1O5JA

Crystal structure of periplasmic divalent cation tolerance protein (tm1056) from thermotoga maritima at 1.95 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
HHHMILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIFKTTEEKEKELYEELRKLHPYETPAIFTLKVENVLTEYMNWLRESVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Periplasmic divalent cation tolerance protein (TM1056) from Thermotoga maritima at 1.95 A resolution
rcsb
molecule keywords periplasmic divalent cation tolerance protein
molecule tags Unknown function
source organism Thermotoga maritima
total genus 24
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1o5jA00
4E98A 2EG2A 3LF0A 4RLEA 3L7PA 1NH8A 4RWXA 2GW8A 3DFEA 1J2VA 4OZJA 2V5HG 4R25A 1NH7A 4USIA 4OZLA 4USJC 4RX6A 3GSDA 3AA9A 4IYQA 2E66A 2CZ4A 1UKUA 4CO5A 2O66A 2O67A 3O8WA 1HWUA 2NUUG 3MHYA 2NS1B 4NYOA 4CNYA 4D3GA 3TA0A 3AH6A 4CO1A 1UFLA 3NCPA 1V6HA 2Z0GA 4Y6IA 2ZFHA 4OZNA 4C3KA 4Y65A 2JJ4D 4YB7A 2RD5C 4WK3A 2XULA 1OSCA 1UL3A 2ZOMA 4USHA 4C3MA 1NAQA 1UMJA 3M05A 1VFJA 2J9DE 5DS7A 1KR4A 3X3UA 3AA8A 1V3RA 4NYPA 1V3SA 4RWWA 1V9OA 3BZQA 4AFFA 1PILA 3O5TB 2XBPA 2DCLA 2NUHA 5DRKA 4C3LA 2EG1A 5D4LA 4CO2A 4CO3A 1QY7A 3CE8A 4CO0A 3NCQA 3NCRA 5L9NA 2J9CA 3OPKA 5D4NA 4CNZA 1NZAA 2GX8A 5D4OA 2PIIA 1P1LA 2GNKA 2VD3A 2J9EA 3TA1A 1O5JA 1O51A 3T9ZA 1H3DA 4YB5A 4WK1A 4D3HA 1Q1KA 3AHPA 5D4PA 1GNKA 4ZK7M 4CO4A 2XG8A 4YB6A 3TA2A 2J9DA 1VHFA 2XZWA 1XK8A 3HLUA 3N5BA
chains in the Genus database with same CATH superfamily
3RR7A 1C1CB 2AHOB 1R8HA 3BO4A 2XZDB 1IWGA 3MOZA 4A8YA 3D3CJ 2LA4A 4CO5A 3UD4P 1BE4A 5L46A 5ETLA 3FFIB 2B7BB 2QA4S 1FRXA 5B08A 4KR0B 4UOFA 3I87A 3RBZA 3KMQA 2B6AB 3NLCA 3WZ0A 2V4JB 5LMUJ 4Q5VA 1BLUA 5KFGA 5JJBA 2DJWA 5KT3A 4ZJLA 2IFXA 4DR2F 1LWXA 5CD4A 1IWAA 2I5JA 4DN0A 1WF0A 3PKYA 4OYOA 5LXYA 5THWA 5IXUA 3I0SA 3CO0P 2RF2A 3HF5A 3L7OA 2KHDA 2XG8A 1WACA 2RB7A 2HNZB 5DGAA 1J27A 5HP1B 2RQCA 3A3NB 1IJEB 3R5GA 4PYDA 3UO0A 2HHQA 3ILLA 1CG2A 1TFWA 3BDPA 3LP1B 1OPZA 4X4NA 2GFFA 1WC1A 4M5IA 3PV8A 4Q44A 2LU2A 5HROA 1U24A 3PYFA 2GO9A 1KKHA 2HQGA 2F9JA 3MEDB 3A8KA 2E1MC 4GVBB 4OI6A 5E3CA 3UI3A 3CJSA 1GTEA 5EX3A 4TYBA 2DEIA 1RT1A 2POKA 4X65F 1IQZA 2BJ8A 4XO0A 3DLHA 4HDGA 2W7AA 4XDDA 1U1OA 3DOKB 2OI2A 2GGPB 1NK8A 1PGZA 4WFYA 2QLJB 2VG6A 4FNHA 4DR6J 1CJUB 3TJAA 1UA0A 4HTJA 4ZLNA 1FTRA 4CLFA 3P5TL 2AKWB 3W9IA 1FXRA 4TLRA 3QSYB 3SDEB 4JI1J 4JI4J 1JLQA 3OXFA 3PM9A 2OAUA 3QSIA 1L5UA 2ZHBA 2AZ1A 1FKAF 2UUBF 5KFOA 3TAMA 2BV3A 1RU2A 4OYMA 4J90A 4ED1A 3IRWP 1WF1A 5EWEA 4LF8J 1WSRA 1FKPB 2DGXA 4IYQA 1WG1A 4F7VA 6AT1B 3NGRA 2JWNA 4QU6A 2HZAA 3ILJA 2EBGA 3LANA 3NGSA 1DTTA 1NPPA 1Q53A 4OYWA 2G9OA 1DURA 1DTQB 3Q89A 1CQNA 2NZCA 4DCJB 3QT7A 1UMJA 4WJBA 2EPIA 3VAHA 3CMAS 4J9UE 2C2KB 4ZPVR 3T6BA 2Y0SD 2V4QA 3JSYA 2DNOA 4ZIWA 2VONA 3VAIA 5JVHQ 2APOA 1SJ3P 1MROB 3HVWA 2AJ4A 2LA6A 4DBQA 1S0VA 2B0GA 3F44A 5KOXA 1QY7A 1XMBA 3H59A 5MLCV 5D4NA 2F8HA 4DR7J 3DNCA 2VD3A 4QIVA 4PKDB 4HL9A 5EN1A 5D78A 3TYTA 1WHXA 2HBQB 3LF0A 3A12A 3D7SB 1FJGF 3G9CA 2WAQD 4QPTA 3ZC4A 3DFEA 1HYSB 1NK4A 2UV8G 3R5CA 1RWUA 3BB5A 1UA1A 1XMOF 2IJFA 1X0PA 5DDRC 2LEPA 2BMBA 3PRBA 4JI3F 2W01A 1P8GA 2PN6A 3JTNA 3M4XA 1Y5IB 3K59A 4ZMMA 4FPRA 2MKHA 2NSBA 1LXJA 3W9JA 1YBUA 1SIZA 2W4CA 2FDNA 3AJ2A 4IR9A 3Q2TC 4NZ7A 5KT2A 3ADAC 4PWDB 2UXCF 2VPZB 4CYUB 2V0NA 4HH1A 1WKJA 2VC1A 5IQQA 1RTHB 5I3QA 1YITS 3GP9A 1RCOB 1U6FA 4P73A 5D4OA 1FWKA 1DQAA 3W2VA 2XMAA 1S12A 4YB6A 4QWEA 1CULB 4I69A 4DPWA 4OIXA 3T1AA 5DG7A 1R6VA 2HS4A 4JOUA 4NLXA 1T9YA 3B6BA 2CVIA 1I5OB 4TU7A 1APSA 3M32B 4NLRA 1VC6A 3TP2A 4KKOA 3MTJA 5HAOA 3THTA 3PIPQ 3KWMA 2WW4A 4DDFA 1S72S 1JLCA 3LH2S 1RWMB 4KAIA 4DL3A 4CI0B 1WHYA 4P9SA 1YJVA 3AA8A 3CDAA 2BRLA 2PD1A 2XO6A 1Y0HA 3H20A 3TZXA 1Q7LB 3AD7C 1VLOA 5D4LA 3DLEB 4K50A 4DSEA 2YWFA 5A76A 2LQBA 4RW4B 2QC3A 3K8WA 4Y3CA 2C22A 1FDDA 3G6ES 1CSJA 5KTQA 4WYWA 2RRNA 1TAUA 2PEHA 2KZZA 3D1HA 2QYGA 3KHRA 1ROFA 4M5JA 2CJYB 4HT5A 3H90A 5LJ5Y 4M5DA 2VQFJ 3KLVA 3D5MA 3B78A 4NLWA 3OQ2A 3J80U 2LVWA 2CIMA 2DYAA 3S01A 6FD1A 2GVDA 4LF6F 5KFNA 2MXYA 1ZTWA 2DH7A 3K58A 2V8VA 3KKFA 4C8LA 2YKQA 1B0TA 3RBEA 4H4OA 1TL1B 3MM6B 2DRAA 5FLXY 4LFAF 2C2NA 3AXMA 3N79A 1JIHA 1Q0NA 3C15A 1TKTA 2CPXA 4PRFA 4LMZA 1KOOA 1RWNB 3CGIA 4H54A 1M1GA 2XYPB 1X5PA 4OI0A 3A8IA 1TL7B 5L1IA 2UXBJ 5KFVA 2QLFB 2O01C 2RDDA 2RT3A 4LBPA 1CBKA 2FHOB 1I94F 3VR1A 1RBLA 1PJ7A 4J9NA 1Q95G 3LP2B 5B0CA 3GILA 2ALYB 4A8SA 5CYMB 5J2NB 1SVDA 3ZZYA 4ZHRB 4QZVB 2RS8A 4O3OA 1EP4B 3GPAA 2ZD1B 1WI6A 1U2FA 2MKSA 2KT5A 2WSFC 1KLNA 4LSNB 1SL2A 4LF5F 1IQTA 2JSXA 3D6MB 4DSFA 3EX7B 4OI1A 4B3OA 4MKAA 4B3TF 3EYZA 1RZMA 1FNXH 1AXQA 3HSJA 1I6JA 5ADZA 5J1EA 2OPQB 3EMTA 1KSPA 4QIGA 1Y3JA 1S57A 2Q3PA 1S6OA 4ER8A 4PPZA 4KIAA 3IAM9 4XAKA 1U0HA 3KK2A 1B64A 2MKJA 2A3JA 2BR0A 3MM7A 2VFVA 3IS9B 2Z2YB 1N56A 2AJQA 5GAEU 4R8UA 2CJKA 1U1LA 4K59A 2FHJD 1H72C 1KHWA 4CLSA 1GX5A 1VOMA 3VZHA 2ZJRQ 1RHUB 3Q86A 1FERA 1S0NA 3RW7A 4DUZJ 2ZUGA 1Q8IA 5HVHA 2DGOA 4NYZA 3R5AA 2W7PA 2L9WA 3QIPA 1HNXF 2ASJA 5JMNA 3GMGA 1FESA 1TL5A 1JB0C 4FBUA 3NAIA 4WFZA 1IKYA 1CC7A 3M05A 1RHQB 1H2VZ 2DNYA 2XBPA 1VRUB 1N48A 