1O5DL

Dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
96
structure length
96
Chain Sequence
GDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
molecule keywords Coagulation factor VII
total genus 16
structure length 96
sequence length 96
ec nomenclature ec 3.4.21.21: Coagulation factor VIIa.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00008 EGF EGF-like domain
L PF00594 Gla Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1o5dL02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1o5dL01
1F0SB 1FAKL 1IQLL 1U67A 3RR3A 5FDQA 1EAIC 4D0FA 2PR3B 4RRYA 1KLOA 2TGFA 3LTGD 1UZPA 5IKVA 3TBDA 4BDXA 5L2YL 3PGHA 4BTUA 4JZDL 3EGFA 4XBMA 3FFGL 2P93L 2G00L 2VWLL 1SZBA 2MHPA 2MGRA 1L5GB 1Z6CA 4ZXYL 5JW1A 1IOEL 1IQNL 3Q3KB 2WPJE 4LORA 2W26B 2D1JB 2OYEP 2W2ME 2VVUL 4AQTA 2P95L 3IITB 3N8WB 1FSBA 2J38B 2BOKL 2VH6B 2BOXA 1YGCL 1N1IA 1Q4GA 4MMYB 1CVUA 3HO4A 3OLUA 1CEJA 3N8XA 4Y6DB 2KL7A 4YT6L 2P3FN 4JZEL 3MQEA 3LAQA 3M37L 4Z0LA 3HPTA 1IQHL 2JKHL 4COXA 1NT0A 1CVWL 1WHEA 1V3XB 4OTYA 3GISX 3LIWB 2DDUA 1W7XL 2EI8B 2WYJB 4BXSA 1Z6EL 4Y7AB 1CCVA 1LPKA 3CENL 2VWNL 5E8DA 4RUTA 2Y38A 1JL9A 4FM5A 3R05A 3LC5B 1YO8A 5JBBE 1IJQA 4YT7L 5COXA 2RHPA 3TK6B 4ZH8B 2UWLB 1P0SL 1J9CL 3ZYJB 2H9EL 1XKAL 1PXXA 1GK5A 4BDWA 5F19A 2RA0L 4RRZA 1IP0A 3BT2A 1HJ7A 1PRHA 2WFXB 2P3UA 1PTHA 2J94B 1CCFA 2J34B 1F7EA 2XBWL 3DEMA 1G1SA 2P28B 1IQEL 1AUTL 1IOXA 3KCGL 1G1RA 4A7IA 1XKBA 5CISA 1EZQB 2W2NE 1F7MA 2YGOA 1JBUL 1EPJA 3NT1A 4BXWA 5CKQA 1DQBA 3HO3A 1ADXA 1HAEA 1LPZA 1HREA 2AYLA 3CFWA 1ATEA 1G1QA 5K0HB 4X8VL 3HS5A 1NZIA 1TOZA 2FLBL 2VWMK 3F1SB 2B7DL 4ZHAB 1G2LB 2W2OE 2I9BA 5KN5C 4M10A 1MOXC 2M74A 1HCGB 1RFNB 1ATDA 1IQGL 1XDTR 4MMXB 2VH0B 1A3PA 1B9WA 1EMOA 2WPME 4Z0KB 4Y71B 2WPIE 2PUQL 2KB9A 2Y80B 4XLWA 5IKQA 1G1TA 4JYUL 1UZQA 2BOHA 4RRWA 1IVOC 1MQ6L 5I46L 1F0RB 4MMZB 1HT5A 3IJEB 4Z6AL 2P26A 2J4IB 1P9JA 3ENSA 4Y76B 2BMGA 3CS7L 1KLIL 2P3FL 1EQHA 1CQEA 4M11A 2VWOL 2XC0L 3N8YB 1COUA 1EMNA 2NPRA 1WHFA 2Y81B 2WG3C 5JBAE 3V64C 1KIGL 3F6UL 2FZZL 4PH9A 4RRXA 1QFKL 1APQA 4X8UL 2XBVL 3KQDL 3KQCL 1OB1C 2RNLA 2WG4B 3QH0A 1NQLB 1EBVA 1FAXL 1YUKB 1DX5I 4CUEA 1C5MF 3BPSE 2EI7B 1IQIL 1URKA 4ISHL 3H5CB 1TPGA 1FFMA 3GCWE 4CSYA 3LN1A 4CUDA 1UZJA 2VVVL 3HS7A 4Y7BB 1JV2B 2BOUA 1MQ5L 4LMFA 4OTJA 2P16L 1BF9A 2Y82B 2W3IB 3ZYGA 2VVCK 4JYVL 5EGMB 2P94L 2K2SB 3OLTA 4BTIA 2WPKE 4ZAEB 4D90A 5JB9E 2W3KB 1DDXA 4D0EA 2Q1JB 3CA7A 2YGPA 1EQGA 3V65B 2FLGA 1IQKL 3ELAL 2WYGB 4E1GA 4JZFL 1YUFA 1LQDA 2FD6A 3MDLA 1WU1B 3SOVA 3TZIA 1HRFA 3HS6A 2UWOB 3QMOA 1EPIA 1NFWB 2XC5L 3LC3B 1K37A 2K2TA 1KLJL 1O5DL 2WPHE 2EI6B 3HO5A 2CJIB 2BQ7A 1HX2A 1FF7A 2BZ6L 5JBCE 2XBXL 2Y5HL 2GD4A 1IQJL 1HT8A 3KRKA 1G2MB 1N7DA 2W2QE 4G1MB 3TGFA 1UZKA 1ZAQA 1LPGA 4NG9L 1YUGA 3Q7DA 3LTFB 2XBYL 1EPGA 1PFXL 3QCWA 1NPEB 3M36L 3TH3L 5KIRA 1PGEA 1XFEA 1NFXB 3KK6A 5JVZA 5L30L 1K36A 4X8SL 5CKMA 3NTBA 2KV4A 5F1AA 6COXA 2Y5GL 2WFTA 1APOA 1M1XB 1CX2A 2Y5FL 3N8VA 3U73A 