1O5JA

Crystal structure of periplasmic divalent cation tolerance protein (tm1056) from thermotoga maritima at 1.95 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
HHHMILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIFKTTEEKEKELYEELRKLHPYETPAIFTLKVENVLTEYMNWLRESVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords periplasmic divalent cation tolerance protein
publication title Crystal structure of Periplasmic divalent cation tolerance protein (TM1056) from Thermotoga maritima at 1.95 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Unknown function
total genus 24
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1o5jA00
2NUUG 3TA2A 4RWXA 2VD3A 3L7PA 5D4NA 1VFJA 4C3KA 3AA8A 3TA0A 1OSCA 2E66A 4NYPA 3BZQA 4OZLA 2XBPA 3NCPA 4OZNA 4CO4A 1GNKA 1NAQA 1V3RA 5DS7A 3MHYA 4E98A 1UL3A 2CZ4A 1QY7A 4C3MA 3AH6A 2J9DE 2PIIA 4RLEA 2DCLA 1H3DA 2GNKA 3X3UA 2JJ4D 3TA1A 1J2VA 3T9ZA 3LF0A 3M05A 1V6HA 1V3SA 3NCRA 4C3LA 4D3HA 5L9NA 3HLUA 4CO1A 2GW8A 4R25A 4AFFA 4OZJA 1UKUA 3AHPA 2J9EA 4USJC 4CO3A 3NCQA 3AA9A 3N5BA 4YB6A 1HWUA 3OPKA 2ZFHA 3CE8A 4YB7A 2NUHA 4CNYA 1V9OA 1UFLA 3GSDA 1KR4A 1P1LA 4CNZA 3O8WA 1NH7A 4RX6A 5D4PA 2GX8A 1PILA 4RWWA 2O66A 2XZWA 1Q1KA 4WK3A 4YB5A 4CO2A 1VHFA 2ZOMA 2XG8A 1NZAA 1XK8A 4CO0A 4D3GA 2RD5C 4NYOA 4Y6IA 5D4OA 2V5HG 4ZK7M 4CO5A 4USHA 2Z0GA 2XULA 3DFEA 5DRKA 1UMJA 1NH8A 2J9DA 4Y65A 2EG2A 2NS1B 2O67A 4IYQA 1O5JA 1O51A 2EG1A 4WK1A 3O5TB 2J9CA 5D4LA 4USIA
chains in the Genus database with same CATH superfamily
2WHOA 2M8HA 1A9NB 3MECB 2XS7A 4I2PA 3H5XA 4CTAB 1UWBB 2IJRA 4DFKA 4HHJA 1QAIA 4TLRA 4M5NA 1RT4B 1B7YB 4FVCA 2IFXA 4YMEA 1JLBA 3POTB 1VIOA 1RAOA 3AD8C 3RR7A 3QRPA 1SXLA 1AXQA 2FZKB 4CM2A 1Q79A 2X7IA 2MQ8A 1PJ6A 3K57A 5KFOA 3EZUA 4KKOB 4USJC 1TUWA 2ZWPA 3ENWA 1NEEA 3THVA 3M2VB 2LU1A 3ILJA 4EMDA 2A10A 3D1OA 3SV4A 1WF1A 3W61A 3S01A 1FKOB 5E41A 4ZLPA 3D7SB 2AF6A 1PKUA 3NL0A 3GJSB 3GPAA 3AB4B 2ZH2A 1RWPB 2RQ4A 2DNQA 4KBIA 3SMZA 2Y1LB 3EXCX 2YPZA 4CYUA 4J9OA 5IM0A 3QBCA 2J6TA 2OELA 3HVTA 2B4VA 1L3KA 3NS5A 1W2IA 4KHRA 3WC0A 3R8YA 2CWXA 2VDHA 4M5GA 1HD0A 3OR1B 2DHGA 2ERRA 1RHJB 1RQ0A 1KLMB 4C0HA 2RS8A 4U9RA 3I87A 1ZBTA 3KLVA 2FB0A 1UPPA 3L09A 2YWFA 2XQCA 4K4XA 1PGZA 2WSFC 3DOLB 2VHGA 1E6VA 1UFLA 3T6BA 5F8MA 4O3NA 3MMBA 1M5OC 3P6YC 5F8LA 4RL1A 3QMQA 1HNZJ 3PVXA 3IGNA 1Y11A 5M2PA 3JQJA 2WOMA 3JXOA 4F0MA 3DRRB 4HL9A 4DV7J 2JLGA 5E33A 1SC6A 1R0AB 3ENVA 3ENAA 2GQ2A 1N5YA 3US5A 3T5KA 4MIWA 1QVGR 4ZLLA 3EX7B 3FSXA 4F67A 1W26A 2Z30B 1REGX 3FJ2A 2W9AA 3MI7X 5CH7B 2D74B 1RT3A 4I68A 1VK8A 3MFIA 4ATNA 3RBXA 1HL6A 4KSEB 4B3MF 3BDEA 3N6MA 3CT9A 1LKZA 1NHKL 1HWIA 1FFSB 4FF1A 3EGZA 1X4HA 3M8WA 4QOTA 2RRAA 2HGMA 3N6NA 1U1QA 1LEOA 4R8UA 4UZBA 5E3AA 1IR2A 4DN9A 4QYZK 2DB1A 2KVQE 4PQAA 5DGAA 1KKHA 2G9OA 2V2QA 3TX8A 5HL7Q 4A8XA 3GR1A 4LF5F 3CB4A 2VBWA 3IM8A 2N82B 2BVZA 2R7VA 5THWA 2ZC3A 2RJZA 4I2QB 3DDNA 1B0TA 3B78A 5DQGA 3LO3A 1VHFA 2V50A 1OPIA 1LK5A 3DMJB 4ZP8A 5AXMA 1TKTB 2BJEA 2HG4A 4MYUA 2FVPA 3R2CJ 4JV0A 3GYXB 4ED6A 2EBEA 2FUG9 1SUQB 2EG1A 5AJ3J 3SI8A 2XYHB 5L39A 2KU7A 4CH0S 1SI9A 1FVQA 3J7YI 2B5JB 3LP2A 4ZCKA 1P27B 1R0BG 1U47A 1ZM9A 2FZGB 3TX0A 2AP6A 4GKJF 2CJAA 3NGRA 1N0VC 3CCQS 1DZ5A 3K5PA 2ASJA 2DGUA 2D3OR 1N36J 4D3HA 4YOEA 1WORA 1UJ6A 3FEZA 3DC2A 3MR2A 1CVJA 1S1UA 3NCQA 3PR4A 4CLFA 2C2EA 4AL5A 5GMEA 2VG5A 5IFMA 3I96A 3PJ9A 4X4VA 3BREA 1RSCA 4QWEA 3LGMA 1D9FA 4I67A 3ITHA 2YKPA 3OL6A 3AJ1A 1XMBA 4DFPA 2MKKA 4CWBA 1NPPA 4HACA 1N32J 4DUZJ 3M4XA 1T95A 1G6BA 4PG6A 2PT0A 2R8KA 3QJLA 1QM9A 3NGSA 3BGFA 1K47A 3OSNA 2CQGA 3QQCD 2MSSA 1JK9B 4PZVA 4OI6A 3MM7A 3ADAC 2UUCF 4RW6B 5J2QB 4BLGA 1AZSA 4P7TA 2JX2A 4JI2F 4QZVB 4OYIA 1HMVA 1HYSA 4JI6J 4NLRA 2CFXA 5KFAA 1X4CA 4ZVFA 1HWLA 3KWMA 2XS5A 4LBIA 4N41A 5LXYA 3C6UB 3VAIA 2XMAA 3A3PB 3VGUA 3DI6B 2CQ0A 4GKKF 4DUYJ 4DV6J 2CPHA 1PILA 2XS2A 4FBTA 4F36A 1X4GA 4J9RA 2P6TA 1S1XA 2QMWA 3U02A 1CJUB 1VIXA 3RAMA 4I6YA 4USIA 4DV2J 1ZPWX 4L76A 1RLCL 3KLFA 3ONQA 3V4MA 4C11B 1TL1B 3SBMA 1FDNA 2V4QA 1ITPA 3IBFB 2QEXS 1NAQA 3OFFA 5IS2A 1MU2A 