2L08A 3HO1A 3WDOA 2K1RA 1S76D 3RAQA 1RUSA 4X62J 4LREA 4FYWB 3UN2A 3HKZD 5AJ3J 3KLGB 2J0SD 5DO2A 4WK1A 2EFQA 3UDVA 2ACYA 3J7ZT 2HEKA 3MUMP 1HBMB 1PIEA 4B08A 2W1BA 3J7A1 1NHKL 3QATA 2LYVA 2M9KA 2F1FA 3O3LA 3BGFA 2MQOA 3IR6B 3D4JA 4MIWA 1HBUB 1FEHA 1GX6A 3MEGB 3Q8YA 2WOMB 2RKIA 2CKWA 5BJRA 4B9TA 2O66A 5ETVA 3TOQA 3RAMA 4RNMA 5HQLA 4FYXB 1CJVA 3EWGA 5KAKA 2DR5A 3SCKE 1N6QB 2NYIA 3R7SB 1IBCB 4O4GA 4PXCA 5HMYA 2R7OA 4EFAC 4DV6F 1DFDA 2I1RA 3GONA 4DV7J 2IVYA 1X4GA 4GC7A 2UVRA 4AL7A 2C3OA 1VQPS 1SV5A 4UZBA 5HLFB 4JV0A 3KYLA 3ZNUA 1QVFR 3UDCA 4DV5J 1PC4A 2HRYA 2RS2A 4JYAF 2X1GA 4ZJQA 3CMES 3I5CA 4C11A 2P6SA 1Q82T 4C97A 4FVCA 4LF7J 4OFZA 2VG7B 2KVIA 4C48A 4S0MA 2YX1A 5ETNA 5D0HA 1NK9A 2DGTA 3NOCA 3CULA 5F8IA 4LIWA 3FDSA 4MKVA 2FD2A 4GMKA 3SYZA 4M5MA 2DGVA 1U45A 4TLQA 2HHHF 4DQSA 2BW2A 1NSKL 1N32F 3G87A 3I5AA 3MECB 2V2QA 2VPXB 4RU9A 2E1PA 2BOPA 3RRHA 1NSQA 4DR5F 3DLJA 4OV6A 3LAMA 4DV3J 1DZ5A 4NMXA 4OV1A 3Q8QB 4YB7A 5HP1A 1OQ3A 2Y8YA 1TVRB 3OUYA 2D3O1 1KONA 4EYHB 2L41A 1RTIA 1IXKA 1TUWA 1OWXA 4N77A 4LF2A 4J9KA 5C24B 5LMUF 1RHMB 4C8KA 2M8DB 2MTLA 2DHHA 4K4ZA 2Z57B 6FDRA 5CH7B 3FSYA 4B9VA 1URNA 2WB1D 4NZ0A 4LIRA 1V3ZA 2J7KA 2HPUA 2R42A 4DU8A 3BQ0A 1PBUA 3UVJA 2MLZA 1VCTA 3OL9A 3R8YA 4IFYA 2FHMA 4ZP6A 1X7VA 2YQ3A 2PI4A 1GNKA 5EDWA 2Y1IA 2MZSA 2FJXA 3OBIA 1YHQS 3CUNA 1NSAA 1Q5YA 5FD1A 3J7YI 4R25A 1U6ZA 3AB2B 3GV8B 3OL7A 2X51A 3HHLA 2HBZB 2ZEJA 4DR1J 3QFHA 2OSQA 3VQTA 3ZTSA 5C25B 2QZ8A 2H54B 4Y2CA 4ZDNA 2R2RA 1UFLA 4V19J 3RZAA 2DPIA 2XULA 1M5PC 1RBOB 2ZZNA 3I32A 4BS2A 2FLOA 3MAQA 2YNHB 3PW7A 4DV2J 1V3SA 4DCPB 2ZH4A 5JVGQ 1PBAA 1RDRA 4N47A 3OVAA 2V68A 2ATCB 2VJVA 2XNRA 3L3CA 2X7IA 1NKEA 5K14A 3BSCA 2CPDA 2XY5A 1QDUB 2GC8A 2GO8A 1UVIA 5IZHA 4DR6F 1WC5A 3V4MA 5L1KA 2VASA 3A8EA 3ULHA 4IQXA 4JI1F 4BWJA 5KFJA 3SFUA 1LKZA 1SQEA 1ZA1B 2RVJA 3R9LA 5J2PB 4JI6J 1SKUB 2LMIA 4O4RA 3M8QB 4XPEA 4OZJA 1PAUB 2V2KA 2VFTA 1MMLA 1VRQC 3V4IB 4BHQA 4F26A 3W8GA 1NXIA 2E1AA 3N6LA 5I42B 5HBMA 4DOZA 2F8MA 2H1YA 5F3ZA 4ZN1A 2XSJA 4J9RA 4UQTA 2GIQA 4JV1A 4YY3J 2DITA 2N4CA 2HHPA 4X66J 1HNIA 1YDLA 4RR5A 3CJQA 4FXDA 4F0HA 3DLLQ 4NA1A 1VQLS 3QT6A 2FLPA 5D3GA 2FJBB 2EG1A 3FJ2A 4CO2A 1YJTA 3EUNA 4F67A 1RISA 4DR7F 1RU1A 3BJYA 3C66A 1X4BA 2VKZG 5A8RB 1M5SA 4RW6A 4DS5A 5HO4A 1IKXA 3VZIA 4FF3A 4YEAA 2BJ1A 5M2PA 2CJ9A 4OZ5A 1OJ4A 3TNVA 3CC7S 1NH8A 5KFTA 2HS3A 3JAMY 1AUSL 1F2HA 2OFGX 1SXLA 4EU0A 1CC8A 1Q7YT 2NXNA 2VA3A 3MFIA 2IM2A 4FF2A 3NS7B 4ZIVA 4PQAA 1SQFA 4Q0BA 1X60A 4HTIA 3SMZA 3T5KA 1BQNA 1HKAA 5HVFA 4J7CA 2L3MA 5DM6Q 5B7WA 1GT8A 3PO5A 2IC3A 2KRBA 3X3UA 4N7TA 4ES2A 5ETPA 2AW0A 3RB3A 3MM5B 2HK2A 5C7PA 3KUHA 4J9SA 1XERA 2H48B 4GO7X 1C2PA 4ES1A 2YPZA 2MQ8A 2ZOFA 3R3TA 1QE1A 3PW0A 4WFNQ 4CM2A 2XCPA 3MWBA 2IBOA 1C0UB 2WTFA 4NX9A 2ZITA 2J9EA 4UUXA 2K2PA 4D3HA 1GMUA 3NEKA 4QIWD 3KFWX 2J9DA 1RB0A 4KH1B 1K47A 2H5EA 3OTDA 4NLOA 1JNZB 1DLOA 1RT2B 4PCQA 3DGPB 4DU7A 4R0EA 2AEFA 1BGXT 3H98A 4WE1B 3PR5B 3I4PA 3POTA 4I64A 2XS2A 2AJ1A 2OMLA 2E5LJ 2LLZA 3EDRB 1XJWB 4TU9A 4I1TA 3NGDA 3FBEA 4B9MA 2ZNYA 4X4VA 4NLGA 4KBIA 5BR8F 3G86A 4I7FA 4GKKJ 4OHYA 3CCRS 2AEJA 2M0GB 2GA7A 3KLFB 3W8PA 3MMBA 3KG4A 1MN9A 2NXEA 1ITPA 2AT1B 2COLA 1F1BB 5KG3A 5LJ3Y 1E6YB 2R7UA 3PRVA 3T1HF 3D6TB 9RUBA 1ZM2A 4IOAQ 5GMKa 2JL9A 3ITHA 2XMMA 4IRKA 5KFHA 1U1MA 5IT4A 1AFJA 1AT1B 2VFSA 3K8VA 3PJWA 1J5EJ 2VQFF 1VI7A 3VWSA 3WX8A 2VDIA 2Q6CA 3J81U 4I2QB 4JI2J 1M5OC 2BABA 4FS1A 4H4KA 3SIPB 3W2WB 2F9DA 4NXMJ 3H2UB 5FDLA 4C7QA 1VRTA 3TJ8A 4F25A 3C14B 7FD1A 4I67A 2MDAA 2ZE2A 2CQ3A 4QWBA 3CCVS 2I38A 1Z2LA 2QFJA 2OH2A 5HJYA 1HLWA 4AXJA 1C1BA 1LWEA 5KT4A 3H2LA 2CPIA 4G1QA 2OJ3A 2FB0A 2LQ8A 5K8OA 2DNNA 3CWJA 2MQPA 1WG5A 3HPOA 2KM8B 1XC9A 4J9MA 2ZBRA 3CB4A 1RA6A 5KG1A 4LR8A 2BKPA 4DL5A 5B09A 1YI2S 1HQEA 2B9XA 2JH3A 3MCMA 1JJ4A 4QOTA 3R1HA 2OEMA 2DVIA 3AQPA 3PACA 4F4XA 2PA3A 4OX9J 5IV3A 1JKHA 2IA6A 2KXFA 3NGUA 2IRXA 2AIRB 2WHOA 2HVDA 2Z30B 4LSZB 5HJXA 1EZZB 3FSIA 2CAJA 2AF6A 1NDCA 3JYTB 3BBBA 3EZUA 3V2UC 4F3MA 3D6FB 1JNRB 1T02A 5A8WA 2JLGA 4FF4A 4HI2A 3IS9A 1U48A 5H9EJ 1KWMA 4Y65A 1OS5A 4GO5X 1LW2B 1VQ5S 2CQ0A 4P72A 5LMNJ 4PUOA 4HR2A 2ZVSA 2ZWPA 1PJ6A 4QYRA 3BGOP 1EKSA 1AZSA 1RADB 3OTEA 3A13A 3R7NB 4Z7CA 3MR5A 3I4HX 1HI8A 3AB4B 1O0PA 5T41A 2V8HA 2BANB 4DV1J 3OR2B 4ES3A 1MNEA 4OJHA 3KXDA 2IMWP 1BQMB 1Q4RA 2LU1A 1YWXA 1TKDA 3WHIA 3BPDA 4J37A 1QM9A 1RT6B 3RB0A 1D0EA 2B3TB 2I2YA 2F4VF 4PWWA 1T05A 2PMHA 2B9EA 2ZM6J 3IBFB 3HVTB 5D15A 2I9SA 1A6LA 4IG3B 4F36A 1YJWS 2XWYA 3TZYA 4ICLA 5GMDA 4USJC 1TK0A 3I96A 2EFPA 3H40A 5LXRA 5E2QA 3ISNC 2PT0A 1IKWB 2P8IA 1GH8A 2NUUG 3KLGA 3VF0B 1H2UX 1NKBA 3DM2B 4D3GA 5A2QU 2ZUAA 3EVMA 1C0TA 4NXNJ 3LO3A 2UVUA 4I2PB 1TL4A 3T5JA 4PQUA 2C2RA 3KJVB 5GAGI 3OVSA 1U49A 1EJ7L 1P6TA 2ZH6A 2DGWA 3MMCA 3QO9B 3I5BA 4ZCIA 3ET6B 3E8OA 1JLFA 1WDTA 2YQ0A 2WONA 4E2FB 2C1EB 3DRPB 2AGPA 3W64A 4NOHA 1T8EA 3BN4A 4Y34A 1QSLA 4CNZA 5D6GA 4X62F 2HS0A 2XS5A 2D3ZA 4DPTA 3SSRA 1TFYA 4PG8A 1NU4A 1UZHA 3CSKA 4P7TA 2FVPA 3KNAA 3V6JA 1HR0J 2WVCA 2P9EA 1N34F 5E7OB 4JI8J 4TYAA 3K89A 3QJLA 3MZIA 3OR1B 1VLYA 1L3SA 1FTCA 1VISA 2MGZA 2QLBB 2VICA 1K44A 5CAAA 4M94A 4CO1A 3MM8B 