4TGFA 4Y79B 2P3TA 4NA9L 1I0UA 3POYA 2XC4L 1EPHA 3SW2A 5CKNA 4C16A 3C9AC 4NGAL 3FBYA 2VJ3A 2PHBB 2W86A 1IQFL 2ADXA 1NFUB 2J2UB 1HAFA 5JB8E 3FCSB 1HZ8A 1DIYA 3GCXE 2BO2A 1W8BL 2FLRL 2I9AA 3KL6B 3N8WA 3NTGA 1IGXA 3SOQA 2J95B 5JVYA 3BT1A 1FE2A 2BQWA 4X8TL 1ATAA 3KQBL 3KQEL 1TLEA 1NFYB 2BQ6A 3N8YA 5L2ZL 4ZXXL 5IKTA 1LMJA 1FJSL 2OYUP 3U7UG 3P5BL 5IKRA 4CUFA 2F9BL 1U8CB 4RS0A 1X7AL 1IGZA 3N8ZA 1EGFA 1ATBA 1KSNB 3K9XA 4XL1A 4O1ZA 2W2PE 1IQML 3ZYIB 2Y7XB 1L3YA 3TK5B 4YZUB 4O02B 3ASIA 3LN0A 2WPLE 3SOBB 2MGPA 3NJPC 1DVAL 2Y7ZB 4BTTA 2UWPB 4ISIL
chains in the Genus database with same CATH superfamily
1F0SB 1FAKL 1IQLL 1U67A 3RR3A 5FDQA 1EAIC 3S6XA 4D0FA 2PR3B 4RRYA 1KLOA 2TGFA 3LTGD 1UZPA 5IKVA 3TBDA 4BDXA 5L2YL 3PGHA 4BTUA 4JZDL 3EGFA 4XBMA 3FFGL 2P93L 2G00L 2VWLL 1SZBA 2MHPA 2MGRA 1L5GB 1Z6CA 4ZXYL 5JW1A 1IOEL 1IQNL 3Q3KB 2WPJE 4LORA 2W26B 2D1JB 2OYEP 2W2ME 2BT7A 2VVUL 4AQTA 2P95L 3IITB 3N8WB 1FSBA 2J38B 2BOKL 2VH6B 2BOXA 1YGCL 1N1IA 1Q4GA 4MMYB 1CVUA 3HO4A 3OLUA 1CEJA 3N8XA 4Y6DB 2KL7A 4YT6L 2P3FN 4JZEL 3MQEA 3LAQA 3M37L 4Z0LA 3HPTA 1IQHL 2JKHL 4COXA 1NT0A 1CVWL 1WHEA 1V3XB 2HOXA 4OTYA 3GISX 3LIWB 2DDUA 1W7XL 2EI8B 2WYJB 4BXSA 1Z6EL 4Y7AB 1CCVA 1LPKA 3CENL 2VWNL 5E8DA 4RUTA 2Y38A 1JL9A 4FM5A 3R05A 3LC5B 1YO8A 5JBBE 1IJQA 4YT7L 5COXA 1LMMA 2RHPA 3TK6B 4ZH8B 2UWLB 1P0SL 1J9CL 3ZYJB 2H9EL 1XKAL 1PXXA 1GK5A 4BDWA 5F19A 2RA0L 4RRZA 1KKEA 1IP0A 3BT2A 1HJ7A 1PRHA 2WFXB 2P3UA 1PTHA 2J94B 2H9EC 1CCFA 2J34B 1F7EA 2XBWL 3DEMA 1G1SA 2P28B 1IQEL 1AUTL 1IOXA 3KCGL 1G1RA 4A7IA 1XKBA 5CISA 1EZQB 2WZPP 2W2NE 1F7MA 2YGOA 1JBUL 1EPJA 3NT1A 4BXWA 5CKQA 1DQBA 3HO3A 1ADXA 1HAEA 1LPZA 1HREA 2AYLA 2HORA 3CFWA 1ATEA 1G1QA 5K0HB 4X8VL 3HS5A 1NZIA 1TOZA 2FLBL 2VWMK 2VRSA 2B7DL 3F1SB 4ZHAB 1G2LB 2W2OE 2I9BA 5KN5C 4M10A 1MOXC 2M74A 1HCGB 1RFNB 1ATDA 1IQGL 1XDTR 4MMXB 2VH0B 1A3PA 1B9WA 1EMOA 2WPME 4Z0KB 4Y71B 2WPIE 2PUQL 2KB9A 2Y80B 4XLWA 5IKQA 1G1TA 4JYUL 1UZQA 2BOHA 4RRWA 1IVOC 1MQ6L 1QIUA 5I46L 1F0RB 4MMZB 1HT5A 3IJEB 4Z6AL 2P26A 2J4IB 1P9JA 3ENSA 4Y76B 2BMGA 3CS7L 1KLIL 2P3FL 1EQHA 1CQEA 4M11A 2VWOL 2XC0L 3N8YB 1COUA 1EMNA 2NPRA 1WHFA 2Y81B 2WG3C 5JBAE 3V64C 1KIGL 3F6UL 2FZZL 4PH9A 4RRXA 1QFKL 1APQA 4X8UL 2XBVL 3KQDL 1V1IA 3KQCL 1OB1C 2RNLA 2WG4B 3QH0A 1NQLB 1EBVA 1FAXL 1YUKB 1DX5I 4A94C 4CUEA 1C5MF 3BPSE 2EI7B 1IQIL 1URKA 4ISHL 3H5CB 1TPGA 1FFMA 3GCWE 2KNIA 4CSYA 3LN1A 4CUDA 1UZJA 2VVVL 3HS7A 4Y7BB 1JV2B 2BOUA 1MQ5L 4LMFA 4OTJA 2P16L 1BF9A 2Y82B 2W3IB 3ZYGA 2VVCK 4JYVL 5EGMB 2P94L 2K2SB 3OLTA 4BTIA 2WPKE 4ZAEB 4D90A 5JB9E 2W3KB 1DDXA 4D0EA 2Q1JB 3CA7A 2YGPA 1EQGA 3V65B 2FLGA 1IQKL 3ELAL 2WYGB 4E1GA 4JZFL 1YUFA 1LQDA 2FD6A 3MDLA 1WU1B 3SOVA 3TZIA 1HRFA 3HS6A 2UWOB 3QMOA 1EPIA 1NFWB 2XC5L 3LC3B 1K37A 2K2TA 1KLJL 1O5DL 2WPHE 2EI6B 3HO5A 2CJIB 2BQ7A 4GU4A 1HX2A 1FF7A 2BZ6L 5JBCE 2XBXL 2Y5HL 2GD4A 1IQJL 1HT8A 3KRKA 1G2MB 1V1HA 1N7DA 2W2QE 4G1MB 3TGFA 1UZKA 1ZAQA 1LPGA 1YUGA 3Q7DA 3LTFB 4NG9L 2XBYL 1EPGA 