1RTKA 4ZHMU 3SJKA 2BZAA 2XC4A 1SC8U 1TAWA 2ANKH 1BTXA 9ESTA 2XCNA 1O32A 4OS2A 4YTAA 1ESTA 2VIVA 1DLKB 1C4V2 2BDBA 1FY3A 2GMTB 4GCHG 4X0WU 2Y81A 1QCPA 4K1TA 1ZHPA 1G30B 3EYDA 4O3TA 2Y5FA 4JZFH 1PPCE 1O39A 1SBWA 1XUKA 2LNCA 4I32A 4LZ4B 5K0HA 3B8JA 1P2QA 2QN5T 1Z6JH 3RM0H 1NFXA 1EZQA 5E0GA 2FTMA 4XE4A 1AN1E 2ZC9H 2G81E 3KQEA 4LZ1H 1QFKH 1GMCG 3OY5U 1XKAC 2A5IA 2ANWA 1LHGH 4ABGA 4DURA 1L0ZA 8LPRA 1BITA 4H6TA 2BY6X 1ELTA 4K1EA 1V2ST 2J2UA 1ABIH 3CS7A 3E1XB 4K60A 3SUFA 1QJ1B 1TNJA 2AFQB 4JZ1A 2OC8A 2FIRH 3UWJH 3ZV8A 1P06A 1SGTA 1NTPA 3QUMP 3LGVA 1QIXB 4TY6A 1LMWB 3R3GB 2GZ9A 2F9PA 1EAXA 1O35A 1OXGA 4FUHA 1P01A 3V7TA 3MO3A 1SQTA 4DY7B 1MTUA 3EA8A 2QXGA 1G36A 2HLCA 1MUEB 2G4TA 4Y7AA 1EP6A 1KSNA 5EOKA 3P92A 2RDLA 5C67A 1TMUH 1C4U2 3OX7U 1L4DA 3RXTA 3V13A 2QGRA 5LPRA 1MD7A 1Z6EA 2A4QA 4AFSA 1A0LA 4BANB 3HGNA 3M3VA 1CBWB 4GHTA 3RXMA 1KXDA 1S6HA 2NU3E 3M61U 2OQ5A 4LOYH 2IJOB 1OKXA 2XBVA 2HGTH 1YYY1 2UWLA 3AASA 1HYLA 3F9HA 2FS8A 1OS8A 1O2OA 4FU8A 1SI5H 1YP9A 1GI4A 1AVXA 3AAVA 1GHVH 2BVRH 1ETRH 1KLJH 2A7HA 2FOBA 3ZZDA 1T8LA 5T6FA 2VVVA 1LVBA 1ELBA 2PTNA 1Q3XA 4DJZB 1BTPA 1TMTH 3V3MA 2GCTC 1GBBA 3FZZA 4D76A 1LHEH 2Z9LA 4MPWA 2FOCA 4MNWA 2ZFTA 4HFPB 1AVWA 2H9TH 1MTNC 3TU7H 4ABHA 4LXBH 2ZU1A 4MPVA 1VJAU 2ZFRH 1PJPA 2TBSA 1XUIA 1O2WA 1DUEA 1MZDA 5FX6A 1TIOA 1EZUC 1SGCA 1Y59T 4H42U 1ID5H 2A32A 5EPYA 1ZMNA 1EPTA 2V0BA 1A1RA 2OINA 5K7RA 2FP7B 1S0QA 2BTCE 1SGFA 1E34B 2ZZUH 1XUFA 1DSUA 1G2LA 1TPAE 4UDWH
chains in the Genus database with same CATH superfamily
2G4UA 4CH8B 1J15A 5ETXA 3S7HB 1DSTA 1YM0A 2NU0E 3W95A 4M7GA 2A4OA 1WBGB 1LQDB 1SB1H 4B71A 5FBEA 5C94A 2VINA 1BMAA 3N7DA 4X6MA 3UPEA 1NZQH 1D3PB 4MTBA 3TNTA 4DW2U 2O8MA 4IGDA 1UK4A 2XNIA 4XOJA 4OS4A 1MTWA 5F03A 1NRNH 3BG4B 4ISIH 3A81A 3U8TH 1ESAA 4KKDA 1CGIE 3PV2A 4ISLA 1BCUH 2G5VA 4Z6AH 3U8OH 1XXFA 3LJJA 5CE1A 2C8YB 3BTWE 3LH1A 1OPHB 3RXQA 3DSGA 1BHXB 1P2OA 4TWYA 1WSSH 1ETSH 3P70B 3PB1E 1C2EA 1WQVH 2EA3A 1NFYA 3QWCH 4FU9A 2ZPRA 1EASA 5FAHA 1LQEA 2AGGX 2VJ1A 3V12A 1A61H 1O2MA 1GJ6A 4ESTE 4Q7YA 1PYTC 3PRDA 4SGAE 1QQ4A 4ZXXH 3FOAA 2J4IA 4WH6A 2AGEX 1DANH 2PGQB 3E91A 1ZSKA 1DWBH 1TA6A 1W14U 1DWDH 3GISB 1SSXA 1W0ZU 1C2FA 2BY9X 1CVWH 2WV5A 3P8GA 3E90B 5T6DA 1HDTH 5C1XA 4INHA 4AGJA 2ODYB 2VB0A 7GCHG 1VCQA 2W3IA 1HIAA 1LHCH 2FPZA 2ZDNA 4IN2A 4JCNA 5IK2D 1OX1A 4I8HA 2CV3A 2YNAA 3BTME 1YWUA 4MPUA 1W0YH 4M9FA 2M2AA 2J94A 2ZHDA 3SQEE 1O5CB 1MH0A 3BTEE 3MU0A 2SNWA 1QQUA 1QRWA 3LOXA 5A0CA 2W5EA 5C17A 1FY1A 1ZSLA 2QY0B 2AHME 2ZP0H 1IQJA 5C2ZA 5L2ZH 3D23A 2WUCA 2A45B 3M5LA 3E6PH 2QF0A 1T4UH 3OE7D 4GLYA 5EJZA 4A1VA 4FUEA 1HGTH 1GBEA 1GBMA 1K1JA 4FETA 4WVPE 2OCVB 4Y7BA 2GGVB 5FPYA 3EA7A 3Q3YA 1AY6H 1DS2E 1K9OE 1AKSB 4ABAA 1O2JA 4Y0YE 1C5ZB 4QT8C 3K6ZA 2OC7A 2VIDA 1OOKB 5T3HA 5EIYA 2VU8E 4Q7ZA 1KXAA 1KLIH 3FANA 2JDID 3OU0A 5B6OA 2KM0A 4ZH8A 1V2OT 1Z1JA 1LKBA 1K1OA 3GY8A 3F68H 1QBVH 2O8LA 1KXEA 1TGSZ 4Y76A 5SGAE 2Z9GA 3A80A 3ENSB 1SLWB 1C5YB 4ISOA 1WAYB 3PMHB 1O0DH 1FQ3A 2C8ZB 1H8IH 1S85A 4FUFA 4ZHLU 4B75A 5IYTA 1ABJH 2BD2A 3OSYA 3RC5A 2WPJS 3SNBA 1THSH 3I77A 3RLYH 4IC5A 1Y5BT 1ACBE 2CGAA 2BD8A 2HNTF 3LGIA 4K3JA 2UWOA 1MZAA 1NM6A 1SFIA 2VBCA 3K65B 4X2WA 1DICA 4A5TS 2RFKC 2H9EH 1SGYE 1BRCE 4AFQA 1AVGH 4CHAB 1NY22 1GJCB 3LGYA 2H1UA 