1O5FH

Dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
255
structure length
248
Chain Sequence
IVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFNSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA).
pubmed doi rcsb
molecule keywords Serine protease hepsin
molecule tags Serine protease, hydrolase
source organism Homo sapiens
total genus 60
structure length 248
sequence length 255
ec nomenclature ec 3.4.21.106: Hepsin.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5fH01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5fH02
4ZH8A 3A7WA 3DFLA 1ANBA 4U30A 5AFZH 1ETRH 1YPMH 3ZZ8A 4MTBA 1YPHC 2AS9A 3Q77A 3D65E 4JYTA 3LT3A 2FTMA 2CHAC 1QTFA 1RIWB 1VITF 3RXEA 5JB8S 1C1SA 1NROH 1TQ0B 1D6WA 3O8CA 4AGJA 2D8WA 1EZUC 1G32B 1SGIB 2PR3A 2QGRA 3TPIZ 1CGIE 1JBUH 1KXCA 1GBDA 3QK1A 1P11E 2ODPA 1CHOG 1C5RA 1LVYA 2R2WU 3SU2A 2UWPA 4THNH 1K21H 3K9XB 1ZSJA 1UK4A 3RMLH 4FU9A 3QGJA 1UVUH 2A2QH 1KLIH 1IQKA 1EJAA 2FMJA 1UTKA 3TNTA 1GJ6A 1IHSH 1O2HA 3GISB 5L30H 1GHWH 4AB9A 2A4OA 2BY6X 1JIRA 1OP8A 1KXDA 1WTGH 3SHAH 1DM4B 1GJBB 2XCNA 3RU4E 1IQLA 2BDBA 1TRYA 2BQ6B 5EW2H 1BMAA 1C5ZB 1EJMA 3SNDA 3P8NA 3GDUA 3LONA 1GDUA 4ESTE 3BV9B 2Z9LA 3MO6A 1SHHB 2AGIX 1O2PA 1F0UA 2BD3A 1FLEE 3A8BA 2O8TA 3T2NA 2HNTF 3A7VA 4F4OC 2ZHDA 3K2UA 9LPRA 1BIOA 1KTSB 1IQIA 2QA9E 3A86A 3E1XB 3ZZ5A 5ESBA 3F9HA 2GMTC 2QF0A 2FYQA 2RA0A 2O8WA 3UWIA 2XW9A 4A6LA 3ZZCA 1CQQA 2BLOA 1QRZA 1E36B 1HAVA 1W11U 1IQNA 3A8AA 2YOLA 3SGQE 8KME2 1L2EA 3LGWA 1EASA 4Y8XA 4MVNA 3Q3XA 1B0FA 1C5NH 2DE8A 3DT0H 3RXHA 3RXRA 5J4SA 1DE7H 2B9LA 2PSYA 4XBDA 5CHAC 1BRAA 2F9BH 3NK8A 1LVOA 1AKSB 1ZTJA 3RUOA 5LH8A 1QL9A 3IWMA 3DHKH 3A83A 4YESB 2FI3E 1TX8A 1DWDH 4BNRA 1SGFA 5FCRA 3AVZA 1CT4E 2Y82A 3A7YA 4UFGH 4WJG2 2ZP0H 1C2IA 4FXGH 1LDTT 3SQEE 3T26A 1Y3VA 4D76A 1Z8IB 2B5TB 3W94A 1T4VH 3RM2H 1TX7A 2PHBA 4FVBA 1BTHH 1UHBB 1O32A 1GBBA 5T6FA 1GHAF 3MU0A 4I31A 2BOHB 5GDSH 5C5NA 3D23A 5EXMA 5BRRE 5T6DA 2Z94A 4HI3A 2ESTE 4DJZB 1FAKH 3VGCC 1AVGH 2JH5D 1XVOA 1CO7E 2RCEA 4MNYA 2NU3E 1V2VT 1HYLA 3BEIB 1O31A 3R3GB 4OS5A 2A0QB 1J16A 5E0JA 3V12A 4XSKU 1OS8A 1EATA 1BBRK 1OOKB 1RFNA 3GDSA 4FUGA 3HKJB 1DANH 1Z1JA 2FESH 4B2CA 1DS2E 3VEQB 4FUFA 3M5LA 1OWEA 1P9SA 1PYTC 3U1IB 4CH2B 1GHBF 2ZPRA 3V0XA 1Y3YA 1D6RA 1HAGE 2FOAA 2BX3A 3UOUA 2ZA5A 4SGAE 2HWLB 2OQUA 3VB6A 1OYQA 1UVOA 1QRWA 3PTNA 3BTTE 2ZFQH 4YM9A 5IDKA 3PV4A 4JZ1A 1CBWB 1GJ8B 4H6SB 2IN2A 3LDXH 4Y7AA 2UUJB 1GI7B 2CF8H 1DUEA 1AE5A 5GPIB 4ABGA 4YO9A 1WU1A 3HKIB 3SNCA 4INHA 1C1RA 4B75A 1SVPA 1O5GH 1LO6A 1P3EA 1NFWA 4FU8A 2ODQA 2KAIB 3CP7A 4MQAA 7KMEH 4AYVB 5L2YH 1V2KT 4TWWA 3GCOA 1P57B 1SGYE 3SBKA 8ESTE 1AKSA 3KQBA 1CGHA 4DOQA 4A5TS 1YPJH 2FOCA 1S6FA 1ZLRA 2NU0E 1IQMA 1O2QA 1QA0A 4X1QU 1C1VH 1Z8RA 2SNVA 4B74A 2Z9JA 1HRTH 2QV1A 4TY6A 3UTUH 3LGIA 1O2NA 3R0FA 4A1XA 1BITA 1Q31A 2FOGA 1PPEE 1VGCB 2BD7A 2VINA 1HAZB 1NFXA 3WY8A 1S5SA 1GCTB 1UHBA 1SGRE 2XWBI 1QB6A 2WYJA 1GMCG 4H4FA 2AIQA 4X1NU 4O97A 2XRCA 3UOPA 3LIWA 1VCPA 1P0SH 1YLDA 2WINI 1WQVH 4K60A 3RDZA 3E3TA 1RGQA 2W3IA 5EQSA 3V7TA 1P05A 8LPRA 5E0HA 1DY9A 2HVXA 4BXSA 2ZDNA 5CE1A 1VJAU 2H2ZA 1EAXA 1FONA 1ID5H 3S9CA 4YOJA 1L4DA 3PMAB 3BTQE 4KKDA 2G5VA 1UCYK 1YPGH 1EOJA 1PJPA 1ZSKA 1C2HA 1P8VC 1RJXB 1FDPA 1SGNE 3A8CA 5ETXA 2BB4A 1LHFH 1L1NA 3LGVA 2ALPA 2R9PA 5ABWA 1AUTC 1EPTB 3TGJE 3KQCA 4ZKNU 3SGBE 5DO4H 1L1GA 4DCDA 4GCHF 1LTOA 1DOJA 1GMHG 2ZPSA 3LGTA 4NA8A 1A0JA 1TNGA 1TONA 2FOEA 1OP0A 2BZ6H 4DURA 1DUAA 1C1PA 1N8OB 1QIXB 2AFQB 3BTKE 2ANYA 1NN6A 1BMMH 4TWYA 3HATH 2ZGXH 3ZVCA 1NU7B 1BJVA 3AW1A 3M5OA 4FUDA 4U32A 4UDWH 4OS6A 2ZFPH 4DIIH 4WH8A 2GDDA 3TNSA 1GBFA 1IQHA 4ABIA 4NIYA 1DXWA 1O2TA 2BY5X 1MU6B 4BAHB 1C5YB 2C8ZB 2PUQH 1MD8A 1Z8JB 4O3UA 1LCYA 1A7SA 2IPHA 2KAIA 2BDHA 1O3AA 3ZVEA 2EEKA 1ZPBA 1N6XA 2A2XH 5ESTE 3UR6A 1LHGH 1ELTA 1KLJH 3RU4D 1Y59T 5IYTA 1ELAA 3MH5A 1OWIA 4Y6DA 4CRCA 1AO5A 1D3PB 2ZTZA 4AN7A 5JDUB 1DITH 1U6QA 2FTLE 5C67A 2YNAA 3BTEE 5I46H 2JKHA 1D4PB 1GVZA 3M7UA 1GJ7B 4D9RA 3SUFA 4K8BA 4U2WA 3LJOA 1O2WA 1XUGA 1UTMA 3A89A 2GZ8A 1PFXC 4IMQA 4I8HA 1K1IA 1A0HB 3UR9A 4B71A 1TPOA 3E0PB 5GCHG 1ZYOA 1EB1H 2TPIZ 3KL6A 1A5GH 1T32A 1UMAH 3Q76A 1O5DH 1GBIA 3FZZA 3SW2B 4ZAEA 2V6NA 1LHEH 2BXUH 3AASA 4MNXA 4I8JA 3BIUH 2UUYA 2VVCA 4IMZA 4B2BA 1TOMH 4H6TA 1K22H 2ZKSA 1PYTD 4NZQA 3EQ0H 3DA9B 3VXFH 3LKWA 1P10A 1TGBA 1AZ8A 2XBXA 1G30B 2GCHF 1EPTA 1PQ5A 1CT0E 2PKSB 4ZROA 1A0LA 7LPRA 5EODA 1C1MA 1IQEA 2PFEA 1FQ3A 1SFIA 2Y7ZA 2Z9IA 1ARBA 5JBAS 3BIVH 4CRBA 2C8YB 3ENSB 1YYY1 2W7SA 1SB1H 1V2TT 2OP9A 1LKAA 1UVSH 1IOEA 2GGVB 1NRNH 4J1YA 4MNWA 2GP9B 1MBMA 4BAOB 2BYAX 2GX4A 2BY8X 1AMHA 3HK3B 5HXFA 1V2WT 3SJOA 4CRFA 2ZDVH 1C5LH 2ZQ2A 3SU1A 1BTXA 1DWEH 2THFB 1AZZA 3M3SA 1CHOF 1BRBE 2CHAB 1GDNA 1V2LT 3BG8A 3OTJE 4K1SA 5EU8A 1KYNA 1EZSC 2JH0D 2ZU5A 4AORA 2Q6DA 1ZGIA 2C4FH 3A81A 1ZTKA 2OC8A 4NWKA 3O8BA 1C2JA 1BTZA 3ZZDA 3FVFB 1TLDA 2GZ7A 5FPTA 1TGSZ 4X8VH 5K7RA 2PGBB 5DG6A 1PQ8A 2XNIA 4OS2A 4ABFA 8GCHG 1AFEH 4CR9A 3UREA 5L6NH 3SV2H 3SJKA 1O3JA 2XWAA 1V6DA 5DJ7A 2Q1JA 2Y81A 4FUHA 1YPKH 1Y5AT 2ZI2H 1Y3UA 4FUIA 1QB1A 2A4GA 3SN8A 3AAUA 1MQ6A 