2YKMA 2ZVIA 3M9OB 3TO8A 3M6VA 2MKKA 5T7LB 2E9RX 1RP5A 3KLHB 2QL7B 2YNGA 3KLEB 2Y1JA 3DDNA 3AT1B 4CH1A 1DJ0A 4NYPA 3J80Y 4DV7F 4HHHA 3MECA 5IOLA 1IBMJ 3JSMB 2PSZA 2KFZA 1PC5A 2JVOA 1CJTB 4NZ6A 1YZ6A 1FFSB 3M8PB 2PIIA 3R97A 5HVGA 4C0BA 4C8OA 3MUVP 2FLLA 5C24A 2K8GA 3QYYA 1Q1KA 1OYDA 2B56A 3D1OA 5KFZA 3KJFB 5ETKA 5KFCA 3G71S 1XNRJ 3D66A 2XSFA 2R8GA 2QSWA 5C5JA 2KG1A 3N6MA 4HEA9 1NK6A 3MAAB 2MKIA 1BXNA 1XEZA 2AJ0A 2ASYA 4YR2A 2VF3A 4OI3A 4J9PA 4LRDA 4OZ1A 2OUGA 3NGKA 4F4AA 3IWNC 1ICEB 1RWXB 1X4EA 3U02A 2XHCA 4DR2J 4NA3A 2BUNA 4MH8A 1JJ2R 4IKAA 2CNNB 2IM0A 2R9LA 1W2BR 4DLEA 3O44A 3RYLA 2EI5A 1FHTA 3NL0A 1NMEB 3DHXA 3CPWR 4BCAA 1KQFB 3SBMA 4RKUC 1U25A 1IVZA 4IH6A 1L3UA 1HBOB 2EKNA 3GQCA 1REGX 3M30B 1B99A 3AOBA 3MFHA 2MQLA 1JXLA 2YNHA 3LW5C 3HVAA 1SJFA 2X1AA 4WKRA 3DLGA 3FBFA 1C4AA 3PJ9A 5AE3A 1FXDA 3UNGC 2XLKA 4DMZA 4RNHA 2HGNA 2RU3A 1D8YA 1N0VC 3HFVA 4AQYJ 5EWFA 1WC4A 2JOQA 3N0VA 4DWIA 3OTOF 2IYIA 1VQNS 4Q8EA 2BM1A 1M5VC 4U9RA 1HW9A 3VAKA 2L48A 4CZCA 4DV2F 3LALA 4R5PB 4M5HA 1YLXA 4RWWA 4DL7A 1FK9B 2NR0A 3OL6A 3MD3A 4ECTA 4B3MF 2ZHOA 1U1RA 3OL8A 1AROP 3VVTA 5L9NA 3CJKB 3K5OA 2WVFA 3VAJA 1FRIA 1RXOB 2DNLA 1GQEA 5IS2A 3H4BA 4CRJA 1XTZA 2RDIA 3IM8A 2EW9A 2DXEA 1CEZA 3CIZA 3R2DJ 1RJJA 3DRRB 2JDJA 5L9XA 2V8GA 2YH1A 3DLKA 3JQJA 1S6QB 2HHWA 4J9OA 4KV8B 2UP1A 1MW7A 4GC6A 2CDRB 3W5YA 4FNIA 4OYIA 3TARA 4X4UA 3GJTB 2CYYA 4X66F 1FJ7A 3PW4A 5F8HA 2MY8A 3UFCX 2HHTA 3PX0A 2HQ3A 1WSVA 2GIRA 4Q43A 1JLBB 4C3LA 3M1VA 1EETB 1N88A 4IQMA 1YX2A 1XR5A 4C9DA 4CTAA 4OI2A 3ILOA 1FJGJ 2DPJA 1LW0B 3FMWA 4LRBA 3CC4S 4W98A 5A6PA 1FX2A 3I9V9 5A6WA 1HWIA 3NKYA 4OI4A 2VBYA 5IT0A 3EPGA 2ZBCA 1AB8A 2ZDPA 3Q22A 4WFBQ 4J91A 1PAEX 3H8YA 4DFKA 2QGFB 3DKDA 2AX1A 2GHPA 2BACA 1LWFA 1C4CA 4JI3J 3M9NB 1IR1A 2IJRA 2NXJA 3BH6B 1IJFB 2H51B 1DAXA 1TR0A 2UUAJ 3PJXA 1BQXA 1SKWA 1RHJB 1V6HA 2R2SA 1FD2A 2KHCA 4C3KA 2RQ4A 4I0WA 1RT2A 2V8PA 3S7RA 4O3RA 1H38A 1VHIA 3FRZA 3OFGA 1HQUB 4P2FA 2HNYA 3HKWA 3H4DA 4Q45A 4ANEA 2E1RA 5GVQA 1HNVA 1VIXA 2D9OA 4OX6A 2PC6A 2NXCA 4ED6A 1VQOS 5CA5A 4ZA1A 2X3GA 1VBYA 2CNKB 4QWAA 3OPKA 4QYZK 2YNIB 3HJVA 5AXLA 5KT7A 2CQIA 4QBUA 3FMBA 3HM9A 4ED5A 3IGVA 1YBAA 3V6HA 4DSKA 3HHEA 2EG2A 3MAHA 3F0NA 3FKBA 4FXWA 1MWYA 1GXLA 1FDAA 1Y5NB 2HMIB 4GVLA 3T1YF 1VQ9S 2HNDB 5KFYA 2W2PP 4PAAA 1I3OB 2ZBIA 3ONQA 1RAOA 3IWLA 2QLXA 1NDLA 1WEZA 5KFKA 2W9CA 4XK8C 2E5LF 1J5OA 5D0RA 5EWGA 3M6XA 4J9QA 2J76E 4G1IA 4WBFA 2AYBA 1YRTA 5DG8A 4MIBA 4DR3F 2Q66A 3EVWA 4I2QA 3C19A 1PKUA 1HL6A 1S49A 4LSLB 3PYDA 3WX4A 3EZ5A 1PO6A 3DMJA 3IG1B 3W2WA 4F2RA 4RPFA 4RBVA 2OO4A 5FJ4A 1JLAA 5KG4A 5LM7E 1RT7A 4MK7A 2FZKB 2G2OA 2P9CA 4HHUA 4AYBD 1YJNS 3QIDA 5HQ8A 2KYZA 4DV0J 3CJ4A 4LF6J 1R0AA 3SI8A 1Y10A 2FZGB 2AX0A 3M8RA 1J5EF 3LWMA 3US5A 4M5GA 3ZZPA 3LUYA 3OV7A 3DXSX 3M6WA 4ZPBA 5ETOA 4DSJA 3HI9A 4OZ0A 4JI2F 1HNZF 1UKUA 1R8AA 3O8WA 4LR7A 1X4FA 2YNFB 4NXMF 1D1UA 2Z2LA 5KFMA 2ALZA 2N7CA 3VGSA 2DRDA 4IDKB 4NLPA 2LKZA 4A8XA 5CQGA 1FO1A 1S1UB 4ELTA 2W9BB 2H5IB 3DI6A 2JVRA 4IO9Q 2A0FB 1W26A 3MXHP 2J0XA 1K9MT 1V9OA 2BYCA 4DL4A 4XTTA 1WOOA 1LWCB 1N8RT 2OP5A 1U4BA 1U1KA 1NJXA 1I94J 4ALZA 3I0RA 3DYAA 3IRXA 1KLMB 1WC0A 3SFGA 2XYGB 3C6TB 2GX8A 1WHVA 2Y0BB 1O5JA 1U1QA 2XMVA 3ZZUA 3VHQA 4ELVA 2OPPA 3BM7A 3Q2SC 2VC0A 4OX9F 4F3OA 1RTDB 4RLEA 4NLTA 1YJUA 4DPUA 4NLSA 1FRLA 3IR7B 2FVQA 4K4XA 4RU2A 2XMWA 3OR2A 3QRRA 3HHLC 3THVA 2X1BA 4B3TJ 1S1WA 1XN9A 4USKA 1CPZA 1VIOA 3DHWC 3BGLA 2UVWA 1Y11A 1YRUA 1H98A 1S1XA 1AW0A 1I1GA 1SKRA 3GYGA 1RT3B 3PRDA 4U8VA 1F5AA 1F9FA 2G2ZA 5J1NA 2Z0GA 1N54B 4ETZA 2GAHC 3UPFA 1GMVA 3KK3B 2EEYA 2BDPA 3GJSB 1VQSA 8RUCA 4WIQA 4IR1A 5CXTA 1S9EA 4X2BA 3QJJA 1OMSA 3BF4A 4LFCJ 1RT5B 3PR4A 4USVA 1WORA 2CA9A 4YR3A 4DV1F 4CLKA 2Y3YA 1BD6A 4MKYA 4ILMA 3E01B 3W5XA 4DX7A 2GZOA 3P5BP 2IVFB 1R8CA 3AOCA 3NAHA 2FQQB 3MR3A 3ET6A 4JUZA 4DQPA 4ID5A 1HHTP 3V6DA 2ZM6F 1HNXJ 1BWVA 3GWCA 3KLIA 4NEZA 2ASDA 1U8WA 2QSFA 3CCWA 1IR0A 1F9HA 2DNGA 3GLJA 2KJWA 3IM9A 1DARA 2DB1A 5CCLA 1T7PA 2M70A 2LCWA 2W4PA 1X9SA 3W60A 1QAXA 4NXNF 2H4YB 3LGNA 1KS2A 4P2XA 4EUVA 5D0GA 2JEIA 2OSRA 1MMNA 1UWBB 1NKCA 3G82B 2W24A 3AODA 5KFQA 4ECQA 2BRKA 4QR0A 4B3SF 2LDYA 3CF5Q 1Q78A 1HD1A 2HIYA 1TKXA 4ZVEA 1ZPVA 2BM0A 2OTLS 1BWEA 2XTJP 3P4UB 2CQ1A 2ZDOA 3V81B 2Z2MA 5E3PA 2I0XA 1HR0F 2QL9B 1DHMA 3D3BJ 4N76A 4CLYA 3MM9A 5F8GA 2RRAA 2CQCA 2OFHX 3SQGA 4JI8F 3C8YA 5HATA 5GAHU 3X1LB 3K0JA 5GADU 1YVFA 4LRFA 4ZCKA 1GXUA 1U26A 2FLNA 4DV6J 1NO8A 4YHHJ 1L3VA 1X31C 4CH0S 3J81j 2E9TA 3DOLB 5D77A 1NPRA 3A1YG 2OEJA 4OL8A 3M2UB 4DL6A 1FE0A 2BXJA 2Z58B 2DXFA 3NMRA 3N9UC 2QG9B 4KT0C 5IT9Y 3MPYA 4KFBB 3DOMB 3J81Y 1G7CB 2MPUA 3FZ2A 2KM8C 1VK8A 1W25A 2F65A 4TY9A 3SCIE 1WF2A 3CJ0A 1IBMF 5M2RA 3OJUA 2ZOGA 4X4PA 3M7VA 3GIKA 1HBNB 2VKRA 4EGLA 4IOCQ 2V2ZA 4YDDB 1ZPWX 5DQGA 2GNKA 5RUBA 3KJQB 5KFXA 1PG5B 4NCGB 2HHHJ 5D4PA 1N32J 2DHGA 4HACB 5HMZA 1XNRF 1KTVA 1PJ5A 2YX7A 4V19X 4DR5J 4L76A 3HP6A 2DKOB 1ZZFA 1GMWD 3TUZC 3DRSA 2GHVC 3GJQB 4OYZA 2KL8A 2CQBA 2LDIA 4MFBA 1DY3A 2QEXS 2EBEA 1E6VA 3U1MA 5SZTA 3PZPA 3FVYA 2PE8A 2B51A 2OGUA 2VHGA 2ZBQA 2DNZA 4Q7AA 1UJ5A 1KVJA 4OJGA 4FYYB 5IM0A 1Y00A 1UWAA 3JQMA 