1TNHA 3EE0B 1TBRH 1MQ6A 3M35A 1GJDB 2G8TA 3RC4A 1L2EA 3C1KA 1O38A 3GS9A 3FO8D 2H5DA 2P3UB 2P93A 3M5OA 5A8YA 2VH6A 1IQLA 2TGTA 1RGQA 1O34A 3SO3A 2AS9A 1UHBB 4YLQH 1VITH 1G2MA 1FAKH 4B76A 1GBFA 1H8ED 1O5BB 1SOZA 3ZVDA 2BMGB 5T1VA 3Q3KA 2Z3EA 1C5UA 1KMHB 1TBQH 2R9PA 1S81A 1UVPA 2R0LA 2KAIB 4GCHF 6ESTA 1V2WT 3U1IB 1SQRA 4IMZA 2J38A 2UUKB 2FDAA 2QF3A 3E0PB 3RMLH 2IN2A 2AGIX 5EG4A 5C3NA 2A2XH 2GT7A 3MI4A 2WV9A 3GYLB 1O3DA 1MU6B 3WY8A 3UREA 2GV7A 1OYTH 1NRRH 3LGWA 3KQDA 4JMYA 3P8FA 1PPGE 1N1LA 3A88A 1BRUP 3M37A 3RXJA 3OTJE 3TITA 1JMOH 4ABJA 2GTBA 2V3OH 1TNGA 2BY7X 5JB9S 5F6MA 3NRLA 5FCKA 2FLBH 1MBMA 2NU4E 1KTTB 1O3LA 4I31A 4CBNA 1P03A 3QTVH 4X6NA 1NFUA 2F9NA 2P8OC 2H5CA 1FMGA 1C5LH 1NRPH 3MU1A 3A84A 3SI3H 2A4GA 1FY5A 3M3SA 1T8OA 2BQ6B 1D3DB 3RP2A 2P3FH 1P2JA 1C9TA 5A09A 1HCGA 2HPPH 1SPJA 5AVDA 3UNRA 1CT0E 1NU9A 2FOMB 1GJ5H 2GDDA 1GBCA 1K28D 5LPEA 1G3DA 4NWKA 4WMFA 3BTGE 1C5QA 1AD8H 4CRDA 1P09A 1TRYA 2WYGA 1GI8B 2HVXA 1HBTH 3PWBA 2FEQH 4IBLH 1J8AA 3JZ2B 1RIWC 4RT1A 1FPCH 1HJAC 5ESTE 1Z8IB 4BOHA 1W2KH 3ATWA 5T6GA 4A6LA 4YOIA 1GJAB 2JH0D 2EC9H 3NZIA 2ILNA 2CHAC 4U01A 1WUNH 2A7JA 3MO9A 2OP9A 2BX4A 4B6EA 2ZI2H 3FN8A 4O3UA 2ZGCA 4Z0KA 1GBLA 2TIOA 4D9QA 1UCYH 4DVAU 2YNBA 1ANEA 2F9UA 5GPIB 1UJ1A 4MPXA 1NROH 1BT7A 1HV7A 2PKAA 2VIOA 5TCCA 1H1BA 1O3KA 2CXVA 1EJAA 2ZU3A 1GBAA 1UTLM 1S5SA 2BOHB 2ZIQH 2ZQ1A 3E0NB 5FHTA 3UB0A 3SORA 1WOFA 5KECA 2XBXA 4AFZA 2F9OA 1SGRE 1TQ7B 3SW2B 4ZMAH 2ZDKA 1FI8A 3E3TA 4Y8YA 3TK6A 1O2NA 2F83A 4YXWD 1ZSJA 4Y10E 2Y5HA 3PO1B 3STJA 3ATMA 4Y79A 1CA8B 2F4LA 2WUBA 1Z8RA 3WWFA 2UUFB 3EQ0H 2SGPE 2TPIZ 1L1JA 2BYAX 2FOGA 3RXFA 1W13U 4Y11E 1TNIA 2BM2A 4CH2B 1BTZA 1IHSH 2GCTB 1EP5A 3FVFB 2BLWA 5HM2A 2XTTB 3BEFB 1EUFA 1BMFD 1K21H 1KDQB 1EZXC 2FOHA 2ZDMA 3M7UA 4K5ZA 3BTDE 1VITG 3RLWH 1GI2A 3MWIU 4NIWA 5EXLA 1ELEE 1EFRD 1F0SA 4HG6A 1HUTH 1FONA 1P8VC 1UO6A 2DE9A 2A1DB 5CHBA 3ZZ9A 1C2GA 2YMSD 1S83A 3A7XA 3CNRA 1C5MD 2KZ4A 3MU4A 4IC6A 1LVOA 3KQCA 1UW7A 1XKBC 2BHGA 4R0IA 2RA3A 1THPB 4AB9A 5L30H 1QURH 5F53A 3F3BA 4NSYA 2A2QH 2O8TA 2P3TB 2GP9B 3BV9B 2PUQH 1C1UH 1YC0A 2FOFA 1ZGIA 1DXPA 3LIWA 1VJ9U 5CDFE 1L1GA 4HTCH 3ZZ3A 4BAQB 1C5VA 1BHXF 1FIZA 1GVKB 2VIWA 5GWZA 3RMOH 1QA7A 1EX3A 1YPGH 1F5LA 5ESBA 3SU2A 1YCPM 1UTPA 1EJMA 1O5DH 3RXBA 3F2FA 5I25A 4MNVA 2A0QB 3I29A 1HPGA 1Y3YA 3C27B 1XVMA 2R0KA 1AU8A 1O3IA 1PPZA 4IS5A 4X8SH 4TPIZ 2DE8A 1QBNA 1XUJA 2CK3D 4NSVA 1HXFH 2OC0A 2BDYA 1VR1H 2D26C 5GXPA 1THRH 2KX4A 7GCHF 1P2KA 1BBRE 4MLFB 2WPHS 3B9FH 2QIQA 3UQOA 1OSSA 2XBWA 3BEIB 1V3XA 3FP7E 1D9IA 3GY2A 1MAXA 1C1NA 1LDTT 2WPIS 3FZDA 1ZHMA 3F0OA 4Q4LA 2B0FA 1O2XA 2GKVE 5B6LA 3VFEA 1FXYA 2GX4A 1V2UT 4MQAA 5F8TA 8ESTE 3BG8A 4BAHB 4YT6H 1P9SA 4JK5A 4ABIA 5C5NA 1AFQC 2PV9B 1O30A 4X1NU 3ZZ8A 3ZZ4A 2WSSD 2ZFQH 3ZYDA 1PQAA 1O5FH 4CR5A 2YOLA 1A5IA 1V2NT 2F91A 1XX9A 3FP8E 3MU8A 1K1NA 1O37A 2V7QD 1Z1IA 3UOUA 1OP8A 1C1SA 5FCRA 3TH4H 3DSOA 5E2OA 4E06H 3PO1C 3LDXH 3TJOA 1TX8A 1MCTA 1UVUH 3SNEA 1SGPE 1UCYK 2VVCA 1Y3VA 4Y0ZE 4O03A 2BXUH 3U8RH 3RM2H 1V2RT 1UTKA 2JH6D 4AG1A 1RXPA 2WV4A 2AMQA 2Z6BD 1HAZB 3QN7A 4X8VH 1CO7E 5DP7A 2Y7ZA 2C8XB 3SZEA 3ZZ5A 3MNXA 1O3MA 3M7TA 2FI5E 1FN8A 1Y5UT 1ANCA 1TOCB 1EOJA 1TNLA 2FYQA 4U30A 3TGJE 1TB6H 2EEKA 5EXNA 2ALPA 1WTHD 1ZJDA 4I8KA 4WXIA 1ZRBA 