1O5FH

Dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
255
structure length
248
Chain Sequence
IVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFNSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease hepsin
publication title Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine protease, hydrolase
total genus 60
structure length 248
sequence length 255
ec nomenclature ec 3.4.21.106: Hepsin.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5fH01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5fH02
4X1PU 1GI8B 4RKOB 5EXLA 2QV1A 4HGCA 3BEIB 1HNEE 1S84A 1TA2A 4K3JA 5J4SA 1GJDB 2AGEX 5CMXH 1QNJA 4INHA 1X7AC 4ABGA 5L2YH 1QBNA 4DIIH 1MTSA 3MU1A 3M7TA 3MYWA 4BXWA 2LPRA 3KQEA 9LPRA 1SGCA 1L1JA 3NXPA 3P6ZB 1FPCH 1TRNA 4NIXA 1KDQA 3SGBE 4JZIA 3MU4A 3SGAE 4I8HA 5E8EH 1CBWC 1TE0A 3VB6A 2GT7A 2W5EA 5T3HA 2UWPA 1TMUH 1YCPM 2VGCC 1MU6B 1O2LA 5FCRA 1SMFE 1E37B 1IQLA 5FBIA 3RMOH 1O3DA 1HAVA 3T28A 3SJ8A 1TLDA 2AMDA 1KLTA 2IN2A 2FMJA 2GVFA 2HOBA 1EAXA 3ZV8A 3SW2B 1K21H 2Y6TA 2ZDAH 4ISIH 1DWBH 2BM2A 4JZFH 1QL7A 1AHTH 4IMZA 1O2SA 1Y3UA 1V2PT 1ZMNA 2AGGX 2W3KA 2ZFQH 3SU5A 2AERH 2WYGA 1L1GA 1NC6A 2P59A 3GCOA 2IJOB 1G36A 2FIRH 1F2SE 1MTWA 3P95A 2BVSH 2PKSC 1QQ4A 2A2QH 3M61U 5JB9S 1GBEA 3TK6A 2EC9H 1BZXE 1YPHC 1Y5AT 1W11U 1HAHH 1TGSZ 3SJOA 2H9HA 2GCHG 1IQHA 1C5OH 1UTQA 4DVAU 1RTLA 4JK5A 1EZQA 2WV4A 1QB6A 1MKWK 3C27B 2J4IA 1P3CA 3SV7A 1Y3XA 2VVVA 4WMFA 1QURH 1XX9A 2QA9E 3SNDA 6CHAB 4RKJB 4TY6A 1D6WA 2ODPA 1UTMA 4FU7A 1N1LA 2OBQA 2BXUH 2ZPQA 3RXOA 2H1UA 2VVUA 2XBYA 3M5MA 4O3UA 4OS7A 2TPIZ 3GCHB 3GY4A 3LGVA 4FXGH 3P8OA 2C8XB 1V2ST 1HJAB 2TRMA 1Z8GA 3ZV9A 1PPFE 4D7FA 3KL6A 2O8TA 1DITH 3O8BA 2ZU3A 3EQ0H 3U98H 3E6PH 2HLCA 2JH0D 7KMEH 1F0UA 4BAOB 1KXCA 3F9GA 1J9CH 1A5IA 1SLVB 2XC0A 1BA8B 1F7ZA 1TPOA 2ZCLP 4F49A 2ILNA 3T27A 2BDCA 4KP0A 2NWNA 2BY5X 3RLWH 3GCTF 4B76A 2BDBA 3STIA 2AFQB 3A84A 1A5HA 5HM2A 1MQ6A 1MCTA 1L2EA 1XKBC 5C2ZA 2OBOA 1HXFH 2WPHS 3HK3B 1ELCA 2H5DA 1Y3YA 2TGPZ 4CHAC 1GMHG 2CJIA 3G01A 3ZVEA 8GCHF 3ATWA 4Q80A 9ESTA 1BHXF 4CRGA 1G32B 3PB1E 1ESBA 3PWBA 1J8AA 3LU9B 2A5KA 4AORA 3A83A 4D8NA 2V3HH 1QL9A 2BY8X 2V35A 1EOLA 5B6OA 1HFDA 1RTKA 5SGAE 3ENSB 2A31A 1GBKA 1L4ZA 3RXEA 1GL1A 2FTLE 3GY2A 1OP0A 4AFSA 2FESH 1ZHRA 4Q7XA 1NFYA 2FI5E 3TPIZ 1UTOA 4Q7ZA 2ZGXH 1AGJA 1FN8A 2D2DA 2QC2A 4ZKSU 1ELEE 1O34A 1LPGB 3AW0A 3SJKA 3P8GA 2GDDA 4GCHF 4X2XA 3S0NA 1KLJH 2CGAA 5ESTE 4Y11E 5FPTA 1N6YA 2GX4A 2AS9A 4IW4E 3SUDA 2QXIA 3EA8A 2G52A 5ETXA 2ZU1A 4AYYB 3QLPH 4SGAE 4LZ4B 5LGOA 1P2OA 4GPGA 1SI5H 4KTCA 4Q7YA 1TQ0B 3RXKA 4DJZB 1Y5UT 1FPHH 1KXAA 1P2JA 2PUXB 3SU6A 2BLWA 2AYWA 2FS9A 4AOQA 2EI7A 1AVGH 1SGFG 2FOMB 1AIXH 1GI7B 1JIRA 1CE5A 5BRRE 1RXPA 1DLEA 4FUBA 1ELVA 5HYOA 1L1NA 2P16A 4ISLA 3TK5A 1F5RA 3UFAA 1GHXH 2FOAA 1BTZA 1C1PA 1O3JA 2OXSA 3I78A 1FQ3A 4Y7AA 4GHQA 1OWDA 1G3DA 2PSXA 3GDUA 5JYIA 4YT6H 3VB3A 1ZRBA 5BPEA 1P03A 1GJAB 1W7XH 3M3VA 3QK1A 1O2YA 3H5CB 4ZAEA 4I8KA 4I7YH 4D76A 1W8BH 2H6MA 2Y82A 2EI8A 4RN6A 4MG3A 1Z71A 4NZLA 2V6NA 1S83A 4ZUHA 2OP9A 1THSH 4IMQA 4Q2KA 3KF2A 4O3TA 5AFYH 5DP3A 3GCNA 1DPOA 1TPPA 1O3FA 3OX7U 2XYAA 5PTPA 1PJPA 4K2YA 2VIQA 1E0FD 1PFXC 2OINA 1C1NA 4F4OC 2PLXA 2ZZUH 4BTTB 2Z6BD 1C2MA 1QHRB 5L6NH 4K60A 5JBAS 2DE8A 1O0DH 1DVAH 4E7NA 2PGQB 2ZDLA 4KGAA 1MKXH 1O2RA 3MO6A 1FAKH 2IPHA 4U2WA 3P70B 1WTHD 4YLUA 5HGGA 1GGDB 1TBQH 1CVWH 1KDQB 1P01A 2P95A 1KSNA 4CR9A 4BXSA 1SQTA 3A8CA 3SV9A 1JMOH 1T4VH 4B2AA 4BAKB 6CHAC 1QL8A 2XWBI 5EPNA 3A81A 3OSYA 1O3KA 1C1VH 1YPGH 4NFFA 5C1XA 3VB5A 1UTLM 1LO6A 2FM2A 2JETC 3CP7A 4I8JA 4BAHB 3LGUA 1C2JA 1HJAC 1C2DA 1J17T 4KELA 3A7YA 1F5KU 5EODA 5DP9A 1AU8A 1EZXC 3SUFA 1WV7H 1LKBA 3ZZ3A 1EAIA 3W95A 1DE7H 1Y5BT 2BQ7B 2FYQA 3D23A 2ZEBA 1PPZA 2ZCHP 4OS4A 2XRCA 1TB6H 3BG8A 1O2JA 1IQNA 5C5NA 1GBIA 3RXAA 1MD8A 4ABIA 2RA3A 1O5EH 1C5YB 3MNCA 2ZNKH 1RTFB 4XBCA 2XBXA 2DUCA 2HALA 4UEHH 2FO9A 1NU7B 3VB4A 3SNEA 2UUFB 1PPEE 1UVPA 2WPMS 1V2JT 4LK4A 1S6HA 1IQGA 1NT1A 1SOTA 3GYMA 1OX1A 4BANB 3MO9A 2OQ5A 2BZ6H 3BEFB 4FUHA 1P0SH 4HFPB 4IC5A 1TYNA 3S9CA 2P8OB 1C2HA 1QB1A 1TRMA 4B2CA 1EXFA 1MAXA 4AFQA 1JRTA 5JPMH 2FI3E 1P04A 3K6ZA 4TWYA 1AWHB 4CRBA 1S6FA 2Z7FE 4XE4A 5C67A 1O3PB 1TOCB 1ESAA 1IQJA 1CT4E 2OD3B 3A87A 3QDZB 4UFFH 3O8DA 1BB0B 3LGTA 2LNCA 3LIWA 4I31A 3P8FA 3UIRA 1GHVH 3SQEE 1UTNA 4ZKNU 5FCKA 4ABFA 2PKAA 5CE1A 4WXIA 1J14A 3S7HB 1LQDB 1KXFA 3NWUA 1ZSKA 5JBTA 3A8BA 4ZKRU 2UWOA 1TMBH 1LVYA 2Z94A 3L6PA 6ESTA 5T6GA 2F9OA 2ZGBH 2UUJB 1ZTJA 3Q77A 1MMJN 4XOJA 2VU8E 3RXJA 4DGJA 4THNH 1YGCH 1SHYA 3T26A 5EG4A 1JBUH 1QCPA 3BN9A 3RC6A 1OS8A 4DG4A 2ZFSA 1TNIA 3SHAH 1F0TA 2A45B 4Y8XA 3EYDA 3M5OA 5LH8A 1AN1E 4ABAA 1SFQB 1TBZH 3ZZ4A 3RXCA 1GBTA 1NFUA 1UCYK 1B7XB 2SGPE 1DWEH 2G4TA 1KXEA 4DCDA 3RM2H 2NU3E 4CBOA 3K9XB 1GDUA 2NU1E 1ANDA 2WPLS 4MNVA 5F8TA 3BTQE 1SGRE 4LZ1H 3U8OH 1TX8A 3ZYDA 5TCCA 2NU4E 1YYY1 1GDQA 1TMTH 1HXEH 5ESBA 3TH2H 1BMNH 1GWAA 1K22H 4Y6DA 1BTHH 1L0ZA 1WCZA 2QF0A 3QUMP 4X6NA 2QXHA 2A2XH 4Z6AH 3KIDU 4AFUA 4K69A 1LVOA 4PROA 2Y5GA 4K1SA 1LHDH 1GDNA 3SU0A 1A5GH 1V2KT 1XUGA 1WSSH 1LQEA 2O8LA 1UVUH 3RMNH 3E0PB 1D6RA 