3GIRA 2MQNA 2VQEJ 4UTGA 3KK1A 2F63A 1D8ZA 3T19A 2ERRA 5CYJA 4KE5A 1FT8A 3P45B 4UQGA 2ZC4A 2CPHA 3QAEA 1Q8LA 4A8QA 4KJIA 1F2GA 3SV4A 2YKOA 1TV6A 2W2QP 1T9TA 1B0PA 4LBHA 4JI0F 1OY8A 1S1TB 2QTWA 2YTCA 2YH0A 4OLPA 4QW8A 4Y2AA 4HKQA 4QR2A 4CP5A 5DETA 4ILLA 3PVXA 2BE2B 2ADBA 4R5PA 5A8KA 2HWHA 3AD9C 1FK9A 5C42B 1ZM9A 2HQDA 3W1YC 1NK7A 4DPYA 3D2WA 2IRYA 2RILA 7AT1B 2NLWA 2MKCA 1R0CB 5BYQA 4HLBA 1N5YB 2FJAB 2J6SA 2XMJA 2KYXA 4M1KA 1U09A 4AQYF 2EFNA 3RU0A 4PR6A 3ZZTA 1MU2A 2DGUA 2W2NP 5G0RB 4OZNA 2YKAA 3MMAB 3M8YA 4P52A 1NEEA 1UJ4A 4WXOA 3C16A 2YKNA 5DQIA 1RYRA 1FRKA 3G6VA 2OPRA 1QSYA 2E9ZA 2CJBA 1IUJA 4URQU 3M9MB 1TKZA 3AXKA 5A2QY 3B82A 5EHHA 2HQCA 1M5HA 2ZKTA 2G0IA 2JEJA 5B0AA 1G6BA 2PO4A 4YB5A 1KTQA 2KFNA 4CO4A 2B5JB 2AP6A 2XY7A 1XMQJ 1JLBA 2K7KA 4NA2A 1Y7PA 2FIUA 2LECA 1WUUA 2CNOB 2WBMA 2KN4A 4B17A 2R2TA 2J8SA 1LW0A 5D8HB 2D3UA 3O1LA 1VYAA 4LF9J 5KFIA 5GAGU 2CZVC 4I4BA 3LAKA 3BREA 1UW9A 2Q79A 1X4HA 2B4VA 3G8QA 4RUCA 4FZVA 2HHSA 4IH5A 5KFWA 3PFEA 3BQ2A 1S7HA 3RW6A 2Z8QA 3KDNA 4JI7F 3U7JA 1S9FA 2I5JB 4NLYA 3PDNA 4NRUA 5J2MA 1FKOA 3ZXWA 1NB2A 3QRPA 3THPA 3I0SB 1W2IA 2RF2B 5F8JA 3WQPA 1RAIB 2UUWA 2ILZA 2IY5B 2E7WA 2WCXA 2CWKA 1Q16B 2IHR1 3Q8RB 2IDLA 4CCHA 3UWTA 4NRTA 2V9KA 1YG0A 3AHPA 3ZTRA 4RBTA 1F5CA 4ECXA 2D41A 2OMOA 5KG7A 3K5NA 2R8JA 4KH0B 2CPEA 2JFDA 2KFYA 3RAXA 4WCEQ 4PABA 4USIA 3TRGA 3DGVA 4O0IA 4M63A 2DR9A 3L9ZA 1TZ0A 2VZ9A 5HROB 4DF4A 3RUBL 4MYTA 2CQGA 2DR7A 1R27B 4A46A 4F4YA 2UUAF 3SXLA 1RT1B 2KT3A 1NAQA 1N33F 2V4RA 1MMDA 1SJRA 4DG1A 1D9DA 1DQ8A 2ZH3A 2MLXA 1S99A 5M2UA 3MEKA 1CS4A 2ASLA 1IKVA 2KH9A 1JLQB 4ZP9A 2D1CA 3WC2A 2YWEA 3TAMB 2YPYA 2AJ2A 1CJKA 2B8PA 3Q8VA 4DUYJ 1WEYA 4P74A 3CCSS 4WFXA 3IC1A 3BGRA 2C42A 1EB0A 2R7TA 3HFZB 4ERDA 1VJWA 2JEGA 2AEMA 3AAWB 1LFPA 4DL2A 4EI2A 2V69A 5BR8J 3D54A 4BC9A 3CD6S 3KNGA 3RG6A 2YWGA 3TX8A 1WKKA 3PTWA 4B9NA 2F8EX 3MCSA 1LFWA 2M8HA 1JLGB 2HLTA 2QL5B 2D3OR 1VQMS 1Y4ZB 3NP5A 3WBZA 1T03A 3BBCA 4K4TA 5LSRA 3T1HJ 3TI0A 2QJ3A 1JXVA 1HMVB 4AFFA 4F4ZA 1L3TA 1RTZA 4F04B 3N6NA 4KPCA 1QUPA 1R3NA 2HWTA 4WP3A 2HFSA 1NZ8A 3QWUA 1REVA 2E5IA 2C3PA 3QAUA 4DV0F 3MUTP 1SL1A 2ZWOA 1B70B 1QAIA 1D3WA 1LWCA 4YP3A 2DD8S 2KZMA 1J2VA 1RWKB 4MMOA 1HI1A 1SCJB 4OHWA 5BYRA 4RX6A 3UNYA 1SQGA 1NM2A 3OW2R 1NCLA 2HHVA 5HANA 3WIUA 2AMCB 4OJ1A 3GSIA 2GHWA 2UU9F 4C8YA 3UCGA 2VG5A 2BE7D 3DU5A 1KQSR 4QR1A 4UOHA 3VTIA 4TXSA 1T11A 1S9GA 3H5XA 3LTOA 4F8RA 2BBEA 2LXFA 2GMLA 2YVSA 1U1NA 4LVNP 4IG0A 3KG0A 4CLZA 4RW7A 4DF8A 2XY6A 1YSJA 2ZZMA 4C8ZA 3HSZA 3ZTPA 1S1VA 3Q23A 1RT3A 1LV5A 3W2VB 5E41A 2BJEA 4L3KA 3PO4A 3CCMS 4EO8A 2PFDA 3KJNB 1VS3A 1XWLA 2DISA 2RNEA 4RW9B 3VV2B 2LXUA 4L6V3 4B3RF 1WOPA 2IPOB 2G0CA 2NXUA 2HFNA 3NG8A 5KFSA 4K7QA 4QIEA 3DC2A 3ETOA 4KKOB 4IFVA 5H9FK 3LGHA 2DO0A 3HHNB 3C6UA 4N56A 4WP9A 2DNPA 1KFSA 4A8OA 4F3QA 2DGQA 1UEKA 5CYQA 2IM3A 3BH7B 2GMJA 4ED2A 4Y2IA 1RT4B 5E3RA 3KOAA 2IVMA 2MHEA 1KN6A 3CD5A 3TEGA 1RWVB 2KTQA 3BGUA 3T6JA 1S48A 3ZNJ1 1KD1T 4E8UA 5J2QA 2CQPA 4ED8A 4HVZA 4BBYA 4ZVFA 1DRZA 4LFCF 4M5KA 3BYRA 1K73T 3WC0A 2H65B 2F4VJ 5G4DA 2J6TA 1CLFA 2M7SA 1VBZA 1S97A 4NLUA 4PG6A 1Q81T 3LOUA 3GFZA 2RQMA 3RGIA 3P3DA 5AT1B 1ZA2B 1OQ6A 2GVDB 5L38A 4PZVA 1NH7A 4F0KA 1F60B 3HK2A 1FJCA 4H4OB 2NPFA 4CLLA 2DNMA 4RUHA 1RTJA 3BSNA 2XZTB 1ZH5A 3TAPA 3PXGa 3C15B 1TKTB 4DX6A 2NQPA 2VBWA 4PG4A 1BUXA 2HLUA 2OKQA 3JQKA 2OLWA 2MMYA 4EEYA 1F6TA 2CFXA 1N4LA 1OSDA 4RW8A 2PGCA 3AQOA 5ETRA 4UOCA 3QZ7A 2IIHA 4O3QA 3DOLA 2ZHAA 2HQFA 4O44A 3LPYA 4GKJJ 1N34J 4CLWA 2VH7A 1T94A 5F9NA 1RI7A 3P8BB 2E44A 3BS9A 3MPVA 3FUYA 5HL7Q 2FHJA 1S5ZA 1VQ7S 5E5NA 4KSEB 3VAGA 1SL0A 1VQKS 1MG7A 1C1CA 4K5SA 3ZZZA 5JUMA 2VBXA 5ETTA 4B3OB 4YHHF 2P6TA 3AD8C 2NS1B 1LQ9A 4EO6A 3PHTA 4KGKA 4I6AA 3G4SS 3FFIA 2JC0A 4RNOA 5J1EB 3CJ3A 1VFJA 4NEYA 3TVZA 2B6AA 3OHAA 2B9YA 4CLPA 3VAMA 2V4JA 4F2SA 5CCMA 5IWAF 4C0OC 4QW9A 1U0HB 3KK2B 3RTVA 4QCLA 2K3IA 3Q0AA 2P5VA 5H9EK 3R6GB 4O3NA 3OLAA 1S7IA 1Q8KA 5K20B 4R8UB 3JSBA 4MT1A 2N3LA 4Y00A 3CJ2A 2N4DA 5DZ7A 3BN7A 2U2FA 1TUVA 3IWXA 2V6AA 3CEDA 4EZ9A 2CDQA 4G1PA 2QA1A 3QIPB 2HNZA 2HHUA 1EQMA 5I4MA 1HA1A 3TUPA 2X1FA 2HFZA 4ZVUB 3HXMA 1S1TA 4QWCA 5DLFA 3HDSA 3KUEA 1IKYB 2UUCF 1TK8A 5EUHA 2GS8A 2ZFHA 2J8AA 3LP1A 1R89A 5C42A 1OO0B 1N36J 2IDEA 2Z56B 2MZTA 1KR4A 3M2VB 2JEFA 2VQEF 4OYPA 3VAFA 1QVGR 3MGJA 3W7BA 3MEDA 2K1RB 4GVBA 4USUA 3EGZA 4OYXA 4ED0A 4ECYA 2VFRA 2R7VA 3FCVA 1T3OA 2VOPA 3DOKA 3FK4A 3MMAA 1V5IB 2GGPA 3OXLA 2FY8A 2MJUA 3IR5B 1S77D 2ZH9A 4LRCA 1CJUA 1VHFA 3GZ7A 2DHXA 5KG6A 1HFEL 3SDEA 2RKIB 1NHVA 3IBWA 1LXNA 2R4FA 3M2RB 3OTOJ 2R8HA 5CZXA 2RE1A 2E66A 3A3PB 3GYNA 1QD1A 1CJVB 4X4QA 1QAJA 2M88A 4FBTA 4DV4F 2HAIA 4FN5A 1HQ2A 1GK8A 4O4GB 1FKPA 2B5JA 4JI5J 5AE2A 3T5HA 4NASA 5DJBA 2ZKUA 4KHRA 3N5FA 1CVJA 4B3MJ 1RQ0A 1S0MA 1U6BA 1SV5B 1NK0A 2HZCA 1DTQA 3NGTA 3NWGA 3MR2A 1KQKA 2WW8A 5K8PA 1YJ9S 2QA4G 3TQEA 2A2CA 3A4TA 4A8FA 4NCBA 4C11B 4DSLA 4ED3A 4ED7A 3TWZA 3NCQA 1U0SA 1QSSA 1MROA 1M1KT 1IBKF 1R8BA 1M5KC 3FC9A 1WC3A 3AJ1A 4WU3A 2DY1A 1N5TA 2HGMA 3G6XA 4K8RA 1XMQF 4TQRA 1Y3KA 3PEJA 5IQ6A 5IV4A 2E5HA 2UV8A 3TJ9A 1S6PB 2Q1LA 3ISND 3TX0A 4K2JA 1HYSA 2OIHA 