3TNSA 1GBHA 1C1RA 2NU2E 2W26A 1BMLA 2IPQX 5HGGA 3HPTB 3SJ8A 2XRCA 1NS3A 3VPKA 4AG2A 1SGIB 4XBDA 3CS0A 3RDZA 2GCHG 2VNTA 5JBBS 2J34A 1KIGH 5A8ZA 4AZ2B 1P05A 2ZDAH 1E38B 5GCHG 3UY9A 2WPLS 1ETTH 1QGFA 2CJIA 1FY8E 1ARBA 1MCVA 3E16B 1N8OC 1V2KT 3O8DA 1NPMA 3TJVA 1L4ZA 1O3FA 1PQ8A 2ZDVH 3GCTF 2V35A 4X2XA 1YPMH 3SOSA 1KLTA 2UUJB 4NIXA 1TQ0B 2JETC 1WDIA 4WF8A 2HALA 2XCFA 1GHAF 1AKSA 4TT3D 2PHBA 4WXVA 2CF9H 2PKSC 3ZVAA 4ZKOU 2G5NA 3GICB 3TJNA 4D7GA 5FL7D 2J5UA 2Y6TA 4ZKSU 1LVYA 1HFDA 2P95A 1RTFB 1ZPZA 4RSPA 4E05H 1GGDC 1P3EA 4X6OA 2Y82A 2ZHFH 4DOQA 3MYWA 3BN9A 4OS1A 4ASUD 3F9FA 2BX3A 1GI3A 4FOUC 1Q31A 1B0EA 1WTGH 2KCYA 2XWBI 4D8NA 1GMHG 5JDUB 1F0TA 2J98A 2JKHA 1O3AA 1MKXH 3RC6A 4NA7A 2V3HH 1TPPA 1HAYB 1NN6A 3S0NA 4UFGH 5JBAS 2QF5A 1O5EH 5DG6A 4A7IB 2ZQ2A 1JOUB 3T25A 1DX5M 5EU8A 2RG3A 4FUIA 1EZSC 8KME2 3MH5A 4GSOA 5C20A 3DFJA 3CENA 4ZAEA 1QRZA 3SV2H 1YLDA 3P6ZB 1VZQH 4INKA 2EI7A 2ZFFH 3OYPA 4D7FA 3KCGH 1O2YA 2C93B 3E8LA 4JZEH 1W3CA 1NO9H 1CQQA 2ULLA 4UFDH 4ZROA 1BZXE 1GCDA 3P95A 1SKYE 4DT7B 5HKKD 2PSYA 3LC3A 2P8OB 2BOKA 2ZFPH 3GY7A 3SN8A 1EAUA 1S6LA 1P2NA 3SJOA 3MFJA 1HAVB 1MQ5A 3GY3A 2FO9A 3NWUA 4OGYA 2A7CA 1GL1A 4JZDH 1J16A 1GBDA 1TGBA 1AUTC 3RXEA 2AEIH 3N7EA 1OHHD 1GHXH 4ISNA 3M36A 4Q80A 2GZ7A 4JYTA 7LPRA 1GJ4H 5BRRE 2O8UA 3BIUH 2KAIA 3D65E 2RCEA 4RN6A 3KL6A 3OY6U 3K2UA 1GMDG 3P17H 3AW1A 4H6SB 1DWCH 4ZKRU 2CF8H 5EJ1A 2ZGHA 1S6FA 2FWWA 1QA0A 2HNTE 2K0QA 2HVYB 1RIWB 1BJVA 3L3TA 3NCLA 3QX5H 4RKOB 4MNYA 1YF4A 1HJAB 2ZEBA 4HGCA 3GCNA 2B7DH 1HRTH 3A7ZA 5DN6D 3KIDU 1AMHA 2EI6A 3Q00A 2ZDLA 5E8EH 3MNSA 2C4FH 3GCHC 1BUIA 3S69A 1FPHH 3T26A 2CHAB 4CRAA 2ZTYA 1HAPH 3FKSD 3A7TA 1OWDA 1SMFE 1P3CA 2PTCE 2ANMH 1YPHE 3EE7A 5KEDA 2PGBB 7KMEH 2BLVA 1BTYA 4YO9A 1O2LA 4FVDA 3IG6B 3UOPA 1D6RA 1O36A 2SNVA 5EW2H 1V6DA 3G01A 1ELCA 1ZOMA 4ZUHA 3AAUA 1RS0A 3SV7A 1ZR0A 1Z7KA 2C3SA 1LCYA 2AH4X 2OTVA 2AERH 3MMGA 3ATIA 1RJXB 1BA8B 2BD9A 2FTLE 1COWD 1O3EA 2BDHA 1GI0A 3BTKE 4RKJB 4BXWA 4JYVH 1HIAB 1T7CA 2XC5A 3ATLA 3GOVB 5FX5A 1VITF 1HJ8A 2AMPA 1MU8B 3MOCA 2GD4B 1CSOE 2Y7XA 2IOTA 2VWMA 5GIBA 4AYVB 3D49H 4JZIA 1P04A 4AB8A 1O2QA 2O8WA 1ZHRA 5EQRA 1W8BH 1MTVA 4X8UH 5GJ4B 3LPRA 1A4WH 5C1YA 1H9LB 1O3NA 2KCPA 6CHAC 1DY8A 1W7GH 1F5RA 1TE0A 2GVFA 1A0JA 1QR3E 4J1YA 4ABEA 1O2TA 5DP9A 2W7UA 3VB7A 3RXUA 2GT8A 1AE8H 1T32A 1V2LT 2BD3A 3D62A 2A5AA 4WWYA 5I46H 4ABFA 1YBWA 4A1TA 4KGAA 1JBUH 3SI4H 1QL8A 4TY7A 2W7SA 3ITIA 1YKTA 1TPOA 2OD3B 1A5GH 4IW4E 2SFAA 1GBKA 1CGHA 3ZVEA 2WINI 5DO4H 2J95A 1P2MA 1GJ8B 1GMCF 2QC2A 1W0JD 1F0RA 2BDGA 1IQGA 4BTUB 4ASHA 2XXLA 1EPTC 1O3PB 4KP0A 3ODFA 4UE7H 3NUMA 2Q6FA 1QZ8A 1V2MT 1BTWA 4F48B 2WPKS 1AUJA 1V2QT 2ZGBH 1EQ9A 2AIQA 1IQKA 3MNBA 3RXIA 1C5SA 2ZO3H 5DK1A 5CHAC 1KYNA 2QCYA 3PYHA 3KQ5A 4FU7A 1GI9B 1LPKB 2FX6A 5AFYH 3U98H 1SGEE 1UCYE 2ZNKH 1ELAA 1KDQA 1UMAH 1SVPA 2VGCC 3OEHD 5C5OA 3ESTA 1HNEE 3EAJA 4RT0A 3BTHE 4TSFD 3GY4A 3KGPA 4DGJA 1DVAH 4MVNA 5FXLA 4B2CA 3U1JB 1GBTA 1JRSA 1EKBB 1QTFA 1P9UA 3SBKA 1G3CA 3GDUA 1AFEH 1CHOG 1MMJN 4KELA 1FAXA 3W94A 1J9CH 2XC0A 3TIUA 4DIIH 1AE5A 1JXPA 2WHXA 1LHDH 1LHFH 2ZWLH 3RU4D 3BTTE 1ZRKA 3ZZCA 1C5TA 3IWMA 2Q1JA 1TX6A 1H8HD 2ZPQA 1F7ZA 1SOTA 4CRBA 2C90B 1OP2A 4R8TB 2G51A 4GAWA 1C2KA 1IHTH 2A31A 2VWNA 3DUXH 2ZA5A 3QZRA 1KXFA 2TRMA 