2VNTA 4BNRA 3A88A 1OWKA 3MNSA 2PHBA 1EQ9A 2A5IA 2STAE 3A7ZA 5C1UA 3KQCA 3BEUA 1GGDC 1EJNA 3SNCA 3PMAB 2VIOA 1AWFH 1SHHB 1V2RT 1UK4A 2J94A 4JMYA 2AMQA 2HNTC 1JXPA 4MNXA 1PPCE 2G5NA 3SU1A 3P17H 4WJG2 1PQ7A 3LC3A 2WUBA 3TGJE 2I6QA 5A2MH 1BTWA 1ZPBA 3C1KA 2XTTB 1O2UA 3T5FH 1SB1H 5JBCS 2VWOA 2A4RA 1GVKB 2SGFE 1RIWB 2Z3EA 1G9IE 1O2ZA 1LPZB 2ZC9H 1ETSH 2GCHF 1MTNB 3ZYEA 2O8MA 1FY8E 4MPWA 1S0QA 3AASA 2ZTZA 1V2LT 4E05H 4BAMB 4OS6A 1EX3A 1AI8H 2XW9A 2FLRH 1C1QA 3TJOA 3LJJA 3RXGA 1UK2A 1ZR0A 3MHWU 1WYKA 2XXLA 4MLFB 1LVBA 1ORFA 1W7GH 4X1QU 1SL3A 2EI6A 4WMDA 4ZKOU 5IDKA 1KTTB 1P2MA 1P2IA 4NIYA 3F1SB 1GI5A 2WPIS 1ELBA 1EUFA 4RSPA 1W10U 2IOTA 2QAAA 3WY8A 5DP7A 2A4GA 2UUYA 4FUGA 3MH7A 1WBGB 2BD2A 1UTPA 1GJBB 2WYJA 1NM6A 2SGEE 1FXYA 1PYTC 4FUFA 5F6MA 2ZDKA 2D26C 1ELAA 3E0NB 2P8OC 2XBWA 1BTXA 1TA6A 4JYTA 3U8TH 1O2IA 1ZRKA 3MMGA 5DJ7A 4E7RG 2W3IA 3AW1A 3HKJB 4MNYA 3LOXA 3BTME 4AGJA 1YM0A 2SGQE 2WPKS 1EB1H 2ZDVH 1VCPA 3F68H 2JKHA 3ITIA 5GDSH 1ELDE 5EQQA 5JDUB 1C4U2 1GMHF 1EP5A 2Z9KA 2O8UA 1C1RA 4X0WU 1Z1IA 1FMGA 2HPPH 3UOPA 3VB7A 3EAJA 4AN7A 3FZDA 1C9PA 2JH6D 4BOHA 3M37A 3HGNA 1G3BA 1YLCA 1SSXA 3O8CA 1B5GH 4ISNA 5IYTA 1PPBH 2YOLA 1AFQC 1C4Y2 1H8DH 1NU9A 2F9PA 1QIXB 4CH2B 1MKWH 1P2NA 4IN1A 1TNHA 2PSYA 5K0HA 2FPZA 3IITA 5EQSA 1HAYB 4X6PA 1O32A 1SGIB 1LCYA 2V3OH 1W14U 1ZOMA 4JZDH 4MQAA 4DURA 4WH6A 2TGTA 4WH8A 3S69A 3GY8A 4B75A 1B0EA 1A3EH 1DX5M 5A0AE 4IS5A 3GY5A 1C5UA 1YPKH 3RXBA 1SBWA 2ZF0H 3UY9A 2ZQ2A 1BRUP 1XXDA 2ZO3H 1O3IA 3M36A 1GJ7B 4O97A 2WPJS 1SGYE 4NSYA 5DP6A 2R0KA 1FNIA 1GMDG 1Q31A 2BX3A 3DUXH 1IOEA 1T32A 2P93A 3ZZ7A 3ESTA 1FLEE 2ZHDA 2ESTE 2PKAB 2G4UA 2D8WA 1G2MA 1BBRK 1GJ4H 5AF9H 1EJMA 4Y8YA 1OKXA 4IBLH 3TGIE 1BJVA 3ZVFA 1P12E 1AZ8A 3BTFE 3QX5H 1FN6A 1EZUC 1ZTLA 1ZYOA 1LHGH 1V2OT 3BG4B 1VCWA 2Z3DA 4K5ZA 3HK6B 4YTAA 3FZZA 4KKDA 3QN7A 1YCPK 3MNXA 4UFEH 3KGPA 3S9BA 1FONA 1V2VT 1YPLH 4OGXA 4MPUA 3LT3A 2C8YB 1SGDE 2SNWA 3NKKA 2AIQA 5DG6A 2BMGB 1AO5A 5FBEA 1GI9B 1F0RA 4TWWA 2Y81A 2GDEH 3RC4A 1SQAA 5DGJA 1HLTH 4UONA 1SG8B 1XVMA 2BD7A 2J34A 7ESTE 2B0FA 4ZROA 5A0BA 3FP6E 2TGDA 1ZLRA 3EE0B 1QFKH 2F9NA 1NTPA 4QT8C 5HXFA 4WMEA 3VXFH 5DO4H 3ZZDA 1QB9A 2FODA 1OWIA 1HJ9A 1K9OE 1RIWC 4NA9H 1GI1A 5DP4A 1P57B 1CT2E 3LDXH 2BD5A 2ZPSA 1C2KA 1AB9B 3OYPA 4XSKU 1S81A 5DPAA 4XFQA 5GCHG 5TJXA 1MTNC 2EA3A 3RXMA 3RP2A 1Z1JA 3K2UA 1QBVH 1JRSA 3RXUA 1GBAA 2D1JA 1P2KA 2THFB 5C5OA 4I32A 4LXBH 1ESTA 2FOFA 1E38B 1AKSA 3QTOH 4NCYA 1NROH 1C5PA 3K6YA 1XUIA 1ANBA 2XWAA 2ZPRA 1HAIH 1DFPA 2F9UA 3T29A 4ABHA 1TNJA 4BTIB 1GI2A 1DY9A 3PM3A 2HGTH 3V7TA 1XUJA 2XBVA 3BTKE 1BITA 5L30H 1N8OB 1SOZA 1V2MT 1QJ7B 4Y8ZA 1AZZA 1O2MA 2HNTE 3MH4A 1O5CB 3PTBA 3KN2A 2R2MB 1T8NA 1QGFA 7GCHG 3RU4T 2FLBH 1GMCG 3F9EA 4AYVB 1RRKA 3FVFB 1OP2A 1F0SA 3R0FA 3GISB 1SVPA 1DANH 6GCHG 3LH3A 2ZWLH 5A09A 3PLPA 2GTBA 1FY1A 1NPMA 1EPTB 3A7XA 3ATKA 1C1TA 1P09A 1Z8JB 4A5TS 1LHCH 2SGAA 1QRXA 2STBE 2XCFA 1DS2E 1CU1A 3RXHA 1AQ7A 3SU4A 1CGJE 2ZDMA 2VWNA 5JB8S 4CRCA 1C5TA 3EA7A 1O38A 5FXLA 1P11E 1TRYA 2ANWA 1O2VA 3GICB 2GGVB 4OS5A 1Q2WA 1TAWA 4ABBA 3URDA 2BB4A 3NCLA 1CHOG 3CS7A 2VWMA 1EZSC 2VIVA 1O2QA 2P94A 1JWTA 3NK8A 4J2YB 3TJVA 5AHGH 1XUHA 1TPAE 4HZHA 3TVJB 4A6LA 1J16A 1F92A 1GI3A 2BY7X 4Z0KA 2GV6A 4UFGH 1O3CA 2J2UA 1O5FH 1A61H 1O2KA 2Z3CA 1GJCB 2WINI 1FJSA 1Y8TA 3RXFA 1TX6A 1VJAU 1QRWA 3MNBA 1H8IH 4Y0YE 4NWLA 5GJ4B 3TGKE 1LHEH 1ZJKA 2FOHA 1VGCB 3I77A 3QTVH 8ESTE 4U01A 1HJ8A 2FI4E 2HPQH 2ZGJA 3GCHC 1CSOE 1Z8IB 2H5CA 3ZVDA 4AX9H 3CENA 3V13A 4H4FA 5E0HA 5C1YA 3LKWA 3DHKH 4SGBE 1ELGA 1P02A 2VIDA 2F9VA 1FZZA 5C20A 2BVXH 2FX4A 4YO9A 1D3TB 5FAHA 1MQ5A 4X1SU 2ZHWH 1C5MD 3LC5A 4VGCB 3BSQA 2BQ6B 4GLYA 4OS2A 1GHAG 5FPYA 3SBKA 1UVOA 3BG4C 2C3SA 1BT7A 2BTCE 2NU2E 3SJ9A 4FVDA 1T8LA 1YPHE 1O33A 2BY9X 4OS1A 1C5WB 1DOJA 5F8XA 3TH3H 3M3TA 3M3SA 2Q1JA 2QXJA 2P3TB 4NIVA 4B2BA 2Y80A 1MH0A 4UFDH 2BLVA 1BHXB 2AIPA 2QIQA 1O2PA 1ABJH 4X6OA 1ANCA 4MPXA 3SUEA 1GCTB 2ALVA 1K28D 2QXGA 1W12U 3NPSA 1FIZA 1AMHA 3SI4H 3I29A 4FVBA 4TY7A 4Y71A 1HAOH 4ZXXH 3PLBA 1YBWA 1WU1A 2ZTXA 1C5VA 3B9FH 3M7UA 4D9QA 5FPSA 1QBOA 3FFGA 5TCAA 3UNSA 1HIAB 1T4UH 4K8BA 1BJUA 1AB9C 2P3UB 3A86A 1A1RA 1DLKB 3KQBA 1UVSH 4ZMAH 2BOKA 1S82A 3RUOA 3FAOA 1G3EA 1RS0A 1B0FA 2UUKB 1YKTA 3BF6H 3F9HA 1O2XA 1GHBG 2OUAA 5T6DA 1C1MA 1GJ8B 4K1TA 1ZPZA 4CRAA 2A7CA 3A7VA 2ZFFH 3UNRA 1OSSA 2VIWA 3PMHB 1Q3XA 1UCYH 2HWLB 2XCNA 1FAXA 1FI8A 1C5XB 1CA0B 1NO9H 2QCYA 2ZFRH 1N8OC 1K1LA 1U6QA 3DFLA 1UTJA 2BD8A 4B74A 1GBMA 1BTUA 4H6SB 3U1JB 2O9QA 1DY8A 3E1XB 2NU0E 1AY6H 1MTUA 2M5TA 4DOQA 4ZH8A 1TALA 1VITG 5EW1H 2BHGA 5DP8A 3GDSA 1EPTC 3P92A 3RXRA 1P8VC 3BTDE 2YNAA 2PWXA 2ZFPH 1TNGA 1O3BA 3NUMA 4ISOA 1S85A 2FWWA 1AKSB 2ZHQH 1CGHA 4NA7A 3SU2A 1ACBE 1HDTH 2ZCKP 2ZKSA 1O3MA 2PV9B 4JZEH 5EOKA 1XUFA 1DT2A 5G4BA 3EDXB 3UUZA 3GY3A 8LPRA 4FUDA 1C5NH 1GBHA 1DWDH 1CO7E 1O2HA 1XM1A 2OC1A 1AD8H 2BY6X 4YOIA 4X1RU 3AVZA 1C5LH 1LTOA 1BMAA 2BZAA 5GWZA 4YOGA 2C4FH 2CHAB 2G55A 3KHVA 1LKAA 1NRQH 3TLOA 3Q3XA 4FUJA 2SFAA 3N7OA 3A80A 3CS0A 3PWCA 3E8LA 1IAUA 1SR5C 2BXTH 1A46H 3UREA 2JH5D 2VINA 2TBSA 2UWLA 3D65E 3LH1A 5EXNA 