1HQUA 2B4UA 3C46A 4LSLB 1HNWJ 1W2BR 2QZ8A 4B08A 1QUVA 4K0KF 3CJQA 1BQXA 1Q5VA 4LSZB 4URSA 2XWYA 3IP0A 1RHMB 5J1EA 2F5GA 3BYPA 3FFIA 3ILLA 2Y9HA 3FDSA 4P52A 4F4YA 4LQ3A 1X4AA 2NR0A 4TY9A 3EGVA 3GQCA 3HJFA 3MAAB 5CHCB 2AYEA 2C3UA 3A12A 1QTMA 4R0JA 2DR9A 2B0GA 2C28A 3NGTA 2V69A 3KXDA 2CPXA 1UEKA 2OI2A 4IFYA 2MKCA 1NK4A 6AT1B 4ZVRB 2NS1B 5CYQA 3L4BC 3VGSA 3HFKA 1RTZA 3VAKA 2KFNA 5LMNF 1MWZA 1YRUA 3D2WA 2CPDA 2OTJS 4ZVPB 3W2VA 4XDDA 1URNA 1HBMA 3G8QA 3QT6A 2PEHA 1T9WA 4O3QA 3I55S 1FVSA 2XMUA 4CO4A 1U1KA 3FEXB 1ZYQA 3HHLD 3PJWA 3D1HA 1TL4A 3CUNA 2CPIA 3KHGA 4B3TF 3N79A 2JVOA 1S48A 2GO9A 3M05A 1XN9A 2QT7A 3C6TB 2OIHA 2RILA 4K50A 4K7QA 3DRSA 4B9LA 4NA3A 4CLUA 1QTNB 4PKDB 5BYSA 1TTHB 2VASA 5B08A 3TO8A 4Q45A 2LDYA 2C2NA 3IC1A 2ZBCA 1R8HA 2KJVA 4ZVTB 1SC4B 2IJNA 2OTLS 4DR1F 1SPBP 2LXIA 1I6JA 1T03A 1HNIB 1U0HA 1LW0A 2RHSB 1U8WA 2BACA 4ECTA 4L3NA 1B64A 2IHR1 2XZDB 4IYQA 2HHHJ 4JI4J 4Y2AA 3ZTQA 5LSLA 1KOHA 3PKYA 5CXTA 3GFZA 4LBHA 1IBMF 1WEXA 4H4OB 1M5SA 1CC8A 5E2QA 5E7OB 4QJVA 3MR3A 5EX3A 2ZHOA 5GMDA 3PYFA 1WKJA 2APOA 3UQSA 2AMCB 4GO7X 1NXIA 3VWSA 5F8IA 1NK9A 3LF0A 1S6QA 3WC2A 3RJMB 2G1HA 3W2WA 1R3NA 4DPOA 2XMVA 1H2VZ 2RDDA 2HWHA 1FRIA 2VV5A 3TOQA 4JI8J 2BZ2A 4UUXA 3ISZA 1F3VA 2E5JA 2V2VA 2W2OP 4K5SA 4CZCA 9RUBA 1TK0A 1WI6A 7FD1A 2EKYA 4DX8H 1PO6A 4A8YA 2OH2A 1U4BA 5HBMA 3TAMA 1X8DA 3AJDA 2BJ7A 1YZ7A 3OSPA 2VF3A 3KLHB 3CJ8A 5GAEI 1Q4RA 2VC0A 3SCJE 4TQRA 4C8OA 2ABYA 4L3KA 2HQ3A 4UTGA 5AXNA 3T1YF 1U1LA 5LXRA 3CCSS 2VFVA 1A6LA 2VG6A 1U7LA 1TL7B 4CLLA 1OSCA 1SL2A 2C2DA 3KLGA 4JI1J 1S1TA 3QAEA 2QL7B 4QCLA 1FXRA 1CJTB 2ZHBA 4DOZA 1ZZFA 1RP5A 1I51B 3ULHA 1DLOB 3QAUA 1YSJA 1Q7LB 1VS3A 3M8QB 4HHHA 1AA1B 3HFVA 4DR6F 2CWKA 1S6UA 2CKWA 2F7VA 3CO0P 1SKWA 2DRAA 4X4NA 3M30B 3HHLB 3LPEA 1D0EA 3MF5A 1HFEL 4JOUA 4L74A 2GMJA 2N7YA 2HNYA 1RKJA 5FIIA 4P10A 2VPXB 5A8WB 4EZ9A 1LWCA 4QWDA 2BYCA 3GSIA 3JSBA 1TMJA 2HVHA 4DX7A 4RUAA 4IQXA 1U02A 1X0FA 3W7BA 1BQMA 4DF4A 1NJIT 3R97A 3O5TB 1X9MA 3IN5A 2GIRA 2HZAA 2XLIA 1RBLA 2BQ3A 5KFPA 1ACMB 4DR4J 1RAHB 5A0YA 2XMWA 1Q8IA 1OY6A 4OZLA 4XAKA 3PFOA 1HQEA 5KFVA 2OPSA 1Q81T 1H98A 3ZNUA 1DTTB 2RQKA 1U0SA 4DSEA 3LAMA 1L5UA 1DY3A 3LP0B 3OL9A 4Q0BA 3B4DA 3RW6A 1LWEB 2UXDF 3CC4S 1C0UA 3CCES 3AAWB 1S7HA 1U2RA 3GIKA 3Q8YA 4K2XA 3E2EA 3R9LA 3SYZA 3JSMB 4EBCA 2GGPA 4P9SA 3GSDA 2YKMB 2MY7A 3IRXB 2M88A 3L9ZA 5B09A 3CMES 2BJ9A 1NBEB 2BM0A 5BXIA 3I0SB 5K14A 5KFQA 2X3DA 3E51A 4F25A 4A8MP 2W1BA 3GE9A 3RU0A 2AYGA 4TXSA 4RNOA 3PFEA 3TVZA 2D69A 4UOCA 2YPYA 3DM2B 4LMZA 2W7OA 1JLCB 2FHOB 2Z56B 4OX9J 5SUHA 1Y0HA 4EYIB 2C22A 3R5BA 4DSIA 1HBUB 1H72C 3OVSA 2F9JA 2Z2LA 1S0VA 1G1XA 3TA1A 1FFGB 2V94A 1F6TA 1OMSA 4DU8A 4NLSA 2KB2A 1SJRA 2V67A 5L9NA 3J7AN 4IOAQ 4ECXA 4LF9J 1YJTA 1VQNS 1UVKA 3CGIA 3OTEA 1IKVA 3QATA 2FLNA 3RRKA 3VTIA 2HIYA 1SH2A 2GS8A 4X62J 3M8YA 3D4JA 3MURP 1E6YB 1HHTP 3PW7A 2P9GA 3IG1A 2XI3A 2JL9A 4XK8C 1WTFA 4JYAF 1C4CA 4NYZA 1MWQA 5IT4A 1S4FA 4DV5F 3V81B 3PZPA 4FYVB 1FJGJ 4IOBA 2V8GA 2UUBJ 3VAFA 3IWNC 1VMBA 2DD8S 4C9DA 2FVQA 2DHHA 1N34J 4EGLA 1FEHA 1UJ4A 5CAAA 2RUSA 4B9UA 1J5OB 2IAJB 2KXFA 2FJDB 2MJUA 3P8BB 1CJVA 2R2RA 4E2FB 4B9NA 4N56A 4LF7F 2OKQA 2Y0BB 4R25A 2JC0A 3Q8RB 3OXGA 2BJ1A 2W2QP 2LP4A 1S7IA 3UD3P 2L9DA 2B7BB 2ZBRA 4DFMA 5LT5A 2AX1A 2VC1A 2COLA 1TK5A 3CJTA 2EFVA 1XWLA 4J5OA 3U1MA 1FNXH 4DR5J 3WX4A 1U26A 4ED1A 4YY3F 5D4OA 5D0GA 5ETNA 4PG5A 3DOKA 1VRTB 3CCZA 3FCWA 1C0TA 4WZMA 4DV3F 4PYAA 3BGUA 2AHOB 1G3OA 1X4BA 1HR0F 2OPQB 4Y3CA 2OJ3A 4PCQA 3GIIA 2ZH6A 3RB0A 3EM1A 5E3QA 2AJ2A 1V3ZA 3CDAA 4ILRA 2FY1A 1DRZA 1JJHA 2HRYA 1KS2A 2IYGA 3PIPQ 2CZ4A 2DIVA 2Z4PA 4TLQA 5H9EK 2R9LA 1X5SA 2HBQB 4JV5J 1S76D 4DL2A 5SZTA 5KT4A 1SKUB 2MMYA 2DGVA 2VA3A 4X2BA 1SBRA 1HI0P 4UOGA 4DG1A 4FF4A 4A8KA 1N5QA 3MR6A 4DHVA 1UFWA 4LUBA 1QLNA 2A18A 5LOQA 4CLPA 3OV7A 2QC3A 2KT3A 2X1GA 1EX8A 2XZWA 2V2ZA 5L1JA 1U2FA 2IIHA 1S79A 5LJ3Y 3AD7C 3SV3A 2XY5A 3ZZTA 3ILIA 4CLYA 1HI8A 4NE9C 4HTJA 1EQMA 3KG4A 1SQEA 1TKZA 2AEJA 2N4CA 2R7QA 2V6AA 3CCWA 3KJVA 1S5ZA 4QWCA 4I69A 3HD1A 3W8GA 1S1WA 2XM3A 4PG4A 4RNFA 