3M5NA 2PWXA 1DWEH 1MKWH 3DHKH 1ANDA 1AFQB 1TGCA 4NA9H 3VB4A 2ESTE 1EB2A 1O2KA 1ZPCA 3SU3A 1DLEA 4K69A 4YOGA 3EA9A 1XUHA 3RMMH 3VB6A 1TMBH 4I33A 1E1QD 4O9VA 1G32B 2BY8X 2D8WA 3U9AH 3M3TA 4U32A 1AWHB 2EY4C 4ZHAA 5EGMA 1BTHH 3TH3H 1GG6B 1O3GA 1TYNA 1EAIA 3H7OA 1ZJKA 1F2SE 4AN7A 1RRKA 2VH0A 2XW9A 4X8TH 2ZTZA 1X7AC 1SHHB 4AC9A 4BAMB 3MU5A 2QXIA 3NK8A 1ZMJA 1OWJA 2BQWB 1C1QA 1W12U 1LO6A 3ATKA 1OYQA 4ABDA 3RUOA 1YGCH 1HXEH 2TGPZ 1C5PA 3F0PA 3RMNH 2LPRA 4AYYB 1XXDA 1F5KU 2F9BH 4TWWA 1K1IA 2GCHF 5AFZH 1TOMH 5J4SA 2JIZD 1DT2A 2NU1E 2ZU5A 3Q76A 3S7KB 4YM9A 1KTSB 2PFEA 1O31A 4DIHH 5GCHF 2WYJA 2BD7A 1J14A 3MH4A 3KYGA 1VGCC 1GVZA 5DP3A 3F9EA 3LC5A 3KEEA 1O2GH 4BTTB 1GCTC 1W11U 5DP8A 4YT7H 3QLPH 2F43B 3S9CA 1C2DA 1OWEA 1O2VA 3O8CA 2OC1A 5HM9A 6GCHG 4FUGA 1L1NA 1GJ7B 1QB1A 1UVSH 1SR5C 5L6NH 3MQKC 1D4PB 2IJD1 2ZKSA 5E0JA 1C2JA 3PMJA 1EOLA 2R2WU 2FMJA 4VGCB 1TGTA 1O3HA 3QGNB 1AHTH 1T8MA 1V2TT 5EPNA 3T29A 3ZZ6A 2HPQH 1AZZA 1HAIH 1D3TB 2SGAA 4MNXA 5BPEA 1QB6A 4BAKB 1TBZH 1U6QA 3AVZA 1N8OB 1P0SH 1AGJA 2VIQA 4FUDA 1K22H 3SUEA 3QK1A 3U69H 3VGCC 4I8GA 1BB0B 4IMQA 2ZHEH 1IQIA 1OWHA 3TK9A 2Y80A 1V2PT 2JETB 3F2HA 3H09A 2W3KA 2FZZA 2NWNA 1BDAA 2QV1A 4O97A 3L33A 3SU1A 1NBMD 1SL3A 5FPSA 5GDSH 4K2YA 3T28A 2PKSB 3A8DA 1GMHF 1DFPA 1OWIA 1YCPH 2Z3CA 1TLDA 1HAOH 1D6WA 2ALVA 4WY3A 1UK3A 3PROA 3UR6A 4YOJA 2ZGJA 1A3BH 4XDEA 3VB5A 2PKAB 2AYWA 2D1JA 3URDA 1GGDB 1CGJE 2Y5GA 4UEHH 4ZXYH 3M7QA 4E7NA 4HI3A 4WMDA 1AI8H 3PWCA 4ZKNU 2ANYA 4K8YA 3RXHA 3RU4T 3UWIA 3A89A 2BDCA 5FBIA 5C0UA 2BVSH 2H6MA 4OS5A 3QGJA 4CRFA 4B2AA 4OS6A 1DUAA 1KY9A 4NWLA 3HKIB 4UFFH 1O3OA 1NT1A 2J97A 2XWAA 1TFXA 1G3EA 2SGQE 2SGEE 1VCWA 5F8XA 3SGAE 1GI5A 1QBOA 1YY3A 1FZZA 3MTYA 2ASUB 1AB9C 1ELFA 1ELVA 1O3BA 1A3EH 2HWLB 2RDEA 5LPFA 2YMSC 3SU5A 5LGOA 3LKWA 3R0FA 2XNDD 4GHQA 3QZQA 1P57B 1MAYA 1HJ9A 2R2MB 3O8BA 4X2YA 1C9PA 3TVJB 1KXCA 1GG6C 4NGAH 3PLPA 1BRAA 1IAUA 3LJOA 3BIVH 3ZV9A 2ZF0H 5F8ZA 1C2HA 1EB1H 1IOEA 4Y71A 3ODDA 1MKWK 1GMDF 3NXPA 1P11E 2FESH 2XOKD 1UTNA 1QJ6B 2OXSA 3Q77A 1UTOA 4K8BA 1C1TA 5EQQA 1BBRH 3DFLA 5HMAA 1AWFH 4TYDA 1FY4A 1O2HA 1IQFA 1EAWA 1NU7B 3SHAH 2HNTC 4HZHA 1O3JA 1QHRB 4UFEH 1IQHA 3H5CB 1CHGA 2KCAA 3H7TA 3SU0A 4KTUA 1K1MA 2A5KA 3SHCH 2K1QA 4XFQA 1SHYA 2OBQA 2L74A 1GDQA 2ZCKP 2J92A 1K1LA 1PQ7A 4I8JA 3ZZAA 1GBIA 1PYTD 2QXJA 4FUJA 1N6YA 4JYUH 4OGXA 1ZGVA 1J17T 1H9IE 3SUDA 5CMXH 1O2PA 3WW7A 1C1MA 1AQ7A 1OWKA 1C5NH 1YPHC 3AK5A 1E1RD 3LGTA 4VGCC 1SGDE 1DE7H 1YPKH 3DD2H 3PV4A 3T27A 5ABWA 2V6NA 1CA0C 4Y8XA 4YZUA 3GCHB 4X1SU 2THFB 2G55A 3RU4E 2OQUA 4TPYA 3SV8A 1ZTKA 1HAVA 2BLQA 1C4Y2 1XVOA 2BDAA 1Z8GA 2GV6A 1O2ZA 1UTMA 1C5XB 2B9LA 2P59A 2PSXA 4XD7D 1FDPA 2RA0A 2WPMS 1TNKA 2GMTC 4Q2KA 5DPAA 5JPMH 1TONA 3A83A 1XMNB 5TCAA 1Q2WA 8GCHG 1C5OH 4LK4A 1H8DH 2F9VA 2BZ6H 4DG4A 3QTOH 4NA8A 1WYKA 1GHBG 2GDEH 2STAE 2R3UA 1E35B 1SLUB 3EDXB 3KF2A 2M5TA 1LVMA 5DGJA 1TWXB 1S0RA 2KCOA 5IDKA 1TX7A 2OBOA 1GJBB 3T62A 1O5GH 1PPBH 4YLUA 1ZTLA 3UTUH 4Z1MD 4OS7A 5AHGH 1SG8B 1O2RA 5EW1H 3A85A 1TALA 4UONA 4B6FA 3RXPA 3ZZ7A 1GI6A 1W7XH 3TJUA 2FOAA 3TK5A 1YCPK 1XM1A 2HLDD 4Q7XA 1N6XA 4FUBA 6CHAB 3HGPA 3RXAA 4KTSA 2BD5A 1K1PA 4CREA 2Z7FE 3SQHE 1FNIA 1GI1A 3OTPA 3SNDA 3HATH 1WV7H 2H2ZA 1ZTJA 2LP6A 2ZGXH 2VWOA 1GBJA 1C5RA 4NFEA 2B8OH 