3OUYB 4WF9Q 4LF9F 1H73A 1RTIB 4KY3A 2DHAA 3B54A 2GV1A 5KOWA 4Z37A 3ZZ0A 2ZBPA 1WELA 3OFFA 2V94A 3QWPA 1SB6A 2AYEA 4JP8A 1ZBTA 4ZS6A 1RAJA 1U7LA 3H5YA 2VA2A 5JXSA 4NMLA 3UVJB 2RHSB 2HFVA 3W65A 4QYZJ 4IFYB 2MY7A 2P2CB 1FVQA 3CDBA 1B3TA 1K0TA 2KB2A 4A47A 4PWDA 2A6OA 2BQRA 4CYUA 3T9ZA 2DNQA 1RTHA 1B4SA 3GIJA 4LJMA 4WIIA 2GVZB 1FI4A 5KFEA 4DFMA 3HHLB 4MAKA 4FKYA 2QLWA 4N41A 1CULA 4X84A 2ZH7A 2VPYB 4L74A 1H6KX 2E7XA 4YUDA 1JXEA 1KVIA 2DT9A 4C4WA 4W4MA 4U7UD 2QMWA 2YY3A 3QGIA 4C2MA 4UY85 2V9WA 1CQMA 2XGQA 1UVMA 3P49B 3M32A 4K4UA 3FBBA 4AT1B 4C98A 1P9QC 1RAGB 2CQ4A 4F4WA 1X4DA 3PNIA 2BJ9A 1AA1B 2MZQA 5K14B 2HVZA 4I6WA 1HHSA 2GAGC 5F8MA 2MSSA 2MJNA 1JWWA 5DQHA 3JS9A 1SBRA 2ZZTA 1JLGA 1OYEA 2W2MP 5K8MA 4RZRA 3DLEA 3H0PA 3T1YJ 3CW2C 4A48A 1RAEB 4RW4A 4UUWA 2AWZA 1NJZA 4DUYF 4Y2KA 1KRPA 1HMVA 2MEWA 5GAHI 5GADI 2RUSA 2OPSB 4RWXA 2G1DA 3BBFA 3VALA 3ILIA 1G3OA 5KFFA 1HW8A 5HBMB 4RO0A 1RSCA 2FHKA 4U67Q 2HURA 1SJQA 1X5OA 4AUKA 4K4SA 3GG1A 2XSJB 1HWUA 2BA9A 4DR3J 1FCAA 4ZVTB 4O3PA 1HNIB 2WZ1A 1EIYB 2CPYA 2VODA 1S6UA 2FTRA 4K2XA 4Y0FA 3EDQB 2M3DA 4W90B 3K5LA 2IM1A 2ZOMA 5KG2A 4USHA 4L73A 2OD4A 2RMLA 5D3GB 3D0HE 1TL1A 3MM6A 2AGQA 2BVZA 1FJEB 3Q83A 5DDQC 2R2UA 2YWWA 2YXLA 4DSIA 2R7XA 4RW6B 1IKXB 5KFBA 2GJ2A 3F41A 3OJSA 3R7BB 3ZTQA 2XMKA 1TL7A 4J9VA 1HNZJ 2R7QA 3DN9A 3LP0B 3CNQP 4ENOA 3KHGA 3SV3A 1SC3B 3DCAA 3ENQA 3LP2A 2D69A 3LGMA 1RHKB 4Q0BB 2ROPA 5CYMA 4RBUA 5J2NA 1NHUA 4DR4J 1BQNB 4P71A 4ZHRA 1WI8A 4NYOA 1EP4A 2ZD1A 4RW9A 1VBKA 2IC3B 2LFVA 1NBEB 4OHZA 5BXIA 4LSNA 1FF2A 2GJIA 4EBEA 2F3JA 1QE1B 3BSOA 2BW7A 3F56A 4LF4J 1RE1B 3CE8A 2OPQA 1RT4A 3PEHA 4F02A 3N4WA 4I68A 2HFOA 1DLOB 4WXWA 4JV2A 4K5RA 3CJTA 3POTB 3OXGA 1F3FA 1UFWA 4F0MA 1UFKA 4MK9A 2GJFA 1SH0A 1RKIA 1FDBA 4DEZA 1VQYA 4OHXA 3CCTA 3UN3A 5K5MA 2EXUA 4C8MA 1SJ4P 1OPIA 3ENVA 5DLGA 4CWBA 3CDUA 1QTMA 2BQUA 2RQKA 2E7VA 4I7FB 1YZ7A 2YWHA 2AQ4A 2AZ3A 1T0TV 2RD5C 3MMBB 5KFUA 2YBVA 1R43A 2BE9B 1UL3A 1UTAA 1AUDA 3A3OB 2ABYA 2FC8A 1FFGB 2XB2D 1YJRA 3EVOA 3QLHB 1I51B 3ITHB 3K2YA 4QWDA 3L7UA 1VRUA 4ZOSA 3EGWB 5I3PA 1NK5A 3OHBA 1NDKA 4ZP7A 1VQ8S 4E98A 3MURP 2V2VA 2QIFA 3LWLA 1HBMA 3FQLA 4URGA 4JBCA 5FDLB 1VRTB 2B9WA 3BV8A 2A18A 5CHCB 1UVJA 2BX6A 2M5YA 1LEOA 3HVRA 2LQ9A 2ZE2B 1HBUA 3JSRA 3MEGA 2LP4A 2WOMA 3BEGB 3U1LA 4B3SJ 1C1BB 1LWEB 4G1QB 3GFYA 1NUEA 4N8NA 4AD6A 2QFIA 3DDKA 1HWKA 5ETMA 2JLFA 5U47A 1EARA 3DLBA 2J7WA 4DZ6A 3FRYA 1RHRB 1DQ9A 2G13A 1N6QA 2DCLA 3AFGA 4TVAB 2IA0A 4LQ3A 3QFWA 1QLNA 1HQEB 1T9XA 2LEBA 4ZVSB 4GKJF 2W7OA 2J9CA 3NY0A 5HLFA 3H5UA 1JKHB 2V67A 4U95A 1GXTA 4Z2XA 4TN2A 2BJ7A 1A0OB 3QGGA 3GCWP 3PIOQ 3D0GE 2IJNA 2VFUA 2CQ2A 1BMQB 2HG4A 2VG7A 5HN0A 5A8WB 5KFDA 2NYHA 1GAOA 3ZTOA 2C3YA 2HFUA 2RAQA 4AE5A 3IFEA 3NRBA 4KO0B 2ILYA 3Q8UA 4KTQA 5L1JA 1YIJS 3RBXA 4PUOB 1EKRA 4LUBA 2GQQA 4O3SA 1HPZB 1AZSB 2HVEA 4ZKAA 2YWKA 1JMTA 5E3AA 5L1LA 1PCAA 1RBAA 3RJMB 4X4RA 1TVRA 2DCUB 3D0IE 4NLDA 4WTYA 2IAJB 4PEOA 3QGPA 4DQIA 4TKTA 1MWZA 3VGVA 4OYAA 4FPIA 1T05B 3HHKA 4KRWA 2C2ZB 2KDOA 1X9WA 4ZPTR 2F40A 1K0VA 2DTJA 3M2VA 1SH2A 2VB6A 4ICLB 2DXDA 1U1PA 4DI6A 2PMWA 5I3UB 3W9HA 3RB6A 1RABB 1XR7A 2FJEB 2QN6B 4RL1A 3T3FA 4DXLA 1U47A 3MPWA 4X4OA 2VBZA 3TUJC 1C0TB 1RA7A 2FVCA 2XCAA 2W8LA 3GCXP 2CNLB 1JJCB 1KHVA 3OTBA 1IBLJ 4PQUB 2ACMA 2MB0B 3HFKA 3CXCR 1Y5LB 4DCOB 5C2CA 3MMCB 4LFBF 1SIWB 2CJQA 3R5JB 5C25A 1JLFB 4FF1A 1N36F 5F41A 2WONB 3GV5B 5IC4B 3M2RA 2HAFA 2CQHA 3LA0A 2M2BA 1V3RA 4YQWA 4JI0J 4IOBA 3IO1A 2DR8A 4ZITA 2N3OA 3QQCD 3Q8SB 3TVKA 5GMEA 1YBTA 5B0EA 2EC2A 3QT5A 2AU0A 4YOEA 2FUG9 4FXVA 2Y1LB 1TP7A 2WRMA 2QE5A 1FRMA 4ECZA 1M90T 3GE9A 2XGPA 3E3XA 4I56A 1XK8A 2ROGA 4DFJA 3OTCA 3QPIA 2O3DA 4UF4A 3OFHA 2JHEA 3D6HB 4QQBA 1Z1ZA 2HGLA 2XI3A 4B02A 2MGZB 5J2PA 3HHLD 3K57A 4C6AA 2CG4A 3SCLE 3ISZA 4OZ3A 4TU8A 2YKMB 3M8QA 1WNEA 2DIVA 3BO2A 2FJVA 1X5TA 1HIYA 4Q2LA 1WG4A 3V4IA 4X64J 2YNGB 4JI5F 4P10A 2B4OA 5I42A 1WHWA 2RIJA 1OSCA 1VC5A 2BZ2A 2J5AA 1S10A 4ANCA 5AXKA 4ZVRB 4Y2MA 2HSEB 1S6PA 1PILA 3JTPA 4YFUA 2BOAA 2RH3A 1EQ0A 2WBRA 2Q43A 2XM3A 3C2PA 4B9SA 4U7UK 2CJXB 3FEZA 4LBIA 4HYKA 4M95A 2NSCA 2UZAA 2C2DA 4U8YA 4DLGA 2CG8A 5A8RA 2GIFA 2W9AA 4DX5A 4Q8FA 4M8LA 2A6MA 4Y28C 1YTYA 1ELOA 5SUHA 3MOJB 3NBPB 1HNWJ 2ZH1A 3J7AN 3KMSA 1T3NA 3EICA 5IC6B 3HZGA 3A8JA 1Q86T 2CQDA 1FXLA 1R6YA 4JI7J 2Z2ZA 4ZVHA 2JX2A 4QIFA 2GVZA 3I55S 3BQ1A 3UR0A 1S0OA 4EMDA 2MZ1A 2H4WB 1X4AA 3O2IA 3UE2A 2EK1A 2J9DE 1WJ9A 2AYMA 5E0OA 3RRKA 1ZETA 2NUHA 1F5BA 1KDNA 3S1TA 4MJKA 3PG9A 1HARA 2XMUA 3MM5A 2HVHA 3NCRA 3IN5A 5AE1A 4ZVQB 3FCWA 4ED4A 2Z4PA 2A10A 1XQIA 3DLGB 2W4DA 5HSPA 1C0UA 3W66A 3DDIA 1XNQJ 4CLUA 4RNNA 1ZOTA 4M5LA 1FNOA 5HI7A 3CCQS 2WVDA 4JI4F 1TMJA 4WPAA 2PFFB 3DGPA 2RHQB 1WKLA 3PW5A 2R8KA 4DPOA 4WE1A 3GR0A 1N33J 1G2EA 1XBWA 4JV5J 1TQLA 2D7SA 1ZTTA 1KC8T 1MWQA 3ENWA 3ETMA 2HVIA 1IR2A 2RRBA 1A7GE 2HK3A 4CQ1A 5L39A 4OQJA 2N82B 4ECUA 4LF8F 2FGOA 2OPSA 2OD6A 1UW4A 3G2XA 3NS5A 2KO1A 2WVEA 3S6EA 4ECVA 3PKMA 4GRSA 3CD7A 3UCZP 1TAQA 3GJRB 2ZNZA 1RWOB 4KQZA 4YN3B 1TL3B 1QAYA 3KLFA 1N5VA 2DH9A 3QNWB 3IGNA 4ZPDA 3NWRA 3GTYX 2R7WA 1FNMA 2L9DA 5E3QA 3D1QA 2DHSA 1L3KA 1ZM4A 1AFIA 1E6YA 