3MEEB 4KRWA 3MUMP 3D1QA 1U48A 4ZP9A 3V4IA 4V19X 1VI7A 3VGVA 2EPIA 2CJ9A 2DNPA 2RSQA 2DGXA 2YX4A 1RT2B 5F8HA 3KJNB 2MQLA 4LVOP 3NGDA 4F2RA 4K5RA 4AFFA 3RAXA 3CJ3A 3HDSA 2VQFJ 1RAJA 4ERDA 4FYXB 5K8OA 2V34A 1JKHB 3NOGA 2V4JA 1YJ7A 4K4WA 2RUGA 2ZC4A 3T5HA 3THTA 4G6VB 2IMWP 2IVYA 2ZJPQ 3UVJB 2RIJA 1HBOA 4N76A 4WWSA 2MZTA 1CPZA 2AJ1A 3MM9A 4BDPA 4DEZA 1KOOA 4P2FA 1HHSA 2V5HG 3DRPB 4A46A 4G1PA 2AKWB 2VL1A 2VU5A 2I2YA 3VVUA 5I3QA 3U27A 1IKXB 5KFMA 2OPPB 5HP1A 1ZAVA 1RBOB 1N33J 4FNHA 1L3TA 1YJUA 4TNOA 3D6TB 4C3KA 1HIYA 1XNRF 2CZVC 4QPTA 1XR5A 1T05B 3NNHA 4FPRA 3BH6B 2GZOA 3I0RA 3AH6A 2EXUA 2HNZA 5B0FA 3X3UA 4QIVA 2FZCB 2ZD1B 1WUUA 4W90B 1EETB 2R7XA 3KHRA 1KTVA 1IQTA 2LEAA 2X1FA 4LF6J 4CLTA 2CPZA 1SJ4P 2AT1B 5EGYA 2J6SA 3LANA 1S1VB 5A2QY 3TZXA 3EUNA 4DV1F 5DDQC 2R4FA 4DQIA 3QWUA 3C14B 3BPDA 3EVWA 4X64F 3T1HJ 2HQCA 2WZ1A 1UETA 2F8HA 4EWTA 4DPXA 4EBEA 4WIIA 1NSPA 4U7CA 2KHDA 3R6LB 4F4XA 5HO4A 2PI4A 3W63A 4KY3A 2DH7A 5J2PB 1PG5B 1L3VA 3NS6A 1CLFA 3KNGA 3KUEA 2JLFA 2VONA 3MEGB 1Q5YA 1VGYA 2CPFA 3V2UC 3QO9B 2HHTA 1UVLA 4OI3A 2B6AA 2PIIA 2VPZB 3KK1B 1RK8A 1LWFA 2UUTA 1V6HA 1S10A 3NCRA 2KM8C 4QW9A 4C8KA 5HMYA 3HVWA 4DR2J 5I42B 4Z2XA 3FKBA 3QLHB 3TAPA 2C42A 4URGA 5HROB 2B4OA 5LSRA 3N5BA 1FK9B 1Q78A 1BXNA 3WIUA 1H2TZ 1T7PA 1NH7A 1MWYA 4M63A 4ZN1A 2R7RA 1JLAA 2OEJA 4TKTA 4Y6IA 2FQQB 1XJWB 4CO5A 4FN5A 1RACB 1XMOF 2UXCF 4IG0B 5DG7A 2QA1A 3BBCA 2AW0A 3KG0A 1FFWB 5C25B 2W9CA 5IWAJ 3GIJA 1GFWB 3HVRA 5LM7E 1WG4A 2XYPB 3HK2A 4QU6A 3AY0A 5T7LB 5JJBA 2KYZA 2Y1JA 5CD4H 3CJ4A 4O4GB 4WTOB 3W5YA 1VQ5S 1M0SA 4OJ1A 5A2QU 4KV8B 4F7VA 1TUGB 2MXYA 4YR2A 2UV8A 1DQ8A 1CSJA 9ATCB 2OUGA 4ED7A 4YB6A 4ZPTR 1VRQC 1U6FA 1N8RT 5J2MA 2IRXA 4RBUA 5K8NA 3VQSA 3M6VA 2YKNB 4WFBQ 4E0DA 4YN3B 2AIRB 3RYLA 1TKXA 4M5DB 1R6VA 2FGOA 2XB2D 4F8RA 4L6V3 5HANA 2CA9A 3RBZA 3IBWA 2ZM6J 2JEIA 5L46A 4ECWA 1UA0A 3C16B 4X66J 2NCKL 2ROGA 5D4LA 1RU1A 1NSAA 4RWXA 3QGHA 2X3GA 1S9GA 1I1GA 2XSJB 1IVZA 5D77A 3EZOA 4XO0A 2HVIA 2ROEA 2MTLA 2HAIA 3GYNA 2MJNA 5KFHA 4ZPAA 2K3IA 3GG0A 5CQGA 1NJYA 2BKOA 2HS4A 3DLEA 3CCUS 4WXWA 1CBKA 5F8NA 2Q66A 4PPDA 3JAMY 2E1PA 4PUOB 4DPWA 3MUVP 1SV5B 5T14A 2UVRA 1VDHA 2JC1A 4WYWA 1RT5B 3LW5C 5KFCA 2PD1A 2M8DB 3M9NB 4AQYJ 3HF5A 2ADBA 5DG8A 2VUGA 1FJGF 3BM7A 1H74A 3UFCX 1T9YA 1S0MA 3M1VB 1KP6A 3A13A 4NYOA 3KLEA 4B3OB 5DQHA 1RTHB 4Y00A 2UUAJ 1DJ0A 2CPJA 3D28A 4PQUA 4NL5A 4M94A 4OX6A 3E01B 2A2DA 2CPEA 3NLCA 2VQEF 2QSFA 3JYTB 2DGOA 1NSQA 3IAM9 4B3RJ 2ASLA 4OHYA 2E7WA 4LIWA 3C19A 3ILOA 2ZVSA 1FTCA 1XMQF 1MMNA 1RLDA 2ZNZA 5L1IA 5A6PA 1NKCA 4JI3F 2VA2A 2OSQA 4OX8A 2VG7B 4DMZA 2E29A 5HSPA 2NYHA 3H5UA 1GX6A 1OO0B 3H2UB 2DKOB 4ES3A 2JZ5A 2YWWA 3R27A 2CVEA 2EW9A 4ZVGA 3MECA 1V9OA 1UWBA 5B0BA 1HLWA 1R7IA 3EDQB 5B0EA 3BDPA 1H38A 1FRHA 4JV2A 3DRXA 1RT4A 2CQIA 4PG7A 3KHLA 4QR1A 2J6UA 2BE7D 2RE1A 5EWGA 3BF4A 4AE5A 3L3CA 4KKOA 2MPUA 5HJXA 1HKAA 2XGQA 3W1YC 2ZOFA 3TQEA 2ZZMA 4OI4A 1TFWA 3S8SA 1BWEA 1FD8A 4L75A 3UE2A 2FTRA 1VC5A 1NKEA 3C15B 2FJAB 3PO5A 1YK9A 3MPWA 2ZH3A 4N47A 2CJBA 4TY8A 3T19A 2MQPA 4F4WA 4I6AA 3A3OB 2J9EA 1DFDA 1VOMA 3NMAA 4QYZJ 5HLFA 1SJ3P 4X4SA 2DEIA 1TELA 3CD5A 4ZP7A 2MKYA 4DLGA 2WRMA 5HATA 1FT8A 2H54B 5JVGQ 3OQ2A 1V5IB 5C24A 3HZEA 4AXIA 3OR1A 4OYXA 4DUTA 1JLGB 4CYUB 1YJRA 2HGNA 4J9QA 3HVTB 1O6XA 2CZ9A 2BQRA 1NDLA 4DU7A 3HSDA 1N5TA 3DOLA 1RTDB 3D3CJ 4LJMA 4OZNA 1RAAB 4NLOA 4IQMA 1SC3B 1DARA 4G1IA 1N54B 1VQSA 3UDLA 4M5LA 3HO1A 5HI7A 3M8RA 1E6VB 3DRRA 3CSKA 2MHNA 1B0PA 2DRBA 3Q24A 4WKRA 3R6GB 1REVB 1WHXA 2KHCA 3S6EA 1K9MT 3F0NA 3Q89A 1JLQB 4U95A 3HHDA 4IG3B 4ZLJA 1CC7A 3FQLA 4S0MA 4DQSA 4F4KA 2FLPA 4ZCLA 1RAFB 3GFHA 2YNIB 2QFIA 4ZJQA 4CH1A 2MSTA 2HFSA 4MFBA 2KJWA 5LMUF 5E3PA 1UAWA 1RT3B 3DLKA 3Q2SC 3SQGA 4KH1B 1RWNB 5AXKA 3M2RB 1ZM2A 3BKTA 4DV4F 4KO0B 3GU0A 1UVMA 1VJQA 2FGCA 2RB7A 4ZVUB 7FDRA 2KG1A 2W9BA 4O23A 1S9FA 2W7AA 4I2QA 2DNHA 5C2CA 1HHQA 3IAS9 1H7XA 1FWPA 2J0WA 2N3LA 3CO9A 4K4TA 3GCXP 2GJFA 1SUQA 4OI1A 4YUDA 3JS9A 3W9HA 3TZWA 2C2MB 4GRSA 4KGXB 2XMMA 4RU9A 3CD0A 3OTCA 1NK7A 4NLWA 2B5JA 5JUMA 1N5VA 4WK3A 1Y10A 