3MH6A 1O3BA 2P3UB 1FIZA 1N1LA 2SFAA 1YC0A 2TRMA 5FXLA 2VH0A 1AWFH 3RC4A 1FJSA 1E0FD 2J94A 2P16A 2FLBH 1BUIA 4OGXA 3RXCA 1MCVA 1MKXH 2UUFB 1MTWA 1T31A 4ABJA 1GPZA 4AYYB 1YF4A 7ESTE 2DE9A 1THRH 2BDAA 2QY0B 1EAWA 2G5NA 3TGKE 3JZ1B 2F9OA 1QURH 6CHAB 3A85A 1OWHA 4BANB 5EGMA 1GL0E 2G4TA 1GI6A 4NIVA 1XUFA 1X7AC 2GMTB 1T8LA 1EXFA 3PLBA 3P8OA 3SU3A 3BG4C 4D8NA 1TYNA 1BA8B 1BHXF 3M5NA 2Q6FA 1GI5A 1P04A 4CRDA 2STAE 1GGDC 1GI8B 1GBCA 4ZKOU 4DGJA 1NC6A 3KN2A 1K1LA 1GBHA 3GDVA 4X2VA 2CJIA 3ZYEA 3FP7E 3VXEH 4WXVA 4X2WA 3E8LA 1TRMA 2AGGX 1HJ9A 2VWMA 2W26A 3KHVA 5CHAB 1T8OA 2XYAA 1YPLH 4Q7XA 2AERH 2BX4A 1HGTH 2FDAA 1YBWA 2CN0H 2TIOA 3K6ZA 1O3GA 3GCHC 4NCYA 3RC6A 1QNJA 1NS3A 3OX7U 3T28A 3A7XA 4AG2A 1EAUA 1Z1IA 1BRCE 1OWJA 1ZOMA 1J15A 2ZHEH 3VB3A 2FOBA 3RP2A 3VFEA 3A87A 1DSUA 1ZSLA 2SNWA 3IG6B 5TCAA 5AF9H 1C2KA 1LHDH 4YT6H 2EA3A 4IW4E 3SU5A 1W12U 1IAUA 3LC5A 3QZRA 1A5HA 1M9UA 2VIPA 3O8RA 1QQ4A 2TGTA 3VGCB 1MQ5A 3ODDA 3S9AA 3Q00A 1ELCA 1IQGA 2FP7B 4GSOA 1GDQA 2WPKS 3QX5H 5A0BA 3RXQA 4YLQH 4NFFA 1H9IE 1MTUA 3MNCA 3RC5A 3HGNA 1ELBA 2H6MA 2OCVB 2WPLS 2ZCHP 4D7FA 1SOZA 1P2NA 1A3BH 5A09A 1YP9A 1KXBA 2FX4A 4AFUA 4Y8YA 4RSPA 2ZFTA 1O39A 4MPWA 1TB6H 2D26C 1CHGA 3F1SB 2OTVA 3MHWU 2ZFFH 1NU9A 3H7TA 4ASHA 1PPZA 1LQEA 2J38A 2FXRA 5EQQA 3GY6A 3E16B 1EX3A 4NIXA 3TH4H 1EOLA 1VJ9U 2GD4B 4TPIZ 3S9BA 1PPBH 1NRRH 2P8OC 3SNBA 3MYWA 2Z9KA 3D62A 6CHAC 3SI4H 2ZPQA 4ABHA 1P9UA 2FWWA 3UNSA 1O5EH 3TGIE 1NTPA 1GJDB 3LGUA 3SUGA 1HAPH 1P2QA 1O2SA 2P95A 2ZZUH 1SLUB 3MNSA 1AVXA 4MDSA 2QAAA 1V2PT 1ZPCA 2RA3A 3VB7A 3RLYH 1VCWA 5BPEA 1K1MA 1SLVB 2ASUB 2WV5A 3MNXA 4NA9H 1TFXA 2K1QA 1LKBA 2ZDMA 5FPSA 3ZYDA 1GMCF 1MAXA 1VZQH 3FAOA 2ZU1A 2HGTH 2J9NA 3P8GA 2I6SA 1TA6A 2BY9X 1KTTB 1C5OH 1TIOA 2H5DA 1SC8U 1G3BA 5F8XA 1UVPA 2F9UA 5FCKA 4CR5A 4AG1A 1HPGA 3EAJA 2BQ7B 3MU1A 2TGAA 1YCPM 4WMDA 5DP6A 3PMHB 4K1EA 4VGCB 3L6PA 1W0ZU 1HJAC 1NT1A 4BTUB 1PPGE 2BMGB 4U01A 1MTSA 1T8MA 2BZAA 5AHGH 1QBNA 4D9QA 1TAWA 1GJAB 4FUEA 3QTVH 1HBTH 3RXBA 3GCTF 3K65B 3CS7A 3PB1E 1G3CA 1V2ST 1XMNB 3ZZAA 3A7ZA 3BTHE 1D3TB 2C3SA 2W5EA 2A4RA 3UIRA 1C2LA 4JK6A 2FM2A 4WMFA 1CSOE 3C1KA 2P59A 1SGEE 2C8XB 3TJVA 3SO3A 1O5BB 2O9QA 3A8DA 1MKWH 3T62A 1UTOA 4X6MA 4DVAU 1V2UT 1IHTH 1ANDA 1GI1A 2WUBA 1BQYA 1QJ1B 2Z3CA 1CGJE 3MO3A 1BT7A 1S84A 2WYGA 1AIXH 2BQWB 4ZKRU 3PLKA 3TK5A 1O3KA 2FIRH 1SOTA 1J8AA 3KGPA 1GJCB 1SG8B 4K5ZA 3TJNA 2BY7X 3TU7H 3I77A 1WAYB 3ATIA 1Q3XA 2QF3A 1BJUA 1ZMLA 4ZMAH 1C1NA 4Y71A 3STJA 1DLKB 1SQAA 1PPCE 1XX9A 1O35A 1W2KH 1PPHE 5AVDA 5A2MH 3E6PH 4AFZA 2GCTC 1C1OA 1XUHA 1VR1H 1TQ7B 4DG4A 2HPQH 1C1QA 1NM6A 1SQTA 1Y3XA 1TOCB 1C1UH 1O5AB 1AN1E 1DVAH 6ESTA 1O3EA 4ZHAA 1A46H 4IS5A 4B76A 3RXKA 1V3XA 4YZUA 1JIMA 1UTQA 4AFQA 3PO1C 3F9FA 3TIUA 1P2IA 1ZHMA 1ARCA 2GV7A 3SV6A 4O03A 1FY8E 1GI4A 1YPEH 5LPEA 1VITH 1FNIA 4KTSA 4WVPE 2OINA 3N7OA 4LZ4B 2ZC9H 1YCPH 3QZQA 4MPXA 1W13U 4TYDA 5C2ZA 3HK6B 2B0FA 1SLWB 1EJNA 2ZGCA 2VNTA 3SV8A 1SGTA 1QJ6B 2PWXA 3URCA 1O3CA 3ATKA 3T29A 5H4IB 4B1TA 4M7GA 4VGCC 7GCHG 1C2FA 5LPFA 1SGDE 2XCFA 3UY9A 2FI4E 1K1PA 3PM3A 1C9TA 1A3EH 4ISNA 2JH6D 4JYVH 4FUCA 1G3DA 1RD3B 2ZHFH 4AOQA 2VWLA 1UCYH 3U69H 1QBOA 5JBBS 1DDJA 1O5CB 1O3FA 3SU4A 1JRTA 2JETC 3PMJA 1C5QA 2Y80A 1GI3A 3GCNA 5A8ZA 1HLTH 1FN8A 3I78A 3P17H 1SGPE 4KGAA 1LMWB 1Z71A 2PV9B 6GCHG 1NY22 1TGTA 3EGKH 1ESAA 3OY6U 1ZZZA 2EI7A 1O3MA 2QC2A 3LH1A 4X8UH 2A4QA 1UK3A 1IQJA 2R3YA 3MU5A 2Z3EA 4OGYA 1ELEE 4JZFH 5CMXH 2C8WB 1K1JA 2H9HA 3EA8A 1FN6A 1AWHB 4YTAA 3QDZB 3SUDA 4LXBH 4WF8A 1P09A 4H42U 1QBVH 1H4WA 3DD2H 2WPJS 1O2MA 1W10U 4AX9H 3LJJA 1P03A 8GCHF 1BTWA 1ZRKA 4NZLA 1GJ5H 1NESE 5EXLA 5FBIA 3PROA 4XDEA 1F2SE 2F9PA 5E2OA 3PMBB 1HFDA 2FO9A 2V3HH 4HTCH 4X8SH 1UVTH 1GG6B 3A80A 5K0HA 2UWOA 1C5MD 1NRPH 2SGFE 3NCLA 4F49A 1V2RT 2BLQA 2XC0A 3PWCA 3RU4T 3RXFA 4CHAB 1DICA 4RKOB 2WPMS 2A1DB 3BSQA 3GY2A 3SZNA 1GHBG 3ELAH 2CF9H 1RXPA 5DP5A 3UUZA 4I32A 4DT7B 1PQ7A 1LHCH 2ZWLH 3E91A 1ETSH 3S69A 5F8ZA 2OC0A 5EQRA 1V2QT 5HYOA 5E2PA 2V3OH 2P3FH 4GLYA 2SGEE 2ZU2A 3Q3KA 4BXWA 3QN7A 2ULLA 2HPPH 1O3HA 2OC1A 1HIAB 3PWBA 1C2MA 1F5KU 1S85A 1XXFA 3GOVB 1K1OA 2W3KA 1ELFA 3L33A 3RXPA 3URDA 2OBOA 3MH7A 4ZHMU 1UK2A 3A7TA 3HPTB 4XFQA 3ZZBA 4MNVA 3VB4A 2QXGA 1TMUH 2OD3B 5J4QA 3UWJH 1KXEA 1B5GH 3SU0A 3RLWH 1P06A 1DT2A 2F3CE 2VIVA 5E0GA 4JZIA 3NKKA 1TA2A 3BG4B 1WSSH 3SORA 1XUKA 4TY7A 1C1WH 2B8OH 4J2YB 1P2KA 3LU9B 5GJ4B 2ODYB 4HFPB 1GGDB 2FLRH 3QO6A 1AB9C 1O2YA 5HM2A 3T25A 2VIQA 1OSSA 2FOMB 1A4WH 3O8DA 1GBKA 4E06H 1DFPA 2RDLA 5C5OA 4Y8ZA 4FUBA 4ZHLU 1D9IA 3DFJA 1ABIH 1DWBH 5A0CA 2ZQ1A 1GVKB 3UQVA 1TPPA 2J2UA 3TLOA 2BD9A 1MZAA 1AE8H 1O30A 1MCTA 5C1XA 1HAOH 2ILNA 2AIPA 4WMEA 3A82A 2FX6A 1P01A 4JZDH 1BBRE 1O2KA 4ISHH 4OS4A 1OX1A 3QWCH 1LQDB 3GCHB 1HNEE 1XKAC 6LPRA 1EZQA 2XTTB 3TVJB 2TGPZ 5EOKA 5EW1H 4Y79A 1GBMA 1TNJA 5FBEA 1YKTA 1FAXA 3MOCA 4X1SU 3CENA 9ESTA 2A5AA 2XC4A 1LPZB 1UTPA 1FI8A 1CT2E 1NFUA 1GG6C 1ZMNA 1TABE 3RXGA 3ZVAA 1C2DA 4WH6A 3BTWE 3L3TA 3VPKA 1XKBC 3I29A 2BVSH 4CHAC 1BZXE 3P95A 1FY4A 1O37A 1S83A 1T8NA 1GMDG 2NU2E 1XXDA 3KF2A 4I7YH 1THPB 5DPAA 1GBJA 3TH3H 2HALA 4D7GA 4Y0ZE 4K2YA 