5L2ZH 1QRZA 5LPEA 3VGCB 3PROA 3DD2H 3TJNA 3A7TA 5C3NA 3MU5A 3KCGH 1ZJDA 3FP8E 4TYDA 3RU4D 4NGAH 1D3DB 3UTUH 3BIVH 1DXPA 5E0JA 1ARBA 1DICA 3ODFA 1ARCA 2OTVA 1VGCC 3SZNA 1EJAA 1KXDA 4MTBA 1O37A 1CGIE 5EQRA 3W94A 4BTUB 1C1OA 5I25A 2ZG0H 3A7WA 1RJXB 2ANMH 1CA8B 3UPEA 3RM0H 5AVDA 1MD7A 1G2LA 1C2LA 1HAZB 1MZAA 2TIOA 3IWMA 1EPTA 2BDYA 3DA9B 2ODQA 3A85A 5JBBS 1YC0A 5E0GA 1TGNA 3OY6U 1F5LA 1GI4A 2G8TA 4X2WA 1DSTA 3UNQA 4VGCC 2A1DB 4A1TA 1TPSA 1V2QT 1T7CA 1UK3A 1NN6A 4KTUA 1ANEA 2A5AA 3Q00A 3EA9A 1GMDF 1BIOA 2R3YA 2GZ7A 2RG3A 1ABIH 2OC7A 5FHTA 1XKAC 4A7IB 4B73A 1V2TT 5HMAA 3RU4E 2AH4X 2ASUB 1GPZA 1P9UA 2R0LA 3IG6B 1C5QA 1KTSB 1TOMH 1OWHA 3PYHA 3L33A 2VB0A 4NFEA 3SOSA 1GCTC 3SI3H 1ELFA 2BD9A 2G51A 2VWLA 3MTYA 4X8VH 1NZQH 4NSVA 1A0LA 1ETRH 3E16B 1A2CH 2Y5FA 1WQVH 3MU8A 4ABEA 1QA7A 1KLIH 3GYLB 1ZTKA 3ZZ5A 1K1MA 1MBQA 1DDJA 1O2OA 1QQUA 1HUTH 1K1OA 1V2UT 1GJ6A 1AUTC 1O5GH 4R8TB 4GUXA 5EW2H 3SNBA 3P8NA 1A0HB 1UMAH 2F91A 2A0QB 2R9PA 2G81E 1C1UH 1FIWA 4GVUA 2SGDE 1GHZA 3ATIA 4X8TH 4X6MA 4U30A 1UVTH 1T31A 1K1PA 1SGFA 1O3AA 3RXLA 3KEEA 2H2ZA 1O3EA 1BTYA 2OLGA 1IQMA 3PMJA 1ZMLA 4J1YA 1CT0E 3MH6A 1BOQA 1XUKA 2PTNA 3ZZ6A 2QYIA 5EGMA 4YZUA 1XMNB 1W0YH 5GXPA 1TGCA 1H9HE 2Q6GA 1D9IA 1TBRH 1Y59T 1MZDA 2Y7XA 2TGAA 3JZ1B 1O36A 4U32A 3Q76A 1CA0C 1GBCA 3RXQA 5GCHF 3QGJA 2QN5T 6LPRA 2BDHA 1YPMH 2ZU5A 4ZHMU 1HAGE 2XC4A 1KY9A 1SGPE 1ZHMA 1GBLA 1UO6A 2FOGA 3MU0A 3RDZA 2FZZA 3H7TA 2VH0A 3HKIB 1BBRH 3RMMH 1HAXB 1LHFH 3GOVB 2PUQH 3BIUH 4E06H 2ZU4A 1PQ8A 1BRCE 2FXRA 3LGWA 1VITH 4NG9H 2A7JA 4ABJA 4AB8A 1TWXB 4AB9A 3D62A 1WUNH 3V0XA 1LMWB 1GVZA 4DY7B 1J15A 1FY3A 3S9AA 1O30A 1T8MA 2ZQ1A 1EKBB 1HIAA 2HNTF 1Z6EA 2CN0H 4CBNA 1UHBA 1HRTH 1YCPH 1Z6JH 1XVOA 3QZRA 4ESTE 3A89A 7GCHF 3GDVA 1NY22 1GMCF 1TGBA 3E3TA 3PV4A 2JETB 4HI3A 4IC6A 2PGBB 2C8ZB 3SV2H 6GCHF 5FX6A 2BD4A 3RXTA 4H6TA 2C90B 1MTVA 1THRH 3K65B 2CHAC 1SGEE 2J92A 1FV9A 3AAUA 1GBFA 5GPIB 3RXDA 3U69H 1ELTA 4A92A 4I8GA 1MUEB 1PPHE 2ZGCA 2HVXA 4IGDA 1N6XA 1P9SA 2H9TH 1TGTA 4I33A 3TITA 3VGCC 1SPJA 1Z7KA 4I8LA 1O3NA 2ZFTA 1AE8H 1BTPA 3EGKH 3M35A 1AVXA 2A4OA 2OQUA 2FDAA 1AFEH 4JYVH 4JK6A 3RC5A 1WTGH 1S0RA 1EP6A 3DT0H 2B7DH 4KTSA 4X8SH 2XC5A 3MI4A 3SV8A 3LJOA 1CHOF 1CQQA 4FUIA 2B9LA 2CF9H 1HCGA 2PR3A 3KNXA 1DXWA 3VPKA 4ZXYH 2GMTB 1O2NA 5DKMA 4JYUH 1L4DA 4ISHH 4AFZA 1Z8RA 4AZ2B 2FX6A 3E90B 3BTHE 5E2OA 3RXIA 1GJ5H 3SJIA 1NRRH 1GBJA 3HATH 1C2FA 3MH5A 3MFJA 1OWJA 4UE7H 4WF8A 2FEQH 4FU9A 3JZ2B 1IHTH 3T62A 2ZDNA 3BTWE 3TIUA 1UCYE 2W7SA 4OGYA 2CMYA 1GHYH 4DIHH 1AVWA 2GT8A 1GHWH 3LGIA 4HTCH 3TK9A 1P3EA 4XBDA 1P2QA 3E91A 1KIGH 2G5VA 1OXGA 1P06A 1OOKB 1AUJA 4TPYA 1YLDA 1IHSH 1NRPH 1YPJH 2F3CE 2Q6FA 2CV3A 1C2GA 1GHAF 4D7GA 4Y0ZE 3ODDA 3T2NA 1BQYA 1BRBE 4UDWH 1GVLA 1TFXA 5A8ZA 1PYTD 2KAIA 4XDEA 1W0ZU 1YP9A 4LOYH 3LPRA 2R2WU 1D4PB 5A8YA 1THPB 3URCA 2ZA5A 1Y3WA 3MOCA 3V12A 3QGNB 3BV9B 1NFXA 1NRNH 1QR3E 3HGPA 4ABDA 3VFEA 1TNKA 5A0CA 1O3GA 1DUEA 1IQFA 1TIOA 2GP9B 3ZVCA 2CF8H 4Y7BA 4YLQH 5CHAB 3QWCH 1SLUB 3GCTG 1LVMA 3F9FA 1HYLA 2C8WB 3ELAH 2ZTYA 1ZMJA 3A82A 1ZHPA 1V3XA 2ZECA 8GCHG 1A0JA 3O8RA 3OY5U 1HBTH 1TABE 4JZ1A 1DM4B 2FP7B 2BD3A 3SHCH 3MWIU 1D3PB 3A8DA 2G00A 1WOFA 4FUCA 2GD4B 3PO1B 1K1NA 2P3FH 3RLYH 1BUIA 3DFJA 1RFNA 1WQSA 2QY0B 4DT7B 1INCA 1TX7A 5ABWA 2BX4A 2GZ8A 4NIWA 1GCDA 1K1JA 4WXVA 4AG2A 1JIMA 1Y3VA 1GHBF 2J9NA 3ZZCA 5DP5A 5GIBA 3S7KB 1BMMH 2BLOA 2FOCA 3PLKA 3ZZBA 2ODYB 1SGNE 2EEKA 2C93B 1O31A 2VVCA 2BOHB 5EXMA 1G30B 1VZQH 2FOEA 3OU0A 5DK1A 1EOJA 2GCTB 4CR5A 1SGQE 4GCHG 4B1TA 3H7OA 1H9LB 3FANA 1HPGA 3SN8A 1GG6B 1MKXK 1C1WH 2A32A 3F6UH 3RXSA 3TNTA 3L3TA 1HAVB 2OC0A 4X8UH 1O2WA 4ZHLU 1KXBA 1G37A 2FOBA 4YM9A 1ID5H 2ZIQH 3SNAA 1NRSH 3UR9A 1HV7A 3M7QA 2K1QA 2BDGA 2Y7ZA 3RMLH 2Y5HA 4GAWA 2BDAA 1K1IA 1VITF 4Y76A 1AE5A 1C4V2 1O3OA 3UR6A 1GBDA 2WV5A 3D49H 4MPVA 5I46H 2OC8A 2BLQA 1HAPH 1FY4A 2F9BH 2QF3A 3VEQB 1O39A 5A8XA 1V2WT 2PFEA 4ASHA 2Q6DA 1JOUB 1D3QB 1H9IE 3SU3A 5F8ZA 1HB0B 7LPRA 2A7HA 2ANYA 1OPHB 4X2VA 1SLWB 1A4WH 1PPGE 2F83A 3SO3A 4CH8B 3ZVBA 1O2TA 1WAYB 1XXFA 3GY7A 5EPYA 2J95A 3B23B 1SQOA 1ZZZA 8KME2 5LPFA 3PTNA 1A7SA 3UQOA 1EAWA 1E34B 1KYNA 4ZHAA 1OWEA 1YPEH 3NZIA 1UHBB 2GMTC 1LDTT 1CBWB 5LPRA 1BMLA 1E36B 2Z9JA 2ZP0H 2VGCB 1P05A 3SQHE 4WWYA 2BYAX 3FP7E 1YF4A 1DWCH 2ALPA 3ATLA 2ZHFH 1C9TA 1O5AB 4AG1A 4D9RA 3ZZAA 1BCUH 3HPTB 4WVPE 1K2I1 4TPIZ 2ZI2H 3ATMA 4INKA 1QA0A 2Z9GA 4K1EA 1VJ9U 3ZVAA 3QO6A 2VJ1A 2Z9IA 3QZQA 1UJ1A 3M5NA 4NA8A 1ZPCA 1DUAA 3M5LA 2ZHEH 1W2KH 2AEIH 1IQIA 1QY6A 1AFQB 4O9VA 1FDPA 2PKSB 1SGTA 2BVRH 1V2NT 4IN2A 1MU8B 2GZ9A 1ZSLA 5T6FA 3BTTE 3VXEH 4MVNA 2SNVA 4XBBA 1BBRE 3MO3A 4BAQB 2VIPA 2W7UA 5E2PA 1T8OA 1LPKB 3ZZ8A 2XNIA 2R3UA 3LONA 2HRVA 2ZGHA 1S5SA 2PTCE 2RCEA 3KQDA 4M7GA 1O3LA 3BTEE 3ZZ9A 1C5SA 1HGTH 2RDLA 2W26A 1BDAA 1OYTH 4Y79A 4FU8A 1FUJA 1IQKA 4JCNA 1ZGVA 2BDIA 3U8RH 3TJUA 5FX5A 4O03A 2H9EH 5AFZH 1UTKA 1C1SA 2VH6A 2ULLA 1C2IA 5CHAC 3BTGE 4YESB 1G3CA 3SUGA 3Q3KA 4MDSA 1O5BB 1ZGIA 1O35A 1GBBA 1DSUA 3STJA 1O2GH 3RXPA 4DW2U 2AMPA 2ANKH 3R3GB 4AGKA 1ZSJA 1EASA 5H4IB 4YOJA 2FYRA 2GKVE 2RA0A 3A8AA 1H4WA 1VCQA 2A4QA 3PO1C 