1PFXL 3QCWA 1NPEB 3M36L 3TH3L 5KIRA 1PGEA 1XFEA 1NFXB 3KK6A 5JVZA 5L30L 1K36A 4X8SL 5CKMA 3NTBA 2KV4A 5F1AA 6COXA 2Y5GL 2WFTA 1APOA 1M1XB 1CX2A 2Y5FL 3N8VA 3U73A 4TGFA 4Y79B 2P3TA 4NA9L 1I0UA 3POYA 2XC4L 1EPHA 3SW2A 5CKNA 4C16A 3C9AC 1LK9A 4NGAL 3FBYA 2VJ3A 2PHBB 2W86A 1IQFL 2ADXA 1NFUB 2J2UB 1HAFA 5JB8E 3FCSB 1HZ8A 1DIYA 3GCXE 2BO2A 1W8BL 2FLRL 2I9AA 3KL6B 3N8WA 3NTGA 1IGXA 3SOQA 2J95B 2BT8A 5JVYA 3BT1A 2YGQA 1FE2A 2BQWA 4X8TL 1ATAA 3KQBL 3KQEL 1TLEA 1NFYB 2BQ6A 3N8YA 2JJLA 5L2ZL 4ZXXL 5IKTA 1LMJA 1FJSL 2OYUP 3U7UG 2BSFA 3P5BL 5IKRA 4CUFA 2F9BL 1U8CB 4RS0A 1X7AL 1IGZA 3N8ZA 4GU3A 1EGFA 1ATBA 1KSNB 3K9XA 4XL1A 4O1ZA 2W2PE 1IQML 3ZYIB 2Y7XB 1L3YA 3TK5B 4YZUB 4O02B 3ASIA 3LN0A 2WPLE 3SOBB 2MGPA 3NJPC 1DVAL 2Y7ZB 4BTTA 2UWPB 4ISIL
chains in the Genus database with same CATH topology
1F0SB 1FAKL 1IQLL 1U67A 3RR3A 5FDQA 1EAIC 3S6XA 4D0FA 2PR3B 4RRYA 1KLOA 2TGFA 3LTGD 1UZPA 5IKVA 3TBDA 4BDXA 5L2YL 3PGHA 4BTUA 4JZDL 3EGFA 4XBMA 3FFGL 2P93L 2G00L 2VWLL 1SZBA 2MHPA 2MGRA 1L5GB 1Z6CA 4ZXYL 5JW1A 1IOEL 1IQNL 3Q3KB 2WPJE 4LORA 2W26B 2D1JB 2OYEP 2W2ME 2VVUL 4AQTA 2P95L 3IITB 3N8WB 1FSBA 2J38B 2BOKL 2VH6B 2BOXA 1YGCL 1N1IA 1Q4GA 4MMYB 1CVUA 3HO4A 3OLUA 1CEJA 3N8XA 4Y6DB 2KL7A 4YT6L 2P3FN 4JZEL 3MQEA 3LAQA 3M37L 4Z0LA 3HPTA 1IQHL 2JKHL 4COXA 1NT0A 1CVWL 1WHEA 1V3XB 4OTYA 3GISX 3LIWB 2DDUA 1W7XL 2EI8B 2WYJB 4BXSA 1Z6EL 4Y7AB 1CCVA 1LPKA 3CENL 2VWNL 5E8DA 4RUTA 2Y38A 1JL9A 4FM5A 3R05A 3LC5B 1YO8A 5JBBE 1IJQA 4YT7L 5COXA 1LMMA 2RHPA 3TK6B 4ZH8B 2UWLB 1P0SL 1J9CL 3ZYJB 2H9EL 1XKAL 1PXXA 1GK5A 4BDWA 5F19A 2RA0L 4RRZA 1IP0A 3BT2A 1HJ7A 1PRHA 2WFXB 2P3UA 1PTHA 2J94B 2H9EC 1CCFA 2J34B 1F7EA 2XBWL 3DEMA 1G1SA 2P28B 1IQEL 1AUTL 1IOXA 3KCGL 1G1RA 4A7IA 1XKBA 5CISA 1EZQB 2WZPP 2W2NE 1F7MA 2YGOA 1JBUL 1EPJA 3NT1A 4BXWA 5CKQA 1DQBA 3HO3A 1ADXA 1HAEA 1LPZA 1HREA 2AYLA 3CFWA 1ATEA 1G1QA 5K0HB 4X8VL 3HS5A 1NZIA 1TOZA 2FLBL 2VWMK 3F1SB 2B7DL 4ZHAB 1G2LB 2W2OE 2I9BA 5KN5C 4M10A 1MOXC 2M74A 1HCGB 1RFNB 1ATDA 1IQGL 1XDTR 4MMXB 2VH0B 1A3PA 1B9WA 1EMOA 2WPME 4Z0KB 4Y71B 2WPIE 2PUQL 2KB9A 2Y80B 4XLWA 5IKQA 1G1TA 4JYUL 1UZQA 2BOHA 4RRWA 1IVOC 1MQ6L 5I46L 1F0RB 4MMZB 1HT5A 3IJEB 4Z6AL 2P26A 2J4IB 1P9JA 3ENSA 4Y76B 2BMGA 3CS7L 1KLIL 2P3FL 1EQHA 1CQEA 4M11A 2VWOL 2XC0L 3N8YB 1COUA 1EMNA 2NPRA 1WHFA 2Y81B 2WG3C 5JBAE 3V64C 1KIGL 3F6UL 2FZZL 4PH9A 4RRXA 1QFKL 1APQA 4X8UL 2XBVL 3KQDL 3KQCL 1OB1C 2RNLA 2WG4B 3QH0A 1NQLB 1EBVA 1FAXL 1YUKB 1DX5I 4A94C 4CUEA 1C5MF 3BPSE 2EI7B 1IQIL 1URKA 4ISHL 3H5CB 1TPGA 1FFMA 3GCWE 2KNIA 4CSYA 3LN1A 4CUDA 1UZJA 2VVVL 3HS7A 4Y7BB 1JV2B 2BOUA 1MQ5L 4LMFA 4OTJA 2P16L 1BF9A 2Y82B 2W3IB 3ZYGA 2VVCK 4JYVL 5EGMB 2P94L 2K2SB 3OLTA 4BTIA 2WPKE 4ZAEB 4D90A 5JB9E 2W3KB 1DDXA 4D0EA 2Q1JB 3CA7A 2YGPA 1EQGA 3V65B 2FLGA 1IQKL 3ELAL 2WYGB 4E1GA 4JZFL 1YUFA 1LQDA 2FD6A 3MDLA 1WU1B 3SOVA 3TZIA 1HRFA 3HS6A 2UWOB 3QMOA 1EPIA 1NFWB 2XC5L 3LC3B 1K37A 2K2TA 1KLJL 1O5DL 2WPHE 2EI6B 3HO5A 2CJIB 2BQ7A 