2H5EA 1L3UA 4DSLA 1RE1B 4A8OA 3RG6A 4LF2A 4ZVQB 2VOPA 2BW7A 5ETKA 3NBPA 2J0XA 2PGCA 1F5AA 2BE9B 1KHWA 2ZUAA 2HLTA 5J2NA 4DR3J 3AOBA 2ASYA 3R7BB 2XCPA 2D3UA 4MK7A 4NLYA 3K0JA 4MT1A 2BJ3A 1QJHA 4B3MJ 4ZIVA 1IKWB 4YP3A 2O5DA 1S1UB 2BQUA 2HHUA 2YXLA 3BN4A 4UOHA 1OSDA 1YKWA 4RNHA 2VG5B 2IC3B 3H42A 3NRBA 4TVAB 2OLWA 3Q86A 1NKBA 1RDRA 2E7XA 4P2SA 1UCNA 4YQWA 1TVRB 3OTDA 1OY8A 1Z2LA 4WTYA 4LF5J 5E0OA 1UPMB 4ETZA 4NXNF 1YJWS 1N6QB 1DTQB 4F4AA 4Q5VA 3D6HB 4RW6A 5J2QA 2Z2MA 1UVIA 4NA1A 1C1CB 1SQFA 2E1MC 2V9WA 1M5PC 2HPUA 5GAGU 1HI1A 4F0KA 3UW1A 3ZC4A 1N88A 3CD7A 5KAKA 2BE2A 2BOPA 3PW0A 4IOCQ 3AXKA 2NUUG 3ZZZA 1FXLA 1VFJA 2DO0A 4C48A 5F9NA 5KT6A 4A47A 3DU5A 4GKJJ 1WF0A 3KOAA 2QJ3A 4RLEA 1KSPA 7AT1B 4NWBA 1FD2A 2G4BA 3SSRA 4Q2MA 4QPXA 1YQHA 2IRYA 4LRCA 1RAEB 1B70B 1B7FA 1F1BB 1GX5A 2MLXA 3IGVA 2R2TA 3Q8VA 1HNVB 5KFGA 4F2SA 1FX4A 4C11A 1S1XB 3KUHA 5F8JA 3EDRB 2NPIA 1ZM3A 1M1HA 3MMAB 1EARA 1WHYA 4G1QB 2JDJA 4USKA 2HQGA 4LSLA 3R1LA 2D3O1 3KLFB 3KK2B 4UOFA 3L7OA 2CIMA 2BABA 2QLWA 1HW9A 5KFBA 3P49B 1RUSA 1MU2B 1HQUB 4PABA 3G6VA 3FCVA 4NRUA 3I9V9 2NXCA 4RBTA 3JQMA 3MAAA 1XR6A 1RWOB 1MN7A 4ECUA 3BO2A 2JEFA 3ZTOA 2UUCJ 1SL0A 4LT6A 4CLKA 3HSJA 2FHKA 1H3DA 1BGXT 1FKPA 4CLSA 4RR5A 2LFVA 4QIWD 3CDWA 1ZTTA 1Z4UA 2Y3YA 4JI2J 4ILMA 2WB4A 2JH3A 4M8LA 1DBDA 4R0EA 3PXGa 2BJ8A 3LP1B 3BO4A 4QW8A 5BYQA 3D5MA 4NZ6A 3DLBA 2EWHA 3HP6A 2DO4A 4EO6A 4YB7A 3CVKA 1NDPA 4LVNP 5KFXA 5DLGA 3GTYX 3NMRA 4GKKJ 5IC4B 1NSKL 1LNQA 2KKHA 2PA3A 2PMWA 1KDNA 1X9SA 3UO0A 2RS2A 3SZ2A 2Q43A 3W2VB 1QVFR 1HBMB 3IXQA 4NLTA 2BEFA 1UVJA 2AZ1A 1RISA 2KZZA 2QX0A 5CYJA 1D1UA 2OGUA 3PHTA 3D0GE 2EFPA 2H65B 1RAIB 4GMKA 1T9TA 2QO3A 5JMNA 1ZA1B 2F4VF 4Y0FA 4AD6A 1TAQA 5G4DA 4OJHA 2G0CA 8AT1B 5EUHA 4LR7A 3F73A 5BR8F 1RT7B 4LQ9A 2BUNA 4K0KJ 2PFDA 4OI2A 1HNIA 8ATCB 3R3TA 2E9RX 4H4KA 3M8SA 4WKYA 2NPFA 4KGZB 3BSCA 2B43A 2AEMA 4LRBA 1RHKB 1OIAA 4ZS6A 2LKZA 3M9OB 2XMTA 3MR7A 3N5FA 1T03B 1JIHA 1LW0B 1N48A 1VK3A 4GC7A 1Q8BA 4ITSA 4H4OA 1IUJA 4DI6A 3OTBA 1GAOA 4LF1A 4H4MA 4ECQA 5FD1A 2Z2YB 3V5RA 1XR7A 4O44B 4LFBF 2P2CB 3UCZP 2HHVA 3TAQA 1NH8A 1UEUA 3CPWR 4LF4F 5E5NA 4MAKA 5LMNJ 1RGVA 3QYYA 3WQPA 4IFVA 2HZVA 1UTAA 3ZTRA 4QU7A 1WNEA 3W2WB 4ANDA 3MFHA 2GMLA 2E9ZA 5CYMA 1RTIB 4E98A 2IM0A 2I0XA 3TUPA 2MY8A 3ICLA 2F1FA 4B3TJ 4HTIA 1JJ2R 3SEOA 4DR7F 4K4UA 2XZTB 1FNOA 2O3DA 3HLUA 4CO1A 2ZH9A 4ZVHA 4CI0B 5I4MA 1ZS6A 2E44A 4DPYA 4QYRA 2P8IA 1B3TA 3B6BA 1F5CA 4PXDA 4XDCA 3OR2A 4DCPB 5KFTA 2HQIA 2B51A 2E1CA 5HBMB 3TAMB 2ZJQQ 4CNYA 1FHTA 4C8MA 5HMZA 2HHXA 4CCHA 1W7WA 2YH1A 1KR4A 1FDBA 5DQIA 3BQ0A 5G0RA 2BANB 4FZVA 3QSYB 4DR1J 2YX7A 4Q8FA 1WSRA 2IDLA 1CJTA 3P45B 3H90A 3E3XA 2XLKA 3DHXA 1YG0A 3UDEA 1DLOA 1S59A 2K1RA 4OI0A 3C3LA 3PW5A 2B3TB 1LW2B 2M4MA 2NLWA 2HIQA 3M8QA 4X4RA 1EP4B 2CQ4A 1IBMJ 3M30A 3HHLA 3JSYA 2XBPA 4MKYA 1OYEA 2HFNA 2RRBA 1TP7A 4H54A 5A8WA 1KRPA 2WBRA 1Y00A 2FVCA 4UW2A 2HNYB 2DGTA 4K4ZA 4CH7A 4L72B 1LWCB 2A1BA 1NJZA 3BGRB 4ZVSB 3H5YA 5KT7A 2ZDOA 3GR0A 1FJCA 2VOOA 2I5JB 2R42A 5RUBA 4CLZA 1K1QA 1R31A 4NA2A 1KONA 3LP0A 3R5GA 3BS9A 2LVWA 3ISNC 5DRKA 1FE4A 1R8BA 2L9NA 4LF8F 5L9XA 3BKFA 1LWEA 3O2IA 4URQU 3T1YJ 3MTJA 4NASA 3NP5A 3DLGB 3JSMA 2YKMA 2F8MA 5C7PA 1WC0A 3QZ7A 2FJVA 1KTQA 5IOLA 3PEHA 5F8GA 3I0SA 3CDUA 1FI4A 2AQ4A 1VQYA 3CTRA 3P5BP 2HQFA 4PWUA 1JNZB 3PG9A 4DJBA 2UXBF 2CNLB 3GB0A 3G86A 1TKDA 2RAQA 3H25A 4DR6J 3KHHA 4NLDA 3KK3A 2H5IB 1WC4A 3H0PA 4ED8A 3CJ5A 3FVYA 4Z7CA 5GADU 4DS4A 1X5TA 3W5XA 2B9EA 4LRAA 1TFYA 2QTWA 5C5JA 2LQ5A 1H0HB 4DR3F 1HBUA 3F41A 4OZ5A 3TVKA 2GVDB 5GAHU 3UDCA 4FVMA 2YKAA 2G0JA 1GMWD 4EI2A 3MEKA 2LA4A 4F4ZA 2OSRA 2WVFA 1K73T 4ZLNA 2PC6A 3QGIA 4CM0A 2IYIA 2DNKA 3CIZA 2JEGA 1TAUA 3PEJA 5A8KA 3J7ZT 5KFYA 2VFRA 2D41A 2SXLA 4IR9A 1YLXA 4DL5A 2D9OA 4M5MA 3EMTA 5B0DA 5H9EJ 5C42B 5H9FJ 3NWRA 1Q16B 3W3SA 4U7UD 2O1PA 5BYRA 3T6JA 2UXDJ 3SFGA 4QQBA 4ED0A 1JLFB 2CRLA 3BSOA 3RZAA 4J9NA 1EQ0A 2P5VA 4E8UA 1MSWD 1VYAA 3WDOA 2EFNA 5D4PA 1J5OA 4DSFA 3KJQB 1RWXB 3G8SA 1VQ6S 3BN7A 1XTZA 2KVIA 2RD5C 2B56A 2CQPA 1YRXA 3ELHA 3EZ5A 2QL5B 4OYBA 2NSCA 