1S82A 1ELGA 4UE7H 3PTBA 1RTLA 2BD8A 1FPCH 3PYHA 5DP9A 5G4BA 1D3QB 3M61U 5FHTA 3F9GA 4X1PU 1QRXA 1WTHD 1P02A 4X8TH 1DPOA 3GY8A 2H9EH 1HV7A 1Z6JH 1CA0C 1O2OA 3U8OH 3GY4A 2VVVA 1LPKB 1GCDA 3KNXA 3KEEA 4I8LA 1FXYA 1THSH 4BTIB 5FX5A 1C5TA 3ZZ7A 1C4U2 2VB0A 1FY3A 1ELDE 4UD9H 1G2MA 2P8OB 3UQOA 1GI9B 5EG4A 4IGDA 1O3DA 2B7DH 1AHTH 2OBQA 1MH0A 3MI4A 1MTNC 3RXOA 1P2JA 3SGAE 2ALVA 1ELVA 1G2LA 1TGCA 4YLUA 3K6YA 1WUNH 1K28D 4CREA 1O0DH 5DP8A 3KCGH 2A45B 4FUJA 4FVDA 2SGQE 3SOSA 1KY9A 2GT7A 4GHTA 1EAIA 2BDIA 1YM0A 1J9CH 1H9HE 1MKXK 4ZKSU 2ZHWH 3BTGE 1UCYE 1SHYA 1L4ZA 2VGCC 1E38B 3B9FH 2AH4X 5DP3A 5I25A 1JXPA 1MBQA 4GVUA 1O2RA 3M7QA 2ZDAH 3Q3YA 1TX6A 1ETTH 1QR3E 3H7OA 4JK5A 1GBLA 4K3JA 1ESBA 4KTCA 1H8IH 1HAIH 4KTUA 4O9VA 2V35A 1WYKA 3BEUA 5HMAA 1BCUH 2Y6TA 1HAVB 1W7GH 2WPIS 5E8EH 1FY1A 1EP6A 1H1BA 1Y3WA 1HXEH 3BTDE 2V0BA 1QHRB 5DK1A 4X6OA 3T5FH 4NG9H 3T27A 1HJAB 5L2ZH 2HNTE 2ZGBH 3U8TH 3RXAA 4OS1A 1J14A 3SU6A 3TH2H 2BM2A 1AFQC 1HAHH 3BEFB 1SMFE 4IC5A 2ZCLP 4E7RG 1MTVA 4RKJB 2GTBA 3RXTA 1QGFA 1B7XB 2AGEX 2PW8H 3NUMA 2O8LA 2G51A 4NGAH 1W0YH 5JYIA 1EB2A 2AMDA 4ZXYH 1RS0A 1S0RA 2P94A 4ABBA 1TMBH 3M36A 2R3UA 4X2XA 2Y5FA 1LPGB 3U8RH 4A1TA 3LC3A 5JPMH 2SGDE 2P93A 3LOXA 2AEIH 2XBYA 2OLGA 1CA8B 2A5IA 1SPJA 1ANEA 3TK6A 1O33A 4Z0KA 1F0SA 3RXUA 2F9NA 2G81E 5EPYA 3FP8E 3EA9A 3KQDA 1FUJA 4GUXA 4TPYA 2ANMH 1ORFA 2A7JA 1W8BH 3U1JB 5DP4A 1BMLA 4NFEA 2W7UA 1GHYH 1G37A 1GHZA 2J95A 1EUFA 5EPNA 2BHGA 3QGNB 2LNCA 2A7CA 2GCTB 1E37B 4LZ1H 1UTJA 2BD4A 5GIBA 2R0KA 1AY6H 2CMYA 4KELA 1NZQH 2HNTC 3UNQA 1XVMA 3HGPA 1AVWA 3AW0A 1TE0A 4AZ2B 2FODA 2C93B 2VWNA 1H9LB 1T4UH 4NA7A 1HUTH 3PO1B 3TJUA 2AYWA 2BLWA 3A88A 3RXLA 2ZTXA 1N6YA 7GCHF 4DY7B 4XBCA 1QA7A 1KDQB 3CS0A 4Q7YA 1OPHB 2VVUA 3SI3H 1O3LA 5DP7A 1NO9H 1C2GA 1F0TA 1AGJA 3TK9A 4CH8B 4WY3A 1QJ7B 4ISLA 5HGGA 1TPSA 4I8GA 1QCPA 3H5CB 2A32A 1PQAA 3BTFE 1S0QA 2ZFRH 5LPRA 6GCHF 3PLPA 4UFEH 3U9AH 2EI8A 1J17T 1DXPA 1SFQB 3SV9A 4BAKB 1A61H 1GWAA 4XOJA 3SJ9A 1JOUB 1Y5UT 1CU1A 1GL1A 3G01A 1GMHF 1W7XH 4JMYA 1O2VA 1RIWC 4IN2A 2JETB 1WV7H 3OSYA 1HAYB 1KXFA 4HZHA 2Z3DA 3M3VA 1BBRH 4Q7ZA 1BTPA 5C20A 1QL8A 3DUXH 4GAWA 1FPHH 4AFSA 1HDTH 3GY7A 3NPSA 1K1NA 1CE5A 1P2OA 2IJOB 1A2CH 1O5FH 1VITG 1NRSH 1FY5A 2OUAA 3M37A 2Y7XA 2QXJA 2ZEBA 4YOIA 5JBCS 2AMQA 1BTUA 2CGAA 2J4IA 5DKMA 5C3NA 4NWLA 1GHVH 2WUCA 4NIWA 2HOBA 1BMNH 1OWDA 3EYDA 1S81A 1DLEA 2GZ9A 2XC5A 2A7HA 2ZHQH 4K69A 1Y5BT 1TNLA 1O2ZA 1MZDA 1QL7A 1V2OT 1Y8TA 2AMPA 4A92A 2BDCA 1QFKH 1ZRBA 1H8DH 2ZDLA 2EC9H 3GY5A 1OYTH 3GYMA 2D1JA 2O8MA 3ZV8A 1WQSA 1A5IA 1MKWK 3V13A 2G8TA 4K1TA 4Y76A 1C5SA 1QQUA 3FP6E 3MU8A 3SJIA 5HM9A 4I8KA 2VH6A 3SQHE 2ZNKH 1SL3A 5PTPA 4CRGA 1GBAA 5C1YA 5FX6A 1MMJN 4A1VA 3ZZ4A 2ZGHA 4YOGA 1O2XA 4UONA 1O3OA 1KDQA 5GCHF 5TCCA 1G9IE 1F7ZA 1MAYA 1OP2A 3OYPA 4MLFB 4IC6A 3STIA 1NFYA 3ZV9A 4Y7BA 1GHXH 4FU7A 1TNHA 4Q2KA 1LVBA 1SGQE 2BVRH 3SJ8A 1EQ9A 5B6OA 1P2MA 2UUKB 2Y5HA 1W3CA 1F5LA 3RMMH 4GPGA 5A8XA 1ACBE 2QN5T 5FAHA 3LH3A 5JB9S 1HAXB 4Y10E 4INKA 2OQ5A 1EZXC 1F92A 1FZZA 1C1TA 3S7HB 1O36A 2VIOA 3S7KB 3SNEA 3ESTA 5F6MA 2CV3A 3GYLB 2BDYA 1ZR0A 3BTME 4BAQB 4GHQA 2PTCE 3P6ZB 1TALA 2FS9A 2VU8E 2QIQA 3QUMP 3IITA 1AQ7A 4ABAA 1ZPZA 3EE0B 1YCPK 2ZU4A 3V3MA 1INCA 3B23B 1TWXB 1DY8A 3P70B 1AUJA 4IBLH 1HCGA 4INLA 4RN6A 4JZEH 1TNKA 1AB9B 2G55A 2HRVA 1O3PB 2BDGA 1NRQH 4X2YA 3MMGA 1HXFH 2WPHS 1RTFB 2GDEH 1PPFE 1FMGA 4DIHH 2G52A 4BTTB 3KQEA 1C5XB 2DUCA 1A1RA 2IOTA 5F03A 1JWTA 1BB0B 4QT8C 1GJ9B 1AI8H 4ZUHA 5GWZA 1L0ZA 2YNBA 1C2EA 4ISOA 2ZF0H 5C1UA 3P92A 1GHAG 3P8FA 4NSVA 1SGFG 1SQOA 5F8TA 1TRNA 1P12E 3MNBA 2QYIA 3GCTG 1XM1A 1C9PA 2PSXA 3KIDU 4Z6AH 1G36A 1W14U 3MWIU 1LVMA 2ZFSA 3ITIA 1DX5M 1GMDF 2OC7A 1C5PA 3RXDA 1Z7KA 1MU8B 4KP0A 2QXHA 2BLVA 1DWCH 2UWLA 1V2JT 2ZIQH 1JMOH 1ZMJA 1Z6EA 1F0RA 1TBZH 4XE4A 4BOHA 3MO9A 1TNIA 2HLCA 1C5VA 3SNAA 4AB8A 2GT8A 3ZVFA 2SGAA 4IN1A 1CBWC 3F68H 3TITA 4SGBE 1O2JA 1SGCA 2XBWA 4Q80A 4PROA 2CXVA 3ZZ9A 2ZU3A 4LK4A 4UEHH 2F9VA 2FI5E 1O2IA 2BXTH 2XBVA 2A31A 5T3HA 3ODFA 2ZG0H 1O2UA 2J92A 2FEQH 1EKBB 3ATLA 2QCYA 5SGAE 1KXAA 4Y0YE 4JYUH 1CA0B 1WOFA 4B73A 4MPUA 2VIDA 1ZTLA 4UFFH 3FFGA 1E35B 1TGNA 1O3NA 1C4Y2 1OKXA 2ZCKP 3D49H 2O8UA 2GKVE 3ZVGA 1SLXB 1AD8H 2BVXH 4XBBA 1GBTA 2ANWA 5A8YA 2VJ1A 3LPRA 2Y5GA 3QLPH 4O3TA 1VGCC 4CBOA 2NWNA 1O38A 1V2NT 1GCTC 1FIWA 1MTNB 2SGPE 4JCNA 2TGDA 4CRAA 5A0AE 3S0NA 1Q2WA 1ABJH 1QY6A 1SI5H 2PUXB 2R0LA 1ZHPA 4BAMB 3TJOA 1OWKA 1SSXA 5GXPA 3U98H 5EXNA 4X6PA 1ZGVA 2FOFA 4A7IB 1OXGA 3A84A 2NU4E 1Z8GA 5JBTA 1ZJDA 2VGCB 2OXSA 1UJ1A 1F5RA 1GVLA 1ZJKA 4X1RU 2GV6A 1BHXB 5TJXA 1MUEB 4WWYA 2GVFA 1BRUP 3C27B 2J34A 1SR5C 1QB9A 2PGQB 2ZTYA 4CBNA 1T7CA 3JZ2B 1EPTC 1C4V2 2Z9GA 1AU8A 3F6UH 3ZZ6A 3RXMA 2G00A 2PKAB 4R0IA 1KSNA 3FZDA 3RXJA 3M3TA 4MPVA 3MU4A 1N8OC 3UFAA 4X6NA 2FZZA 3EDXB 2FPZA 3E90B 2BTCE 1SBWA 1G3EA 1D3DB 3RMOH 1DSTA 4LOYH 4X0WU 3RXIA 1L1JA 1FV9A 1YLCA 2R2MB 2ZECA 3W95A 4AGKA 2NU1E 4HGCA 1C5WB 3FANA 5FPYA 2WV4A 4UFDH 3ATMA 4GCHG 1AFQB 4I33A 1UO6A 2FOHA 4NSYA 3ZVBA 1XUIA 1CVWH 1YGCH 1ESTA 3ATWA 3M35A 1IQFA 1V2MT 2C90B 4ABDA 3NZIA 1NPMA 1O3IA 3E0NB 3GICB 1XUJA 