1HX2A 1FF7A 2BZ6L 5JBCE 2XBXL 2Y5HL 2GD4A 1IQJL 1HT8A 3KRKA 1G2MB 1N7DA 2W2QE 4G1MB 3TGFA 1UZKA 1ZAQA 1LPGA 1YUGA 3Q7DA 3LTFB 4NG9L 2XBYL 1EPGA 1PFXL 3QCWA 1NPEB 3M36L 3TH3L 5KIRA 1PGEA 1XFEA 1NFXB 3KK6A 5JVZA 5L30L 1K36A 4X8SL 5CKMA 3NTBA 2KV4A 5F1AA 6COXA 2Y5GL 2WFTA 1APOA 1M1XB 1CX2A 2Y5FL 3N8VA 3U73A 4TGFA 4Y79B 2P3TA 4NA9L 1I0UA 3POYA 2XC4L 1EPHA 3SW2A 5CKNA 4C16A 3C9AC 4NGAL 3FBYA 2VJ3A 2PHBB 2W86A 1IQFL 2ADXA 1NFUB 2J2UB 1HAFA 5JB8E 3FCSB 1HZ8A 1DIYA 3GCXE 2BO2A 1W8BL 2FLRL 2I9AA 3KL6B 3N8WA 3NTGA 1IGXA 3SOQA 2J95B 5JVYA 3BT1A 2YGQA 1FE2A 2BQWA 4X8TL 1ATAA 3KQBL 3KQEL 1TLEA 1NFYB 2BQ6A 3N8YA 5L2ZL 4ZXXL 5IKTA 1LMJA 1FJSL 2OYUP 3U7UG 3P5BL 5IKRA 4CUFA 2F9BL 1U8CB 4RS0A 1X7AL 1IGZA 3N8ZA 1EGFA 1ATBA 1KSNB 3K9XA 4XL1A 4O1ZA 2W2PE 1IQML 3ZYIB 2Y7XB 1L3YA 3TK5B 4YZUB 4O02B 3ASIA 3LN0A 2WPLE 3SOBB 2MGPA 3NJPC 1DVAL 2Y7ZB 4BTTA 2UWPB 4ISIL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F0S B;  1FAK L;  1IQL L;  1U67 A;  3RR3 A;  5FDQ A;  1EAI C;  4D0F A;  2PR3 B;  4RRY A;  1KLO A;  2TGF A;  3LTG D;  1UZP A;  5IKV A;  3TBD A;  4BDX A;  5L2Y L;  3PGH A;  4BTU A;  4JZD L;  3EGF A;  4XBM A;  3FFG L;  2P93 L;  2G00 L;  2VWL L;  1SZB A;  2MHP A;  2MGR A;  1L5G B;  1Z6C A;  4ZXY L;  5JW1 A;  1IOE L;  1IQN L;  3Q3K B;  2WPJ E;  4LOR A;  2W26 B;  2D1J B;  2OYE P;  2W2M E;  2VVU L;  4AQT A;  2P95 L;  3IIT B;  3N8W B;  1FSB A;  2J38 B;  2BOK L;  2VH6 B;  2BOX A;  1YGC L;  1N1I A;  1Q4G A;  4MMY B;  1CVU A;  3HO4 A;  3OLU A;  1CEJ A;  3N8X A;  4Y6D B;  2KL7 A;  4YT6 L;  2P3F N;  4JZE L;  3MQE A;  3LAQ A;  3M37 L;  4Z0L A;  3HPT A;  1IQH L;  2JKH L;  4COX A;  1NT0 A;  1CVW L;  1WHE A;  1V3X B;  4OTY A;  3GIS X;  3LIW B;  2DDU A;  1W7X L;  2EI8 B;  2WYJ B;  4BXS A;  1Z6E L;  4Y7A B;  1CCV A;  1LPK A;  3CEN L;  2VWN L;  5E8D A;  4RUT A;  2Y38 A;  1JL9 A;  4FM5 A;  3R05 A;  3LC5 B;  1YO8 A;  5JBB E;  1IJQ A;  4YT7 L;  5COX A;  2RHP A;  3TK6 B;  4ZH8 B;  2UWL B;  1P0S L;  1J9C L;  3ZYJ B;  2H9E L;  1XKA L;  1PXX A;  1GK5 A;  4BDW A;  5F19 A;  2RA0 L;  4RRZ A;  1IP0 A;  3BT2 A;  1HJ7 A;  1PRH A;  2WFX B;  2P3U A;  1PTH A;  2J94 B;  1CCF A;  2J34 B;  1F7E A;  2XBW L;  3DEM A;  1G1S A;  2P28 B;  1IQE L;  1AUT L;  1IOX A;  3KCG L;  1G1R A;  4A7I A;  1XKB A;  5CIS A;  1EZQ B;  2W2N E;  1F7M A;  2YGO A;  1JBU L;  1EPJ A;  3NT1 A;  4BXW A;  5CKQ A;  1DQB A;  3HO3 A;  1ADX A;  1HAE A;  1LPZ A;  1HRE A;  2AYL A;  3CFW A;  1ATE A;  1G1Q A;  5K0H B;  4X8V L;  3HS5 A;  1NZI A;  1TOZ A;  2FLB L;  2VWM K;  3F1S B;  2B7D L;  4ZHA B;  1G2L B;  2W2O E;  2I9B A;  5KN5 C;  4M10 A;  1MOX C;  2M74 A;  1HCG B;  1RFN B;  1ATD A;  1IQG L;  1XDT R;  4MMX B;  2VH0 B;  1A3P A;  1B9W A;  1EMO A;  2WPM E;  4Z0K B;  4Y71 B;  2WPI E;  2PUQ L;  2KB9 A;  2Y80 B;  4XLW A;  5IKQ A;  1G1T A;  4JYU L;  1UZQ A;  2BOH A;  4RRW A;  1IVO C;  1MQ6 L;  5I46 L;  1F0R B;  4MMZ B;  1HT5 A;  3IJE B;  4Z6A L;  2P26 A;  