2QMXA 2PO4A 3RBDA 4NOHA 1DQAA 4J37A 5DS7A 3MHYA 2DGQA 3PYDA 1VC6A 2UU9F 2RKIA 3KMSA 1OWXA 4WU3A 1VRTA 2JRSA 2XHCA 3IS9A 3D9BA 2DT9A 3WHIA 2KFZA 2KXHA 2HZCA 1QE1B 4BS2A 4ED2A 3ZZ0A 2I1RA 2J76E 4R5PB 1FO1A 1GQEA 2I9SA 2GQCA 2OPQA 3LAKA 2RDIA 5KG3A 4CRJA 5DJBA 1C0TB 4IO9Q 4YS2A 4PPZA 1XEZA 2FHJD 1Y3KA 4JYAJ 4J90A 2EC0A 2N4DA 2ZBPA 4DV5J 4EEYA 2DPIA 5JVHQ 4IUFA 4XIUA 3W8PA 3R7SB 2I38A 4OLPA 1HBNA 5DZ7A 5KG6A 4I4BA 1K8AT 3I32A 1Q82T 3ZZPA 3MAQA 1U1MA 3M2UB 3CJSA 4N8OA 3M7VA 3DOMB 3QZ8A 1RWWB 3QWPA 3FBCA 4J9SA 3DYAA 3UR0A 4O3RA 3TUJC 3A8KA 5KFIA 3UD4P 5DETA 3NS7B 5LJ5Y 4LF7J 2A6MA 4C3LA 2VPYB 1LFPA 1F9HA 1R89A 3BB5A 3BBBA 1N0UA 3W66A 3HKWA 2XLJA 1M90T 1WKKA 1JLEB 2RQMA 4UT4A 2XNQA 4JI7F 4ZHRB 3RB6A 3MEEA 4WZQA 1U49A 1NCLA 5B0GA 6FD1A 2AJFE 3PM9A 3BQ1A 4YY3J 3MM6B 3MD3A 2HW3A 4KJIA 3MEDB 1KVIA 4PRFA 3CMQA 2KYXA 4U8YA 2IY5B 5KG2A 1RT2A 3TP2A 1R27B 2VODA 4KH0B 5HJYA 1X0PA 3MM8A 4DV3J 2CXEA 2J0SD 2MQOA 4I56A 1JKHA 3T41A 1HR0J 4KIAA 3DGPB 3OTOF 2BDPA 2F8EX 1IR0A 2UVUA 3OFHA 2R7OA 2V2KA 3TQ1A 3QIPA 2K7KA 1LWXA 3G82A 4BBYA 1T0TV 5HVGA 4QWAA 3DRPA 2POKA 3O1LA 1HPZB 3J7Z5 1NK6A 2CG4A 2HVEA 4OYOA 3EVOA 1HBOB 1IKXA 4K2JA 2R3VA 2R2UA 4HKQA 3P5TL 1UFKA 2OPPA 4CO3A 3FBFA 3B54A 4ZITA 1IR1A 2AX0A 1T05A 1LQ9A 5KT5A 5HVFA 1C4AA 3GV7B 3DLLQ 1UW9A 3PYGA 1NM2A 4LFCF 1S57A 4HEA9 3ZTPA 4D3GA 2QE5A 4I1TA 3N6LA 4ZPVR 1RT1B 1TMMA 4OHXA 4ZCMA 2ZD1A 4GO5X 3BGOP 5FLXY 2F63A 2EG2A 3ENQA 2C2RA 4IRCA 4HDHA 2AYBA 2QSWA 1S1VA 3UD5A 3M9MB 1FJ7A 4USUA 3G6ES 2DK2A 3GV5B 1GNKA 4EU0A 2YQ0A 2FLLA 3TW0A 2DNZA 4DQQA 2JJ4D 1F2GA 1DAXA 3O3LA 3SQOP 3NNCA 2FJBB 3FMWA 5FDLB 2HYIB 2WTFA 3B8HA 1TK8A 5J2PA 2YVSA 2KM8B 1DQ9A 4O0IA 5D8HB 3W9JA 2QG9B 5HQ8A 2XI2A 3OT9A 3DXSX 3WIVA 4WJBA 1UA1A 3CE8A 3TVYA 2LCWA 1URRA 2R7SA 5KG1A 4Y2MA 1WTBA 2XC9A 1JMTA 3QO9A 2W2NP 4X65F 2D9PA 3K58A 3KK1A 1FF2A 4V1Ak 3ZZRA 1ZAWA 3HSZA 1YJNS 1JX4A 1WELA 2HBYB 1F2HA 3LH2S 1FA0A 3PX4A 1BUXA 4FXVA 2O67A 2XHWA 5I42A 1S4EA 1VBZA 2KRBA 2B6AB 2EK6A 5HROA 3DCAA 5E3CA 4LFAF 4K8RA 4RUHA 1RZMA 1LWFB 1XNRJ 2G2YA 5KT2A 2JHEA 4OHZA 2C3MA 5ETMA 4PWDB 4IO1A 2GCFA 2JVRA 2UZAA 4MMOA 3FBEA 3SXLA 2WBMA 4IG0A 3WZ0A 4DL3A 2C3PA 3F44A 2NYIA 2CYYA 4C0BA 1IKYA 3TANA 2WONB 2BV3A 4UF4A 2DNOA 3CDBA 4LRDA 5C25A 4DV1J 2H48B 4UZCA 1QUPA 2Y8YA 1WG1A 3V6DA 1WEYA 2KT2A 4X64J 3S1TA 5FLXU 3TJ9A 2ASDA 4WP9A 2BJDA 3QRRA 3H2LA 4KV8A 1J27A 1IBCB 4LR9A 4NZ7A 3EWGA 3P3DA 4B17A 2HBRB 3HULA 4ECYA 4CQ1A 4RNMA 4WE1B 2E66A 3LWMA 2VIHA 3BKUA 1NDCA 3BSNA 1KD1T 2PSZA 2YKNA 2GVZA 4C8NA 3RRHA 4EUVA 2YNGB 1D8ZA 2NXNA 2KG0A 2AWZA 4RUCA 5J2MB 1OPZA 3K5OA 1KBRA 3J80Y 1VCTA 2DTJA 1VC0A 1WG5A 4UQTA 5ETRA 4Y34A 1VRUB 2NXJA 3ZTSA 3N28A 3Q83A 2XSJA 3MM5A 2G1DA 2A6OA 1NK0A 3FUYA 1PYTA 3N9UC 4ZP6A 3TEGA 2VICA 5ETTA 3NG8A 3QSIA 2XG8A 2GJIA 3PV8A 2RVJA 2UVVA 4ZK7M 1T8EA 4USHA 5L1LA 1XMOJ 1IBKF 2UXCJ 4PUOA 3O6QA 2K06A 2A0FB 1RT6A 1KLNA 1CS4A 1SV5A 3HZGA 1O51A 4WXOA 3CEDA 3H59A 1RT5A 3EXYA 2F40A 4CT9A 1WEZA 2IBKA 1Z1ZA 3GWCA 3I9ZA 2F3JA 5I3UB 4PXBA 2R7WA 2QIFA 3S7RA 1AFJA 4B3SF 2GHWA 4LIRA 4DQPA 2ZNYA 2F4FA 4NCBA 4FXDA 2OD6A 4B3OA 1TR0A 1Q95G 3VZHA 2OPRB 1RTHA 3TARA 3HKZD 4LR8A 3PYEA 2IM1A 1IJFB 3E01A 2QLJB 1I94F 1U45A 4ECZA 2DR8A 2YWEA 1F5BA 3KLEB 3KUGA 2H4YB 4YHHF 4U7UK 1BHNA 3JYTA 1RADB 1VBXA 4M5HA 4PQUB 3VV2B 2R8JA 1K0VA 4KHPF 1U1OA 1UVNA 2NZ4A 5CABA 5GMKa 1WWHA 2WSCC 3ZZUA 3K5NA 2DR7A 2V8PA 5A8RB 2MKJA 4Z37A 1X9WA 5AE1A 2PI5A 4USVA 2VG7A 4BCAA 4ID5A 2H9ZA 1TQLA 1GTEA 4HLBA 1JWWA 4Q44A 4X4PA 3A4TA 2D1CA 2E1RA 2B9YA 4WFZA 5AT1B 4P74A 1EAYC 5H1SV 1M1GA 3J80U 3LA0A 1VLOA 5EWEA 1HNXF 4AL6A 2ZUGA 3CJ2A 4CT8A 3G9CA 4ANEA 3UN5A 3O44A 3MMCB 3VZIA 2GQQA 3IM9A 2AYMA 2WCXA 3PRVA 4ZDNA 2O01C 2WAQD 3O8WA 2ZE2B 3C15A 3H4BA 1OJ4A 1CJKB 4U6PA 2DYAA 2KH9A 4CDIA 1YZ6A 5DLFA 2DXDA 4OQJA 3RRGA 1KQGB 4IR1A 2YH0A 4O3PA 4Y28C 1JXLA 2EFGA 4DV0F 2VQEJ 2IDEA 1BC6A 1VHIA 4TY8B 2FJXA 2Z8QA 5D4NA 2LA6A 3CC2S 2C2ZB 4AUKA 3K7RA 1HQ2A 3AOAA 4WFXA 2AZ3A 1XERA 1XNQF 5KFSA 5FJ4A 3KDNA 3HD2A 3D6MB 3UNYA 4NCAA 1J5EF 1XMQJ 4NXMF 2VFTA 2GNKA 