4R0IA 1PQAA 3AAVA 1E35B 2CXVA 3OTJE 1O5DH 3UQVA 2B8OH 2FTMA 4X1NU 4YT7H 3B8JA 1MCVA 4X2YA 4GSOA 1EB2A 2KAIB 2WUCA 2Z9LA 1ETTH 1TONA 1V6DA 1VR1H 3UWJH 1CHGA 1SLXB 4WY3A 2B5TB 3TH4H 2GV7A 2V0BA 1EATA 3SV6A 4MNWA 3RXVA 1A3BH 1C2EA 4CHAB 3V3MA 1QJ6B 2FS8A 2GCTC 4H42U 4NZQA 1MBMA 3T25A 5HM9A 2ZU2A 2AGIX 1MAYA 3ZVGA 4B71A 5J4QA 1GG6C 1IQEA 4GHTA 3LGYA 2I6SA 3Q3YA 4CREA 1RD3B 1TQ7B 2YNBA 3U1IB 1P10A 2BQWB 1C5RA 3TNSA 4NWKA 2QGRA 3TU7H 1OP8A 1GI6A 3UOUA 4K8YA 1NESE 4Y10E 4A1VA 1W13U 2PW8H 1GI0A 5F03A 3SGQE 1TNLA 1PQ5A 1W3CA 3SORA 5EU8A 1M9UA 1BRAA 3U9AH 3UWIA 1EAUA 2DE9A 4UD9H 5K7RA 4CRFA 4INLA 2OCVB 1QTFA 4FUEA 1C5ZB 1FY5A 1NS3A 1QJ1B 2O8WA 1H1BA 1RGQA 1O3HA 4CRDA 1GL0E 1NFWA 1SC8U 3GY6A 2J38A 1OYQA 4A1XA 3PMBB 1SFIA 1GJ9B
chains in the Genus database with same CATH superfamily
4X1PU 1GI8B 4RKOB 5EXLA 1KMHB 2QV1A 4HGCA 3BEIB 1HNEE 1S84A 1TA2A 4K3JA 5KECA 5J4SA 1GJDB 2AGEX 5CMXH 1QNJA 4INHA 1X7AC 4ABGA 5L2YH 1QBNA 4DIIH 1MTSA 3MU1A 3M7TA 3MYWA 4BXWA 2LPRA 3KQEA 9LPRA 1SGCA 1L1JA 3NXPA 3P6ZB 1FPCH 1TRNA 4NIXA 1KDQA 3SGBE 5HKKD 4JZIA 3MU4A 3SGAE 4I8HA 5E8EH 1CBWC 1TE0A 3VB6A 2GT7A 2W5EA 5T3HA 2UWPA 1TMUH 1YCPM 2VGCC 5EJLA 1MU6B 1O2LA 5FCRA 1SMFE 1W0JD 1E37B 1IQLA 5FBIA 3RMOH 1O3DA 1HAVA 3T28A 3SJ8A 1TLDA 2AMDA 1KLTA 2IN2A 2FMJA 2GVFA 3OTPA 2HOBA 1EAXA 3ZV8A 3SW2B 1K21H 2Y6TA 2ZDAH 4ISIH 1DWBH 2BM2A 4JZFH 1QL7A 1AHTH 4IMZA 1O2SA 1Y3UA 1V2PT 1ZMNA 2AGGX 2W3KA 2ZFQH 3SU5A 2AERH 1WDIA 1L1GA 1NC6A 2WYGA 2P59A 3GCOA 3N7DA 4FOUC 2IJOB 1G36A 2FIRH 1F2SE 1MTWA 3P95A 2BVSH 2PKSC 1QQ4A 2A2QH 3M61U 5JB9S 1GBEA 3TK6A 2EC9H 1BZXE 1YPHC 1Y5AT 1W11U 1HAHH 2KM0A 1TGSZ 3SJOA 2H9HA 2GCHG 1IQHA 1C5OH 1UTQA 4DVAU 1RTLA 4JK5A 1EZQA 2WV4A 1QB6A 1MKWK 3C27B 2J4IA 3OE7D 1P3CA 3SV7A 1Y3XA 2VVVA 4WMFA 1QURH 1XX9A 2EQNA 2QA9E 3SNDA 6CHAB 4RKJB 4TY6A 1D6WA 2ODPA 5IK2D 1UTMA 4FU7A 1N1LA 2OBQA 2BXUH 2ZPQA 3RXOA 2H1UA 2VVUA 2XBYA 3M5MA 4O3UA 4OS7A 2TPIZ 3GCHB 3GY4A 3LGVA 4FXGH 3P8OA 2C8XB 1V2ST 1HJAB 2TRMA 1Z8GA 3ZV9A 1PPFE 4D7FA 3KL6A 2O8TA 1DITH 3O8BA 2ZU3A 3EQ0H 3U98H 3E6PH 2K0QA 2HLCA 2JH0D 7KMEH 1F0UA 4BAOB 1KXCA 3F9GA 1J9CH 1A5IA 3UB0A 1SLVB 2XC0A 1BA8B 1F7ZA 1TPOA 2ZCLP 4F49A 2ILNA 3T27A 2BDCA 4KP0A 2NWNA 2BY5X 3RLWH 3GCTF 4B76A 2BDBA 3STIA 2AFQB 3A84A 1A5HA 5HM2A 1MQ6A 1MCTA 1L2EA 1XKBC 5C2ZA 2OBOA 1HXFH 2WPHS 3HK3B 1ELCA 2H5DA 1Y3YA 2TGPZ 4CHAC 1GMHG 2CJIA 3G01A 3ZVEA 8GCHF 3ATWA 4Q80A 9ESTA 1BHXF 4CRGA 1G32B 3OAAD 3PB1E 1ESBA 3PWBA 1J8AA 3LU9B 2A5KA 4AORA 3A83A 4D8NA 2V3HH 1QL9A 2BY8X 2V35A 1EOLA 5B6OA 1HFDA 1RTKA 5SGAE 3ENSB 2J98B 2A31A 1GBKA 1L4ZA 3RXEA 1GL1A 2FTLE 1FX0B 3GY2A 1OP0A 4AFSA 2FESH 1ZHRA 4Q7XA 1NFYA 2FI5E 3TPIZ 1UTOA 4Q7ZA 2ZGXH 1AGJA 1FN8A 2D2DA 2QC2A 4ZKSU 1ELEE 1O34A 1LPGB 3AW0A 3SJKA 3P8GA 2GDDA 4GCHF 4X2XA 3S0NA 1KLJH 2CGAA 3OFND 5ESTE 4Y11E 5FPTA 1N6YA 2GX4A 2AS9A 4IW4E 3SUDA 2QXIA 3EA8A 2G52A 5ETXA 2ZU1A 4AYYB 3QLPH 4SGAE 4LZ4B 5LGOA 1P2OA 4GPGA 1SI5H 4KTCA 4Q7YA 1TQ0B 3RXKA 4DJZB 1Y5UT 1FPHH 1KXAA 1P2JA 2PUXB 3SU6A 2BLWA 2AYWA 2FS9A 4AOQA 2EI7A 1AVGH 1SGFG 2FOMB 1AIXH 1GI7B 1JIRA 1CE5A 5BRRE 1RXPA 1DLEA 4FUBA 1ELVA 5HYOA 1L1NA 2P16A 4B6EA 4ISLA 2WZQA 1F5RA 3TK5A 2F43B 1GHXH 2FOAA 1BTZA 1C1PA 3UFAA 1O3JA 2OXSA 5C94A 3I78A 1FQ3A 4Y7AA 4GHQA 1OWDA 1G3DA 2PSXA 3GDUA 5JYIA 4YT6H 3VB3A 1ZRBA 5BPEA 1P03A 1GJAB 1W7XH 3M3VA 3QK1A 1O2YA 2LELA 3H5CB 4ZAEA 4I8KA 4I7YH 4D76A 1W8BH 2H6MA 2Y82A 2EI8A 4RN6A 4MG3A 1Z71A 4NZLA 2V6NA 1S83A 4ZUHA 2OP9A 1THSH 4IMQA 4Q2KA 3KF2A 4O3TA 5AFYH 5DP3A 3GCNA 5DSFA 1DPOA 1TPPA 1O3FA 3OX7U 2XYAA 3FOAA 5PTPA 1PJPA 4K2YA 2VIQA 2KZ4A 1E0FD 1PFXC 2OINA 1C1NA 4F4OC 2PLXA 2ZZUH 4BTTB 2Z6BD 1C2MA 1QHRB 5L6NH 4K60A 2PP6A 5JBAS 2DE8A 1O0DH 3F0PA 1DVAH 4E7NA 2PGQB 2ZDLA 4KGAA 1MKXH 1O2RA 3MO6A 1FAKH 2IPHA 4U2WA 3P70B 1WTHD 4YLUA 5HGGA 1GGDB 1TBQH 1CVWH 2IJD1 1YLNA 1KDQB 1P01A 2P95A 2WPDD 1KSNA 1E79D 4CR9A 4BXSA 1SQTA 3A8CA 3SV9A 1JMOH 1T4VH 4B2AA 4BAKB 6CHAC 1QL8A 2EY4C 2XWBI 1H8HD 5EPNA 3A81A 3OSYA 1O3KA 1C1VH 1YPGH 4NFFA 5C1XA 3VB5A 1UTLM 1LO6A 2FM2A 5T1VA 2JETC 3CP7A 1YY3A 4I8JA 4BAHB 3LGUA 1C2JA 1HJAC 1C2DA 1J17T 4KELA 3A7YA 1F5KU 5EODA 5DP9A 1AU8A 1EZXC 3SUFA 1WV7H 1LKBA 3ZZ3A 1EAIA 3W95A 1DE7H 1Y5BT 2BQ7B 2FYQA 3D23A 2ZEBA 2XOKD 1PPZA 2ZCHP 4OS4A 2XRCA 1TB6H 3BG8A 1O2JA 1IQNA 5C5NA 1GBIA 3RXAA 1MD8A 4ABIA 2RA3A 1O5EH 1C5YB 3MNCA 2J5UA 2ZNKH 1RTFB 4XBCA 2XBXA 2DUCA 2HALA 4UEHH 2FO9A 1NU7B 3VB4A 3SNEA 2UUFB 1PPEE 1UVPA 2WPMS 3DSOA 1V2JT 4LK4A 1S6HA 1IQGA 1NT1A 1SOTA 3GYMA 1OX1A 4BANB 3MO9A 2OQ5A 1NBMD 2BZ6H 3BEFB 4FUHA 1P0SH 4HFPB 4IC5A 1TYNA 3S9CA 2P8OB 1C2HA 1QB1A 1TRMA 4B2CA 1EXFA 1MAXA 4AFQA 1JRTA 5JPMH 2FI3E 1P04A 3K6ZA 4TWYA 1AWHB 4CRBA 1S6FA 2Z7FE 4XE4A 5C67A 1O3PB 1TOCB 1ESAA 1IQJA 1CT4E 2OD3B 3A87A 3QDZB 4UFFH 2WSSD 3O8DA 1BB0B 3LGTA 2LNCA 3LIWA 2VBCA 4I31A 3P8FA 3UIRA 1GHVH 3SQEE 1UTNA 4ZKNU 5FCKA 5B6LA 4ABFA 2PKAA 5CE1A 3U28C 4WXIA 1J14A 3S7HB 1LQDB 1KXFA 3NWUA 1ZSKA 5JBTA 3A8BA 4ZKRU 2UWOA 1TMBH 1LVYA 2Z94A 4ZCNA 3L6PA 6ESTA 5T6GA 2KFWA 1NBME 2F9OA 2ZGBH 2UUJB 1ZTJA 3Q77A 1MMJN 4XOJA 2VU8E 3RXJA 4DGJA 3FKSD 