2J4I B;  1P9J A;  3ENS A;  4Y76 B;  2BMG A;  3CS7 L;  1KLI L;  2P3F L;  1EQH A;  1CQE A;  4M11 A;  2VWO L;  2XC0 L;  3N8Y B;  1COU A;  1EMN A;  2NPR A;  1WHF A;  2Y81 B;  2WG3 C;  5JBA E;  3V64 C;  1KIG L;  3F6U L;  2FZZ L;  4PH9 A;  4RRX A;  1QFK L;  1APQ A;  4X8U L;  2XBV L;  3KQD L;  3KQC L;  1OB1 C;  2RNL A;  2WG4 B;  3QH0 A;  1NQL B;  1EBV A;  1FAX L;  1YUK B;  1DX5 I;  4CUE A;  1C5M F;  3BPS E;  2EI7 B;  1IQI L;  1URK A;  4ISH L;  3H5C B;  1TPG A;  1FFM A;  3GCW E;  4CSY A;  3LN1 A;  4CUD A;  1UZJ A;  2VVV L;  3HS7 A;  4Y7B B;  1JV2 B;  2BOU A;  1MQ5 L;  4LMF A;  4OTJ A;  2P16 L;  1BF9 A;  2Y82 B;  2W3I B;  3ZYG A;  2VVC K;  4JYV L;  5EGM B;  2P94 L;  2K2S B;  3OLT A;  4BTI A;  2WPK E;  4ZAE B;  4D90 A;  5JB9 E;  2W3K B;  1DDX A;  4D0E A;  2Q1J B;  3CA7 A;  2YGP A;  1EQG A;  3V65 B;  2FLG A;  1IQK L;  3ELA L;  2WYG B;  4E1G A;  4JZF L;  1YUF A;  1LQD A;  2FD6 A;  3MDL A;  1WU1 B;  3SOV A;  3TZI A;  1HRF A;  3HS6 A;  2UWO B;  3QMO A;  1EPI A;  1NFW B;  2XC5 L;  3LC3 B;  1K37 A;  2K2T A;  1KLJ L;  1O5D L;  2WPH E;  2EI6 B;  3HO5 A;  2CJI B;  2BQ7 A;  1HX2 A;  1FF7 A;  2BZ6 L;  5JBC E;  2XBX L;  2Y5H L;  2GD4 A;  1IQJ L;  1HT8 A;  3KRK A;  1G2M B;  1N7D A;  2W2Q E;  4G1M B;  3TGF A;  1UZK A;  1ZAQ A;  1LPG A;  4NG9 L;  1YUG A;  3Q7D A;  3LTF B;  2XBY L;  1EPG A;  1PFX L;  3QCW A;  1NPE B;  3M36 L;  3TH3 L;  5KIR A;  1PGE A;  1XFE A;  1NFX B;  3KK6 A;  5JVZ A;  5L30 L;  1K36 A;  4X8S L;  5CKM A;  3NTB A;  2KV4 A;  5F1A A;  6COX A;  2Y5G L;  2WFT A;  1APO A;  1M1X B;  1CX2 A;  2Y5F L;  3N8V A;  3U73 A;  4TGF A;  4Y79 B;  2P3T A;  4NA9 L;  1I0U A;  3POY A;  2XC4 L;  1EPH A;  3SW2 A;  5CKN A;  4C16 A;  3C9A C;  4NGA L;  3FBY A;  2VJ3 A;  2PHB B;  2W86 A;  1IQF L;  2ADX A;  1NFU B;  2J2U B;  1HAF A;  5JB8 E;  3FCS B;  1HZ8 A;  1DIY A;  3GCX E;  2BO2 A;  1W8B L;  2FLR L;  2I9A A;  3KL6 B;  3N8W A;  3NTG A;  1IGX A;  3SOQ A;  2J95 B;  5JVY A;  3BT1 A;  1FE2 A;  2BQW A;  4X8T L;  1ATA A;  3KQB L;  3KQE L;  1TLE A;  1NFY B;  2BQ6 A;  3N8Y A;  5L2Z L;  4ZXX L;  5IKT A;  1LMJ A;  1FJS L;  2OYU P;  3U7U G;  3P5B L;  5IKR A;  4CUF A;  2F9B L;  1U8C B;  4RS0 A;  1X7A L;  1IGZ A;  3N8Z A;  1EGF A;  1ATB A;  1KSN B;  3K9X A;  4XL1 A;  4O1Z A;  2W2P E;  1IQM L;  3ZYI B;  2Y7X B;  1L3Y A;  3TK5 B;  4YZU B;  4O02 B;  3ASI A;  3LN0 A;  2WPL E;  3SOB B;  2MGP A;  3NJP C;  1DVA L;  2Y7Z B;  4BTT A;  2UWP B;  4ISI L; 
#chains in the Genus database with same CATH topology