1MTSA 2ZPSA 4BTIB 1DPOA 2TGDA 4F49A 1LPGB 1SLXB 2Z94A 4MDSA 1YPLH 1OP0A 3A82A 2Z9JA 3PLKA 4D9RA 1PPEE 3KYFA 4NG9H 3RXGA 2QAAA 2ZHWH 3A7YA 1JWTA 3HK6B 3MHWU 3LT3A 5EODA 4NCYA 1EPTB 4X1QU 1CBWC 3WWBA 1GVLA 1TRNA 4BAOB 5C1UA 2OLGA 1ZYOA 1O33A 1TGNA 1SGFG 5JBCS 3IITA 3FAOA 3QDZB 3A86A 3P8NA 5AF9H 1UHBA 5E2PA 1CHOF 2ZTXA 2UUYA 3DA9B 1IQNA 3BF6H 3QO6A 3A8AA 3MH6A 4THNH 2ZHQH 3SJIA 4E7RG 4WJG2 1JIRA 5CHAB 1DXWA 5TJXA 3N7OA 6LPRA 2V3MA 4P00A 3BSQA 1BQYA 3HKJB 5EJLA 1Z71A 4F4OC 4ZCNA 3F6UH 2R3YA 1M9UA 4PROA 3RXRA 1GDUA 3K6YA 5JBTA 2VGCB 2FM2A 3A8CA 3OFND 2Z3DA 1FV9A 3GYMA 2BLOA 4CRGA 4NIYA 1NBME 7ESTE 3NPSA 1C2IA 1C1OA 3DT0H 4SGBE 4B73A 1C1VH 1G37A 1C1PA 3B23B 3K9XB 4BNRA 5LH8A 2STBE 1B7XB 1BBRK 2Z9KA 4Y8ZA 3ZVBA 3T2NA 1DY9A 1ZLRA 1NRSH 4INLA 2HRVA 1S84A 1HLTH 1QB9A 1CT2E 4P02A 3DSPA 1SFQB 1EATA 2AIPA 2W6ID 2FODA 4GUXA 4XSKU 1IQMA 1GHZA 4DCDA 2BB4A 4GPGA 2ZFSA 1SQAA 3RXSA 1BOQA 1A7SA 2XBYA 1LPZB 1DDJA 3STIA 3UNSA 1CT4E 1FN6A 3A87A 3MNCA 3BTFE 1QY6A 1O5AB 5EQSA 4I7YH 1SGNE 1B5GH 1QL7A 1P02A 3UQVA 2J98B 1VCPA 4NZQA 1PFXC 3W1EA 3PRBA 2FOEA 1S82A 5E0HA 2J9NA 5A8XA 2F3CE 5JYIA 2FI3E 3KHVA 5KGOA 4FXGH 2QA9E 2ODPA 3SNCA 2FI4E 1G9IE 4AX9H 3BG4C 1C1WH 2Q6DA 3PMBB 2K8IA 2FYRA 1DOJA 2CN0H 3UFAA 1ORFA 3LONA 4X2VA 4X1RU 1E36B 4YESB 3L6PA 1GHYH 5A0BA 1F0UA 2DUCA 2P94A 2PLXA 6GCHF 2QYIA 5L2YH 3HK3B 1ANBA 2Z9IA 3AW0A 1F92A 2FS9A 1QNJA 3GCTG 3OAAD 5PTPA 3ELAH 2QXHA 3S9BA 1A46H 1QRXA 3S9AA 3GDVA 2O9QA 3P8OA 2Q6GA 4AORA 2I6SA 4XBCA 1HAHH 3SZNA 1AZ8A 1GHAG 1H9HE 1VGCB 5FPTA 3ZZBA 1E79D 1YLCA 5G4BA 3ZVCA 1BJUA 1FLEE 1DITH 2BQ7B 2G52A 3F9GA 3UIRA 2BY5X 4Y6DA 1GCTB 1FIWA 1SGQE 4CR9A 4H4FA 3VXEH 5J4QA 3UNQA 1FJSA 1INCA 1NESE 1QL9A 1K2I1 4GVUA 1GI7B 2I6QA 5DSFA 3VG8A 2BVXH 3TGIE 1D3QB 4DT4A 3SGBE 1SQOA 2P16A 4A1XA 1NRQH 1MKXK 2KR7A 3ZIAD 1W10U 3UR9A 2C8WB 1ZZZA 4A92A 1ELGA 2IPHA 1TRMA 2LELA 5A2MH 1QJ7B 1XUGA 3SV6A 2JJ1D 2CMYA 1KXBA 1LTOA 3TPIZ 1UTJA 4JK6A 5JB8S 1CE5A 3GY5A 3MO6A 4NIVA 4J2YB 3MH7A 3F1SB 1AO5A 3RXCA 1P10A 3VGCB 1NC6A 1RFNA 3SU4A 3JZ1B 1HB0B 4UD9H 1WCZA 1RTLA 2JH5D 1GPZA 2VIPA 3PTNA 3KQBA 3KNXA 3CP7A 3T5FH 2WPDD 3A7VA 1SLVB 2WZQA 1TPSA 1V2VT 2G00A 1ARCA 3TLOA 2GZ8A 3LGUA 1GL0E 1DM4B 5A0AE 3A7WA 4B74A 1EXFA 3O8RA 1BTUA 2FX4A 3LU9B 4X1PU 3RXKA 2AMDA 4KTCA 3UUZA 3Q3XA 2BDIA 3RXVA 1C2LA 3NKKA 1LKAA 2A4RA 1EJNA 3ZVFA 5DP5A 4WMEA 5C0TA 1UTQA 2ZU2A 3BEUA 3M5MA 5HIZA 1O3CA 4AFUA 1G3BA 3GCOA 2W6JD 3VB3A 1GHWH 1BMNH 1HAXB 5EXMA 4MG3A 1BIOA 1YPEH 4AOQA 1RD3B 4NFFA 9LPRA 3SUGA 3BTQE 3RXOA 4X6PA 3F2GA 2H9HA 3LH3A 1UVTH 2EI8A 2PP6A 1WQSA 3U28C 2VWLA 4WH8A 3TGKE 2ZCLP 1A5HA 1H4WA 1C2MA 1T8NA 2ZU4A 1ZPBA 2FLRH 1Y3WA 4XBBA 2SGDE 1AB9B 3PTBA 2L6OA 2BXTH 2YMSB 1PPFE 1V2JT 4U2WA 2SGFE 1GDNA 2OUAA 1E37B 2D2DA 4XRNA 3RXDA 3URCA 1AIXH 1UVOA 1YPJH 4ISHH 3VEQB 1T4VH 5DKMA 3SJ9A 2TGAA 1W0KD 3KN2A 1C5WB 2B5TB 3ZYEA 5HIYA 5HXFA 1ZMLA 1NFWA 2BD4A 3PM3A 3RXLA 3ZVGA 3PMAB 2PR3A 4CHAC 4BXSA 1IQEA 4ABBA 3I78A 1ELDE 1MBQA 2PUXB 1O2SA 2PW8H 3V0XA 1Y3UA 1P2IA 1TA2A 3DCLA 1GWAA 4ACBA 4IN1A 3SU6A 2KFWA 5DP4A 4NZLA 1B0FA 2ZG0H 1JIMA 4FVBA 1Y3XA 3EGKH 3OEED 2XYAA 5HYOA 1HAGE 5H4IB 3GY6A 4CRCA 1E0FD 1FUJA 4OM9A 1T31A 1Y5AT 2ZECA 4B1TA 1TABE 3VXFH 1GJ9B 1ESBA 1Y8TA 4CBOA 3GDSA 1MD8A 3SGQE 4ACAA 3SNAA 