4THNH 1YGCH 1SHYA 3T26A 5EG4A 1JBUH 1QCPA 3BN9A 3RC6A 1OS8A 4DG4A 2ZFSA 1TNIA 3SHAH 1F0TA 2A45B 4Y8XA 3EYDA 3M5OA 5LH8A 1AN1E 4ABAA 1SFQB 1TBZH 3ZZ4A 3RXCA 1GBTA 1NFUA 1UCYK 1B7XB 2SGPE 1DWEH 2G4TA 1KXEA 4DCDA 3RM2H 2NU3E 4CBOA 3K9XB 1GDUA 4Q4LA 2NU1E 1ANDA 2WPLS 4MNVA 5F8TA 3BTQE 1SGRE 4P02A 4LZ1H 3U8OH 1TX8A 3ZYDA 5TCCA 2NU4E 3DCLA 1YYY1 3N99A 1GDQA 1TMTH 5C0UA 1HXEH 5ESBA 3TH2H 1BMNH 1GWAA 1K22H 4Y6DA 2J98A 1BTHH 1L0ZA 1WCZA 2QF0A 3QUMP 4X6NA 2QXHA 2A2XH 4TSFD 2LP6A 3KIDU 4AFUA 4K69A 1LVOA 4Z6AH 4PROA 2Y5GA 4K1SA 1LHDH 1GDNA 3SU0A 1A5GH 1V2KT 1XUGA 1WSSH 1LQEA 2O8LA 1UVUH 3RMNH 3E0PB 1D6RA 2VNTA 4BNRA 3A88A 1S6LA 1OWKA 3MNSA 4ACAA 2PHBA 1EQ9A 2A5IA 2STAE 3A7ZA 5C1UA 3KQCA 3BEUA 1GGDC 1EJNA 3SNCA 3PMAB 2VIOA 4P00A 1AWFH 1SHHB 1V2RT 4Q63A 1W0KD 1UK4A 2J94A 4JMYA 2AMQA 2HNTC 1JXPA 4MNXA 1PPCE 2G5NA 3SU1A 3P17H 4WJG2 1PQ7A 3LC3A 2WUBA 3TGJE 2I6QA 5A2MH 1BTWA 1ZPBA 2QF5A 3C1KA 2XTTB 1O2UA 3T5FH 1SB1H 5JBCS 2VWOA 2A4RA 1GVKB 2SGFE 1RIWB 2Z3EA 1G9IE 1O2ZA 1LPZB 2ZC9H 1ETSH 2WV9A 2GCHF 1MTNB 3ZYEA 2O8MA 2OK5A 1FY8E 4MPWA 1S0QA 3AASA 2ZTZA 1V2LT 4E05H 4BAMB 4OS6A 1EX3A 1AI8H 2XW9A 2FLRH 1C1QA 3TJOA 3LJJA 3RXGA 1UK2A 1ZR0A 3MHWU 1WYKA 2XXLA 4MLFB 1LVBA 4FETA 1ORFA 1W7GH 2KCOA 4X1QU 1SL3A 2EI6A 4WMDA 4ZKOU 5IDKA 1KTTB 1P2MA 1P2IA 4NIYA 4TT3D 3F1SB 1GI5A 2WPIS 1ELBA 4XD7D 1EUFA 4RSPA 1W10U 2IOTA 2QAAA 3WY8A 2JDID 5DP7A 2A4GA 2UUYA 4FUGA 2K8IA 3MH7A 1WXRA 1WBGB 2BD2A 1UTPA 1GJBB 2WYJA 1NM6A 2SGEE 1FXYA 1PYTC 4FUFA 5F6MA 2ZDKA 3CNRA 2D26C 1ELAA 3E0NB 2P8OC 2XBWA 1BTXA 1TA6A 4JYTA 3U8TH 1O2IA 1ZRKA 3MMGA 5DJ7A 4E7RG 2W3IA 3AW1A 3HKJB 4MNYA 3LOXA 3VG8A 3BTME 4AGJA 1YM0A 2SGQE 2WPKS 1EB1H 2ZDVH 1VCPA 3F68H 2JKHA 3ITIA 5GDSH 1ELDE 5EQQA 5JDUB 1C4U2 1GMHF 1EP5A 2Z9KA 2O8UA 5KGOA 1C1RA 4X0WU 1Z1IA 1FMGA 2HPPH 3UOPA 3VB7A 3EAJA 4AN7A 3FZDA 1C9PA 2JH6D 4BOHA 3M37A 3HGNA 1G3BA 1YLCA 1SSXA 3O8CA 1B5GH 4ISNA 5IYTA 1PPBH 2YOLA 1AFQC 1C4Y2 1H8DH 1NU9A 2F9PA 2YMSB 1QIXB 4CH2B 1MKWH 1P2NA 4IN1A 1TNHA 2PSYA 5K0HA 2FPZA 3IITA 5EQSA 1HAYB 2JJ1D 4X6PA 1O32A 1SGIB 1LCYA 2V3OH 1W14U 1ZOMA 4JZDH 4MQAA 4DURA 4WH6A 2TGTA 4WH8A 3S69A 3GY8A 4B75A 1B0EA 1A3EH 1DX5M 5A0AE 4OM9A 2JIZD 4IS5A 3GY5A 1C5UA 1YPKH 3RXBA 1SBWA 2ZF0H 3UY9A 2ZQ2A 1BRUP 1XXDA 2ZO3H 1O3IA 3M36A 1GJ7B 4O97A 2WPJS 1SGYE 4NSYA 5DP6A 2R0KA 1FNIA 1GMDG 1Q31A 2BX3A 3DUXH 1IOEA 1T32A 2P93A 3ZZ7A 3ESTA 1FLEE 2ZHDA 2ESTE 2PKAB 2G4UA 2D8WA 1G2MA 1BBRK 1GJ4H 5AF9H 1EJMA 4Y8YA 2XNDD 1OKXA 4IBLH 3TGIE 1BJVA 2W6JD 3ZVFA 1P12E 1AZ8A 3BTFE 3QX5H 5C0TA 1FN6A 1EZUC 1ZTLA 1ZYOA 1BMFD 3DSGA 1LHGH 1V2OT 3BG4B 1VCWA 2Z3DA 4K5ZA 3HK6B 3ZIAD 4YTAA 3FZZA 4KKDA 3QN7A 1YCPK 3MNXA 3WWBA 4UFEH 3KGPA 3S9BA 1FONA 1V2VT 1YPLH 4OGXA 4MPUA 3WWFA 3LT3A 1SQRA 2C8YB 1SGDE 2SNWA 2WHXA 2AIQA 3NKKA 5DG6A 2BMGB 1AO5A 4F55A 5FBEA 1GI9B 1F0RA 4TWWA 3NRLA 2Y81A 2GDEH 3RC4A 1SQAA 5DGJA 1HLTH 1K0HA 4UONA 1SG8B 2JJ2D 1XVMA 2BD7A 2J34A 7ESTE 2B0FA 4ZROA 5A0BA 3FP6E 2TGDA 1ZLRA 3EE0B 1QFKH 2F9NA 1NTPA 4QT8C 3GS9A 5HXFA 4WMEA 3VXFH 5DO4H 3ZZDA 1EFRD 1QB9A 2FODA 1OWIA 1HJ9A 1K9OE 1RIWC 4NA9H 1GI1A 5DP4A 1P57B 1CT2E 3LDXH 2BD5A 2ZPSA 1C2KA 1AB9B 3OYPA 4XSKU 1S81A 5DPAA 4XFQA 5GCHG 5TJXA 1MTNC 2EA3A 3RXMA 3RP2A 1Z1JA 3K2UA 1QBVH 1JRSA 3RXUA 5F53A 1GBAA 2D1JA 2QE7D 1P2KA 2THFB 5C5OA 4I32A 4LXBH 1ESTA 2FOFA 5EJ1A 1E38B 1AKSA 3QTOH 4NCYA 1NROH 1C5PA 3K6YA 1XUIA 1ANBA 2XWAA 2ZPRA 1HAIH 3MQKC 1DFPA 2F9UA 3T29A 4ABHA 1TNJA 4BTIB 1GI2A 1DY9A 3PM3A 2HGTH 3V7TA 3DSPA 1XUJA 2XBVA 3BTKE 1BITA 5L30H 3F2FA 1N8OB 1SOZA 1V2MT 1QJ7B 4Y8ZA 1AZZA 1QZ8A 1O2MA 2HNTE 3MH4A 1O5CB 3PTBA 3KN2A 2R2MB 1T8NA 1QGFA 7GCHG 3RU4T 2FLBH 1GMCG 3F9EA 4AYVB 1RRKA 3FVFB 1OP2A 1F0SA 3R0FA 3GISB 1SVPA 1DANH 6GCHG 3LH3A 2ZWLH 5A09A 5EIYA 3PLPA 2GTBA 1UW7A 1FY1A 1NPMA 1EPTB 3A7XA 3ATKA 1C1TA 1P09A 1Z8JB 4A5TS 4ASUD 1LHCH 2SGAA 1QRXA 2STBE 2XCFA 3SYJA 1DS2E 1CU1A 3RXHA 1AQ7A 3SU4A 1CGJE 2ZDMA 2VWNA 2M2AA 5JB8S 4CRCA 1C5TA 3EA7A 1O38A 5FXLA 1P11E 1TRYA 2ANWA 1O2VA 3GICB 2GGVB 4OS5A 1Q2WA 1TAWA 4ACBA 4ABBA 3URDA 2YMSC 2BB4A 3NCLA 1CHOG 3CS7A 2VWMA 1EZSC 2VIVA 1O2QA 2P94A 1JWTA 3NK8A 4J2YB 3TJVA 5AHGH 1XUHA 1TPAE 4HZHA 3TVJB 4A6LA 1J16A 1F92A 1GI3A 2BY7X 4Z0KA 1E1QD 2GV6A 4UFGH 1O3CA 2J2UA 1O5FH 1A61H 1O2KA 2Z3CA 1GJCB 2WINI 1FJSA 1Y8TA 3RXFA 1TX6A 1VJAU 1QRWA 3MNBA 2RFKC 1H8IH 4Y0YE 4NWLA 5GJ4B 3TGKE 1LHEH 1ZJKA 2FOHA 2KR7A 1VGCB 3I77A 3QTVH 8ESTE 4U01A 3KQ5A 1HJ8A 2FI4E 2HPQH 2ZGJA 3GCHC 1CSOE 1Z8IB 2H5CA 1SKYE 3ZVDA 4AX9H 3CENA 3V13A 4H4FA 5E0HA 5C1YA 3LKWA 3DHKH 4SGBE 1ELGA 1P02A 2VIDA 2F9VA 1FZZA 5C20A 2BVXH 2FX4A 4YO9A 1D3TB 5FAHA 1MQ5A 4X1SU 2ZHWH 1C5MD 3LC5A 4VGCB 3BSQA 2BQ6B 4GLYA 4OS2A 1GHAG 5FPYA 3SBKA 1UVOA 3BG4C 2C3SA 1BT7A 2BTCE 2NU2E 3SJ9A 4FVDA 1T8LA 1YPHE 1O33A 2BY9X 4OS1A 1C5WB 1DOJA 5F8XA 3TH3H 3M3TA 3M3SA 2Q1JA 2QXJA 2P3TB 4NIVA 4B2BA 2Y80A 1MH0A 4UFDH 2BLVA 1BHXB 2AIPA 2QIQA 1O2PA 1ABJH 4X6OA 1ANCA 4MPXA 3SUEA 1GCTB 2ALVA 1K28D 2QXGA 1W12U 2V3MA 3NPSA 1FIZA 1YWUA 1AMHA 3SI4H 3I29A 4FVBA 4TY7A 4Y71A 1HAOH 4ZXXH 3PLBA 1YBWA 1WU1A 2ZTXA 1C5VA 3B9FH 3M7UA 4D9QA 5FPSA 1QBOA 3FFGA 