4ZCLA 3DLKB 2HRTA 4DQRA 3HSGA 2HRUA 3CIMA 4X4TA 2HWIA 3V5RA 4PXEA 3W3SA 1JLEB 2QV6A 3H7HB 3HULA 2FGCA 3G6YA 2DNRA 1NB7A 2B43A 1LOUA 5CABA 1TMMA 3AH6A 4XIUA 1YKWA 3LP0A 3MCNA 4ZP8A 1ZM3A 4ZVPB 1WTFA 3GG0A 2QO3A 4FYVB 5F3TA 3M1VB 3C14A 1NDPA 1FWLA 4CTAB 2CXEA 1RYSA 5KT6A 2VJUA 3AJDA 2B8QA 1W7WA 3CC2S 4USTA 4QU7A 2RDJA 2JZ5A 4TY8B 4P2SA 4M5NA 3HJFA 2R3VA 1UVNA 4ID8A 4IUFA 9ATCB 3FBCA 1PYTA 4LVOP 2RU9A 3P96A 2FZCB 1ZAWA 1XR6A 3D68A 5F8LA 4H4MB 3P6YC 1LWFB 4NWBA 3L7PA 2UU9J 5H9FJ 4HHJA 4DL0C 1ZAXA 8ATCB 1EHWA 3TZWA 2MSTA 2XWXA 4UY8T 2YQ1A 2YX4A 3FCHA 4KHMA 4G3IA 5K9FA 4MK8A 4DR4F 1PYOB 2Q6BA 3JYTA 3C3LA 4E0DA 1UEUA 4KYZA 5CD4H 2QX0A 2VU5A 4BC7A 5F9LA 2HNYB 2HHXA 4IH7A 1VQ6S 4URSA 1HNVB 4C3MA 2XC9A 1UZDA 1FVSA 1LW2A 2J0QD 4RUAA 2FC9A 2EWHA 1VC0A 2BJDA 2QA2A 5DRKA 4LF4F 1KEKA 2AGOA 3MEEB 2JRSA 4ELUA 1WC6A 4B3RJ 2EKYA 4CO0A 3L4BC 4XPCA 1NJWA 2K7JA 2BANA 4B9LA 3FSXA 2HBRB 2C2EA 3ZZRA 3PX6A 3C46A 1BQMA 3PHEA 3CCES 1FX4A 2GMHA 1SUQB 4F50A 2VIHA 1VGYA 1WD6A 1RT6A 3R2CJ 1WEXA 2RUGA 3QLHA 3R5BA 3HHDA 2PEBA 4DFPA 2W9CB 3N01A 2BJ3A 2MZJA 1R31A 1J5OB 3HVTA 2UXDJ 7FDRA 4IG3A 5KT5A 1OIAA 4P6QA 2WB4A 4ZJOA 3U27A 3SZ2A 1BHNA 5IT9U 1IKWA 4Y6IA 3I6PA 4W92B 5ETQA 2J7UA 3SSQA 3DM2A 3CDWA 3DMJB 2UUTA 3NNHA 2MYFA 4I2PA 1JLAB 1RT7B 3FEYB 3KDOA 3KJVA 2C28A 2HBYB 2PA8D 1UPPA 3QO9A 3CVKA 1URRA 4K0KJ 1SPBP 3PY8A 1JJHA 1HWLA 1NZAA 2MLYA 4ZVGA 1R0AB 2JFKA 3DRPA 4K4YA 3FEXB 2AV5A 3DRXA 2QMUB 1TUGB 2O5DA 5AXNA 3UCUP 2BEFA 4Z7YA 1F0XA 2FPHX 2OELA 5KFPA 2F5GA 2UXBF 2SXLA 1N0UA 2GQCA 4KHPJ 1YRXA 4OZLA 4OHVA 3IP0A 1SC6A 4U6PA 1Z2ZA 3BYPA 2EFOA 2HIQA 3IMQJ 3KTQA 2ROEA 5L8RC 1RWWB 4WFAQ 4ZN3A 1KP6A 2XEXA 2OTJS 3OR1A 1NJIT 3DI6B 2JJ4D 1RAAB 2DK2A 2HYIB 1H74A 3K17A 3MM8A 1UAWA 2E5JA 2XLJA 2L9NA 3E51A 3BR8A 3I0RB 1B7YB 2LEAA 3DYAB 3TQ1A 3D28A 5T7LA 4KO0A 3BZQA 3IRXB 2NREA 3KLHA 1D09B 3KLEA 4YB1P 3WIVA 1EX8A 3W62A 2OPPB 1S4EA 3Q8PB 4CH7A 2IBKA 3JSMA 1HPZA 5IFMA 1RWPB 4KGVB 1CJTA 1G1XA 3DXBA 2C2OB 1IN0A 1PYSB 5A0YB 2H3EB 3M8PA 4LF1A 1OY9A 2IAJA 2F7VA 1S1WB 3IA0A 3UN5A 1NRKA 5CZVA 1HD0A 1S1XB 3EXCX 3H42A 4PG7A 3QJPA 5K8NA 5F8NA 3PCOB 1A9NB 4DS4A 3BO3A 4ECRA 4ZLLA 2DRBA 1YGYA 3HCXA 3MAAA 3OVBA 5HQMA 5IWAJ 3NCPA 1X9MA 1YJ7A 3U1NA 1S9EB 1X4CA 3CO9A 4WK3A 4DUZF 5T14A 2Y9HA 2E1CA 2JNJA 5I3UA 2JC1A 1QTNB 3CJ5A 5KG0A 1LNQA 5B0GA 3GYXB 1N5SA 2J0WA 2CVEA 4NI2B 3OLBA 3MD1A 1DBDA 1RAFB 3BPSP 4DZDA 3ICLA 3MR6A 1S79A 4ID5B 3V6DB 1FD8A 1FA0A 3OD2A 2ATLA 3KLIB 3GV7B 1HBOA 4BDPA 2KXNB 3M6UA 3M30A 4A4JA 1SC4B 2VDHA 2UUCJ 3TVYA 2OEKA 1Q8BA 3JB9k 2V5HG 5AJ3F 4J5OA 2PDAA 2VPWB 4ETXA 3UDEA 1P9YA 3PW2A 1KQGB 1B7FA 1IBLF 3MPDA 4NLQA 3G96A 1TELA 4ECSA 3BKUA 4ZPAA 4OZ2A 4B9UA 4L75A 2AD9A 3TEHB 1U02A 1HHQA 4ILRA 1F3VA 3CCUS 1ACMB 3V6KA 5DS7A 1T9UA 1RLDA 2W25A 2KI2A 4IO1A 5KFLA 1T95A 1U8SA 1UETA 1YQHA 2BQ3A 3EZOA 1TKXB 5LL6d 1JX4A 2XYHB 2LQJA 4EWTA 3VGUA 3OSNA 3I31A 2M4MA 3KUGA 2EFGA 2FJDB 1R0BG 4FDFA 4DHVA 2C2MB 2GCFA 4LT6A 2MHNA 1RLCL 4YDXA 5F0WA 3TA1A 4KPYA 3MM9B 1Q79A 3EM1A 3GR1A 3SQGB 4H4KC 2IMOA 4EBCA 3CJKA 4K4WA 2GQ2A 5DGBA 4O23A 3EJMA 4DV5F 5BYSA 2K06A 2J6UA 4DV4J 3ZFVA 3FQKA 1WWHA 4CT8A 2BKNA 3I9ZA 4ZLPA 3DRRA 2EVZA 2R7SA 4LF7F 4FS2A 3SSSA 1GMWA 2XNQA 4LRAA 1T9WA 1S6QA 4C0HA 3MHYA 4KV8A 4R0JA 4X64F 2KKHA 4WKYA 2VUGA 1VQ4S 3N28A 5HMXA 2G4BA 4UT4A 1D9FA 1IM6A 2V8DA 4KGXB 4I6YA 4CIOA 1ZYQA 1NNDA 3TW0A 4DV3F 4WWSA 4DUTA 1IBKJ 3F73A 3NBPA 1U2CA 4MIAA 4Q2MA 3SQOP 4KC5A 3UW1A 3MR7A 3PX4A 1T9VA 4YR0A 1EETA 4KB7A 1UP1A 1P1LA 5EGYA 1WOSA 3CCJS 3GB0A 4CDIA 2XS7A 4DQQA 3QMQA 1F9EB 2XZWA 4OJ3A 4ZVOB 2KU7A 3DU6A 2KJVA 3DRSB 4YS2A 1RAHB 1RK8A 3R6LB 2DR6A 3ENAA 4MFBB 1E6VB 5F0UA 3AA9A 3HMJG 4DJBA 4OX8A 4OLOA 1HNWF 3KHHA 2ZH8A 4V1Ak 3VVUA 4HI1A 5IM0B 4EK2A 3LPEA 3L95X 3H2VE 1NSPA 4PYAA 4K4VA 1HWJA 4L72B 4DR1F 1ZAVA 3KK1B 4A8MP 4P2MA 1FEEA 2FVRA 4X65J 2V63A 3CJRA 3FZBA 1TV6B 3B4DA 1HQUA 2CPFA 2QYCA 1ZS6A 3PFOA 4A8KA 3M8WA 1NPKA 4ANDA 3T9NA 3KHLA 3GFXA 3HD1A 4UZCA 1H2TZ 3OT9A 3PYEA 5A8KB 4AL6A 3HT0A 1X8DA 3MCOA 2WSCC 5LT5A 3IBCB 2YNIA 3UDLA 1ULRA 2UUBJ 3W5ZA 1XNQF 5FLXU 4FP9A 4ATNA 3EGVA 5DM7Q 1TL3A 5LSOA 1R7IA 5LSLA 2I6WA 2EC0A 4KGMA 5B0FA 3I56S 1MU2B 1KOHA 5EX0A 4JI6F 2HMIA 4JV5F 3QGHA 2HNDA 2HQIA 5E33A 2WVBA 4CNYA 2KXHA 2B4UA 2VG6B 3QRQA 4OMFG 2XO7A 1FFWB 5KFAA 2H5JB 3C16B 2DY9A 2YKNB 1SKSA 5J1PA 2LXIA 3GFHA 3GU0A 3OSPA 1GTHA 2OPRB 3CT9A 2WK4A 2NZ4A 3B4MA 1UVLA 2G2YA 1RCXB 2FVSA 2V34A 4F4KA 2HKEA 4WYLA 1JLEA 4JB8B 1TKZB 3TR5A 2DBBA 2V50A 3FNNA 4YMEA 1K1QA 4IRCA 4YY3F 1UPMB 4PPDA 1QJHA 3T5LA 2C3UA 1SJ1A 3MPUB 4LSLA 5LOQA 4AXIA 2D74B 4MYUA 2MZRA 2VOOA 4PG5A 3IG1A 2U1AA 3M8SA 1DTTB 3K5PA 3QZ8A 3G8SA 4WTOB 1ZZNA 3D9BA 3GIIA 1MLAA 5GAEI 3CTRA 3E2EA 3R27A 2UVVA 2WSEC 1UEVA 2XMTA 4TY8A 3G8TA 5B0BA 1BY9A 1K1SA 2Y8WA 2M52A 1FRHA 2PMZD 2G1HA 4IRDA 1XMOJ 3D67A 2XLIA 5AXMA 4H4MA 1RKJA 2E29A 2YNFA 3MMJA 1V5VA 3MDFA 1WDDA 2O1PA 2ZJQQ 2YKPA 1IM4A 5J2MB 1LK7A 4IDKA 1FKOB 2D9PA 1QUVA 1SH3A 2XHWA 1D9AA 3O5TB 1S1UA 2W9BA 3T41A 1TU0B 2PI5A 2UXCJ 3O6QA 4CLTA 5D0EA 1O8BA 1HI0P 1MSWD 3EXYA 4FYDA 2A1BA 1Z4UA 2I8EA 2R7RA 1KLMA 3BKTA 4HT7A 1BC6A 4MTPA 