4JI3J 1GMUA 5KFZA 1JLGA 5HLFB 1V3SA 4JI0F 4MIAA 4EFAC 2RT3A 2PDAA 2VKZG 1KVKA 3CCVS 3H4DA 5IV4A 4CIOA 3M6WA 1KWMA 3M32B 5C24B 5HQLA 2DXEA 3M6XA 5B0AA 1SC1B 1RTDA 1MROB 3W65A 3D54A 4MKBA 4FKXA 4ZPDA 2DRDA 2MZ1A 4ECSA 2G0IA 4K4VA 4FS1A 4ECRA 1JQGA 2EC2A 4F0HA 3MPYA 1ZAXA 3DDIA 2QLBB 4WFYA 3V6HA 4DCJB 2NXEA 5DM7Q 1WF2A 2CG8A 2PN6A 1REVA 2CDQA 3IBCB 3DRYA 2EK1A 3ETOA 4NCGB 1S6PB 3VAHA 1JLQA 4ZJLA 4IG3A 4I6WA 1NUEA 3W5ZA 1APSA 3IR6B 2GMHA 3TA0A 2QN6B 1OYDA 5F3TA 2CJXB 3OL8A 3HFZB 1S49A 4RJVA 2YNIA 4NLVA 2FYXA 5I3PA 1HD1A 3CJ0A 3OUYB 2HK3A 3TWZA 1HWJA 2HFZA 2FC8A 3UCUP 4JI5F 3M2RA 4RBVA 4ID8A 4KO0A 3VAJA 1A0OB 4MFBB 3AD9C 2GJ2A 2HBZB 2CQBA 2J7KA 4FP9A 1BQNB 3ZZOA 3DLKB 3MD1A 2KZMA 4CNZA 3SQGB 1FRMA 2OEMA 3T5JA 1CULA 1NK5A 3MCSA 3DN9A 3M8PB 2IMOA 4TYBA 1SJQA 3H8YA 1UZDA 2WB1D 3PRBA 3R5AA 3MPUB 4PG8A 5IT9Y 2EI5A 1QAJA 2W9BB 2DHAA 2V0NA 4FYDA 2J9CA 4NLQA 1FNMA 2WVDA 3Q8UA 3CXCR 1EJ7L 3TI0A 3L7PA 2W4DA 2AD9A 2PMZD 5AE2A 3NWGA 1TL3B 4NLXA 3RUBL 1FWKA 1T9XA 3R5JB 2WW4A 2ROPA 5D0RA 5KTQA 3T9ZA 3VALA 4I7FB 2WVEA 4ED3A 3HI9A 1TV6A 1FX2A 4AL7A 5EN1A 2F9DA 4OX7A 5HMWA 1AYEA 2HRTA 4EBDA 3CC7S 3J81j 1YHQS 3NBPB 3DHWC 4BC7A 2N3OA 1TUVA 2V63A 4Q43A 1WHVA 1IKWA 4RUBA 5J2NB 1XC9A 1MMDA 1Q8KA 3CIMA 5LMUJ 2LQJA 3ET6B 1YGYA 4LSNB 2IC3A 4M95A 1X4EA 2DGSA 2OHDA 2ALZA 1RHRB 4ICLA 5IQQA 1GT8A 3SDEB 2P9EA 4DV4J 2AJ0A 1TVRA 4HI2A 1FRLA 3SSSA 1V3RA 3RR8A 4OZ0A 4B9VA 1UL3A 3H2VE 1A7GE 3K8WA 1N6QA 1QY7A 1DTQA 3C8YA 4EK2A 1C1CA 2XGPA 2V68A 3GCWP 3SCLE 1BE4A 2BX6A 4W98A 4RW9B 1R43A 2RDJA 1LOUA 5GAEU 2VBZA 3IR5B 5EDWA 3GILA 4PR6A 3WBZA 2YNHA 2XO7A 4QR2A 3TYTA 1F9FA 3IWXA 3UI3A 2E5IA 1D3WA 2K3KA 2BE2B 3EVMA 2ZOMA 4C2MA 4CO0A 2R7UA 1WACA 3CDEA 5IT9U 1X5PA 4ES1A 2J0QD 1S9EA 3GJRB 1S97A 4MH8A 4FF2A 4RW8B 4IH6A 1YWXA 2HNDB 2QV6A 1GMVA 1QSYA 3DU6A 1GTHA 1YBAA 1HNVA 2QGFB 4JUZA 1JJCB 3FNNA 2EKNA 2ZKTA 4HR2A 2J8SA 3QNWB 2XMJA 3MMAA 4G1QA 1V5VA 3C2PA 5IV3A 5D3GA 2HLUA 2F65A 2DCLA 4DN0A 1Q7YT 3FBBA 3MUTP 3KK2A 4GVBA 3CJKB 3BQ2A 2E1AA 2W8LA 4N8NA 3DKDA 4ZOSA 2G13A 1FJEB 2CQDA 2CQHA 2YKOA 4LRFA 1I3OB 4NXNJ 4FS2A 1P1LA 2ZKUA 3X1LB 3I4PA 4NZ0A 4F3QA 3QGGA 4YB5A 1ZM4A 2MZJA 1MNEA 2GHPA 2ACMA 2CQ3A 2GC8A 3UPFA 3AB2B 3MOJB 3PW4A 2HMIA 4OL8A 4J7CA 3LP1A 1TZ0A 5DGBA 2OD4A 4C4WA 2PE8A 2MQMA 4RW4A 4DL7A 1FKPB 2YNFB 4N77A 2HWTA 1GEHA 3PIOQ 2N7CA 4KFBB 2XY7A 2XEXA 4NEYA 2E7VA 4P2XA 2ATLA 2QL9B 3HVAA 1IBLF 4PWWA 5B0CA 5CZXA 1NJXA 2D3ZA 4LREA 4NI2A 2M5YA 3QRQA 3NXZA 5KT3A 2GW8A 1KN6A 1YJVA 3BV8A 3BGLA 2QYGA 4P71A 2E5LF 2JSXA 4YR0A 2KL8A 4ER8A 3ISND 4U67Q 1I5OB 4NMLA 4JB8B 1F0XA 1RT7A 2ATCB 2L9WA 3IMQJ 3R5CA 2PA8D 2OO4A 4Y65A 4PEOA 4XPCA 4F3MA 1RI7A 2EFOA 5K5MA 2RF2B 3ZNJ1 3JB9k 4KR0B 2DHXA 3GYGA 2YWHA 4ANCA 4A8QA 2Z57B 2E5HA 1C1BA 1XIQA 5D15A 3I5AA 1PJ7A 2BM1A 2ZH4A 1R0CB 4O44A 3SSQA 2HHSA 4F02A 1F60B 3Q22A 1Q53A 3R5DA 5ETVA 1P1TA 3W60A 4KPCA 4RU2A 2E9TA 1Z2ZA 5K9FA 2DNYA 4H4MB 4K4SA 3G2XA 4ETXA 4USTA 1Y5IB 3CD6S 2ZFHA 4Y2KA 1X5OA 3KLIB 4TU7A 1M5KC 3HPOA 3NGKA 1RTIA 2DNGA 4RW7B 2JNJA 4MTPA 3LPYA 2O66A 1Q1KA 3IR7B 4IFVB 1EHWA 3AT1B 2G2ZA 2QRRA 2Q6BA 2MKIA 2MGZB 1MW7A 4KE5A 5CYMB 2XSFA 2GIFA 3OHAA 4G65A 4O0NA 5KFFA 4DSJA 4WF9Q 2BKNA 3PRDA 2DR5A 2F4VJ 3EPIA 2LEBA 3VAMA 4IDKB 2YWGA 4DZ6A 5BR8J 5F0WA 4ZMMA 1Q0NA 2BANA 2J9DE 3OR2B 1VQ9S 1RTJB 4OHWA 4CTAA 2KTQA 1Y5LB 4Y2CA 4J9MA 3VAGA 2DNRA 5L1KA 2DY1A 5G0RB 1LW2A 4J9VA 5K8MA 3POTA 2HEKA 4FKYA 3RW7A 4I2PB 1EP4A 4O4RA 5ADZA 2RRNA 4B9SA 3CCJS 3TNVA 3RGIA 2K1RB 2MKSA 1LFWA 1P9YA 3OXLA 3MCNA 4RWWA 1HNZF 2BR0A 2BRLA 4LFBJ 1JLBB 1G4CA 3M2VA 2XULA 4DV7F 4LF4J 3VQTA 3PHEA 1PJ5A 2G2OA 3R7NB 4C8ZA 4A8SA 3JAMU 4HT5A 2ZZTA 2DCUB 1FKOA 3PO4A 1OY9A 3GIRA 2DGWA 4NLUA 1SQGA 1D9DA 1BD6A 3BGRA 3MDFA 2GHVC 3FSIA 4I0WA 2B8QA 4KHMA 2GA7A 2RH3A 4OZ2A 5E3RA 5EWFA 2I5JA 4NX9A 1S0OA 1S99A 1NB7A 4DR7J 2LQ9A 2QA4S 2VJUA 5HQMA 4QWBA 1XQIA 1P9QC 1IXKA 1SH0A 4WFNQ 1T3OA 5KG4A 1IM6A 2R2SA 1SL1A 1KLMA 4YFUA 3KJFB 5IM0B 2FJEB 1BLUA 3Q23A 3DLGA 4Q2LA 1D8YA 2B8PA 1KHVA 3FSYA 2VFUA 3D67A 1R8PA 4W4MA 2C1EB 5EX0A 2XWXA 2M2BA 