2VVUA 2ODQA 3TH2H 1O2IA 4B2BA 4I8LA 3FFGA 2FXRA 1BRBE 5DJ7A 1MTNB 1UK2A 3SV9A 3SYJA 2QE7D 2ZCHP 3FP6E 1A0HB 1JRTA 1Z8JB 2OK5A 1VKYA 2UWPA 8GCHF 1WU1A 1CU1A 1PQ5A 1PPHE 1A2CH 1BMMH 4RI0A 1O2UA 4AGKA 1GHBF 4K1SA 5DP6A 1CA0B 3A8BA 3PLBA 4FUCA 2HOBA 1P12E 1RTKA 4ZHMU 3SJKA 2BZAA 2XC4A 1SC8U 1TAWA 2ANKH 1BTXA 9ESTA 2XCNA 1O32A 4OS2A 1K0HA 4YTAA 1ESTA 2VIVA 1DLKB 1C4V2 2BDBA 1FY3A 2GMTB 4GCHG 4X0WU 2Y81A 1QCPA 4K1TA 1ZHPA 1G30B 3EYDA 4O3TA 2Y5FA 2QF4A 4JZFH 1PPCE 1O39A 1SBWA 1XUKA 2LNCA 4I32A 4LZ4B 1YLNA 5K0HA 3B8JA 3N99A 1P2QA 2QN5T 1Z6JH 3RM0H 1NFXA 1EZQA 5E0GA 2FTMA 4XE4A 1AN1E 2ZC9H 2G81E 3KQEA 4LZ1H 1QFKH 1GMCG 3OY5U 1XKAC 2A5IA 2ANWA 3UAIC 1LHGH 4ABGA 4DURA 1L0ZA 8LPRA 1BITA 4H6TA 2BY6X 1ELTA 4K1EA 1V2ST 2J2UA 1ABIH 3CS7A 3E1XB 4K60A 3SUFA 1QJ1B 1TNJA 2AFQB 1FX0B 4JZ1A 2OC8A 2FIRH 3UWJH 3ZV8A 1P06A 1SGTA 1NTPA 3QUMP 3LGVA 1QIXB 4TY6A 1LMWB 3R3GB 2GZ9A 2F9PA 1EAXA 1O35A 1OXGA 4FUHA 1P01A 3V7TA 3MO3A 1SQTA 4DY7B 1MTUA 3EA8A 2QXGA 1WXRA 1G36A 2HLCA 1MUEB 2G4TA 4Y7AA 1EP6A 1KSNA 2JJ2D 5EOKA 3P92A 2RDLA 5C67A 1TMUH 1C4U2 3OX7U 1L4DA 3RXTA 3V13A 1MABB 2QGRA 5LPRA 1MD7A 1Z6EA 2A4QA 4AFSA 1A0LA 4BANB 3HGNA 3M3VA 1CBWB 4GHTA 3RXMA 1KXDA 1S6HA 2NU3E 3M61U 2OQ5A 4LOYH 2IJOB 1OKXA 2XBVA 2HGTH 1YYY1 2UWLA 3AASA 1HYLA 3F9HA 2FS8A 1OS8A 1O2OA 4FU8A 4I86A 1SI5H 1YP9A 1GI4A 1AVXA 3AAVA 1GHVH 2BVRH 1ETRH 1KLJH 2A7HA 2FOBA 3ZZDA 1T8LA 5T6FA 2VVVA 1LVBA 1ELBA 2PTNA 1Q3XA 4DJZB 1BTPA 1TMTH 3PV5A 3V3MA 2GCTC 1GBBA 2EQNA 3FZZA 4D76A 1LHEH 2Z9LA 4MPWA 5GNDA 2FOCA 2GJGA 4MNWA 2ZFTA 4HFPB 1AVWA 2H9TH 1MTNC 3TU7H 4ABHA 4LXBH 2ZU1A 4MPVA 1VJAU 2ZFRH 1PJPA 2TBSA 1XUIA 1O2WA 1DUEA 1MZDA 5FX6A 1TIOA 1EZUC 1SGCA 1Y59T 4H42U 1ID5H 2A32A 5EPYA 1ZMNA 1EPTA 2V0BA 1A1RA 2OINA 5K7RA 2FP7B 1S0QA 2BTCE 1SGFA 1E34B 2ZZUH 1XUFA 1DSUA 4Q63A 1G2LA 1TPAE 4UDWH 4F55A
chains in the Genus database with same CATH topology
2G4UA 4CH8B 1J15A 5ETXA 3S7HB 1DSTA 1YM0A 2NU0E 3W95A 4M7GA 2A4OA 1WBGB 1LQDB 1SB1H 4B71A 5FBEA 2VINA 1BMAA 4X6MA 3UPEA 1NZQH 1D3PB 4MTBA 3TNTA 4DW2U 2O8MA 4IGDA 1UK4A 2XNIA 4XOJA 4OS4A 1MTWA 5F03A 1NRNH 3BG4B 4ISIH 3A81A 3U8TH 1ESAA 4KKDA 1CGIE 4ISLA 1BCUH 2G5VA 4Z6AH 3U8OH 1XXFA 3LJJA 5CE1A 2C8YB 3BTWE 3LH1A 1OPHB 3RXQA 1BHXB 1P2OA 4TWYA 1WSSH 1ETSH 3P70B 3PB1E 1C2EA 1WQVH 2EA3A 1NFYA 3QWCH 4FU9A 2ZPRA 1EASA 5FAHA 1LQEA 2AGGX 2VJ1A 3V12A 1A61H 1O2MA 1GJ6A 4ESTE 4Q7YA 1PYTC 4SGAE 1QQ4A 4ZXXH 2J4IA 4WH6A 2AGEX 1DANH 2PGQB 3E91A 1ZSKA 1DWBH 1TA6A 1W14U 1DWDH 3GISB 1SSXA 1W0ZU 1C2FA 2BY9X 1CVWH 2WV5A 3P8GA 3E90B 5T6DA 1HDTH 5C1XA 4INHA 4AGJA 2ODYB 2VB0A 7GCHG 1VCQA 2W3IA 1HIAA 1LHCH 2FPZA 2ZDNA 4IN2A 4JCNA 1OX1A 4I8HA 2CV3A 2YNAA 3BTME 4MPUA 1W0YH 2J94A 2ZHDA 3SQEE 1O5CB 1MH0A 3BTEE 3MU0A 2SNWA 1QQUA 1QRWA 3LOXA 5A0CA 2W5EA 1FY1A 1ZSLA 2QY0B 2ZP0H 1IQJA 5C2ZA 5L2ZH 3D23A 2WUCA 2A45B 3M5LA 3E6PH 2QF0A 1T4UH 4GLYA 4A1VA 4FUEA 1HGTH 1GBEA 1GBMA 1K1JA 4WVPE 2OCVB 4Y7BA 2GGVB 5FPYA 3EA7A 3Q3YA 1AY6H 1DS2E 1K9OE 1AKSB 4ABAA 1O2JA 4Y0YE 1C5ZB 4QT8C 3K6ZA 2OC7A 2VIDA 1OOKB 5T3HA 2VU8E 4Q7ZA 1KXAA 1KLIH 3FANA 3OU0A 5B6OA 4ZH8A 1V2OT 1Z1JA 1LKBA 1K1OA 3GY8A 3F68H 1QBVH 2O8LA 1KXEA 1TGSZ 4Y76A 5SGAE 2Z9GA 3A80A 3ENSB 1SLWB 1C5YB 4ISOA 1WAYB 3PMHB 1O0DH 1FQ3A 2C8ZB 1H8IH 1S85A 4FUFA 