3C6TA 2QRRA 3VQSA 5KG5A 2B7CB 3EE3A 4LQ9A 2KRRA 1K8AT 3MEEA 1RTDA 2G0JA 1H0HB 4FKXA 3TAQA 1VR6A 2ZC3A 2O67A 3EGNA 5KFRA 4BLGA 3CJ8A 1OY6A 2CRLA 4O0NA 5DDPC 4J9LA 1EAYC 2R8IA 2BKOA 3H25A 4X4SA 2CPZA 4CT9A 1SUQA 4DG1B 1JQGA 4G65A 4C8NA 1P1TA 1LK5A 3RB4A 3UD3P 1FE4A 1CS4B 3KK3A 1IKVB 3TZZA 2NCKL 4FVMA 1G4CA 2IRUA 2ZJPQ 2IYGA 3BDEA 4GKKF 4USWA 1CJKB 1AYEA 2MQQA 2A2DA 1RT5A 3TANA 3BGRB 1NJYA 4OX7A 1Y9OA 4U7CA 2CJAA 2AYGA 3E01A 4LR9A 1GFWB 5B0DA 1R8PA 1JLCB 3L09A 3BR9A 3IXQA 2GW8A 4NLVA 3IAS9 3B8HA 4KGZB 3J7YU 2UXDF 3GSDA 5C2GA 4OYBA 3JTOA 2ADCA 2OHDA 3GIMA 1T03B 5H1SV 2CADA 1RACB 4ZCMA 3AY0A 3BSAA 4LFAJ 3CCZA 3OFEA 3NOGA 4NE9C 3M8ZA 8AT1B 4HH0A 1VDHA 2FJWA 2K3KA 4RUBA 1JK9B 2VL1A 1YK9A 4M5DB 2DEJA 5ETSA 4K0KF 1UWBA 1REVB 4CO3A 4L3NA 3G82A 3HD2A 4CM0A 4TNOA 4ZPCA 3R1LA 2DIUA 3RR8A 2AJFE 2NPIA 1O51A 4P7VA 2HW3A 1X5SA 3CMQA 3QBCA 1PSDA 3J7Z5 3NNCA 4KHPF 2VV5A 2W8KA 3V81A 3Q24A 1KVKA 2VG5B 2N7YA 1SI9A 2CZ9A 2CZ4A 3CDEA 4WP8A 4LF5J 1S9GB 2DNHA 1VK3A 3DRYA 2LQ5A 5A0YA 4IG0B 5MAOA 4RW7B 4MKBA 2MKYA 4WZQA 3M2UA 3TUIC 4WU2A 1S1VB 4PXBA 4G6VB 2EFVA 2ZH2A 2C3MA 2P9GA 4KFBA 3H5SA 2FY1A 4RJVA 1GEHA 1TTHB 3DOMA 1SC1B 5LMNF 4U96A 1P27B 5ITHA 2KG0A 2QMXA 1S4FA 3VGTA 4EYIB 2EK6A 2RSQA 3UD5A 4ECWA 4NCAA 4UOGA 5DDOC 2XI2A 3K7RA 3JXOA 2DO4A 3ELHA 1H3DA 2X3DA 4DN9A 2KT2A 1HBNA 2QT7A 2HZVA 4ZK7M 4UW2A 3PYGA 3ZZOA 3HLUA 5DZ6A 4IFVB 4NCGA 1MN7A 4NI2A 2ZH5A 3C6UB 3MTKA 4HACA 5FIIA 3QT8A 1UJ6A 2CWXA 3NMAA 3UR3C 3NS6A 5CYQB 4PXDA 4NPOA 1B0VA 3MI7X 3AOAA 3HZEA 1M0SA 3LQVA 3TA0A 3VCDA 3NXZA 2XQCA 5J2QB 2DNKA 2DH8A 1H7XA 2B4PA 3MM7B 4DPXA 2CPJA 3MF5A 5HK4A 1RGVA 1VMBA 4ITSA 1VBXA 4A8WA 1UVKA 4AL5A 1TK5A 2H9ZA 4HDHA 3S8SA 4PWUA 3K5MA 4DX8H 1O6XA 1X0FA 3UQSA 2RJZA 3W63A 1UCNA 3TA2A 3CCLS 2MQMA 1S59A 2Y1RI 3I82A 4RNFA 2F4FA 3RBDA 3ZO7A 3CD0A 2BE2A 4N8OA 4LFBJ 4P75A 4BWMA 5HMWA 1WTBA 3HX9A 4WZMA 1NLKL 1RTJB 4EZ6A 1FRJA 3RRGA 1Q5VA 4NL5A 1N5YA 2CUYA 5DG9A 3FGVA 3EPIA 2FYXA 1FWPA 1FDNA 4N5SA 1XIQA 4ZPWR 4RW8B 3W61A 2DGSA 1KFDA 5G0RA 4XDCA 3SCJE 4O44B 2W2OP 4QJVA 1U2RA 4USMA 2KVQE 3JAMU 1KNZA 3HSDA 3BKFA 1N52B 4QPXA 4JYAJ 3SEOA 2JLEA 1M1HA 2E5GA 1H7WA 3R5DA 4TQSA 3NNAA 1N5QA 1KBRA 1VJQA 3HT3A 3KG1A 4EBDA 4ZLJA 3N5BA
chains in the Genus database with same CATH topology
3RR7A 1QAIA 3HVTB 1D3WA 2I9SA 1C1CB 1LWCA 4RNNA 1A6LA 1R8HA 4YP3A 2DD8S 3BO4A 1ZOTA 4IG3B 3MOZA 2KZMA 1YJWS 1J2VA 2XWYA 1FNOA 5HI7A 3CCQS 4MMOA 4A8YA 4ICLA 1HI1A 4USJC 4OHWA 5BYRA 4JI4F 4RX6A 1TK0A 3I96A 3OW2R 2PFFB 3DGPA 2EFPA 3H40A 2HHVA 5LXRA 5E2QA 3PW5A 2LA4A 4CO5A 2R8KA 4DPOA 3UD4P 3ISNC 2PT0A 4WE1A 1IKWB 3GR0A 4OJ1A 2GHWA 1G2EA 1XBWA 1GH8A 1TQLA 2D7SA 2NUUG 1ZTTA 1KC8T 3FFIB 3ENWA 3VF0B 3KLGA 1H2UX 1NKBA 2UU9F 2B7BB 4C8YA 3DM2B 2QA4S 2HVIA 4D3GA 3UCGA 2RRBA 1A7GE 2VG5A 1FRXA 5B08A 3DU5A 4CQ1A 4KR0B 1KQSR 3I87A 1C0TA 3KMQA 5L39A 2B6AB 4OQJA 2N82B 4ECUA 3NLCA 4QR1A 4LF8F 3LO3A 2FGOA 3WZ0A 2OPSA 3VTIA 2V4JB 2OD6A 4I2PB 4TXSA 2UVUA 1TL4A 1UW4A 3T5JA 4PQUA 1S9GA 3NS5A 3H5XA 2KO1A 2C2RA 2BBEA 4F8RA 3KJVB 5GAGI 3OVSA 1U49A 1P6TA 2ZH6A 2DGWA 3MMCA 2LXFA 3QO9B 3I5BA 3S6EA 4ZCIA 2GMLA 3E8OA 1JLFA 2YVSA 1U1NA 4ECVA 4LVNP 4IG0A 3KG0A 3PKMA 4RW7A 4DF8A 2XY6A 1YSJA 3CD7A 2ZZMA 4C8ZA 2WONA 4Q5VA 3UCZP 1BLUA 1TAQA 5KFGA 5JJBA 2ZNZA 4KQZA 2DJWA 5KT3A 1TL3B 1QAYA 2IFXA 1S1VA 3DRPB 3Q23A 2AGPA 3KLFA 4DR2F 1N5VA 1RT3A 2DH9A 3IGNA 4ZPDA 1LV5A 4NOHA 3W2VB 1T8EA 3BN4A 2I5JA 4Y34A 4DN0A 1WF0A 5E41A 2BJEA 1QSLA 3PKYA 4CNZA 5LXYA 5D6GA 4X62F 2R7WA 5THWA 3PO4A 1FNMA 2L9DA 5IXUA 3CCMS 5E3QA 3D1QA 2HS0A 3I0SA 4EO8A 2XS5A 2DHSA 1L3KA 1ZM4A 2RF2A 2D3ZA 3SSRA 1TFYA 1AFIA 4PG8A 1E6YA 1VS3A 3HF5A 4ZCLA 1XWLA 2DISA 1NU4A 2KHDA 2RNEA 3L7OA 3CSKA 3DLKB 2XG8A 1WACA 4P7TA 4RW9B 2FVPA 2RB7A 3KNAA 2HNZB 2LXUA 5DGAA 5HP1B 3V6JA 2RQCA 4L6V3 4B3RF 2G0CA 2P9EA 4DQRA 2NXUA 1N34F 1IJEB 2HFNA 3NG8A 2HRUA 3CIMA 5KFSA 5E7OB 4X4TA 2HHQA 4QIEA 2HWIA 3V5RA 4TYAA 3DC2A 4PXEA 3ETOA 4KKOB 3W3SA 1CG2A 1JLEB 2QV6A 4IFVA 3QJLA 3MZIA 2FGCA 2DO0A 3OR1B 3HHNB 3C6UA 3G6YA 4N56A 1VLYA 1TFWA 2DNPA 3BDPA 1L3SA 3LP1B 1FTCA 1OPZA 2DNRA 2MGZA 1KFSA 4A8OA 1NB7A 4X4NA 2B43A 4F3QA 1LOUA 2DGQA 5CYQA 4M94A 2IM3A 2GFFA 3AH6A 4CO1A 3MM8B 2YKMA 3PV8A 4XIUA 2GMJA 4Q44A 2LU2A 4ED2A 5HROA 4Y2IA 1RT4B 1U24A 5E3RA 3LP0A 3M9OB 3KOAA 2IVMA 2GO9A 3TO8A 2MHEA 4ZP8A 1ZM3A 1KN6A 1WTFA 3CD5A 3M6VA 2MKKA 3GG0A 5T7LB 3BGUA 2E9RX 2QO3A 2KTQA 5F3TA 2F9JA 3MEDB 3T6JA 1RP5A 3KLHB 1S48A 1KD1T 2YNGA 3KLEB 2Y1JA 2E1MC 3DDNA 4OI6A 3M1VB 5E3CA 3UI3A 4E8UA 4CH1A 2CQPA 5J2QA 1DJ0A 4ED8A 1GTEA 4HVZA 4NYPA 4TYBA 5EX3A 3J80Y 4DV7F 1RT1A 2POKA 4BBYA 4CTAB 4X65F 3MECA 1IQZA 4ZVFA 1DRZA 4XO0A 1RYSA 4HDGA 3DLHA 4LFCF 2W7AA 4XDDA 3WC0A 1K73T 5KT6A 3DOKB 1U1OA 5G4DA 2GGPB 3JSMB 1NK8A 2PSZA 2J6TA 2KFZA 1PGZA 4WFYA 1CLFA 1PC5A 3CC2S 2VG6A 2JVOA 4QU7A 4FNHA 2RDJA 2JZ5A 4TY8B 2M7SA 4NZ6A 4P2SA 1VBZA 1UA0A 4HTJA 3HJFA 1S97A 1UVNA 4ID8A 4IUFA 3M8PB 4NLUA 4PG6A 1FTRA 2PIIA 3P5TL 1FXRA 4TLRA 1Q81T 4LVOP 3LOUA 2RU9A 4C0BA 3SDEB 3MUVP 2FLLA 4C8OA 5C24A 3P96A 2K8GA 3QYYA 1Q1KA 1JLQA 2B56A 3D1OA 3OXFA 3GFZA 2RQMA 5KFZA 3P3DA 1ZAWA 1XR6A 3PM9A 