2F91A 2FYRA 1UTLM 1C5UA 2M5TA 3EA7A 1GI0A 1HIAA 5DGJA 2Z6BD 3SV7A 3VB5A 1MD7A 2BOKA 1HJ8A 1TMTH 1O2GH 3RMNH 1S6HA 5T6GA 3UPEA 2PLXA 2TBSA 1YPHE 2I6QA 4Y11E 1BDAA 2A5KA 2G4UA 1VCQA 5LGOA 3BN9A 3MH4A 2H9TH 3SUEA 1HB0B 2RG3A 2ZO3H 1KIGH 1GBEA 2QXIA 4WXIA 3RXSA 4E05H 2STBE 3B8JA 3ZVDA 1O34A 3F9EA 1ZHRA 2ZGJA 3M7TA 1B0EA 4MG3A 2LPRA 4ZXXH 3OU0A 1O2LA 1K2I1 1RTKA 4R8TB 4YT7H 3RM0H 3GY3A 3M5MA 1KLTA 1BTYA 1GI2A 5AFYH 3NXPA 1P3CA 2P3TB 2ANKH 4B2AA 1ANCA 1GJ4H 1E34B 2Z7FE 3UNRA 4OS7A 3QTOH 1EP5A 1K9OE 2H5CA 1RRKA 1TBQH 1UTNA 3BF6H 1WCZA 2PKSC 2EI6A 2PKAA 4E7NA 2D2DA 3OY5U 2H1UA 2FS8A 3MTYA 2F83A 1TPAE 3NWUA 2VWOA 1BOQA 2BD5A 2BD2A 1WBGB 3AAVA 2ZDKA 4ISIH 3RXVA 4K8YA 4DW2U 1JRSA 2Q6GA 3ZZ3A 4ABEA 1TBRH 2GCHG 2VIWA 3LGYA 2XXLA 3MFJA 2PTNA 3SHCH
chains in the Genus database with same CATH superfamily
4ZH8A 3A7WA 3DFLA 1ANBA 4U30A 5AFZH 1ETRH 1YPMH 3ZZ8A 4MTBA 1YPHC 2AS9A 3Q77A 3D65E 4JYTA 3LT3A 2FTMA 2CHAC 1QTFA 2KR7A 3OAAD 1RIWB 1VITF 3RXEA 5JB8S 1C1SA 1NROH 1TQ0B 1D6WA 3O8CA 4AGJA 2D8WA 1EZUC 1G32B 1SGIB 2PR3A 2QGRA 3TPIZ 1CGIE 1JBUH 1KXCA 1GBDA 2WPDD 3QK1A 1P11E 2ODPA 1CHOG 1C5RA 1LVYA 2R2WU 3SU2A 2UWPA 4THNH 1K21H 3K9XB 1ZSJA 1UK4A 3RMLH 4FU9A 3QGJA 1UVUH 2A2QH 1KLIH 2YMSC 2KZ4A 1IQKA 1EJAA 2FMJA 1UTKA 3TNTA 1GJ6A 1IHSH 1O2HA 3GISB 5L30H 1GHWH 4AB9A 2A4OA 2BY6X 1JIRA 1OP8A 1KXDA 4AC9A 1WTGH 3SHAH 1DM4B 1GJBB 2XCNA 3RU4E 1IQLA 2BDBA 1TRYA 2BQ6B 5EW2H 1BMAA 1C5ZB 1EJMA 4XD7D 3SNDA 3W1EA 3P8NA 3GDUA 3LONA 5F53A 1GDUA 4FETA 4ESTE 3BV9B 2Z9LA 3KYFA 3MO6A 1SHHB 2AGIX 1O2PA 1F0UA 2BD3A 1FLEE 3A8BA 2O8TA 3T2NA 2HNTF 3A7VA 4F4OC 2ZHDA 3K2UA 9LPRA 1BIOA 1KTSB 1IQIA 2QA9E 3A86A 3E1XB 3ZZ5A 5ESBA 3F9HA 2GMTC 2QF0A 2FYQA 2RA0A 2O8WA 3UWIA 2XW9A 4A6LA 3ZZCA 1CQQA 2BLOA 1QRZA 1E36B 1HAVA 1W11U 1IQNA 3A8AA 2YOLA 3SGQE 8KME2 1L2EA 3LGWA 1EASA 4Y8XA 4MVNA 3Q3XA 1B0FA 1C5NH 3CNRA 2DE8A 3DT0H 3RXHA 3RXRA 5J4SA 1DE7H 2B9LA 2PSYA 4XBDA 5CHAC 1BRAA 2F9BH 3NK8A 1LVOA 1AKSB 1ZTJA 3RUOA 5LH8A 1QL9A 3IWMA 3DHKH 5KGOA 3A83A 4YESB 2FI3E 1TX8A 1DWDH 4BNRA 1SGFA 5FCRA 3AVZA 1CT4E 2Y82A 3A7YA 4UFGH 4WJG2 2ZP0H 1C2IA 4FXGH 1LDTT 3SQEE 3T26A 1Y3VA 4D76A 1Z8IB 2EY4C 2B5TB 3W94A 1T4VH 3RM2H 1TX7A 2PHBA 4FVBA 1BTHH 1UHBB 1O32A 1GBBA 5T6FA 1GHAF 3MU0A 4I31A 2BOHB 5GDSH 5C5NA 3D23A 5EXMA 5BRRE 5T6DA 2Z94A 4HI3A 2ESTE 4DJZB 5CDFE 1FAKH 3VGCC 1AVGH 2JH5D 4P00A 1XVOA 1CO7E 2RCEA 4MNYA 2NU3E 4F48B 1V2VT 1HYLA 3BEIB 1O31A 3R3GB 4OS5A 2A0QB 1J16A 5E0JA 3V12A 4XSKU 1OS8A 1EATA 1BBRK 1OOKB 1RFNA 3GDSA 4FUGA 3HKJB 1DANH 1Z1JA 2FESH 4B2CA 1DS2E 3VEQB 4FUFA 3M5LA 1OWEA 1P9SA 1PYTC 3U1IB 4CH2B 1GHBF 1H8HD 2ZPRA 3V0XA 1Y3YA 1D6RA 1HAGE 2FOAA 2BX3A 3UOUA 2ZA5A 2W6JD 4SGAE 2HWLB 2OQUA 3VB6A 1OYQA 5EJLA 1UVOA 1QRWA 3PTNA 3BTTE 2ZFQH 4YM9A 5IDKA 3PV4A 4JZ1A 1CBWB 1GJ8B 4H6SB 3FN8A 2IN2A 3LDXH 4Y7AA 2UUJB 1GI7B 2CF8H 1DUEA 1AE5A 5GPIB 4ABGA 4YO9A 1WU1A 3HKIB 3SNCA 4INHA 1C1RA 4B75A 1SVPA 1O5GH 1LO6A 1P3EA 1NFWA 4FU8A 2ODQA 2KAIB 3CP7A 4MQAA 7KMEH 4AYVB 5L2YH 1V2KT 3F0OA 3OE7D 4TWWA 2VBCA 3GCOA 1P57B 1SGYE 3SBKA 8ESTE 1AKSA 3KQBA 1CGHA 4DOQA 4A5TS 1YPJH 2FOCA 1S6FA 2KCPA 1ZLRA 2NU0E 1IQMA 1O2QA 1QA0A 4X1QU 1C1VH 4XRNA 1Z8RA 2SNVA 4B74A 2Z9JA 1HRTH 2QV1A 4TY6A 3UTUH 3LGIA 1O2NA 3R0FA 4A1XA 1BITA 1Q31A 2FOGA 1PPEE 2YMSD 1VGCB 5B6LA 2KCAA 2BD7A 1QZ8A 1HAZB 1NFXA 2VINA 1S5SA 3WY8A 3PV2A 1GCTB 1UHBA 1SGRE 2XWBI 1QB6A 2WYJA 3PRBA 1GMCG 4H4FA 2AIQA 4X1NU 4Q4LA 4O97A 2XRCA 3UOPA 3LIWA 1VCPA 1P0SH 1YLDA 2WINI 1WQVH 4K60A 3RDZA 3E3TA 1RGQA 2W3IA 5EQSA 3V7TA 1P05A 3WWBA 8LPRA 5E0HA 1DY9A 2HVXA 4BXSA 2ZDNA 5CE1A 1VJAU 2H2ZA 1EAXA 1FONA 1ID5H 3S9CA 4YOJA 1L4DA 3PMAB 3BTQE 4KKDA 2G5VA 1UCYK 1YPGH 1EOJA 1PJPA 1ZSKA 1C2HA 1P8VC 1RJXB 3FOAA 1FDPA 1SGNE 3A8CA 5ETXA 2BB4A 1LHFH 1L1NA 3DSPA 3LGVA 2ALPA 1H8ED 2R9PA 5ABWA 1AUTC 1EPTB 3TGJE 3KQCA 4ZKNU 3SGBE 5DO4H 1L1GA 4DCDA 3EE7A 4GCHF 1LTOA 1DOJA 1GMHG 2ZPSA 3LGTA 4NA8A 1A0JA 1TNGA 1TONA 2FOEA 1OP0A 2BZ6H 2W6ID 4DURA 1DUAA 1C1PA 1N8OB 1QIXB 2AFQB 3BTKE 2ANYA 1NN6A 1BMMH 4TWYA 3HATH 2ZGXH 3ZVCA 1NU7B 1BJVA 1FX0B 3AW1A 1E1RD 3M5OA 4FUDA 4U32A 4UDWH 4OS6A 2ZFPH 4DIIH 4WH8A 2GDDA 3TNSA 1GBFA 2RDEA 1IQHA 4ABIA 4NIYA 1DXWA 1O2TA 2BY5X 1MU6B 4BAHB 1C5YB 2C8ZB 2PUQH 1MD8A 1Z8JB 4O3UA 1LCYA 1A7SA 2IPHA 2KAIA 2BDHA 1O3AA 3ZVEA 2EEKA 1ZPBA 1N6XA 2A2XH 3OTPA 5ESTE 1WXRA 3UR6A 1LHGH 1ELTA 1KLJH 3RU4D 3PRDA 1Y59T 5IYTA 1ELAA 3MH5A 1OWIA 4Y6DA 4CRCA 1AO5A 1D3PB 2ZTZA 4AN7A 5JDUB 1DITH 1U6QA 4Z1MD 2FTLE 5C67A 2YNAA 3BTEE 5I46H 2JKHA 2JJ1D 1D4PB 1GVZA 3M7UA 1GJ7B 2V7QD 4D9RA 2WHXA 1SQRA 3SUFA 4K8BA 4U2WA 3LJOA 1O2WA 1XUGA 1UTMA 3A89A 2GZ8A 1PFXC 4IMQA 4I86A 4I8HA 1K1IA 1A0HB 3UR9A 4B71A 1TPOA 3E0PB 5GCHG 1ZYOA 1EB1H 2TPIZ 3KL6A 1A5GH 1T32A 1UMAH 3Q76A 1O5DH 1GBIA 3FZZA 3SW2B 4ZAEA 2V6NA 1LHEH 2BXUH 3AASA 4MNXA 4I8JA 3BIUH 2UUYA 2VVCA 4IMZA 4B2BA 1TOMH 4H6TA 1K22H 2ZKSA 1PYTD 4NZQA 3EQ0H 3DA9B 3VXFH 3LKWA 1P10A 1TGBA 1AZ8A 2XBXA 1G30B 2GCHF 3KYGA 1EPTA 1PQ5A 1CT0E 2PKSB 4ZROA 1A0LA 7LPRA 5EODA 1C1MA 1IQEA 3VG8A 2PFEA 1FQ3A 1SFIA 2Y7ZA 2Z9IA 1ARBA 5JBAS 3BIVH 4CRBA 2C8YB 3ENSB 1YYY1 