4ZHLU 4B75A 5IYTA 1ABJH 2BD2A 3OSYA 3RC5A 2WPJS 3SNBA 1THSH 3I77A 3RLYH 4IC5A 1Y5BT 1ACBE 2CGAA 2BD8A 2HNTF 3LGIA 4K3JA 2UWOA 1MZAA 1NM6A 1SFIA 3K65B 4X2WA 4A5TS 1DICA 2H9EH 1SGYE 1BRCE 4AFQA 1AVGH 4CHAB 1NY22 1GJCB 3LGYA 2H1UA 1TNHA 3EE0B 1TBRH 1MQ6A 3M35A 1GJDB 2G8TA 3RC4A 1L2EA 3C1KA 1O38A 2H5DA 2P3UB 2P93A 3M5OA 5A8YA 2VH6A 1IQLA 2TGTA 1RGQA 1O34A 3SO3A 2AS9A 1UHBB 4YLQH 1VITH 1G2MA 1FAKH 4B76A 1GBFA 1O5BB 1SOZA 3ZVDA 2BMGB 3Q3KA 2Z3EA 1C5UA 1TBQH 2R9PA 1S81A 1UVPA 2R0LA 2KAIB 4GCHF 6ESTA 1V2WT 3U1IB 4IMZA 2J38A 2UUKB 2FDAA 2QF3A 3E0PB 3RMLH 2IN2A 2AGIX 5EG4A 5C3NA 2A2XH 2GT7A 3MI4A 3GYLB 1O3DA 1MU6B 3WY8A 3UREA 2GV7A 1OYTH 1NRRH 3LGWA 3KQDA 4JMYA 3P8FA 1PPGE 1N1LA 3A88A 1BRUP 3M37A 3RXJA 3OTJE 3TITA 1JMOH 4ABJA 2GTBA 2V3OH 1TNGA 2BY7X 5JB9S 5F6MA 5FCKA 2FLBH 1MBMA 2NU4E 1KTTB 1O3LA 4I31A 4CBNA 1P03A 3QTVH 4X6NA 1NFUA 2F9NA 2P8OC 2H5CA 1FMGA 1C5LH 1NRPH 3MU1A 3A84A 3SI3H 2A4GA 1FY5A 3M3SA 1T8OA 2BQ6B 1D3DB 3RP2A 2P3FH 1P2JA 1C9TA 5A09A 1HCGA 2HPPH 1SPJA 5AVDA 3UNRA 1CT0E 1NU9A 2FOMB 1GJ5H 2GDDA 1GBCA 1K28D 5LPEA 1G3DA 4NWKA 4WMFA 3BTGE 1C5QA 1AD8H 4CRDA 1P09A 1TRYA 2WYGA 1GI8B 2HVXA 1HBTH 3PWBA 2FEQH 4IBLH 1J8AA 3JZ2B 1RIWC 1FPCH 1HJAC 5ESTE 1Z8IB 4BOHA 1W2KH 3ATWA 5T6GA 4A6LA 4YOIA 1GJAB 2JH0D 2EC9H 3NZIA 2ILNA 2CHAC 4U01A 1WUNH 2A7JA 3MO9A 2OP9A 2BX4A 2ZI2H 4O3UA 2ZGCA 4Z0KA 1GBLA 2TIOA 4D9QA 1UCYH 4DVAU 2YNBA 1ANEA 2F9UA 5GPIB 1UJ1A 4MPXA 1NROH 1BT7A 1HV7A 2PKAA 2VIOA 5TCCA 1H1BA 1O3KA 2CXVA 1EJAA 2ZU3A 1GBAA 1UTLM 1S5SA 2BOHB 2ZIQH 2ZQ1A 3E0NB 5FHTA 3SORA 1WOFA 2XBXA 4AFZA 2F9OA 1SGRE 1TQ7B 3SW2B 4ZMAH 2ZDKA 1FI8A 3E3TA 4Y8YA 3TK6A 1O2NA 2F83A 1ZSJA 4Y10E 2Y5HA 3PO1B 3STJA 3ATMA 4Y79A 1CA8B 2WUBA 1Z8RA 2UUFB 3EQ0H 2SGPE 2TPIZ 1L1JA 2BYAX 2FOGA 3RXFA 1W13U 4Y11E 1TNIA 2BM2A 4CH2B 1BTZA 1IHSH 2GCTB 1EP5A 3FVFB 2BLWA 5HM2A 2XTTB 3BEFB 1EUFA 1K21H 1KDQB 1EZXC 2FOHA 2ZDMA 3M7UA 4K5ZA 3BTDE 1VITG 3RLWH 1GI2A 3MWIU 4NIWA 5EXLA 1ELEE 1F0SA 1HUTH 1FONA 1P8VC 1UO6A 2DE9A 2A1DB 3ZZ9A 1C2GA 1S83A 3A7XA 1C5MD 3MU4A 4IC6A 1LVOA 3KQCA 1XKBC 2BHGA 4R0IA 2RA3A 1THPB 4AB9A 5L30H 1QURH 4NSYA 2A2QH 2O8TA 2P3TB 2GP9B 3BV9B 2PUQH 1C1UH 1YC0A 2FOFA 1ZGIA 1DXPA 3LIWA 1VJ9U 1L1GA 4HTCH 3ZZ3A 4BAQB 1C5VA 1BHXF 1FIZA 1GVKB 2VIWA 5GWZA 3RMOH 1QA7A 1EX3A 1YPGH 1F5LA 5ESBA 3SU2A 1YCPM 1UTPA 1EJMA 1O5DH 3RXBA 5I25A 4MNVA 2A0QB 3I29A 1HPGA 1Y3YA 3C27B 1XVMA 2R0KA 1AU8A 1O3IA 1PPZA 4IS5A 4X8SH 4TPIZ 2DE8A 1QBNA 1XUJA 4NSVA 1HXFH 2OC0A 2BDYA 1VR1H 2D26C 5GXPA 1THRH 7GCHF 1P2KA 1BBRE 4MLFB 2WPHS 3B9FH 2QIQA 3UQOA 1OSSA 2XBWA 3BEIB 1V3XA 3FP7E 1D9IA 3GY2A 1MAXA 1C1NA 1LDTT 2WPIS 3FZDA 1ZHMA 2B0FA 1O2XA 2GKVE 3VFEA 1FXYA 2GX4A 1V2UT 4MQAA 5F8TA 8ESTE 3BG8A 4BAHB 4YT6H 1P9SA 4JK5A 4ABIA 5C5NA 1AFQC 2PV9B 1O30A 4X1NU 3ZZ8A 3ZZ4A 2ZFQH 3ZYDA 1PQAA 1O5FH 4CR5A 2YOLA 1A5IA 1V2NT 2F91A 1XX9A 3FP8E 3MU8A 1K1NA 1O37A 1Z1IA 3UOUA 1OP8A 1C1SA 5FCRA 3TH4H 5E2OA 4E06H 3PO1C 3LDXH 3TJOA 1TX8A 1MCTA 1UVUH 3SNEA 1SGPE 1UCYK 2VVCA 1Y3VA 4Y0ZE 4O03A 2BXUH 3U8RH 3RM2H 1V2RT 1UTKA 2JH6D 4AG1A 1RXPA 2WV4A 2AMQA 2Z6BD 1HAZB 3QN7A 4X8VH 1CO7E 5DP7A 2Y7ZA 2C8XB 3ZZ5A 3MNXA 1O3MA 3M7TA 2FI5E 1FN8A 1Y5UT 1ANCA 1TOCB 1EOJA 1TNLA 2FYQA 4U30A 3TGJE 1TB6H 2EEKA 5EXNA 2ALPA 1WTHD 1ZJDA 4I8KA 4WXIA 