5TCAA 3UNSA 1HIAB 1T4UH 4K8BA 1BJUA 1AB9C 2P3UB 3A86A 1A1RA 1DLKB 3KQBA 1UVSH 2J97A 4ZMAH 2BOKA 1S82A 3RUOA 3FAOA 1G3EA 1RS0A 2L6OA 1B0FA 2UUKB 1YKTA 3BF6H 3F9HA 1O2XA 1GHBG 2OUAA 5T6DA 1C1MA 1GJ8B 4K1TA 1ZPZA 4CRAA 2A7CA 3A7VA 2ZFFH 3UNRA 1OSSA 2VIWA 3PMHB 1Q3XA 1UCYH 2HWLB 2XCNA 1FAXA 1FI8A 1C5XB 1CA0B 1NO9H 2QCYA 2ZFRH 1N8OC 1K1LA 1U6QA 3DFLA 1UTJA 2BD8A 4B74A 1GBMA 1BTUA 4H6SB 3U1JB 2O9QA 1DY8A 3E1XB 2NU0E 1AY6H 4RI0A 1MTUA 2M5TA 4DOQA 4ZH8A 1TALA 1VITG 5EW1H 3FN8A 2BHGA 5DP8A 3GDSA 1EPTC 3P92A 3RXRA 1P8VC 3BTDE 2YNAA 2PWXA 2ZFPH 1TNGA 1O3BA 3NUMA 4ISOA 1S85A 2FWWA 3F2GA 1AKSB 2ZHQH 1CGHA 4NA7A 3SU2A 1ACBE 1HDTH 2ZCKP 2ZKSA 1O3MA 2PV9B 4JZEH 5EOKA 1XUFA 1DT2A 5G4BA 3EDXB 3UUZA 2GJGA 3GY3A 8LPRA 4FUDA 1C5NH 1GBHA 1DWDH 1CO7E 1H8ED 1O2HA 1XM1A 5HIZA 2OC1A 1AD8H 2BY6X 4YOIA 4X1RU 3AVZA 1C5LH 1LTOA 1BMAA 4F48B 2BZAA 5GWZA 4YOGA 2C4FH 2CHAB 2G55A 3KHVA 2F4LA 1LKAA 1NRQH 3TLOA 3Q3XA 4FUJA 4B6FA 2SFAA 3N7OA 3A80A 3CS0A 3PWCA 3E8LA 1IAUA 1SR5C 2BXTH 1A46H 3UREA 4Z1MD 2JH5D 2VINA 2TBSA 2UWLA 3D65E 3LH1A 5EXNA 5L2ZH 1QRZA 5LPEA 3VGCB 3PROA 3DD2H 3TJNA 2V7QD 3A7TA 5C3NA 3MU5A 3KCGH 1ZJDA 3FP8E 4TYDA 3RU4D 4NGAH 1D3DB 3UTUH 3BIVH 1DXPA 5E0JA 1ARBA 1DICA 3ODFA 1ARCA 2OTVA 1VGCC 3SZNA 1EJAA 1KXDA 4MTBA 1O37A 5HIYA 1CGIE 5EQRA 3W94A 4BTUB 1C1OA 5I25A 2ZG0H 3A7WA 1RJXB 2ANMH 1CA8B 3UPEA 3RM0H 5AVDA 1MD7A 1G2LA 1C2LA 1HAZB 1MZAA 2TIOA 3IWMA 1EPTA 2BDYA 3DA9B 2ODQA 3A85A 5JBBS 1YC0A 5E0GA 1TGNA 4I86A 3OY6U 1F5LA 1GI4A 2G8TA 4X2WA 1DSTA 3UNQA 4VGCC 2A1DB 4A1TA 5CDFE 1TPSA 1V2QT 1T7CA 1UK3A 1NN6A 4KTUA 1ANEA 2A5AA 3Q00A 3EA9A 1GMDF 1BIOA 2R3YA 2GZ7A 2RG3A 1ABIH 2OC7A 5FHTA 1XKAC 4A7IB 4B73A 1V2TT 5HMAA 3RU4E 2AH4X 2ASUB 1GPZA 1P9UA 2R0LA 3IG6B 4HG6A 1C5QA 1KTSB 1TOMH 1OWHA 3PYHA 2W6ID 3L33A 2VB0A 4NFEA 3SOSA 1GCTC 3SI3H 1ELFA 5C17A 2BD9A 2G51A 2IPQX 2VWLA 3MTYA 4X8VH 1NZQH 2CK3D 4NSVA 1A0LA 1ETRH 3E16B 1A2CH 1MABB 2Y5FA 1WQVH 3MU8A 4ABEA 1QA7A 1KLIH 3GYLB 1ZTKA 3ZZ5A 1K1MA 1MBQA 1DDJA 1O2OA 1QQUA 1HUTH 1K1OA 1V2UT 1GJ6A 1AUTC 1O5GH 4R8TB 4GUXA 5EW2H 3SNBA 3P8NA 1A0HB 1UMAH 2F91A 4AC9A 2A0QB 2R9PA 2G81E 1C1UH 1FIWA 4GVUA 2SGDE 1GHZA 3ATIA 4X8TH 4X6MA 4U30A 1UVTH 1T31A 1K1PA 1SGFA 1O3AA 3RXLA 3KEEA 2H2ZA 1O3EA 1BTYA 3OEED 2OLGA 1IQMA 3PMJA 1ZMLA 4J1YA 1CT0E 3MH6A 1BOQA 1XUKA 2PTNA 3ZZ6A 2QYIA 5EGMA 4YZUA 1XMNB 1W0YH 5GXPA 1TGCA 1H9HE 3WW7A 2Q6GA 1D9IA 1TBRH 1Y59T 1MZDA 2Y7XA 3UAIC 2TGAA 3JZ1B 1O36A 4U32A 3Q76A 1CA0C 1GBCA 3RXQA 5GCHF 3QGJA 2QN5T 6LPRA 2BDHA 1YPMH 2ZU5A 4ZHMU 1HAGE 2XC4A 3F2HA 1KY9A 1SGPE 1ZHMA 1GBLA 1UO6A 2FOGA 3MU0A 3RDZA 2FZZA 1VKYA 3H7TA 2VH0A 3HKIB 1BBRH 3RMMH 1HAXB 1LHFH 3GOVB 2PUQH 3BIUH 4E06H 2ZU4A 1PQ8A 1BRCE 2FXRA 3LGWA 1VITH 4NG9H 2A7JA 4ABJA 4AB8A 1TWXB 4AB9A 3D62A 3H09A 1WUNH 3V0XA 3PRBA 1LMWB 1GVZA 4DY7B 1J15A 1FY3A 3S9AA 1O30A 1T8MA 2ZQ1A 1EKBB 1HIAA 2HNTF 1Z6EA 2CN0H 4CBNA 1UHBA 1HRTH 1YCPH 1Z6JH 1XVOA 3QZRA 4ESTE 3A89A 7GCHF 3GDVA 1NY22 1GMCF 1TGBA 3E3TA 3PV5A 3PV4A 2JETB 4HI3A 4IC6A 2PGBB 2C8ZB 3SV2H 6GCHF 5FX6A 2BD4A 3RXTA 4H6TA 2C90B 1MTVA 1THRH 3K65B 2CHAC 1SGEE 2J92A 1FV9A 3AAUA 1GBFA 5GPIB 3RXDA 3U69H 1ELTA 4A92A 4I8GA 1MUEB 1PPHE 2ZGCA 2HVXA 4IGDA 1N6XA 1P9SA 2H9TH 1TGTA 4I33A 3TITA 3VGCC 1SPJA 1Z7KA 4I8LA 1O3NA 2ZFTA 1AE8H 1BTPA 3EGKH 3M35A 1AVXA 2A4OA 2OQUA 2FDAA 1AFEH 4JYVH 4JK6A 3RC5A 1WTGH 1S0RA 3W1EA 1EP6A 3DT0H 2B7DH 4KTSA 4X8SH 2XC5A 3MI4A 3SV8A 3AK5A 3LJOA 1CHOF 1CQQA 4FUIA 2B9LA 3KYGA 2CF9H 1HCGA 2PR3A 3KNXA 1DXWA 3VPKA 4ZXYH 2GMTB 1O2NA 5DKMA 4JYUH 1L4DA 4ISHH 4AFZA 1Z8RA 4AZ2B 2FX6A 3E90B 3BTHE 5E2OA 3RXIA 1GJ5H 3SJIA 1NRRH 2KCAA 1GBJA 3HATH 1C2FA 3MH5A 3MFJA 1OWJA 4UE7H 4WF8A 2FEQH 4FU9A 3JZ2B 1IHTH 3T62A 2ZDNA 5KEDA 3BTWE 3TIUA 1UCYE 2W7SA 4OGYA 2CMYA 1GHYH 4DIHH 1AVWA 2GT8A 1GHWH 3LGIA 4HTCH 3TK9A 3FO8D 1P3EA 4XBDA 1P2QA 3E91A 1KIGH 2G5VA 1OXGA 1P06A 1OOKB 1AUJA 4TPYA 1YLDA 1IHSH 1NRPH 1YPJH 2F3CE 2Q6FA 2CV3A 1C2GA 1GHAF 4YXWD 4D7GA 4Y0ZE 3ODDA 3T2NA 1BQYA 1BRBE 4UDWH 1GVLA 1TFXA 5A8ZA 1PYTD 2KAIA 4XDEA 1W0ZU 1YP9A 4LOYH 3LPRA 2R2WU 1D4PB 5A8YA 1THPB 3URCA 2ZA5A 1Y3WA 3MOCA 5GNDA 3V12A 3QGNB 3BV9B 1NFXA 1NRNH 1QR3E 3HGPA 4ABDA 3VFEA 1TNKA 5A0CA 1O3GA 1DUEA 1IQFA 1TIOA 2GP9B 3ZVCA 2CF8H 4Y7BA 4YLQH 2AHME 5CHAB 3QWCH 1SLUB 3GCTG 3N7EA 1LVMA 3F9FA 1HYLA 2C8WB 3EE7A 3ELAH 2ZTYA 2KCYA 1ZMJA 3A82A 1ZHPA 1V3XA 2ZECA 8GCHG 1A0JA 3O8RA 3OY5U 1HBTH 1TABE 2L74A 4JZ1A 1DM4B 3OEHD 2FP7B 2BD3A 3SHCH 3F3BA 3MWIU 1D3PB 3A8DA 2G00A 1WOFA 4FUCA 2GD4B 3PO1B 1K1NA 2P3FH 3RLYH 1BUIA 3DFJA 1RFNA 1WQSA 2QY0B 4DT7B 1INCA 1TX7A 5ABWA 2BX4A 2GZ8A 4NIWA 1COWD 1GCDA 1K1JA 4WXVA 4AG2A 1JIMA 1Y3VA 1GHBF 2J9NA 3ZZCA 5DP5A 5GIBA 3S7KB 1BMMH 2BLOA 2FOCA 3PLKA 3ZZBA 2ODYB 1SGNE 2EEKA 2C93B 1O31A 2VVCA 2BOHB 5EXMA 1G30B 1VZQH 2FOEA 3OU0A 5DK1A 1EOJA 2GCTB 4CR5A 1SGQE 4GCHG 4B1TA 3H7OA 1H9LB 3FANA 1HPGA 3SN8A 3KYFA 4M9FA 1GG6B 1MKXK 1C1WH 2A32A 3F6UH 3RXSA 3TNTA 5EJZA 3L3TA 1HAVB 2OC0A 4X8UH 1O2WA 4ZHLU 1KXBA 1G37A 2FOBA 4YM9A 1ID5H 2ZIQH 3SNAA 1NRSH 3UR9A 1HV7A 3M7QA 2K1QA 2BDGA 2Y7ZA 3RMLH 2Y5HA 4GAWA 2BDAA 1K1IA 1VITF 4Y76A 