2W7SA 1SB1H 1V2TT 2OP9A 1LKAA 1UVSH 1IOEA 2GGVB 1NRNH 4J1YA 4MNWA 2GP9B 1MBMA 4BAOB 2BYAX 2GX4A 2BY8X 1AMHA 3HK3B 5HXFA 1V2WT 3SJOA 4CRFA 2ZDVH 1C5LH 2ZQ2A 2CK3D 3SU1A 1BTXA 1DWEH 2THFB 1AZZA 3M3SA 1CHOF 2WV9A 1BRBE 2CHAB 1GDNA 1V2LT 3BG8A 3OTJE 4K1SA 5EU8A 1KYNA 1EZSC 2JH0D 2ZU5A 4AORA 2Q6DA 1ZGIA 2C4FH 1OHHD 2L74A 3A81A 1ZTKA 2OC8A 4NWKA 3O8BA 1C2JA 1BTZA 3ZZDA 3FVFB 1TLDA 2GZ7A 2J98B 5FPTA 1TGSZ 2LELA 4X8VH 5K7RA 2PGBB 5DG6A 1PQ8A 2XNIA 4OS2A 4ABFA 8GCHG 1AFEH 4CR9A 2HVYB 3UREA 5L6NH 3SV2H 3SJKA 1O3JA 2YMSB 2XWAA 1V6DA 5DJ7A 2Q1JA 2Y81A 4FUHA 1YPKH 1Y5AT 3F2HA 2ZI2H 1Y3UA 4FUIA 1QB1A 2A4GA 3SN8A 3AAUA 1MQ6A 3MH6A 1O3BA 2P3UB 1FIZA 1N1LA 2SFAA 1YC0A 2TRMA 5FXLA 2VH0A 1AWFH 3RC4A 1FJSA 1E0FD 3MQKC 2J94A 2P16A 2FLBH 1BUIA 4OGXA 3RXCA 1MCVA 1MKXH 2UUFB 1MTWA 1T31A 4ABJA 1GPZA 4AYYB 1YF4A 7ESTE 2DE9A 1THRH 2BDAA 2K0QA 2QY0B 1EAWA 2G5NA 3F0PA 3JZ1B 3TGKE 2F9OA 1QURH 6CHAB 3A85A 1OWHA 4BANB 5EGMA 1GL0E 2G4TA 1GI6A 4NIVA 1XUFA 1X7AC 2GMTB 1T8LA 1EXFA 3PLBA 3P8OA 3SU3A 3BG4C 4D8NA 1TYNA 1BA8B 1BHXF 3M5NA 2Q6FA 1GI5A 1P04A 4CRDA 2STAE 1GGDC 1GI8B 1GBCA 4ZKOU 4DGJA 1NC6A 3KN2A 1K1LA 1GBHA 3GDVA 4X2VA 2CJIA 3ZYEA 3FP7E 3VXEH 1W0JD 4WXVA 4X2WA 3E8LA 1TRMA 2AGGX 1HJ9A 2VWMA 2W26A 3KHVA 5CHAB 1T8OA 2XYAA 3SYJA 1YPLH 4Q7XA 2AERH 3WW7A 2BX4A 1HGTH 2FDAA 1YBWA 2CN0H 2TIOA 3K6ZA 1O3GA 3GCHC 4NCYA 3RC6A 1YLNA 1QNJA 1NS3A 3OX7U 3T28A 3A7XA 4AG2A 1EAUA 1Z1IA 1BRCE 1OWJA 2J98A 1ZOMA 1J15A 2ZHEH 3VB3A 3UAIC 2FOBA 3RP2A 3VFEA 3A87A 1YWUA 1DSUA 5C0TA 1ZSLA 2SNWA 3IG6B 5TCAA 5AF9H 1C2KA 1LHDH 4YT6H 2EA3A 4IW4E 3SU5A 1W12U 1IAUA 3LC5A 3QZRA 1A5HA 1M9UA 2VIPA 3O8RA 1QQ4A 2TGTA 3VGCB 1MQ5A 3ODDA 3S9AA 3Q00A 1ELCA 1IQGA 2FP7B 4GSOA 1GDQA 2WPKS 3QX5H 5A0BA 3RXQA 4YLQH 4NFFA 1H9IE 1MTUA 3MNCA 3RC5A 3HGNA 1ELBA 2H6MA 2OCVB 3DCLA 2WPLS 2ZCHP 4D7FA 1SKYE 1SOZA 1P2NA 1A3BH 5A09A 1YP9A 1KXBA 2FX4A 4AFUA 4Y8YA 4RSPA 2ZFTA 1O39A 4MPWA 1TB6H 2M2AA 2D26C 2V3MA 3SZEA 1CHGA 3F1SB 2OTVA 3MHWU 2ZFFH 1NU9A 3H7TA 1BMFD 4ASHA 1PPZA 1LQEA 2J38A 2FXRA 5EQQA 3GY6A 3E16B 1EX3A 2GJGA 4NIXA 3TH4H 4TSFD 1EOLA 1VJ9U 2GD4B 4TPIZ 3S9BA 1PPBH 1NRRH 2P8OC 3SNBA 3MYWA 1NBME 2Z9KA 3D62A 6CHAC 3SI4H 2ZPQA 2XNDD 4ABHA 1P9UA 2FWWA 3UNSA 1O5EH 3TGIE 1NTPA 3N99A 1GJDB 3LGUA 3SUGA 1HAPH 1P2QA 1O2SA 2P95A 2ZZUH 1SLUB 3MNSA 2IPQX 1AVXA 4MDSA 3OEHD 2QAAA 1V2PT 1ZPCA 2RA3A 3VB7A 3RLYH 1VCWA 2WZQA 5BPEA 1K1MA 1SLVB 2ASUB 2WV5A 2IJD1 3MNXA 4NA9H 1TFXA 2K1QA 1LKBA 2ZDMA 5FPSA 3ZYDA 1GMCF 1MAXA 1VZQH 3FAOA 2ZU1A 2HGTH 2J9NA 3P8GA 2I6SA 1TA6A 2BY9X 1KTTB 1C5OH 1TIOA 2H5DA 1SC8U 1G3BA 5F8XA 1UVPA 2F9UA 5FCKA 4CR5A 4AG1A 1HPGA 3EAJA 2BQ7B 3MU1A 2TGAA 1YCPM 4WMDA 5DP6A 3PMHB 4K1EA 4VGCB 3L6PA 1W0ZU 1HJAC 1NT1A 4BTUB 1PPGE 2BMGB 4U01A 1MTSA 1T8MA 2BZAA 5AHGH 1QBNA 4D9QA 1TAWA 1GJAB 4FUEA 3QTVH 1HBTH 3RXBA 3GCTF 3K65B 3CS7A 3PB1E 1G3CA 1V2ST 1XMNB 3ZZAA 3A7ZA 3BTHE 1D3TB 2C3SA 2JJ2D 2A4RA 2W5EA 3UIRA 1C2LA 4JK6A 2FM2A 4WMFA 1CSOE 4YXWD 3C1KA 2P59A 1SGEE 2C8XB 3TJVA 3SO3A 1O5BB 2O9QA 3A8DA 1MKWH 3T62A 1UTOA 4X6MA 4DVAU 1V2UT 1IHTH 1ANDA 1GI1A 2WUBA 1BQYA 1QJ1B 2Z3CA 1CGJE 3MO3A 1BT7A 1S84A 2WYGA 1AIXH 2BQWB 4ZKRU 3PLKA 3TK5A 1O3KA 2FIRH 1SOTA 1J8AA 3KGPA 4ZCNA 1GJCB 1SG8B 4K5ZA 3TJNA 2BY7X 3TU7H 3I77A 1WAYB 3ATIA 1Q3XA 2QF3A 1BJUA 1ZMLA 4ZMAH 1C1NA 4Y71A 3STJA 1DLKB 1SQAA 1PPCE 1XX9A 1O35A 1W2KH 1PPHE 5AVDA 5A2MH 3E6PH 4AFZA 2GCTC 1C1OA 1XUHA 1VR1H 1TQ7B 4DG4A 2HPQH 1C1QA 1NM6A 1SQTA 1Y3XA 1TOCB 1C1UH 1O5AB 1AN1E 1DVAH 6ESTA 1O3EA 4ZHAA 1A46H 4IS5A 4B76A 3RXKA 1V3XA 4YZUA 1JIMA 1UTQA 4AFQA 3PO1C 3F9FA 3TIUA 1P2IA 1ZHMA 1ARCA 2GV7A 3SV6A 4O03A 1FY8E 5HKKD 1GI4A 1YPEH 5LPEA 1VITH 4B6FA 1FNIA 4KTSA 4WVPE 2OINA 3N7OA 4LZ4B 2ZC9H 1YCPH 3QZQA 4MPXA 1W13U 4TYDA 5C2ZA 3HK6B 2B0FA 1SLWB 1EJNA 2ZGCA 2VNTA 3SV8A 1SGTA 1QJ6B 2PWXA 3URCA 1O3CA 3ATKA 3T29A 5H4IB 4B1TA 4M7GA 4VGCC 7GCHG 1C2FA 5LPFA 1SGDE 2XCFA 3UY9A 2FI4E 1K1PA 3PM3A 1C9TA 1A3EH 4ISNA 2JH6D 4JYVH 4FUCA 1G3DA 1RD3B 2ZHFH 4AOQA 2VWLA 1UCYH 3U69H 3F3BA 1QBOA 5JBBS 1DDJA 1O5CB 1O3FA 3SU4A 1JRTA 2JETC 3PMJA 1C5QA 2Y80A 1GI3A 3GCNA 5A8ZA 4OM9A 1HLTH 1FN8A 5KEDA 3I78A 3P17H 1SGPE 4KGAA 1LMWB 1Z71A 2PV9B 6GCHG 1NY22 1TGTA 3EGKH 1ESAA 3OY6U 1E1QD 1ZZZA 2EI7A 1O3MA 2QC2A 3LH1A 4X8UH 2A4QA 1UK3A 1IQJA 2R3YA 3MU5A 2Z3EA 4OGYA 1ELEE 4JZFH 5CMXH 2C8WB 1K1JA 2H9HA 3EA8A 3PV5A 1FN6A 1AWHB 4YTAA 3QDZB 3SUDA 4LXBH 4WF8A 1P09A 2F4LA 4H42U 1QBVH 2XOKD 1H4WA 3DD2H 2WPJS 1O2MA 3U28C 1W10U 4AX9H 3LJJA 1P03A 8GCHF 1BTWA 1ZRKA 4NZLA 1GJ5H 1NESE 5EXLA 5FBIA 3PROA 4XDEA 1F2SE 2F9PA 5E2OA 3PMBB 1HFDA 1EFRD 2FO9A 2V3HH 4HTCH 1UVTH 4X8SH 3UB0A 1GG6B 3A80A 5K0HA 2UWOA 1C5MD 1NRPH 2SGFE 3NCLA 4F49A 1V2RT 2BLQA 4F55A 2XC0A 3PWCA 3RU4T 3RXFA 4CHAB 1DICA 4RKOB 3WWFA 2WPMS 2A1DB 3BSQA 3GY2A 3SZNA 1GHBG 3ELAH 2CF9H 1RXPA 5DP5A 3UUZA 4I32A 2J5UA 4DT7B 1PQ7A 1LHCH 2ZWLH 3E91A 1ETSH 3S69A 5F8ZA 2OC0A 5EQRA 1V2QT 5HYOA 5E2PA 2V3OH 2P3FH 4GLYA 1NBMD 2SGEE 2ZU2A 3Q3KA 4BXWA 3QN7A 2ULLA 2HPPH 1O3HA 2OC1A 1HIAB 3PWBA 1C2MA 1F5KU 1S85A 2QF5A 1XXFA 3GOVB 1K1OA 2W3KA 4ACBA 1ELFA 3L33A 3RXPA 3URDA 2OBOA 3MH7A 