1ZRBA 3TNSA 1GBHA 1C1RA 2NU2E 2W26A 1BMLA 5HGGA 3HPTB 3SJ8A 2XRCA 1NS3A 3VPKA 4AG2A 1SGIB 4XBDA 3CS0A 3RDZA 2GCHG 2VNTA 5JBBS 2J34A 1KIGH 5A8ZA 4AZ2B 1P05A 2ZDAH 1E38B 5GCHG 3UY9A 2WPLS 1ETTH 1QGFA 2CJIA 1FY8E 1ARBA 1MCVA 3E16B 1N8OC 1V2KT 3O8DA 1NPMA 3TJVA 1L4ZA 1O3FA 1PQ8A 2ZDVH 3GCTF 2V35A 4X2XA 1YPMH 3SOSA 1KLTA 2UUJB 4NIXA 1TQ0B 2JETC 4WF8A 2HALA 2XCFA 1GHAF 1AKSA 2PHBA 4WXVA 2CF9H 2PKSC 3ZVAA 4ZKOU 2G5NA 3GICB 3TJNA 4D7GA 2Y6TA 4ZKSU 1LVYA 1HFDA 2P95A 1RTFB 1ZPZA 4RSPA 4E05H 1GGDC 1P3EA 4X6OA 2Y82A 2ZHFH 4DOQA 3MYWA 3BN9A 4OS1A 3F9FA 2BX3A 1GI3A 1Q31A 1B0EA 1WTGH 2XWBI 4D8NA 1GMHG 5JDUB 1F0TA 2JKHA 1O3AA 1MKXH 3RC6A 4NA7A 2V3HH 1TPPA 1HAYB 1NN6A 3S0NA 4UFGH 5JBAS 1O5EH 5DG6A 4A7IB 2ZQ2A 1JOUB 3T25A 1DX5M 5EU8A 2RG3A 4FUIA 1EZSC 8KME2 3MH5A 4GSOA 5C20A 3DFJA 3CENA 4ZAEA 1QRZA 3SV2H 1YLDA 3P6ZB 1VZQH 4INKA 2EI7A 2ZFFH 3OYPA 4D7FA 3KCGH 1O2YA 2C93B 3E8LA 4JZEH 1W3CA 1NO9H 1CQQA 2ULLA 4UFDH 4ZROA 1BZXE 1GCDA 3P95A 4DT7B 2PSYA 3LC3A 2P8OB 2BOKA 2ZFPH 3GY7A 3SN8A 1EAUA 3SJOA 1P2NA 3MFJA 1HAVB 1MQ5A 3GY3A 2FO9A 3NWUA 4OGYA 2A7CA 1GL1A 4JZDH 1J16A 1GBDA 1TGBA 1AUTC 3RXEA 2AEIH 1GHXH 4ISNA 3M36A 4Q80A 2GZ7A 4JYTA 7LPRA 1GJ4H 5BRRE 2O8UA 3BIUH 2KAIA 3D65E 2RCEA 4RN6A 3KL6A 3OY6U 3K2UA 1GMDG 3P17H 3AW1A 4H6SB 1DWCH 4ZKRU 2CF8H 2ZGHA 1S6FA 2FWWA 1QA0A 2HNTE 1RIWB 1BJVA 3L3TA 3NCLA 3QX5H 4RKOB 4MNYA 1YF4A 1HJAB 2ZEBA 4HGCA 3GCNA 2B7DH 1HRTH 3A7ZA 3KIDU 1AMHA 2EI6A 3Q00A 2ZDLA 5E8EH 3MNSA 2C4FH 3GCHC 1BUIA 3S69A 1FPHH 3T26A 2CHAB 4CRAA 2ZTYA 1HAPH 3A7TA 1OWDA 1SMFE 1P3CA 2PTCE 2ANMH 1YPHE 2PGBB 7KMEH 2BLVA 1BTYA 4YO9A 1O2LA 4FVDA 3IG6B 3UOPA 1D6RA 1O36A 2SNVA 5EW2H 1V6DA 3G01A 1ELCA 1ZOMA 4ZUHA 3AAUA 1RS0A 3SV7A 1ZR0A 1Z7KA 2C3SA 1LCYA 2AH4X 2OTVA 2AERH 3MMGA 3ATIA 1RJXB 1BA8B 2BD9A 2FTLE 4BXWA 1O3EA 2BDHA 1GI0A 3BTKE 4RKJB 4JYVH 1HIAB 1T7CA 2XC5A 3ATLA 3GOVB 5FX5A 1VITF 1HJ8A 2AMPA 1MU8B 3MOCA 2GD4B 1CSOE 2Y7XA 2IOTA 2VWMA 5GIBA 4AYVB 3D49H 4JZIA 1P04A 4AB8A 1O2QA 2O8WA 1ZHRA 5EQRA 1W8BH 1MTVA 4X8UH 5GJ4B 3LPRA 1A4WH 5C1YA 1H9LB 1O3NA 6CHAC 1DY8A 1W7GH 1F5RA 1TE0A 2GVFA 1A0JA 1QR3E 4J1YA 4ABEA 1O2TA 5DP9A 2W7UA 3VB7A 3RXUA 2GT8A 1AE8H 1T32A 1V2LT 2BD3A 3D62A 2A5AA 4WWYA 5I46H 4ABFA 1YBWA 4A1TA 4KGAA 1JBUH 3SI4H 1QL8A 4TY7A 2W7SA 3ITIA 1YKTA 1TPOA 2OD3B 1A5GH 4IW4E 2SFAA 1GBKA 1CGHA 3ZVEA 2WINI 5DO4H 2J95A 1P2MA 1GJ8B 1GMCF 2QC2A 1F0RA 2BDGA 1IQGA 4BTUB 4ASHA 2XXLA 1EPTC 1O3PB 4KP0A 3ODFA 4UE7H 3NUMA 2Q6FA 1V2MT 1BTWA 2WPKS 1AUJA 1V2QT 2ZGBH 1EQ9A 2AIQA 1IQKA 3MNBA 3RXIA 1C5SA 2ZO3H 5DK1A 5CHAC 1KYNA 2QCYA 3PYHA 4FU7A 1GI9B 1LPKB 2FX6A 5AFYH 3U98H 1SGEE 1UCYE 2ZNKH 1ELAA 1KDQA 1UMAH 1SVPA 2VGCC 5C5OA 3ESTA 1HNEE 3EAJA 3BTHE 3GY4A 3KGPA 4DGJA 1DVAH 4MVNA 5FXLA 4B2CA 3U1JB 1GBTA 1JRSA 1EKBB 1QTFA 1P9UA 3SBKA 1G3CA 3GDUA 1AFEH 1CHOG 1MMJN 4KELA 1FAXA 3W94A 1J9CH 2XC0A 3TIUA 4DIIH 1AE5A 1JXPA 1LHDH 1LHFH 2ZWLH 3RU4D 3BTTE 1ZRKA 3ZZCA 1C5TA 3IWMA 2Q1JA 1TX6A 2ZPQA 1F7ZA 1SOTA 4CRBA 2C90B 1OP2A 4R8TB 2G51A 4GAWA 1C2KA 1IHTH 2A31A 2VWNA 3DUXH 2ZA5A 3QZRA 1KXFA 2TRMA 3M5NA 2PWXA 1DWEH 1MKWH 3DHKH 1ANDA 1AFQB 1TGCA 4NA9H 3VB4A 2ESTE 1EB2A 1O2KA 1ZPCA 3SU3A 1DLEA 4K69A 4YOGA 3EA9A 1XUHA 3RMMH 3VB6A 1TMBH 4I33A 4O9VA 1G32B 2BY8X 2D8WA 3U9AH 3M3TA 4U32A 1AWHB 4Z