1AE5A 1C4V2 1O3OA 3UR6A 1GBDA 2WV5A 3D49H 4MPVA 5I46H 2OC8A 2BLQA 1HAPH 1FY4A 2F9BH 2QF3A 3VEQB 1O39A 5A8XA 1V2WT 2PFEA 4ASHA 2Q6DA 1JOUB 1D3QB 1H9IE 5CHBA 3SU3A 5F8ZA 1HB0B 3SZEA 7LPRA 2A7HA 2ANYA 1OPHB 4RT0A 4X2VA 1SLWB 1A4WH 1PPGE 2F83A 3SO3A 4CH8B 3ZVBA 1O2TA 1WAYB 1XXFA 3GY7A 5EPYA 2J95A 3B23B 3PRDA 1SQOA 1ZZZA 8KME2 5LPFA 3PTNA 1A7SA 3UQOA 1EAWA 1E34B 1KYNA 4ZHAA 1OWEA 1YPEH 3NZIA 1UHBB 2GMTC 1LDTT 1CBWB 5LPRA 1BMLA 1E36B 2Z9JA 2ZP0H 2VGCB 1P05A 3SQHE 4WWYA 2BYAX 3FP7E 1YF4A 1DWCH 2ALPA 3ATLA 2ZHFH 1C9TA 1O5AB 4AG1A 4D9RA 3ZZAA 1BCUH 3HPTB 4WVPE 1K2I1 4TPIZ 2ZI2H 3ATMA 4INKA 1E1RD 1QA0A 2Z9GA 4K1EA 1VJ9U 3ZVAA 3QO6A 2VJ1A 2Z9IA 3QZQA 1UJ1A 3M5NA 4NA8A 1ZPCA 1DUAA 3M5LA 2ZHEH 1W2KH 2AEIH 1IQIA 1QY6A 1AFQB 4O9VA 1FDPA 2PKSB 1SGTA 2BVRH 1V2NT 4IN2A 1MU8B 2GZ9A 1ZSLA 5T6FA 3BTTE 3VXEH 4MVNA 2SNVA 4XBBA 1BBRE 3MO3A 4BAQB 2VIPA 2W7UA 2QF4A 4DT4A 5E2PA 1T8OA 1LPKB 3ZZ8A 2XNIA 1OHHD 2R3UA 3LONA 2HRVA 2ZGHA 1S5SA 2PTCE 2RCEA 3KQDA 4M7GA 1O3LA 3BTEE 3ZZ9A 1C5SA 1HGTH 2RDLA 2W26A 1BDAA 1OYTH 4Y79A 4FU8A 1FUJA 1IQKA 4JCNA 1ZGVA 2BDIA 3U8RH 3TJUA 5FX5A 5FL7D 4O03A 2H9EH 5AFZH 1UTKA 1C1SA 2VH6A 2ULLA 1C2IA 5CHAC 3BTGE 4YESB 1G3CA 3SUGA 3Q3KA 4MDSA 1O5BB 4XRNA 2HVYB 1ZGIA 1O35A 1GBBA 1DSUA 3STJA 1O2GH 3RXPA 4DW2U 2AMPA 2ANKH 3R3GB 4AGKA 1ZSJA 1EASA 5H4IB 4YOJA 2FYRA 2GKVE 2RA0A 3A8AA 1H4WA 1VCQA 2A4QA 2KCPA 3PO1C 4R0IA 1PQAA 2YMSD 3AAVA 1E35B 2CXVA 3OTJE 1O5DH 3UQVA 2B8OH 2FTMA 4X1NU 4YT7H 3B8JA 1MCVA 4X2YA 4GSOA 1EB2A 2KAIB 2WUCA 2Z9LA 1ETTH 1TONA 1V6DA 1VR1H 3UWJH 1CHGA 1SLXB 4WY3A 5DN6D 3PV2A 2B5TB 3TH4H 2GV7A 2V0BA 1EATA 3SV6A 4MNWA 3RXVA 1A3BH 1C2EA 4CHAB 3V3MA 1QJ6B 2FS8A 2GCTC 4H42U 4NZQA 1MBMA 3T25A 5HM9A 2ZU2A 2AGIX 1MAYA 3ZVGA 2KX4A 4B71A 5J4QA 1GG6C 1IQEA 4GHTA 3LGYA 2I6SA 3Q3YA 4CREA 1RD3B 1TQ7B 2YNBA 3U1IB 1P10A 2BQWB 1C5RA 3TNSA 4NWKA 2QGRA 3TU7H 1OP8A 1GI6A 3UOUA 4K8YA 1NESE 4Y10E 4A1VA 1W13U 2PW8H 1GI0A 5F03A 3SGQE 1TNLA 1PQ5A 1W3CA 2HLDD 3SORA 5EU8A 1M9UA 1BRAA 3U9AH 3UWIA 4RT1A 1EAUA 2DE9A 4UD9H 5K7RA 4CRFA 4INLA 2OCVB 2RDEA 1QTFA 4FUEA 1C5ZB 1FY5A 1NS3A 1QJ1B 2O8WA 1H1BA 1RGQA 1O3HA 3F0OA 1GL0E 4CRDA 1NFWA 1SC8U 3GY6A 2J38A 1OYQA 4A1XA 3PMBB 1SFIA 1GJ9B
chains in the Genus database with same CATH topology
4X1PU 1GI8B 4RKOB 5EXLA 2QV1A 4HGCA 3BEIB 1HNEE 1S84A 1TA2A 4K3JA 5J4SA 1GJDB 2AGEX 5CMXH 1QNJA 4INHA 1X7AC 4ABGA 5L2YH 1QBNA 4DIIH 1MTSA 3MU1A 3M7TA 3MYWA 4BXWA 2LPRA 3KQEA 9LPRA 1SGCA 1L1JA 3NXPA 3P6ZB 1FPCH 1TRNA 4NIXA 1KDQA 3SGBE 4JZIA 3MU4A 3SGAE 4I8HA 5E8EH 1CBWC 1TE0A 3VB6A 2GT7A 2W5EA 5T3HA 2UWPA 1TMUH 1YCPM 2VGCC 1MU6B 1O2LA 5FCRA 1SMFE 1E37B 1IQLA 5FBIA 3RMOH 1O3DA 1HAVA 3T28A 3SJ8A 1TLDA 2AMDA 1KLTA 2IN2A 2FMJA 2GVFA 2HOBA 1EAXA 3ZV8A 3SW2B 1K21H 2Y6TA 2ZDAH 4ISIH 1DWBH 2BM2A 4JZFH 1QL7A 1AHTH 4IMZA 1O2SA 1Y3UA 1V2PT 1ZMNA 2AGGX 2W3KA 2ZFQH 3SU5A 2AERH 2WYGA 1L1GA 1NC6A 2P59A 3GCOA 2IJOB 1G36A 2FIRH 1F2SE 1MTWA 3P95A 2BVSH 2PKSC 1QQ4A 2A2QH 3M61U 5JB9S 1GBEA 3TK6A 2EC9H 1BZXE 1YPHC 1Y5AT 1W11U 1HAHH 1TGSZ 3SJOA 2H9HA 2GCHG 1IQHA 1C5OH 1UTQA 4DVAU 1RTLA 4JK5A 1EZQA 2WV4A 1QB6A 1MKWK 3C27B 2J4IA 1P3CA 3SV7A 1Y3XA 2VVVA 4WMFA 1QURH 1XX9A 2QA9E 3SNDA 6CHAB 4RKJB 4TY6A 1D6WA 2ODPA 1UTMA 4FU7A 1N1LA 2OBQA 2BXUH 2ZPQA 3RXOA 2H1UA 2VVUA 2XBYA 3M5MA 4O3UA 4OS7A 2TPIZ 3GCHB 3GY4A 3LGVA 4FXGH 3P8OA 2C8XB 1V2ST 1HJAB 2TRMA 1Z8GA 3ZV9A 1PPFE 4D7FA 3KL6A 2O8TA 1DITH 3O8BA 2ZU3A 3EQ0H 3U98H 3E6PH 2HLCA 2JH0D 7KMEH 1F0UA 4BAOB 1KXCA 3F9GA 1J9CH 1A5IA 1SLVB 2XC0A 1BA8B 1F7ZA 1TPOA 2ZCLP 4F49A 2ILNA 3T27A 2BDCA 4KP0A 2NWNA 2BY5X 3RLWH 3GCTF 4B76A 2BDBA 3STIA 2AFQB 3A84A 1A5HA 5HM2A 1MQ6A 1MCTA 1L2EA 1XKBC 5C2ZA 2OBOA 1HXFH 2WPHS 3HK3B 1ELCA 2H5DA 1Y3YA 2TGPZ 4CHAC 1GMHG 2CJIA 3G01A 3ZVEA 8GCHF 3ATWA 4Q80A 9ESTA 1BHXF 4CRGA 1G32B 3PB1E 1ESBA 3PWBA 1J8AA 3LU9B 2A5KA 4AORA 3A83A 4D8NA 2V3HH 1QL9A 2BY8X 2V35A 1EOLA 5B6OA 1HFDA 1RTKA 5SGAE 3ENSB 2A31A 1GBKA 1L4ZA 3RXEA 1GL1A 2FTLE 3GY2A 1OP0A 4AFSA 2FESH 1ZHRA 4Q7XA 1NFYA 2FI5E 3TPIZ 1UTOA 4Q7ZA 2ZGXH 1AGJA 1FN8A 2D2DA 2QC2A 4ZKSU 1ELEE 1O34A 1LPGB 3AW0A 3SJKA 3P8GA 2GDDA 4GCHF 4X2XA 3S0NA 1KLJH 2CGAA 5ESTE 4Y11E 5FPTA 1N6YA 2GX4A 2AS9A 4IW4E 3SUDA 2QXIA 3EA8A 2G52A 5ETXA 2ZU1A 4AYYB 3QLPH 4SGAE 4LZ4B 5LGOA 1P2OA 4GPGA 1SI5H 4KTCA 4Q7YA 1TQ0B 3RXKA 4DJZB 1Y5UT 1FPHH 1KXAA 1P2JA 2PUXB 3SU6A 2BLWA 2AYWA 2FS9A 4AOQA 2EI7A 1AVGH 1SGFG 2FOMB 1AIXH 1GI7B 1JIRA 1CE5A 5BRRE 1RXPA 1DLEA 4FUBA 1ELVA 5HYOA 1L1NA 2P16A 4ISLA 3TK5A 1F5RA 3UFAA 1GHXH 2FOAA 1BTZA 1C1PA 1O3JA 2OXSA 3I78A 1FQ3A 4Y7AA 4GHQA 1OWDA 1G3DA 2PSXA 3GDUA 5JYIA 4YT6H 3VB3A 1ZRBA 5BPEA 1P03A 1GJAB 1W7XH 3M3VA 3QK1A 1O2YA 3H5CB 4ZAEA 4I8KA 4I7YH 4D76A 1W8BH 2H6MA 2Y82A 2EI8A 4RN6A 4MG3A 1Z71A 4NZLA 2V6NA 1S83A 4ZUHA 2OP9A 1THSH 4IMQA 4Q2KA 3KF2A 4O3TA 5AFYH 5DP3A 3GCNA 1DPOA 1TPPA 1O3FA 3OX7U 2XYAA 5PTPA 1PJPA 4K2YA 2VIQA 1E0FD 1PFXC 2OINA 1C1NA 4F4OC 2PLXA 2ZZUH 4BTTB 2Z6BD 1C2MA 1QHRB 5L6NH 4K60A 5JBAS 2DE8A 1O0DH 1DVAH 4E7NA 2PGQB 2ZDLA 4KGAA 1MKXH 1O2RA 3MO6A 1FAKH 2IPHA 4U2WA 3P70B 1WTHD 4YLUA 5HGGA 1GGDB 1TBQH 1CVWH 1KDQB 