2JDID 4ZHMU 1UK2A 3A7TA 3HPTB 4XFQA 3ZZBA 2L6OA 4MNVA 3VB4A 2QXGA 1TMUH 2OD3B 5J4QA 3UWJH 1KXEA 1B5GH 3SU0A 3RLWH 1P06A 1DT2A 2F3CE 2VIVA 5E0GA 4JZIA 3NKKA 1TA2A 3BG4B 1WSSH 3SORA 1XUKA 4TY7A 1C1WH 2B8OH 4J2YB 1P2KA 3LU9B 5GJ4B 2ODYB 4HFPB 1GGDB 2FLRH 3QO6A 1AB9C 1O2YA 5HM2A 3T25A 2VIQA 1OSSA 2FOMB 1A4WH 3O8DA 1GBKA 4E06H 1DFPA 2RDLA 5C5OA 4Y8ZA 4FUBA 3ZIAD 4ZHLU 1D9IA 3DFJA 1ABIH 1DWBH 5A0CA 2ZQ1A 1GVKB 3UQVA 1TPPA 2J2UA 3TLOA 2BD9A 1MZAA 1AE8H 1O30A 1MCTA 5C1XA 1HAOH 2ILNA 2AIPA 4WMEA 3A82A 2FX6A 1P01A 2LP6A 4JZDH 1BBRE 1O2KA 4ISHH 4OS4A 1OX1A 3QWCH 1LQDB 3GCHB 2QE7D 1HNEE 1XKAC 6LPRA 1YY3A 1EZQA 2XTTB 4RT1A 3TVJB 2TGPZ 5EOKA 5EW1H 4Y79A 1GBMA 1TNJA 5FBEA 1YKTA 1FAXA 3MOCA 4X1SU 3CENA 9ESTA 2A5AA 2XC4A 1LPZB 2HLDD 1UTPA 1FI8A 1CT2E 1NFUA 1GG6C 1ZMNA 1TABE 3RXGA 3ZVAA 1C2DA 4WH6A 5EJZA 3BTWE 3L3TA 3VPKA 1XKBC 3FKSD 2AHME 3I29A 2BVSH 4CHAC 1BZXE 3P95A 1FY4A 1O37A 5EJ1A 1S83A 1T8NA 1GMDG 2NU2E 1XXDA 3KF2A 4I7YH 1THPB 5DPAA 1GBJA 3TH3H 2HALA 4D7GA 4Y0ZE 4K2YA 1S82A 1ELGA 4UE7H 3PTBA 1RTLA 2BD8A 1FPCH 3PYHA 5DP9A 5G4BA 1D3QB 3M61U 5FHTA 3F9GA 4X1PU 1QRXA 1WTHD 1P02A 4X8TH 1DPOA 3GY8A 2H9EH 1HV7A 1Z6JH 3AK5A 1CA0C 1O2OA 3U8OH 3GY4A 2VVVA 1LPKB 1GCDA 3KNXA 3KEEA 4I8LA 1FXYA 1THSH 4BTIB 5FX5A 1C5TA 3ZZ7A 1C4U2 2VB0A 1FY3A 1ELDE 4UD9H 4ASUD 1G2MA 2P8OB 3UQOA 1GI9B 5EG4A 4IGDA 1O3DA 2B7DH 1AHTH 2OBQA 1MH0A 3MI4A 1MTNC 3RXOA 1P2JA 3SGAE 2ALVA 1ELVA 1G2LA 1TGCA 4YLUA 3K6YA 1WUNH 1K28D 4CREA 1O0DH 5DP8A 3KCGH 2A45B 4FUJA 4FVDA 2SGQE 3SOSA 1KY9A 2GT7A 4GHTA 1EAIA 2BDIA 1YM0A 1J9CH 1H9HE 1MKXK 4ZKSU 2ZHWH 3BTGE 1UCYE 1SHYA 1L4ZA 2VGCC 1E38B 3B9FH 2AH4X 5C0UA 5DP3A 5I25A 1JXPA 1MBQA 4GVUA 1O2RA 3M7QA 2ZDAH 5DSFA 3Q3YA 1TX6A 1ETTH 1VKYA 1QR3E 3H7OA 4JK5A 1GBLA 4K3JA 3N7DA 1ESBA 4KTCA 1H8IH 1HAIH 4KTUA 4O9VA 2V35A 1WYKA 3BEUA 4TT3D 5HMAA 1BCUH 2Y6TA 4RT0A 1HAVB 1W7GH 2WPIS 5E8EH 1FY1A 1EP6A 1H1BA 1Y3WA 1HXEH 3BTDE 2V0BA 2RFKC 1QHRB 5DK1A 4X6OA 3T5FH 4NG9H 3T27A 1HJAB 5L2ZH 2HNTE 2ZGBH 3U8TH 3RXAA 4OS1A 1J14A 3SU6A 2QF4A 3TH2H 2BM2A 1AFQC 1HAHH 3BEFB 1SMFE 4IC5A 2ZCLP 4E7RG 1MTVA 4RKJB 5FL7D 2GTBA 3RXTA 1QGFA 1B7XB 3DSGA 2AGEX 2PW8H 3NUMA 2O8LA 2G51A 4NGAH 1W0YH 5JYIA 1EB2A 2AMDA 4ZXYH 1RS0A 1S0RA 2P94A 4ABBA 1TMBH 3M36A 2R3UA 4X2XA 5HIZA 2Y5FA 1LPGB 1K0HA 3U8RH 4A1TA 3LC3A 5JPMH 2SGDE 2P93A 3LOXA 2AEIH 2XBYA 2OLGA 1CA8B 2A5IA 1SPJA 1ANEA 3TK6A 1O33A 4Z0KA 1F0SA 3RXUA 2F9NA 2G81E 5EPYA 3FP8E 3EA9A 3KQDA 1FUJA 4GUXA 4TPYA 2ANMH 1ORFA 2A7JA 1W8BH 3U1JB 5DP4A 1BMLA 4NFEA 2W7UA 1GHYH 1G37A 1GHZA 2J95A 1EUFA 5EPNA 2BHGA 3KQ5A 3QGNB 2LNCA 2A7CA 2GCTB 3N7EA 1E37B 4LZ1H 3NRLA 1UTJA 2BD4A 5GIBA 2R0KA 1AY6H 2CMYA 4KELA 1NZQH 2HNTC 3UNQA 1XVMA 3HGPA 1AVWA 3AW0A 1TE0A 4AZ2B 2FODA 2C93B 2VWNA 1MABB 1H9LB 1T4UH 4NA7A 1HUTH 2WSSD 3PO1B 3TJUA 2AYWA 2BLWA 3A88A 3RXLA 2ZTXA 1N6YA 7GCHF 5IK2D 4DY7B 4XBCA 2K8IA 1QA7A 1KDQB 3CS0A 4Q7YA 1OPHB 2VVUA 3SI3H 1O3LA 5DP7A 1NO9H 1C2GA 1F0TA 1AGJA 3TK9A 4CH8B 4WY3A 1QJ7B 4ISLA 5HGGA 1TPSA 5T1VA 4I8GA 1QCPA 3H5CB 2A32A 5EIYA 1PQAA 3BTFE 1S0QA 2ZFRH 5LPRA 6GCHF 3PLPA 4UFEH 3U9AH 2EI8A 1J17T 1DXPA 1SFQB 3SV9A 4BAKB 1A61H 1GWAA 4XOJA 3SJ9A 1JOUB 1Y5UT 1CU1A 1GL1A 3G01A 1GMHF 1W7XH 4JMYA 1O2VA 1RIWC 4IN2A 2JETB 1WV7H 3OSYA 4RI0A 1HAYB 1KXFA 4HZHA 2Z3DA 3M3VA 1BBRH 4Q7ZA 1BTPA 5C20A 1QL8A 3DUXH 4GAWA 1FPHH 4AFSA 1HDTH 3GY7A 4P02A 3NPSA 1K1NA 1CE5A 1P2OA 2IJOB 1A2CH 1O5FH 1VITG 1NRSH 1FY5A 2OUAA 3M37A 2Y7XA 2QXJA 2ZEBA 4YOIA 5JBCS 2AMQA 1BTUA 2CGAA 2J4IA 5DKMA 5C3NA 4NWLA 1GHVH 2WUCA 4NIWA 1UW7A 2HOBA 1BMNH 1OWDA 3EYDA 1S81A 1DLEA 2GZ9A 2XC5A 2A7HA 2ZHQH 4K69A 1Y5BT 1TNLA 1O2ZA 1MZDA 1QL7A 1V2OT 1Y8TA 2AMPA 4A92A 2BDCA 1QFKH 1ZRBA 1H8DH 2ZDLA 2EC9H 3GY5A 1OYTH 3GYMA 2D1JA 2O8MA 3ZV8A 1WQSA 1A5IA 1MKWK 3V13A 2G8TA 4K1TA 4Y76A 2KM0A 1C5SA 1QQUA 3FP6E 3MU8A 3SJIA 5HM9A 4I8KA 2VH6A 3SQHE 2ZNKH 1SL3A 5PTPA 4CRGA 1GBAA 5C1YA 5FX6A 1MMJN 4A1VA 3ZZ4A 2ZGHA 4YOGA 1O2XA 4UONA 3OFND 1O3OA 2F43B 1KDQA 5GCHF 5TCCA 1G9IE 1F7ZA 1MAYA 1OP2A 3OYPA 4MLFB 4IC6A 3STIA 2JIZD 1NFYA 3ZV9A 4Y7BA 1GHXH 4FU7A 1TNHA 4Q2KA 1LVBA 1SGQE 2BVRH 3SJ8A 1EQ9A 2KFWA 5B6OA 1P2MA 2UUKB 2Y5HA 1W3CA 1F5LA 3RMMH 4GPGA 5A8XA 1ACBE 2QN5T 5FAHA 3LH3A 5JB9S 1HAXB 4Y10E 4INKA 2OQ5A 1EZXC 2J97A 1F92A 1FZZA 1C1TA 3F2FA 3S7HB 1O36A 2VIOA 3S7KB 3SNEA 3ESTA 5F6MA 2CV3A 3GYLB 2BDYA 1ZR0A 3BTME 5GNDA 4BAQB 4GHQA 2PTCE 3P6ZB 1TALA 1W0KD 2FS9A 2VU8E 2QIQA 3QUMP 3IITA 1AQ7A 4ABAA 1ZPZA 3EE0B 1YCPK 2ZU4A 3V3MA 1INCA 3B23B 1TWXB 1DY8A 3P70B 1AUJA 4IBLH 1HCGA 4INLA 4RN6A 4JZEH 1TNKA 1AB9B 2G55A 2HRVA 1O3PB 2BDGA 1NRQH 4X2YA 3MMGA 1HXFH 2WPHS 4ACAA 3FO8D 5DN6D 1RTFB 2GDEH 1PPFE 1FMGA 4DIHH 2G52A 4BTTB 3KQEA 1C5XB 2DUCA 1A1RA 2IOTA 5F03A 1JWTA 1BB0B 4QT8C 1GJ9B 1AI8H 4ZUHA 5GWZA 1L0ZA 2YNBA 1C2EA 4ISOA 2ZF0H 4FOUC 5C1UA 3P92A 1GHAG 3P8FA 4NSVA 1SGFG 1SQOA 5F8TA 1TRNA 1P12E 3MNBA 2QYIA 3GCTG 1XM1A 1C9PA 2PSXA 3KIDU 2OK5A 4Z6AH 1G36A 1W14U 3MWIU 1LVMA 2ZFSA 3ITIA 1DX5M 1GMDF 2OC7A 1C5PA 3RXDA 1Z7KA 1S6LA 1MU8B 4KP0A 2QXHA 2BLVA 1DWCH 2UWLA 1V2JT 2ZIQH 1JMOH 4M9FA 1ZMJA 1Z6EA 1F0RA 1TBZH 4XE4A 4BOHA 