2ZH1A 1PC4A 3BSAA 1ROFA 3AQOA 4N5SA 2HFUA 4IKAA 1X4DA 2AV5A 4WK1A 2QLFB 2WVBA 5AJ3F 1L3SA 5HK4A 1OQ3A 1U09A 3A8EA 4OIXA 2VH7A 4V19J 1LXJA 1FRJA 1RA7A 4KB7A 5HAOA 3MMBB 1R0AA 4OYZA 2VZ9A 3BPSP 3ZXWA 2XO6A 1SJ1A 3PW2A 4KYZA 3QJPA 3KK3B 5DDRC 2WOMB 3G87A 2GVDA 4KT0C 3D0IE 4F50A 3K8VA 1N36F 1AB8A 1D9AA 4RKUC 3FRZA 1N5YB 2PEBA 1ZZNA 3OVAA 3K5LA 2CNNB 2IPOB 2X1BA 2R8HA 2HK2A 2HHWA 3HT0A 3I82A 1FKAF 2GAHC 4EZ6A 3MCOA 2DISA 2D7SA 4EO8A 1CEZA 2V8DA 5C42A 1RWVB 3HSGA 4LF8J 1UMJA 4R8UB 2H3EB 1N32F 4DUZF 3H40A 1JLFA 5A8KB 2ZDPA 3QT5A 2BKPA 1RU2A 1IQZA 3TA2A 3DMJA 4UY8T 1TKTA 4M5IA 2DJWA 3G4SS 1CQNA 1QSSA 1WDTA 2HKEA 2X51A 2W7PA 3NOCA 3UN2A 1BWVA 1X7VA 4HVZA 1NU4A 1PC5A 1ZOTA 4O3SA 3UWTA 4HH0A 1W25A 1YBTA 3D66A 4C97A 4JV1A 2ZZNA 2DNNA 2W4CA 2UXBJ 4JI6F 3PDNA 2YWKA 4IH5A 2DPJA 1WOSA 3Q2TC 2ZH7A 2NUHA 4C8LA 4ZPBA 2OFHX 3LP2B 3OLAA 3PX0A 4HDGA 1K0TA 2AEFA 4DX6A 3V6KA 2M7SA 2PMHA 3OBIA 1NJWA 4DUYF 5LL6d 4DV6F 1UW4A 2WSEC 1NHUA 4NEZA 3PTWA 3MGJA 4ECVA 2UV8G 4HT7A 2HAFA 1U1NA 4F26A 3VHQA 2B7CB 1QE1A 5CCMA 4R5PA 1BMQB 4DV2F 2RKIB 2L41A 1RAGB 5KFNA 1NB2A 1VQMS 2QLXA 1GXUA 3CWJA 1NDKA 3D68A 5DO2A 3P4UB 4Y2IA 2JLEA 3IS9B 2R8IA 2CQCA 3W62A 5U47A 4A8FA 1HNWF 3ITHB 3HHEA 2I8EA 1YBUA 3GV8B 2QA4G 2IM3A 1KVJA 1H7WA 4HACB 3TJAA 1R8AA 4L73A 3ZO7A 2KN4A 3PR5B 1N4LA 2E5GA 5H9FK 6FDRA 2BW2A 3OPKA 3CCLS 3MM7B 3M2UA 2MQQA 4NRTA 2NXUA 2ZBIA 3DOMA 4RX6A 1FXDA 1HBNB 4Q7AA 4ZCIA 1Q8LA 1GMWA 1UZHA 3G96A 2QYCA 1KEKA 5M2UA 1AZSB 3IFEA 3C6UA 1RYSA 3DI6A 1HMVB 1UJ5A 4TN2A 1HYSB 2DXFA 4NPOA 4USWA 2CDRB 2YTCA 2ZWOA 3HHKA 4QR0A 3DYAB 1VBKA 4ZN3A 1JLEA 2W24A 4U96A 4C6AA 1RCOB 4ELUA 3I56S 1CJUA 1VQOS 3NEKA 5DM6Q 4ZHRA 2ILYA 3N01A 2CPYA 5KFLA 3HMJG 4GVLA 1YX2A 2WK4A 2VBYA 3R2DJ 3OJSA 5KFWA 2A3JA 2Z58B 4IRDA 3MM6A 2UU9J 4B9TA 2RU9A 3MEDA 5AXLA 1TL1A 1D09B 2KO1A 5CZVA 2LXUA 3RTVA 1R8CA 3UR3C 3HT3A 2H1YA 5ITHA 4A48A 3DGPA 5EHHA 3K59A 4DS5A 1FEEA 4Q8EA 1QDUB 4NLPA 3MM8B 3BO3A 3K2YA 3GMGA 4WPAA 4UQGA 3TZZA 3L7UA 4HHUA 2WVCA 1HPZA 1N56A 3DFEA 1ZTWA 5J1EB 4J9LA 2HQDA 3QIPB 2RQCA 3NNAA 3FFIB 2HHHF 4JI4F 3G82B 2QFJA 2GIQA 1AFIA 2BBEA 2ADCA 1NO8A 4RO0A 2MHEA 3A3NB 3K5MA 3UDVA 1R6YA 1TL5A 3FRYA 3OFEA 3MPDA 2DR6A 1SJFA 4YEAA 4UY85 2IVFB 4WFAQ 2BA9A 4YB1P 2UVWA 5ETSA 3MAHA 2OMOA 1U6ZA 2AGPA 1RT1A 1IJEB 3LALA 4IFYB 4A4JA 1MG7A 1RWKB 2Q3PA 4WCEQ 2W2PP 3H7HB 5CYQB 2L48A 4DFJA 3RBEA 5KG0A 4HYKA 1FERA 2LMIA 5CA5A 1FESA 4JI8F 3TRGA 3H20A 3C6TA 4JI7J 2MB0B 3MZIA 2OFGX 2DNLA 1YDLA 2FHJA 1YVFA 4KGKA 2P9CA 2CJQA 2XNRA 4CO2A 1SKSA 1PCAA 3RB4A 2HVZA 1CG2A 2LYVA 3PY8A 2VDIA 3MOZA 1WI8A 1WOOA 5FDLA 3DXBA 3BBFA 4RZRA 1PIEA 3DRSB 2QMUB 1CQMA 2VB6A 1RYRA 1WC5A 3OTOJ 1IWAA 2M3DA 2FDNA 2XYGB 2MZRA 4O3OA 2Q79A 1N5SA 1LK7A 4JI1F 1ZETA 4DX5A 1FDDA 1U0HB 2PFFB 1ULRA 1RA6A 1RKIA 1ZA2B 2MZQA 3OFGA 5DDPC 3AHPA 4DSKA 2Q6CA 2A2CA 4MKVA 4ZPWR 1GH8A 3QFHA 2K2PA 1K1SA 1O8BA 2LLZA 3GZ7A 4J91A 2CJKA 3AODA 4PWDA 2ACYA 5KG5A 3DNCA 5GVQA 4LFCJ 4H4KC 5IXUA 5L8RC 1NZAA 4ED5A 4TU8A 3DDKA 1DURA 1S6QB 3U1NA 2Z0GA 1EZZB 4ZPCA 2X1AA 4QIEA 3PKMA 1QAXA 1RHUB 2LXFA 3BR9A 4A8WA 2DVIA 2WONA 1P6TA 4X4QA 3OJUA 3PACA 4DL6A 4DLEA 2DEJA 5K8PA 4MK9A 3G71S 4DR4F 3KLHA 4MK8A 5HN0A 1EKSA 1PBAA 3OD2A 3I5BA 1JXVA 5GAGI 1IKYB 2KI2A 4X4UA 1KC8T 1J2VA 2GV1A 2M70A 1TL7A 3MCMA 3V6DB 3K89A 2ZITA 3A8IA 3KKFA 1FWLA 1B0VA 5F0UA 1RBAA 2CVIA 1YRTA 1HWUA 1S0NA 2VG6B 2HGLA 3BYRA 4WE1A 3EGWB 1C2PA 5KG7A 3NY0A 4BWJA 3J81Y 3KLGB 2GX8A 4X65J 1S77D 1S1TB 2M0GB 2MQNA 1UWAA 1LV5A 2YNGA 1U8SA 4WU2A 2RMLA 3UCGA 2AJ4A 3RAQA 3TJ8A 1YTYA 4DQRA 3GFXA 2UUWA 1GK8A 4MYTA 2FY8A 2GVZB 1RJJA 4UUWA 4RNNA 5A6WA 5KFUA 2V8VA 1VRUA 1WC3A 4LFAJ 4AXJA 1YI2S 4F04B 1YITS 3DLHA 3AOCA 3AA8A 4XTTA 3FMBA 1AT1B 3A1YG 2K8GA 3I5CA 4P72A 1BY9A 4OX9F 4ED4A 1EB0A 3MR5A 3LWLA 2JFKA 3NAIA 3PJXA 1ELOA 2VPWB 3MM5B 4ZKAA 1QSLA 4P2MA 2BOAA 1KQKA 4OZJA 4LF9F 3W9IA 1AUDA 2EVZA 4WBFA 1BQMB 4GC6A 1DTTA 3GJQB 3HHLC 3KMQA 3VVTA 1WKLA 4IRKA 2R7TA 5A0YB 1PAUB 4X62F 5I3UA 1S12A 2L3MA 1HQEB 1RT6B 2OPSB 1UEVA 3M8ZA 1CS4B 1HA1A 3FCHA 1HW8A 2CAJA 3N0VA 4IH7A 