 1F0S B;  1FAK L;  1IQL L;  1U67 A;  3RR3 A;  5FDQ A;  1EAI C;  3S6X A;  4D0F A;  2PR3 B;  4RRY A;  1KLO A;  2TGF A;  3LTG D;  1UZP A;  5IKV A;  3TBD A;  4BDX A;  5L2Y L;  3PGH A;  4BTU A;  4JZD L;  3EGF A;  4XBM A;  3FFG L;  2P93 L;  2G00 L;  2VWL L;  1SZB A;  2MHP A;  2MGR A;  1L5G B;  1Z6C A;  4ZXY L;  5JW1 A;  1IOE L;  1IQN L;  3Q3K B;  2WPJ E;  4LOR A;  2W26 B;  2D1J B;  2OYE P;  2W2M E;  2BT7 A;  2VVU L;  4AQT A;  2P95 L;  3IIT B;  3N8W B;  1FSB A;  2J38 B;  2BOK L;  2VH6 B;  2BOX A;  1YGC L;  1N1I A;  1Q4G A;  4MMY B;  1CVU A;  3HO4 A;  3OLU A;  1CEJ A;  3N8X A;  4Y6D B;  2KL7 A;  4YT6 L;  2P3F N;  4JZE L;  3MQE A;  3LAQ A;  3M37 L;  4Z0L A;  3HPT A;  1IQH L;  2JKH L;  4COX A;  1NT0 A;  1CVW L;  1WHE A;  1V3X B;  2HOX A;  4OTY A;  3GIS X;  3LIW B;  2DDU A;  1W7X L;  2EI8 B;  2WYJ B;  4BXS A;  1Z6E L;  4Y7A B;  1CCV A;  1LPK A;  3CEN L;  2VWN L;  5E8D A;  4RUT A;  2Y38 A;  1JL9 A;  4FM5 A;  3R05 A;  3LC5 B;  1YO8 A;  5JBB E;  1IJQ A;  4YT7 L;  5COX A;  1LMM A;  2RHP A;  3TK6 B;  4ZH8 B;  2UWL B;  1P0S L;  1J9C L;  3ZYJ B;  2H9E L;  1XKA L;  1PXX A;  1GK5 A;  4BDW A;  5F19 A;  2RA0 L;  4RRZ A;  1KKE A;  1IP0 A;  3BT2 A;  1HJ7 A;  1PRH A;  2WFX B;  2P3U A;  1PTH A;  2J94 B;  2H9E C;  1CCF A;  2J34 B;  1F7E A;  2XBW L;  3DEM A;  1G1S A;  2P28 B;  1IQE L;  1AUT L;  1IOX A;  3KCG L;  1G1R A;  4A7I A;  1XKB A;  5CIS A;  1EZQ B;  2WZP P;  2W2N E;  1F7M A;  2YGO A;  1JBU L;  1EPJ A;  3NT1 A;  4BXW A;  5CKQ A;  1DQB A;  3HO3 A;  1ADX A;  1HAE A;  1LPZ A;  1HRE A;  2AYL A;  2HOR A;  3CFW A;  1ATE A;  1G1Q A;  5K0H B;  4X8V L;  3HS5 A;  1NZI A;  1TOZ A;  2FLB L;  2VWM K;  2VRS A;  2B7D L;  3F1S B;  4ZHA B;  1G2L B;  2W2O E;  2I9B A;  5KN5 C;  4M10 A;  1MOX C;  2M74 A;  1HCG B;  1RFN B;  1ATD A;  1IQG L;  1XDT R;  4MMX B;  2VH0 B;  1A3P A;  1B9W A;  1EMO A;  2WPM E;  4Z0K B;  4Y71 B;  2WPI E;  2PUQ L;  2KB9 A;  2Y80 B;  4XLW A;  5IKQ A;  1G1T A;  4JYU L;  1UZQ A;  2BOH A;  4RRW A;  1IVO C;  1MQ6 L;  1QIU A;  5I46 L;  1F0R B;  4MMZ B;  1HT5 A;  3IJE B;  4Z6A L;  2P26 A;  2J4I B;  1P9J A;  3ENS A;  4Y76 B;  2BMG A;  3CS7 L;  1KLI L;  2P3F L;  1EQH A;  1CQE A;  4M11 A;  2VWO L;  2XC0 L;  3N8Y B;  1COU A;  1EMN A;  2NPR A;  1WHF A;  2Y81 B;  2WG3 C;  5JBA E;  3V64 C;  1KIG L;  3F6U L;  2FZZ L;  4PH9 A;  4RRX A;  1QFK L;  1APQ A;  4X8U L;  2XBV L;  3KQD L;  1V1I A;  3KQC L;  1OB1 C;  2RNL A;  2WG4 B;  3QH0 A;  1NQL B;  1EBV A;  1FAX L;  1YUK B;  1DX5 I;  4A94 C;  4CUE A;  1C5M F;  3BPS E;  2EI7 B;  1IQI L;  1URK A;  4ISH L;  3H5C B;  1TPG A;  1FFM A;  3GCW E;  2KNI A;  4CSY A;  3LN1 A;  4CUD A;  1UZJ A;  2VVV L;  3HS7 A;  4Y7B B;  1JV2 B;  2BOU A;  1MQ5 L;  4LMF A;  4OTJ A;  2P16 L;  1BF9 A;  2Y82 B;  2W3I B;  3ZYG A;  2VVC K;  4JYV L;  5EGM B;  2P94 L;  2K2S B;  3OLT A;  4BTI A;  2WPK E;  4ZAE B;  4D90 A;  5JB9 E;  2W3K B;  1DDX A;  4D0E A;  2Q1J B;  3CA7 A;  2YGP A;  1EQG A;  3V65 B;  2FLG A;  1IQK L;  3ELA L;  2WYG B;  4E1G A;  4JZF L;  1YUF A;  1LQD A;  2FD6 A;  3MDL A;  1WU1 B;  3SOV A;  3TZI A;  1HRF A;  3HS6 A;  2UWO B;  3QMO A;  1EPI A;  1NFW B;  2XC5 L;  3LC3 B;  1K37 A;  2K2T A;  1KLJ L;  1O5D L;  2WPH E;  2EI6 B;  3HO5 A;  2CJI B;  2BQ7 A;  4GU4 A;  1HX2 A;  1FF7 A;  2BZ6 L;  5JBC E;  2XBX L;  2Y5H L;  2GD4 A;  1IQJ L;  1HT8 A;  3KRK A;  1G2M B;  1V1H A;  1N7D A;  2W2Q E;  