3MO9A 1TNIA 2HLCA 1C5VA 3SNAA 4AB8A 2GT8A 3ZVFA 2SGAA 4IN1A 1CBWC 3F68H 3TITA 4SGBE 1O2JA 1SGCA 2XBWA 4Q80A 4PROA 2CXVA 2PP6A 3ZZ9A 2ZU3A 4LK4A 4UEHH 2F9VA 2FI5E 1O2IA 2BXTH 2XBVA 2A31A 5T3HA 3ODFA 2ZG0H 4B6EA 1O2UA 2J92A 2FEQH 2KCYA 1EKBB 3ATLA 2QCYA 5SGAE 1KXAA 4Y0YE 4JYUH 1CA0B 1WOFA 4B73A 4MPUA 2VIDA 1ZTLA 4UFFH 3FFGA 3GS9A 1E35B 1TGNA 1O3NA 1C4Y2 1OKXA 2ZCKP 3D49H 2O8UA 2GKVE 3ZVGA 1SLXB 1AD8H 1KMHB 2BVXH 4XBBA 1GBTA 2ANWA 5A8YA 2VJ1A 3LPRA 2Y5GA 3QLPH 4O3TA 1VGCC 4CBOA 2NWNA 1O38A 1V2NT 1GCTC 1FIWA 1MTNB 2SGPE 4JCNA 2TGDA 4CRAA 5A0AE 3S0NA 1Q2WA 1ABJH 1QY6A 1SI5H 2PUXB 4HG6A 5C17A 2R0LA 1ZHPA 4BAMB 3TJOA 1OWKA 1SSXA 5GXPA 3U98H 5EXNA 4X6PA 1ZGVA 2FOFA 4A7IB 5HIYA 1OXGA 3A84A 5KECA 2NU4E 1WDIA 1Z8GA 5JBTA 1ZJDA 2VGCB 2OXSA 1UJ1A 1F5RA 1GVLA 1ZJKA 4X1RU 2GV6A 1BHXB 5TJXA 1MUEB 4WWYA 2GVFA 1BRUP 3C27B 2J34A 1SR5C 1QB9A 2PGQB 2ZTYA 4CBNA 1T7CA 3JZ2B 1EPTC 1C4V2 2Z9GA 1AU8A 3F6UH 3ZZ6A 3RXMA 2G00A 2PKAB 4R0IA 1KSNA 3FZDA 3RXJA 3M3TA 4MPVA 3MU4A 1N8OC 3UFAA 4X6NA 2FZZA 3EDXB 2FPZA 3E90B 2BTCE 1SBWA 3DSOA 1E79D 1G3EA 1D3DB 3RMOH 1DSTA 4LOYH 4X0WU 3RXIA 1L1JA 1FV9A 1YLCA 2R2MB 2ZECA 3W95A 4AGKA 2NU1E 4HGCA 1C5WB 3FANA 5FPYA 2KX4A 2WV4A 4UFDH 3ATMA 4GCHG 1AFQB 4I33A 1UO6A 2FOHA 4NSYA 3ZVBA 1XUIA 1CVWH 1COWD 1YGCH 1ESTA 3ATWA 3M35A 1IQFA 1V2MT 2C90B 4ABDA 3NZIA 1NPMA 1O3IA 3E0NB 3GICB 1XUJA 2F91A 2FYRA 1UTLM 1C5UA 2M5TA 3EA7A 1GI0A 3F2GA 1HIAA 5DGJA 5CHBA 2Z6BD 3SV7A 3VB5A 1MD7A 2BOKA 1HJ8A 1TMTH 2EQNA 1O2GH 3RMNH 1S6HA 5T6GA 3UPEA 2PLXA 2TBSA 1YPHE 2I6QA 4Y11E 1BDAA 2A5KA 2G4UA 1VCQA 5LGOA 3OEED 3BN9A 3MH4A 2H9TH 3SUEA 1HB0B 2RG3A 2ZO3H 1KIGH 1GBEA 3H09A 2QXIA 4WXIA 3RXSA 4E05H 2STBE 3B8JA 3ZVDA 1O34A 3F9EA 1ZHRA 2ZGJA 3M7TA 1B0EA 4MG3A 2LPRA 4ZXXH 3OU0A 1O2LA 1K2I1 1RTKA 4R8TB 4YT7H 5C94A 3RM0H 3GY3A 3M5MA 1KLTA 1BTYA 1GI2A 5AFYH 3NXPA 1P3CA 2P3TB 2ANKH 4B2AA 1ANCA 1GJ4H 1E34B 2Z7FE 3UNRA 4OS7A 3QTOH 1EP5A 1K9OE 2H5CA 1RRKA 1TBQH 1UTNA 3BF6H 1WCZA 2PKSC 2EI6A 2PKAA 4E7NA 4Q63A 2D2DA 3OY5U 2H1UA 2FS8A 3MTYA 2F83A 1TPAE 3NWUA 2VWOA 1BOQA 2BD5A 2BD2A 1WBGB 3AAVA 2ZDKA 4ISIH 3RXVA 4K8YA 4DW2U 1JRSA 2Q6GA 4DT4A 3ZZ3A 2KCOA 1TBRH 2GCHG 2VIWA 4ABEA 3LGYA 2XXLA 3MFJA 2PTNA 3SHCH
chains in the Genus database with same CATH topology
4ZH8A 3A7WA 3DFLA 1ANBA 4U30A 5AFZH 1ETRH 1YPMH 3ZZ8A 4MTBA 1YPHC 2AS9A 3Q77A 3D65E 4JYTA 3LT3A 2FTMA 2CHAC 1QTFA 1RIWB 1VITF 3RXEA 5JB8S 1C1SA 1NROH 1TQ0B 1D6WA 3O8CA 4AGJA 2D8WA 1EZUC 1G32B 1SGIB 2PR3A 2QGRA 3TPIZ 1CGIE 1JBUH 1KXCA 1GBDA 3QK1A 1P11E 2ODPA 1CHOG 1C5RA 1LVYA 2R2WU 3SU2A 2UWPA 4THNH 1K21H 3K9XB 1ZSJA 1UK4A 3RMLH 4FU9A 3QGJA 1UVUH 2A2QH 1KLIH 1IQKA 1EJAA 2FMJA 1UTKA 3TNTA 1GJ6A 1IHSH 1O2HA 3GISB 5L30H 1GHWH 4AB9A 2A4OA 2BY6X 1JIRA 1OP8A 1KXDA 1WTGH 3SHAH 1DM4B 1GJBB 2XCNA 3RU4E 1IQLA 2BDBA 1TRYA 2BQ6B 5EW2H 1BMAA 1C5ZB 1EJMA 3SNDA 3P8NA 3GDUA 3LONA 1GDUA 4ESTE 3BV9B 2Z9LA 3MO6A 1SHHB 2AGIX 1O2PA 1F0UA 2BD3A 1FLEE 3A8BA 2O8TA 3T2NA 2HNTF 3A7VA 4F4OC 2ZHDA 3K2UA 9LPRA 1BIOA 1KTSB 1IQIA 2QA9E 3A86A 3E1XB 3ZZ5A 5ESBA 3F9HA 2GMTC 2QF0A 2FYQA 2RA0A 2O8WA 3UWIA 2XW9A 4A6LA 3ZZCA 1CQQA 2BLOA 1QRZA 1E36B 1HAVA 1W11U 1IQNA 3A8AA 2YOLA 3SGQE 8KME2 1L2EA 3LGWA 1EASA 4Y8XA 4MVNA 3Q3XA 1B0FA 1C5NH 2DE8A 3DT0H 3RXHA 3RXRA 5J4SA 1DE7H 2B9LA 2PSYA 4XBDA 5CHAC 1BRAA 2F9BH 3NK8A 1LVOA 1AKSB 1ZTJA 3RUOA 5LH8A 1QL9A 3IWMA 3DHKH 3A83A 4YESB 2FI3E 1TX8A 1DWDH 4BNRA 1SGFA 5FCRA 3AVZA 1CT4E 2Y82A 3A7YA 4UFGH 4WJG2 2ZP0H 1C2IA 4FXGH 1LDTT 3SQEE 3T26A 1Y3VA 4D76A 1Z8IB 2B5TB 3W94A 1T4VH 3RM2H 1TX7A 2PHBA 4FVBA 1BTHH 1UHBB 1O32A 1GBBA 5T6FA 1GHAF 3MU0A 4I31A 2BOHB 5GDSH 5C5NA 3D23A 5EXMA 5BRRE 5T6DA 2Z94A 4HI3A 2ESTE 4DJZB 1FAKH 3VGCC 1AVGH 2JH5D 1XVOA 1CO7E 2RCEA 4MNYA 2NU3E 1V2VT 1HYLA 3BEIB 1O31A 3R3GB 4OS5A 2A0QB 1J16A 5E0JA 3V12A 4XSKU 1OS8A 1EATA 1BBRK 1OOKB 1RFNA 3GDSA 4FUGA 3HKJB 1DANH 1Z1JA 2FESH 4B2CA 1DS2E 3VEQB 4FUFA 3M5LA 1OWEA 1P9SA 1PYTC 3U1IB 4CH2B 1GHBF 2ZPRA 3V0XA 1Y3YA 1D6RA 1HAGE 2FOAA 2BX3A 3UOUA 2ZA5A 4SGAE 2HWLB 2OQUA 3VB6A 1OYQA 1UVOA 1QRWA 3PTNA 3BTTE 2ZFQH 4YM9A 5IDKA 3PV4A 4JZ1A 1CBWB 1GJ8B 4H6SB 2IN2A 3LDXH 4Y7AA 2UUJB 1GI7B 2CF8H 1DUEA 1AE5A 5GPIB 4ABGA 4YO9A 1WU1A 3HKIB 3SNCA 4INHA 1C1RA 4B75A 1SVPA 1O5GH 1LO6A 1P3EA 1NFWA 4FU8A 2ODQA 2KAIB 3CP7A 4MQAA 7KMEH 4AYVB 5L2YH 1V2KT 4TWWA 3GCOA 1P57B 1SGYE 3SBKA 8ESTE 1AKSA 3KQBA 1CGHA 4DOQA 4A5TS 1YPJH 2FOCA 1S6FA 1ZLRA 2NU0E 1IQMA 1O2QA 1QA0A 4X1QU 1C1VH 1Z8RA 2SNVA 4B74A 2Z9JA 1HRTH 2QV1A 4TY6A 3UTUH 3LGIA 1O2NA 3R0FA 4A1XA 1BITA 1Q31A 2FOGA 1PPEE 1VGCB 2BD7A 2VINA 1HAZB 1NFXA 3WY8A 1S5SA 1GCTB 1UHBA 1SGRE 2XWBI 1QB6A 2WYJA 1GMCG 4H4FA 2AIQA 4X1NU 4O97A 2XRCA 3UOPA 3LIWA 1VCPA 1P0SH 1YLDA 2WINI 1WQVH 4K60A 3RDZA 3E3TA 1RGQA 2W3IA 5EQSA 3V7TA 1P05A 8LPRA 5E0HA 1DY9A 2HVXA 4BXSA 2ZDNA 5CE1A 1VJAU 2H2ZA 1EAXA 1FONA 1ID5H 3S9CA 4YOJA 1L4DA 3PMAB 3BTQE 4KKDA 2G5VA 1UCYK 1YPGH 1EOJA 1PJPA 1ZSKA 1C2HA 1P8VC 1RJXB 1FDPA 1SGNE 3A8CA 5ETXA 2BB4A 1LHFH 1L1NA 3LGVA 2ALPA 2R9PA 5ABWA 1AUTC 1EPTB 3TGJE 3KQCA 4ZKNU 3SGBE 5DO4H 1L1GA 4DCDA 4GCHF 1LTOA 1DOJA 1GMHG 2ZPSA 