1P01A 2P95A 1KSNA 4CR9A 4BXSA 1SQTA 3A8CA 3SV9A 1JMOH 1T4VH 4B2AA 4BAKB 6CHAC 1QL8A 2XWBI 5EPNA 3A81A 3OSYA 1O3KA 1C1VH 1YPGH 4NFFA 5C1XA 3VB5A 1UTLM 1LO6A 2FM2A 2JETC 3CP7A 4I8JA 4BAHB 3LGUA 1C2JA 1HJAC 1C2DA 1J17T 4KELA 3A7YA 1F5KU 5EODA 5DP9A 1AU8A 1EZXC 3SUFA 1WV7H 1LKBA 3ZZ3A 1EAIA 3W95A 1DE7H 1Y5BT 2BQ7B 2FYQA 3D23A 2ZEBA 1PPZA 2ZCHP 4OS4A 2XRCA 1TB6H 3BG8A 1O2JA 1IQNA 5C5NA 1GBIA 3RXAA 1MD8A 4ABIA 2RA3A 1O5EH 1C5YB 3MNCA 2ZNKH 1RTFB 4XBCA 2XBXA 2DUCA 2HALA 4UEHH 2FO9A 1NU7B 3VB4A 3SNEA 2UUFB 1PPEE 1UVPA 2WPMS 1V2JT 4LK4A 1S6HA 1IQGA 1NT1A 1SOTA 3GYMA 1OX1A 4BANB 3MO9A 2OQ5A 2BZ6H 3BEFB 4FUHA 1P0SH 4HFPB 4IC5A 1TYNA 3S9CA 2P8OB 1C2HA 1QB1A 1TRMA 4B2CA 1EXFA 1MAXA 4AFQA 1JRTA 5JPMH 2FI3E 1P04A 3K6ZA 4TWYA 1AWHB 4CRBA 1S6FA 2Z7FE 4XE4A 5C67A 1O3PB 1TOCB 1ESAA 1IQJA 1CT4E 2OD3B 3A87A 3QDZB 4UFFH 3O8DA 1BB0B 3LGTA 2LNCA 3LIWA 4I31A 3P8FA 3UIRA 1GHVH 3SQEE 1UTNA 4ZKNU 5FCKA 4ABFA 2PKAA 5CE1A 4WXIA 1J14A 3S7HB 1LQDB 1KXFA 3NWUA 1ZSKA 5JBTA 3A8BA 4ZKRU 2UWOA 1TMBH 1LVYA 2Z94A 3L6PA 6ESTA 5T6GA 2F9OA 2ZGBH 2UUJB 1ZTJA 3Q77A 1MMJN 4XOJA 2VU8E 3RXJA 4DGJA 4THNH 1YGCH 1SHYA 3T26A 5EG4A 1JBUH 1QCPA 3BN9A 3RC6A 1OS8A 4DG4A 2ZFSA 1TNIA 3SHAH 1F0TA 2A45B 4Y8XA 3EYDA 3M5OA 5LH8A 1AN1E 4ABAA 1SFQB 1TBZH 3ZZ4A 3RXCA 1GBTA 1NFUA 1UCYK 1B7XB 2SGPE 1DWEH 2G4TA 1KXEA 4DCDA 3RM2H 2NU3E 4CBOA 3K9XB 1GDUA 2NU1E 1ANDA 2WPLS 4MNVA 5F8TA 3BTQE 1SGRE 4LZ1H 3U8OH 1TX8A 3ZYDA 5TCCA 2NU4E 1YYY1 1GDQA 1TMTH 1HXEH 5ESBA 3TH2H 1BMNH 1GWAA 1K22H 4Y6DA 1BTHH 1L0ZA 1WCZA 2QF0A 3QUMP 4X6NA 2QXHA 2A2XH 4Z6AH 3KIDU 4AFUA 4K69A 1LVOA 4PROA 2Y5GA 4K1SA 1LHDH 1GDNA 3SU0A 1A5GH 1V2KT 1XUGA 1WSSH 1LQEA 2O8LA 1UVUH 3RMNH 3E0PB 1D6RA 2VNTA 4BNRA 3A88A 1OWKA 3MNSA 2PHBA 1EQ9A 2A5IA 2STAE 3A7ZA 5C1UA 3KQCA 3BEUA 1GGDC 1EJNA 3SNCA 3PMAB 2VIOA 1AWFH 1SHHB 1V2RT 1UK4A 2J94A 4JMYA 2AMQA 2HNTC 1JXPA 4MNXA 1PPCE 2G5NA 3SU1A 3P17H 4WJG2 1PQ7A 3LC3A 2WUBA 3TGJE 2I6QA 5A2MH 1BTWA 1ZPBA 3C1KA 2XTTB 1O2UA 3T5FH 1SB1H 5JBCS 2VWOA 2A4RA 1GVKB 2SGFE 1RIWB 2Z3EA 1G9IE 1O2ZA 1LPZB 2ZC9H 1ETSH 2GCHF 1MTNB 3ZYEA 2O8MA 1FY8E 4MPWA 1S0QA 3AASA 2ZTZA 1V2LT 4E05H 4BAMB 4OS6A 1EX3A 1AI8H 2XW9A 2FLRH 1C1QA 3TJOA 3LJJA 3RXGA 1UK2A 1ZR0A 3MHWU 1WYKA 2XXLA 4MLFB 1LVBA 1ORFA 1W7GH 4X1QU 1SL3A 2EI6A 4WMDA 4ZKOU 5IDKA 1KTTB 1P2MA 1P2IA 4NIYA 3F1SB 1GI5A 2WPIS 1ELBA 1EUFA 4RSPA 1W10U 2IOTA 2QAAA 3WY8A 5DP7A 2A4GA 2UUYA 4FUGA 3MH7A 1WBGB 2BD2A 1UTPA 1GJBB 2WYJA 1NM6A 2SGEE 1FXYA 1PYTC 4FUFA 5F6MA 2ZDKA 2D26C 1ELAA 3E0NB 2P8OC 2XBWA 1BTXA 1TA6A 4JYTA 3U8TH 1O2IA 1ZRKA 3MMGA 5DJ7A 4E7RG 2W3IA 3AW1A 3HKJB 4MNYA 3LOXA 3BTME 4AGJA 1YM0A 2SGQE 2WPKS 1EB1H 2ZDVH 1VCPA 3F68H 2JKHA 3ITIA 5GDSH 1ELDE 5EQQA 5JDUB 1C4U2 1GMHF 1EP5A 2Z9KA 2O8UA 1C1RA 4X0WU 1Z1IA 1FMGA 2HPPH 3UOPA 3VB7A 3EAJA 4AN7A 3FZDA 1C9PA 2JH6D 4BOHA 3M37A 3HGNA 1G3BA 1YLCA 1SSXA 3O8CA 1B5GH 4ISNA 5IYTA 1PPBH 2YOLA 1AFQC 1C4Y2 1H8DH 1NU9A 2F9PA 1QIXB 4CH2B 1MKWH 1P2NA 4IN1A 1TNHA 2PSYA 5K0HA 2FPZA 3IITA 5EQSA 1HAYB 4X6PA 1O32A 1SGIB 1LCYA 2V3OH 1W14U 1ZOMA 4JZDH 4MQAA 4DURA 4WH6A 2TGTA 4WH8A 3S69A 3GY8A 4B75A 1B0EA 1A3EH 1DX5M 5A0AE 4IS5A 3GY5A 1C5UA 1YPKH 3RXBA 1SBWA 2ZF0H 3UY9A 2ZQ2A 1BRUP 1XXDA 2ZO3H 1O3IA 3M36A 1GJ7B 4O97A 2WPJS 1SGYE 4NSYA 5DP6A 2R0KA 1FNIA 1GMDG 1Q31A 2BX3A 3DUXH 1IOEA 1T32A 2P93A 3ZZ7A 3ESTA 1FLEE 2ZHDA 2ESTE 2PKAB 2G4UA 2D8WA 1G2MA 1BBRK 1GJ4H 5AF9H 1EJMA 4Y8YA 1OKXA 4IBLH 3TGIE 1BJVA 3ZVFA 1P12E 1AZ8A 3BTFE 3QX5H 1FN6A 1EZUC 1ZTLA 1ZYOA 1LHGH 1V2OT 3BG4B 1VCWA 2Z3DA 4K5ZA 3HK6B 4YTAA 3FZZA 4KKDA 3QN7A 1YCPK 3MNXA 4UFEH 3KGPA 3S9BA 1FONA 1V2VT 1YPLH 4OGXA 4MPUA 3LT3A 2C8YB 1SGDE 2SNWA 3NKKA 2AIQA 5DG6A 2BMGB 1AO5A 5FBEA 1GI9B 1F0RA 4TWWA 2Y81A 2GDEH 3RC4A 1SQAA 5DGJA 1HLTH 4UONA 1SG8B 1XVMA 2BD7A 2J34A 7ESTE 2B0FA 4ZROA 5A0BA 3FP6E 2TGDA 1ZLRA 3EE0B 1QFKH 2F9NA 1NTPA 4QT8C 5HXFA 4WMEA 3VXFH 5DO4H 3ZZDA 1QB9A 2FODA 1OWIA 1HJ9A 1K9OE 1RIWC 4NA9H 1GI1A 5DP4A 1P57B 1CT2E 3LDXH 2BD5A 2ZPSA 1C2KA 1AB9B 3OYPA 4XSKU 1S81A 5DPAA 4XFQA 5GCHG 5TJXA 1MTNC 2EA3A 3RXMA 3RP2A 1Z1JA 3K2UA 1QBVH 1JRSA 3RXUA 1GBAA 2D1JA 1P2KA 2THFB 5C5OA 4I32A 4LXBH 1ESTA 2FOFA 1E38B 1AKSA 3QTOH 4NCYA 1NROH 1C5PA 3K6YA 1XUIA 1ANBA 2XWAA 2ZPRA 1HAIH 1DFPA 2F9UA 3T29A 4ABHA 1TNJA 4BTIB 1GI2A 1DY9A 3PM3A 2HGTH 3V7TA 1XUJA 2XBVA 3BTKE 1BITA 5L30H 1N8OB 1SOZA 1V2MT 1QJ7B 4Y8ZA 1AZZA 1O2MA 2HNTE 3MH4A 1O5CB 3PTBA 3KN2A 2R2MB 1T8NA 1QGFA 7GCHG 3RU4T 2FLBH 1GMCG 3F9EA 4AYVB 1RRKA 3FVFB 1OP2A 1F0SA 3R0FA 3GISB 1SVPA 1DANH 6GCHG 3LH3A 2ZWLH 5A09A 3PLPA 2GTBA 1FY1A 1NPMA 1EPTB 3A7XA 3ATKA 1C1TA 1P09A 1Z8JB 4A5TS 1LHCH 2SGAA 1QRXA 2STBE 2XCFA 1DS2E 1CU1A 3RXHA 1AQ7A 3SU4A 1CGJE 2ZDMA 2VWNA 5JB8S 4CRCA 1C5TA 3EA7A 1O38A 5FXLA 1P11E 1TRYA 2ANWA 1O2VA 3GICB 2GGVB 4OS5A 1Q2WA 1TAWA 4ABBA 3URDA 2BB4A 3NCLA 1CHOG 3CS7A 2VWMA 1EZSC 2VIVA 1O2QA 2P94A 1JWTA 3NK8A 4J2YB 3TJVA 5AHGH 1XUHA 1TPAE 4HZHA 3TVJB 4A6LA 1J16A 1F92A 1GI3A 2BY7X 4Z0KA 2GV6A 4UFGH 1O3CA 2J2UA 1O5FH 1A61H 1O2KA 2Z3CA 1GJCB 2WINI 1FJSA 1Y8TA 3RXFA 1TX6A 1VJAU 1QRWA 3MNBA 1H8IH 4Y0YE 4NWLA 5GJ4B 3TGKE 1LHEH