4G1M B;  3TGF A;  1UZK A;  1ZAQ A;  1LPG A;  1YUG A;  3Q7D A;  3LTF B;  4NG9 L;  2XBY L;  1EPG A;  1PFX L;  3QCW A;  1NPE B;  3M36 L;  3TH3 L;  5KIR A;  1PGE A;  1XFE A;  1NFX B;  3KK6 A;  5JVZ A;  5L30 L;  1K36 A;  4X8S L;  5CKM A;  3NTB A;  2KV4 A;  5F1A A;  6COX A;  2Y5G L;  2WFT A;  1APO A;  1M1X B;  1CX2 A;  2Y5F L;  3N8V A;  3U73 A;  4TGF A;  4Y79 B;  2P3T A;  4NA9 L;  1I0U A;  3POY A;  2XC4 L;  1EPH A;  3SW2 A;  5CKN A;  4C16 A;  3C9A C;  1LK9 A;  4NGA L;  3FBY A;  2VJ3 A;  2PHB B;  2W86 A;  1IQF L;  2ADX A;  1NFU B;  2J2U B;  1HAF A;  5JB8 E;  3FCS B;  1HZ8 A;  1DIY A;  3GCX E;  2BO2 A;  1W8B L;  2FLR L;  2I9A A;  3KL6 B;  3N8W A;  3NTG A;  1IGX A;  3SOQ A;  2J95 B;  2BT8 A;  5JVY A;  3BT1 A;  2YGQ A;  1FE2 A;  2BQW A;  4X8T L;  1ATA A;  3KQB L;  3KQE L;  1TLE A;  1NFY B;  2BQ6 A;  3N8Y A;  2JJL A;  5L2Z L;  4ZXX L;  5IKT A;  1LMJ A;  1FJS L;  2OYU P;  3U7U G;  2BSF A;  3P5B L;  5IKR A;  4CUF A;  2F9B L;  1U8C B;  4RS0 A;  1X7A L;  1IGZ A;  3N8Z A;  4GU3 A;  1EGF A;  1ATB A;  1KSN B;  3K9X A;  4XL1 A;  4O1Z A;  2W2P E;  1IQM L;  3ZYI B;  2Y7X B;  1L3Y A;  3TK5 B;  4YZU B;  4O02 B;  3ASI A;  3LN0 A;  2WPL E;  3SOB B;  2MGP A;  3NJP C;  1DVA L;  2Y7Z B;  4BTT A;  2UWP B;  4ISI L; 
#chains in the Genus database with same CATH homology
 1F0S B;  1FAK L;  1IQL L;  1U67 A;  3RR3 A;  5FDQ A;  1EAI C;  3S6X A;  4D0F A;  2PR3 B;  4RRY A;  1KLO A;  2TGF A;  3LTG D;  1UZP A;  5IKV A;  3TBD A;  4BDX A;  5L2Y L;  3PGH A;  4BTU A;  4JZD L;  3EGF A;  4XBM A;  3FFG L;  2P93 L;  2G00 L;  2VWL L;  1SZB A;  2MHP A;  2MGR A;  1L5G B;  1Z6C A;  4ZXY L;  5JW1 A;  1IOE L;  1IQN L;  3Q3K B;  2WPJ E;  4LOR A;  2W26 B;  2D1J B;  2OYE P;  2W2M E;  2VVU L;  4AQT A;  2P95 L;  3IIT B;  3N8W B;  1FSB A;  2J38 B;  2BOK L;  2VH6 B;  2BOX A;  1YGC L;  1N1I A;  1Q4G A;  4MMY B;  1CVU A;  3HO4 A;  3OLU A;  1CEJ A;  3N8X A;  4Y6D B;  2KL7 A;  4YT6 L;  2P3F N;  4JZE L;  3MQE A;  3LAQ A;  3M37 L;  4Z0L A;  3HPT A;  1IQH L;  2JKH L;  4COX A;  1NT0 A;  1CVW L;  1WHE A;  1V3X B;  4OTY A;  3GIS X;  3LIW B;  2DDU A;  1W7X L;  2EI8 B;  2WYJ B;  4BXS A;  1Z6E L;  4Y7A B;  1CCV A;  1LPK A;  3CEN L;  2VWN L;  5E8D A;  4RUT A;  2Y38 A;  1JL9 A;  4FM5 A;  3R05 A;  3LC5 B;  1YO8 A;  5JBB E;  1IJQ A;  4YT7 L;  5COX A;  1LMM A;  2RHP A;  3TK6 B;  4ZH8 B;  2UWL B;  1P0S L;  1J9C L;  3ZYJ B;  2H9E L;  1XKA L;  1PXX A;  1GK5 A;  4BDW A;  5F19 A;  2RA0 L;  4RRZ A;  1IP0 A;  3BT2 A;  1HJ7 A;  1PRH A;  2WFX B;  2P3U A;  1PTH A;  2J94 B;  2H9E C;  1CCF A;  2J34 B;  1F7E A;  2XBW L;  3DEM A;  1G1S A;  2P28 B;  1IQE L;  1AUT L;  1IOX A;  3KCG L;  1G1R A;  4A7I A;  1XKB A;  5CIS A;  1EZQ B;  2WZP P;  2W2N E;  1F7M A;  2YGO A;  1JBU L;  1EPJ A;  3NT1 A;  4BXW A;  5CKQ A;  1DQB A;  3HO3 A;  1ADX A;  1HAE A;  1LPZ A;  1HRE A;  2AYL A;  3CFW A;  1ATE A;  1G1Q A;  5K0H B;  4X8V L;  3HS5 A;  1NZI A;  1TOZ A;  2FLB L;  2VWM