3LGTA 4NA8A 1A0JA 1TNGA 1TONA 2FOEA 1OP0A 2BZ6H 4DURA 1DUAA 1C1PA 1N8OB 1QIXB 2AFQB 3BTKE 2ANYA 1NN6A 1BMMH 4TWYA 3HATH 2ZGXH 3ZVCA 1NU7B 1BJVA 3AW1A 3M5OA 4FUDA 4U32A 4UDWH 4OS6A 2ZFPH 4DIIH 4WH8A 2GDDA 3TNSA 1GBFA 1IQHA 4ABIA 4NIYA 1DXWA 1O2TA 2BY5X 1MU6B 4BAHB 1C5YB 2C8ZB 2PUQH 1MD8A 1Z8JB 4O3UA 1LCYA 1A7SA 2IPHA 2KAIA 2BDHA 1O3AA 3ZVEA 2EEKA 1ZPBA 1N6XA 2A2XH 5ESTE 3UR6A 1LHGH 1ELTA 1KLJH 3RU4D 1Y59T 5IYTA 1ELAA 3MH5A 1OWIA 4Y6DA 4CRCA 1AO5A 1D3PB 2ZTZA 4AN7A 5JDUB 1DITH 1U6QA 2FTLE 5C67A 2YNAA 3BTEE 5I46H 2JKHA 1D4PB 1GVZA 3M7UA 1GJ7B 4D9RA 3SUFA 4K8BA 4U2WA 3LJOA 1O2WA 1XUGA 1UTMA 3A89A 2GZ8A 1PFXC 4IMQA 4I8HA 1K1IA 1A0HB 3UR9A 4B71A 1TPOA 3E0PB 5GCHG 1ZYOA 1EB1H 2TPIZ 3KL6A 1A5GH 1T32A 1UMAH 3Q76A 1O5DH 1GBIA 3FZZA 3SW2B 4ZAEA 2V6NA 1LHEH 2BXUH 3AASA 4MNXA 4I8JA 3BIUH 2UUYA 2VVCA 4IMZA 4B2BA 1TOMH 4H6TA 1K22H 2ZKSA 1PYTD 4NZQA 3EQ0H 3DA9B 3VXFH 3LKWA 1P10A 1TGBA 1AZ8A 2XBXA 1G30B 2GCHF 1EPTA 1PQ5A 1CT0E 2PKSB 4ZROA 1A0LA 7LPRA 5EODA 1C1MA 1IQEA 2PFEA 1FQ3A 1SFIA 2Y7ZA 2Z9IA 1ARBA 5JBAS 3BIVH 4CRBA 2C8YB 3ENSB 1YYY1 2W7SA 1SB1H 1V2TT 2OP9A 1LKAA 1UVSH 1IOEA 2GGVB 1NRNH 4J1YA 4MNWA 2GP9B 1MBMA 4BAOB 2BYAX 2GX4A 2BY8X 1AMHA 3HK3B 5HXFA 1V2WT 3SJOA 4CRFA 2ZDVH 1C5LH 2ZQ2A 3SU1A 1BTXA 1DWEH 2THFB 1AZZA 3M3SA 1CHOF 1BRBE 2CHAB 1GDNA 1V2LT 3BG8A 3OTJE 4K1SA 5EU8A 1KYNA 1EZSC 2JH0D 2ZU5A 4AORA 2Q6DA 1ZGIA 2C4FH 3A81A 1ZTKA 2OC8A 4NWKA 3O8BA 1C2JA 1BTZA 3ZZDA 3FVFB 1TLDA 2GZ7A 5FPTA 1TGSZ 4X8VH 5K7RA 2PGBB 5DG6A 1PQ8A 2XNIA 4OS2A 4ABFA 8GCHG 1AFEH 4CR9A 3UREA 5L6NH 3SV2H 3SJKA 1O3JA 2XWAA 1V6DA 5DJ7A 2Q1JA 2Y81A 4FUHA 1YPKH 1Y5AT 2ZI2H 1Y3UA 4FUIA 1QB1A 2A4GA 3SN8A 3AAUA 1MQ6A 3MH6A 1O3BA 2P3UB 1FIZA 1N1LA 2SFAA 1YC0A 2TRMA 5FXLA 2VH0A 1AWFH 3RC4A 1FJSA 1E0FD 2J94A 2P16A 2FLBH 1BUIA 4OGXA 3RXCA 1MCVA 1MKXH 2UUFB 1MTWA 1T31A 4ABJA 1GPZA 4AYYB 1YF4A 7ESTE 2DE9A 1THRH 2BDAA 2QY0B 1EAWA 2G5NA 3TGKE 3JZ1B 2F9OA 1QURH 6CHAB 3A85A 1OWHA 4BANB 5EGMA 1GL0E 2G4TA 1GI6A 4NIVA 1XUFA 1X7AC 2GMTB 1T8LA 1EXFA 3PLBA 3P8OA 3SU3A 3BG4C 4D8NA 1TYNA 1BA8B 1BHXF 3M5NA 2Q6FA 1GI5A 1P04A 4CRDA 2STAE 1GGDC 1GI8B 1GBCA 4ZKOU 4DGJA 1NC6A 3KN2A 1K1LA 1GBHA 3GDVA 4X2VA 2CJIA 3ZYEA 3FP7E 3VXEH 4WXVA 4X2WA 3E8LA 1TRMA 2AGGX 1HJ9A 2VWMA 2W26A 3KHVA 5CHAB 1T8OA 2XYAA 1YPLH 4Q7XA 2AERH 2BX4A 1HGTH 2FDAA 1YBWA 2CN0H 2TIOA 3K6ZA 1O3GA 3GCHC 4NCYA 3RC6A 1QNJA 1NS3A 3OX7U 3T28A 3A7XA 4AG2A 1EAUA 1Z1IA 1BRCE 1OWJA 1ZOMA 1J15A 2ZHEH 3VB3A 2FOBA 3RP2A 3VFEA 3A87A 1DSUA 1ZSLA 2SNWA 3IG6B 5TCAA 5AF9H 1C2KA 1LHDH 4YT6H 2EA3A 4IW4E 3SU5A 1W12U 1IAUA 3LC5A 3QZRA 1A5HA 1M9UA 2VIPA 3O8RA 1QQ4A 2TGTA 3VGCB 1MQ5A 3ODDA 3S9AA 3Q00A 1ELCA 1IQGA 2FP7B 4GSOA 1GDQA 2WPKS 3QX5H 5A0BA 3RXQA 4YLQH 4NFFA 1H9IE 1MTUA 3MNCA 3RC5A 3HGNA 1ELBA 2H6MA 2OCVB 2WPLS 2ZCHP 4D7FA 1SOZA 1P2NA 1A3BH 5A09A 1YP9A 1KXBA 2FX4A 4AFUA 4Y8YA 4RSPA 2ZFTA 1O39A 4MPWA 1TB6H 2D26C 1CHGA 3F1SB 2OTVA 3MHWU 2ZFFH 1NU9A 3H7TA 4ASHA 1PPZA 1LQEA 2J38A 2FXRA 5EQQA 3GY6A 3E16B 1EX3A 4NIXA 3TH4H 1EOLA 1VJ9U 2GD4B 4TPIZ 3S9BA 1PPBH 1NRRH 2P8OC 3SNBA 3MYWA 2Z9KA 3D62A 6CHAC 3SI4H 2ZPQA 4ABHA 1P9UA 2FWWA 3UNSA 1O5EH 3TGIE 1NTPA 1GJDB 3LGUA 3SUGA 1HAPH 1P2QA 1O2SA 2P95A 2ZZUH 1SLUB 3MNSA 1AVXA 4MDSA 2QAAA 1V2PT 1ZPCA 2RA3A 3VB7A 3RLYH 1VCWA 5BPEA 1K1MA 1SLVB 2ASUB 2WV5A 3MNXA 4NA9H 1TFXA 2K1QA 1LKBA 2ZDMA 5FPSA 3ZYDA 1GMCF 1MAXA 1VZQH 3FAOA 2ZU1A 2HGTH 2J9NA 3P8GA 2I6SA 1TA6A 2BY9X 1KTTB 1C5OH 1TIOA 2H5DA 1SC8U 1G3BA 5F8XA 1UVPA 2F9UA 5FCKA 4CR5A 4AG1A 1HPGA 3EAJA 2BQ7B 3MU1A 2TGAA 1YCPM 4WMDA 5DP6A 3PMHB 4K1EA 4VGCB 3L6PA 1W0ZU 1HJAC 1NT1A 4BTUB 1PPGE 2BMGB 4U01A 1MTSA 1T8MA 2BZAA 5AHGH 1QBNA 4D9QA 1TAWA 1GJAB 4FUEA 3QTVH 1HBTH 3RXBA 3GCTF 3K65B 3CS7A 3PB1E 1G3CA 1V2ST 1XMNB 3ZZAA 3A7ZA 3BTHE 1D3TB 2C3SA 2W5EA 2A4RA 3UIRA 1C2LA 4JK6A 2FM2A 4WMFA 1CSOE 3C1KA 2P59A 1SGEE 2C8XB 3TJVA 3SO3A 1O5BB 2O9QA 3A8DA 1MKWH 3T62A 1UTOA 4X6MA 4DVAU 1V2UT 1IHTH 1ANDA 1GI1A 2WUBA 1BQYA 1QJ1B 2Z3CA 1CGJE 3MO3A 1BT7A 1S84A 2WYGA 1AIXH 2BQWB 4ZKRU 3PLKA 3TK5A 1O3KA 2FIRH 1SOTA 1J8AA 3KGPA 1GJCB 1SG8B 4K5ZA 3TJNA 2BY7X 3TU7H 3I77A 1WAYB 3ATIA 1Q3XA 2QF3A 1BJUA 1ZMLA 4ZMAH 1C1NA 4Y71A 3STJA 1DLKB 1SQAA 1PPCE 1XX9A 1O35A 1W2KH 1PPHE 5AVDA 5A2MH 3E6PH 4AFZA 2GCTC 1C1OA 1XUHA 1VR1H 1TQ7B 4DG4A 2HPQH 1C1QA 1NM6A 1SQTA 1Y3XA 1TOCB 1C1UH 1O5AB 1AN1E 1DVAH 6ESTA 1O3EA 4ZHAA 1A46H 4IS5A 4B76A 3RXKA 1V3XA 4YZUA 1JIMA 1UTQA 4AFQA 3PO1C 3F9FA 3TIUA 1P2IA 1ZHMA 1ARCA 2GV7A 3SV6A 4O03A 1FY8E 1GI4A 1YPEH 5LPEA 1VITH 1FNIA 4KTSA 4WVPE 2OINA 3N7OA 4LZ4B 2ZC9H 1YCPH 3QZQA 4MPXA 1W13U 4TYDA 5C2ZA 3HK6B 2B0FA 1SLWB 1EJNA 2ZGCA 2VNTA 3SV8A 1SGTA 1QJ6B 2PWXA 3URCA 1O3CA 3ATKA 3T29A 5H4IB 4B1TA 4M7GA 4VGCC 7GCHG 1C2FA 5LPFA 1SGDE 2XCFA 3UY9A 2FI4E 1K1PA 3PM3A 1C9TA 1A3EH 4ISNA 2JH6D 4JYVH 4FUCA 1G3DA 1RD3B 2ZHFH 4AOQA 2VWLA 1UCYH 3U69H 1QBOA 5JBBS 1DDJA 1O5CB 1O3FA 3SU4A 1JRTA 2JETC 3PMJA 1C5QA 2Y80A 1GI3A 3GCNA 5A8ZA 1HLTH 1FN8A 3I78A 3P17H 1SGPE 4KGAA 1LMWB 1Z71A 2PV9B 6GCHG 1NY22 1TGTA 3EGKH 1ESAA 3OY6U 1ZZZA 2EI7A 1O3MA 2QC2A 3LH1A 4X8UH 2A4QA 1UK3A 1IQJA 2R3YA 3MU5A