2OAUA 5F8LA 4H4MB 5KFCA 1L5UA 3G71S 2ZHBA 3P6YC 1LWFB 1FKAF 2UUBF 4NWBA 2XSFA 2R8GA 5KFOA 2QSWA 3TAMA 3L7PA 5C5JA 2BV3A 2KG1A 1OQ6A 3N6MA 4HEA9 5H9FJ 4HHJA 4DL0C 1ZAXA 5L38A 1NH7A 4ED1A 3IRWP 1NK6A 1WF1A 2MSTA 2XWXA 5EWEA 4UY8T 2MKIA 1FKPB 2DGXA 4IYQA 1F60B 1WG1A 2YX4A 3FCHA 4KHMA 1XEZA 4G3IA 3HK2A 1FJCA 4H4OB 5K9FA 2AJ0A 4MK8A 2ASYA 2NPFA 4DR4F 4YR2A 2JWNA 4OI3A 4QU6A 2Q6BA 4J9PA 2DNMA 2EBGA 3LANA 4OZ1A 4RUHA 3JYTA 3C3LA 1DTTA 1RTJA 3BSNA 4E0DA 1Q53A 1UEUA 3PXGa 3NGKA 2G9OA 5CD4H 3TAPA 1ZH5A 4BC7A 1DURA 5F9LA 1DTQB 3IWNC 2HNYB 2HHXA 1TKTB 1CQNA 1X4EA 3U02A 4IH7A 1VQ6S 2NQPA 2VBWA 4URSA 1HNVB 4PG4A 4C3MA 4NA3A 2BUNA 4MH8A 1UMJA 2HLUA 2XC9A 1JJ2R 2OKQA 4WJBA 2EPIA 3VAHA 3CMAS 4IKAA 4ZPVR 3T6BA 2Y0SD 2V4QA 2IM0A 2R9LA 1FVSA 3JSYA 1LW2A 2J0QD 2OLWA 2MMYA 4EEYA 1W2BR 4RUAA 4DLEA 2DNOA 3O44A 2CFXA 3RYLA 2EI5A 1OSDA 1N4LA 2EWHA 2FC9A 3VAIA 2VONA 3NL0A 4RW8A 5JVHQ 2PGCA 1VC0A 2BJDA 3AQOA 2QA2A 3DHXA 3CPWR 2APOA 1SJ3P 4BCAA 1MROB 5DRKA 3HVWA 2AJ4A 4LF4F 2LA6A 4UOCA 4DBQA 1KQFB 1S0VA 1KEKA 2B0GA 3QZ7A 2AGOA 3F44A 5KOXA 3MEEB 4O3QA 2JRSA 3DOLA 2ZHAA 4ELUA 4RKUC 4O44A 1QY7A 3LPYA 1U25A 1XMBA 2EKYA 4CO0A 4IH6A 1L3UA 3H59A 2VH7A 5MLCV 1HBOB 1T94A 5D4NA 5F9NA 4XPCA 1NJWA 2F8HA 1RI7A 3DNCA 3GQCA 2K7JA 2VD3A 2BANA 4QIVA 3M30B 4B9LA 3FSXA 2C2EA 3ZZRA 3PX6A 3C46A 3MFHA 2MQLA 2E44A 1BQMA 3BS9A 4PKDB 3PHEA 4HL9A 2YNHA 3CCES 1JXLA 3LW5C 5EN1A 3MPVA 2GMHA 5D78A 3TYTA 1SUQB 1WHXA 3HVAA 4F50A 1SJFA 2X1AA 4WKRA 3LF0A 5HL7Q 1VGYA 1WD6A 1FJGF 2FHJA 3G9CA 1RT6A 2WAQD 4QPTA 1WEXA 3DLGA 2RUGA 3DFEA 3ZC4A 3QLHA 1VQ7S 3R5BA 3HHDA 5E5NA 4KSEB 4DFPA 2W9CB 3VAGA 1HYSB 1SL0A 3N01A 1C4AA 1VQKS 2MZJA 1R31A 5AE3A 1J5OB 1FXDA 3HVTA 1C1CA 3UNGC 2XLKA 7FDRA 4K5SA 1NK4A 3ZZZA 4IG3A 5KT5A 4DMZA 2UV8G 4RNHA 1OIAA 3R5CA 5JUMA 2HGNA 2VBXA 4P6QA 2WB4A 4B3OB 4YHHF 2P6TA 2RU3A 1D8YA 1RWUA 1N0VC 3BB5A 3U27A 5EWFA 1UA1A 3SZ2A 2NS1B 1LQ9A 4EO6A 1XMOF 2IJFA 2JOQA 3N0VA 4DWIA 1X0PA 3OTOF 2IYIA 1VQNS 4Q8EA 2BM1A 1IKWA 4Y6IA 3I6PA 5DDRC 4W92B 2LEPA 4I6AA 4KGKA 3PRBA 4JI3F 3G4SS 1M5VC 3FFIA 2PN6A 1P8GA 3JTNA 2JC0A 2J7UA 3M4XA 3DM2A 4U9RA 3SSQA 4RNOA 5J1EB 1Y5IB 3CDWA 3K59A 1HW9A 3CJ3A 3VAKA 4ZMMA 4FPRA 2MKHA 2L48A 1VFJA 2NSBA 4CZCA 3TVZA 1LXJA 2B6AA 1SIZA 3DMJB 2B9YA 3OHAA 2UUTA 4DV2F 3LALA 4R5PB 2W4CA 2FDNA 3NNHA 2MYFA 3VAMA 2V4JA 1JLAB 3AJ2A 4I2PA 5CCMA 4IR9A 4F2SA 4RWWA 5IWAF 1FK9B 1RT7B 4C0OC 4DL7A 3Q2TC 3FEYB 4NZ7A 3OL6A 2NR0A 3KJVA 5KT2A 2C28A 2PA8D 4QW9A 3QO9A 3KK2B 3MD3A 4PWDB 2UXCF 4ECTA 4B3MF 3RTVA 3CVKA 4QCLA 1URRA 2K3IA 2ZHOA 3Q0AA 1U1RA 2VPZB 2P5VA 3OL8A 2V0NA 3PY8A 1AROP 4HH1A 4O3NA 3OLAA 2VC1A 5IQQA 5L9NA 1JJHA 4R8UB 1RTHB 5I3QA 1HWLA 3CJKB 1YITS 3K5OA 3JSBA 1NZAA 4ZVGA 3VAJA 1R0AB 1U6FA 2JFKA 3DRPA 5D4OA 1FRIA 4K4YA 2DNLA 3FEXB 1GQEA 5IS2A 2AV5A 3H4BA 3DRXA 1DQAA 1XTZA 3W2VA 2RDIA 2EW9A 2N3LA 4Y00A 3CJ2A 2O5DA 5AXNA 3UCUP 1CEZA 4YB6A 2N4DA 3CIZA 4QWEA 3BN7A 2U2FA 1RJJA 1F0XA 4I69A 2FPHX 3DRRB 2JDJA 1TUVA 4OIXA 5L9XA 2V8GA 3T1AA 5DG7A 2YH1A 3IWXA 5KFPA 2HS4A 3CEDA 4JOUA 2UXBF 2SXLA 1N0UA 2GQCA 2CDQA 3DLKA 4EZ9A 4G1PA 2QA1A 4NLXA 1YRXA 3QIPB 1S6QB 2HNZA 2HHUA 2HHWA 2CVIA 4OZLA 4J9OA 4KV8B 4OHVA 5I4MA 1HA1A 1SC6A 4U6PA 1Z2ZA 2UP1A 1MW7A 2X1FA 2HFZA 4TU7A 3HXMA 1S1TA 1APSA 2EFOA 2HIQA 4QWCA 3M32B 5DLFA 4NLRA 1VC6A 3KTQA 3TP2A 2ROEA 4KKOA 5L8RC 3HDSA 3MTJA 4GC6A 1IKYB 3THTA 2UUCF 4WFAQ 3PIPQ 2XEXA 3KWMA 4FNIA 2OTJS 3OR1A 1TK8A 5EUHA 4DDFA 1S72S 3DI6B 1NJIT 2ZFHA 1JLCA 2J8AA 2JJ4D 3LP1A 1R89A 3LH2S 3TARA 4X4UA 2DK2A 2HYIB 2CYYA 5C42A 1OO0B 4X66F 1FJ7A 3PW4A 3MM8A 4KAIA 5F8HA 4DL3A 4CI0B 1UAWA 1WHYA 2E5JA 2MY8A 1YJVA 1KR4A 2MZTA 3AA8A 2XLJA 2L9NA 3M2VB 3E51A 3BR8A 3CDAA 2JEFA 3UFCX 2BRLA 2PD1A 3I0RB 2VQEF 2LEAA 3DYAB 3VAFA 3TQ1A 1Y0HA 3MGJA 3D28A 1QVGR 2HHTA 5T7LA 4KO0A 3BZQA 3IRXB 3PX0A 3W7BA 3H20A 3MEDA 2NREA 1Q7LB 2HQ3A 3KLHA 2GIRA 4Q43A 3KLEA 2K1RB 1JLBB 4C3LA 3M1VA 1EETB 1N88A 4IQMA 3EGZA 1XR5A 4YB1P 5D4LA 3DLEB 4K50A 4ED0A 4C9DA 4ECYA 2VFRA 2R7VA 4CTAA 4OI2A 4DSEA 2YWFA 1T3OA 2LQBA 4RW4B 2OPPB 3K8WA 2VOPA 3DOKA 4Y3CA 2C22A 3Q8PB 1FDDA 4CH7A 3MMAA 2DPJA 1LW0B 3G6ES 1CSJA 5KTQA 2GGPA 3FMWA 4WYWA 3JSMA 2IBKA 3OXLA 2MJUA 2RRNA 1HPZA 3CC4S 3IR5B 5A6PA 1TAUA 5IFMA 1S77D 2PEHA 3I9V9 5A6WA 2ZH9A 1HWIA 3NKYA 4OI4A 1G1XA 2VBYA 3DXBA 2KZZA 5IT0A 1IN0A 3D1HA 5A0YB 1VHFA 3EPGA 2ZBCA 3M8PA 3KHRA 3GZ7A 1ROFA 2IAJA 2ZDPA 2F7VA 2DHXA 4HT5A 4WFBQ 1S1WB 3Q22A 3IA0A 5KG6A 1HFEL 3H8YA 3SDEA 1NRKA 2RKIB 4DFKA 5CZVA 5LJ5Y 4M5DA 1HD0A 1NHVA 3IBWA 3KLVA 1LXNA 2AX1A 2R4FA 1S1XB 3D5MA 3EXCX 3M2RB 4PG7A 3QJPA 2GHPA 2BACA 1LWFA 3B78A 4NLWA 5K8NA 2R8HA 3OQ2A 1C4CA 2LVWA 2CIMA 5F8NA 5CZXA 1A9NB 3M9NB 2RE1A 4DS4A 3S01A 6FD1A 2E66A 3BO3A 4LF6F 5KFNA 2MXYA 4ECRA 3GYNA 1ZTWA 4X4QA 2DRBA 1YGYA 1IJFB 2M88A 1QAJA 4FBTA 1DAXA 1TR0A 2DH7A 4DV4F 2HAIA 3K58A 3PJXA 4FN5A 3OVBA 2V8VA 4O4GB 1BQXA 3KKFA 1FKPA 4C8LA 2B5JA 2YKQA 3NCPA 1B0TA 1SKWA 1X9MA 1V6HA 2R2SA 3RBEA 1FD2A 2KHCA 4H4OA 4C3KA 2RQ4A 1TL1B 5AE2A 3U1NA 3MM6B 3T5HA 2DRAA 1S9EB 1X4CA 2ZKUA 3CO9A 4I0WA 4KHRA 4WK3A 5DJBA 5T14A 5FLXY 3N5FA 4DUZF 1CVJA 2E1CA 1RT2A 1RQ0A 4LFAF 3S7RA