K;  3F1S B;  2B7D L;  4ZHA B;  1G2L B;  2W2O E;  2I9B A;  5KN5 C;  4M10 A;  1MOX C;  2M74 A;  1HCG B;  1RFN B;  1ATD A;  1IQG L;  1XDT R;  4MMX B;  2VH0 B;  1A3P A;  1B9W A;  1EMO A;  2WPM E;  4Z0K B;  4Y71 B;  2WPI E;  2PUQ L;  2KB9 A;  2Y80 B;  4XLW A;  5IKQ A;  1G1T A;  4JYU L;  1UZQ A;  2BOH A;  4RRW A;  1IVO C;  1MQ6 L;  5I46 L;  1F0R B;  4MMZ B;  1HT5 A;  3IJE B;  4Z6A L;  2P26 A;  2J4I B;  1P9J A;  3ENS A;  4Y76 B;  2BMG A;  3CS7 L;  1KLI L;  2P3F L;  1EQH A;  1CQE A;  4M11 A;  2VWO L;  2XC0 L;  3N8Y B;  1COU A;  1EMN A;  2NPR A;  1WHF A;  2Y81 B;  2WG3 C;  5JBA E;  3V64 C;  1KIG L;  3F6U L;  2FZZ L;  4PH9 A;  4RRX A;  1QFK L;  1APQ A;  4X8U L;  2XBV L;  3KQD L;  3KQC L;  1OB1 C;  2RNL A;  2WG4 B;  3QH0 A;  1NQL B;  1EBV A;  1FAX L;  1YUK B;  1DX5 I;  4A94 C;  4CUE A;  1C5M F;  3BPS E;  2EI7 B;  1IQI L;  1URK A;  4ISH L;  3H5C B;  1TPG A;  1FFM A;  3GCW E;  2KNI A;  4CSY A;  3LN1 A;  4CUD A;  1UZJ A;  2VVV L;  3HS7 A;  4Y7B B;  1JV2 B;  2BOU A;  1MQ5 L;  4LMF A;  4OTJ A;  2P16 L;  1BF9 A;  2Y82 B;  2W3I B;  3ZYG A;  2VVC K;  4JYV L;  5EGM B;  2P94 L;  2K2S B;  3OLT A;  4BTI A;  2WPK E;  4ZAE B;  4D90 A;  5JB9 E;  2W3K B;  1DDX A;  4D0E A;  2Q1J B;  3CA7 A;  2YGP A;  1EQG A;  3V65 B;  2FLG A;  1IQK L;  3ELA L;  2WYG B;  4E1G A;  4JZF L;  1YUF A;  1LQD A;  2FD6 A;  3MDL A;  1WU1 B;  3SOV A;  3TZI A;  1HRF A;  3HS6 A;  2UWO B;  3QMO A;  1EPI A;  1NFW B;  2XC5 L;  3LC3 B;  1K37 A;  2K2T A;  1KLJ L;  1O5D L;  2WPH E;  2EI6 B;  3HO5 A;  2CJI B;  2BQ7 A;  1HX2 A;  1FF7 A;  2BZ6 L;  5JBC E;  2XBX L;  2Y5H L;  2GD4 A;  1IQJ L;  1HT8 A;  3KRK A;  1G2M B;  1N7D A;  2W2Q E;  4G1M B;  3TGF A;  1UZK A;  1ZAQ A;  1LPG A;  1YUG A;  3Q7D A;  3LTF B;  4NG9 L;  2XBY L;  1EPG A;  1PFX L;  3QCW A;  1NPE B;  3M36 L;  3TH3 L;  5KIR A;  1PGE A;  1XFE A;  1NFX B;  3KK6 A;  5JVZ A;  5L30 L;  1K36 A;  4X8S L;  5CKM A;  3NTB A;  2KV4 A;  5F1A A;  6COX A;  2Y5G L;  2WFT A;  1APO A;  1M1X B;  1CX2 A;  2Y5F L;  3N8V A;  3U73 A;  4TGF A;  4Y79 B;  2P3T A;  4NA9 L;  1I0U A;  3POY A;  2XC4 L;  1EPH A;  3SW2 A;  5CKN A;  4C16 A;  3C9A C;  4NGA L;  3FBY A;  2VJ3 A;  2PHB B;  2W86 A;  1IQF L;  2ADX A;  1NFU B;  2J2U B;  1HAF A;  5JB8 E;  3FCS B;  1HZ8 A;  1DIY A;  3GCX E;  2BO2 A;  1W8B L;  2FLR L;  2I9A A;  3KL6 B;  3N8W A;  3NTG A;  1IGX A;  3SOQ A;  2J95 B;  5JVY A;  3BT1 A;  2YGQ A;  1FE2 A;  2BQW A;  4X8T L;  1ATA A;  3KQB L;  3KQE L;  1TLE A;  1NFY B;  2BQ6 A;  3N8Y A;  5L2Z L;  4ZXX L;  5IKT A;  1LMJ A;  1FJS L;  2OYU P;  3U7U G;  3P5B L;  5IKR A;  4CUF A;  2F9B L;  1U8C B;  4RS0 A;  1X7A L;  1IGZ A;  3N8Z A;  1EGF A;  1ATB A;  1KSN B;  3K9X A;  4XL1 A;  4O1Z A;  2W2P E;  1IQM L;  3ZYI B;  2Y7X B;  1L3Y A;  3TK5 B;  4YZU B;  4O02 B;  3ASI A;  3LN0 A;  2WPL E;  3SOB B;  2MGP A;  3NJP C;  1DVA L;  2Y7Z B;  4BTT A;  2UWP B;  4ISI L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...