4WYLA 1EIYB 1PSDA 1G2EA 2HS3A 2FD2A 4Q0BB 4FBUA 1KNZA 2MLYA 1PYSB 4M5KA 3KDOA 4OJ3A 2JOQA 3SCKE 4ZIWA 2OPRA 1S72S 4KPYA 4QIFA 3OHBA 2CQ1A 4DBQA 1PAEX 1C0UB 3IRXA 3PNIA 2XTJP 2M9KA 3T9NA 2UUBF 2FHMA 3EE3A 1N34F 3Q0AA 4J9UE 1FCAA 2GGPB 1P8GA 2DIUA 2FPHX 3NAHA 3MXHP 3CW2C 3JTNA 2Y1IA 1YIJS 4XPEA 4ELTA 3U1LA 2CUYA 1OQ6A 1ZH5A 5K14B 2HFVA 4DL0C 5A8RA 2FJWA 3GIMA 3DM2A 4DCOB 1JXEA 5J1NA 1NHVA 1ZPVA 3FZ2A 1JLCA 2W01A 1B99A 1ICEB 1Y7PA 1UKUA 4HH1A 2ZH8A 3J81U 4PXEA 1VQKS 3OW2R 3WX8A 4RPFA 4ID5B 4I64A 4X84A 4ZJOA 2LU2A 2W25A 3LGNA 1U6BA 5BJRA 3PCOB 4AYBD 3N4WA 2BRKA 2C3YA 4DR5F 4DL4A 2VBXA 1IBKJ 3U7JA 2AGQA 3DGVA 2ZEJA 2ALYB 2LECA 2Y0SD 1E6YA 2W8KA 2YBVA 2KRRA 1IKVB 2J7UA 4C0OC 4BWMA 3MMCA 1VR6A 4KTQA 3Q8PB 3IWLA 3RB3A 3G6YA 4OZ3A 2V9KA 1WDDA 1SIZA 4OZ1A 3V81A 4OYPA 2H51B 2LDIA 3IG1B 4B3SJ 2LQ8A 4P7VA 1PBUA 2ZE2A 2P6SA 1FDAA 1NPKA 4DPTA 1CJKA 4JV5F 4ZVEA 3T3FA 1DHMA 5D78A 4EYHB 1HWKA 1YJ9S 1T9UA 2HHPA 1NZ8A 2IAJA 2ILZA 1I94J 4NLGA 2W2MP 1RXOB 3UN3A 1H6KX 2DITA 4YHHJ 4OYWA 3FEYB 3W64A 2Q1LA 8RUCA 4KHPJ 5MAOA 3OL7A 2MDAA 4USMA 5T41A 1WC6A 1CJVB 3MWBA 1RWUA 1U25A 3JTOA 1WHWA 2XY6A 4QIGA 3GLJA 5CD4A 2FVRA 2MKHA 1MN9A 1PYOB 2DY9A 1NNDA 3QIDA 1XBWA 1FRXA 1Y4ZB 3KTQA 3M32A 4B02A 3GG1A 4U8VA 1GXLA 2VD3A 2HWIA 3D6FB 5KFDA 1MROA 3OXFA 1VQ4S 2KT5A 3TUZC 1HNXJ 4AT1B 5IT0A 4KAIA 3DOKB 1OS5A 2RU3A 2DH9A 3I6PA 5D0HA 5DG9A 2K7JA 3R1HA 2VQFF 4NCGA 1S6PA 4DDFA 3QFWA 4BHQA 3K17A 3OVBA 2RNEA 2Z2ZA 3SFUA 1NMEB 1KQSR 3B4MA 1NPRA 4ZA1A 2ZBQA 3FZBA 1FRKA 3OUYA 4DXLA 4KQZA 1M5HA 3H5SA 3QGPA 3L95X 4J9KA 4TU9A 2MLZA 5IQ6A 1SVDA 4DG1B 4DF8A 2MYFA 1MMLA 4DV0J 4P73A 1N33F 3FGVA 1KFSA 2J5AA 4ZVOB 3UNGC 2V4RA 1RABB 3FC9A 4FXWA 1BQNA 2L08A 3QJJA 2GO8A 1XNQJ 1U1PA 1J5EJ 4NXMJ 3EICA 4OYMA 2W4PA 3NGUA 3M8PA 3GONA 1KFDA 4JI0J 1WOPA 4FYYB 1WC1A 5KFKA 5KFJA 4X4OA 1WSVA 2DHSA 4MIBA 4LF6F 1VQ8S 5JXSA 2B9WA 1TKZB 1VISA 1CULB 3AA9A 4B9MA 1G7CB 2OP5A 3IRWP 3KJVB 3M6UA 4C98A 1S1WB 1F3FA 4K4YA 1TL3A 3T1HF 3BEGB 1Q86T 3V4IB 3QPIA 4KGMA 3BJYA 4I7FA 3IO1A 4NMXA 3UVJA 1X31C 3FK4A 1RCXB 2IA0A 4F3OA 1SIWB 5GADI 2V4JB 1M1KT 1U24A 5CCLA 1U1RA 3HM9A 1RB0A 1B4SA 1T9VA 3TUIC 4YDDB 1TV6B 2GAGC 5MLCV 5GAHI 4P75A 3A8JA 3MM9B 5KFRA 3J7A1 3Q8SB 1NK8A 1F9EB 2YKQA 5KFEA 2AJQA 1T11A 5L38A 3ET6A 2U2FA 5F9LA 4LSNA 2C3OA 4DR2F 1T94A 2ZOGA 4WIQA 4JI5J 5HP1B 3LGHA 1KQFB 3SDEA 2OAUA 5ETQA 4ES2A 2VFSA 4N7TA 3QT8A 2IRUA 2H5JB 1Y3JA 3I4HX 1EETA 4OJGA 3HHNB 2DNMA 2U1AA 3EGNA 4Z7YA 3JTPA 1T3NA 3I0RB 2VKRA 4ICLB 5ETPA 3ETMA 4MKAA 2MZSA 2HNZB 1X60A 1AW0A 3JQKA 3AFGA 1QD1A 3CNQP 4JP8A 4CLWA 3C14A 3T1AA 2AGOA 4OYAA 4ENOA 4WP3A 4LBPA 2J7WA 3ZFVA 1IN0A 5M2RA 4RW9A 3GFYA 2RHQB 4OLOA 5IWAF 1LXNA 2VJVA 3Q8QB 2FIUA 2IVMA 4OFZA 1UP1A 1S6OA 3GP9A 4OMFG 2ZJRQ 3MTKA 1JNRB 3CCTA 3T5LA 4C3MA 1GXTA 3NKYA 2KFYA 3MEGA 2QA2A 3VCDA 5K20B 2ZVIA 2CNKB 4JBCA 4FF3A 1H73A 4RW8A 2YNHB 1RHQB 2HNDA 1X4FA 1SCJB 2EEYA 2B9XA 3SIPB 3DLJA 3BH7B 4WP8A 2EFQA 4G3IA 3V6JA 4OHVA 4W92B 1S9EB 4QBUA 5IZHA 3AQPA 2HRUA 3CF5Q 1SH3A 4PXCA 4PAAA 2ZHAA 3KFWX 3HXMA 3MMJA 5KOXA 3QLHA 3LUYA 3VR1A 1FK9A 3THPA 3LTOA 4DZDA 2GFFA 2YQ1A 3CJKA 1FE0A 4J9PA 2ZM6F 3VF0B 1M5VC 5D3GB 4X66F 3CMAS 1WD6A 1TU0B 5IC6B 2C2OB 2DBBA 2IM2A 3BR8A 2IA6A 4GVBB 4YR3A 3AJ2A 3EYZA 2Y8WA 5HMXA 2JEJA 3H98A 2HURA 4CP5A 2CNOB 3KNAA 4FYWB 3GJTB 1K44A 1N52B 3FQKA 1JLAB 3LOUA 2NREA 2UP1A 3I31A 2NSBA 2KDOA 3CJRA 3B82A 2Y1RI 2FVSA 5F41A 1JB0C 1SB6A 5T7LA 2JFDA 3PX6A 1QAYA 4O4GA 5HVHA 2W9CB 2YNFA 4AQYF 1IM4A 2HS0A 4KFBA 2EBGA 2HMIB 1VBYA 2CQ2A 1VLYA 4K59A 2NQPA 4OV6A 2M52A 1T02A 3MPVA 4KGVB 2MEWA 3SCIE 2HVDA 5C2GA 4RW4B 3TEHB 4P6QA 1XK8A 2KXNB 1VQLS 3TR5A 5DZ6A 5F3ZA 2UUAF 1NLKL 3G6XA 4ALZA 4PYDA 1U2CA 3QT7A 5B7WA 3CCMS 4M5DA 5KOWA 2BMBA 4X4TA 4ELVA 4NI2B 4NYPA 3BZQA 3NCPA 2DH8A 3AXMA 4B3RF 2CADA 3EPGA 3C16A 2YY3A 2YX1A 3D0HE 4DPUA 1RWMB 2C2KB 3OLBA 2H4WB 2NZCA 2XCAA 1TKXB 3JSRA 1H2UX 1O0PA 2HHQA 4ILLA 1EKRA 1SKRA 2LEPA 2BXJA 2RF2A 2IBOA 3LQVA 4M5JA 3TZYA 1S9GB 5ETLA 3HJVA 3F56A 5A76A 4FDFA 5LSOA 1IWGA 2WW8A 4M1KA 2AU0A 4YDXA 4FNIA 1WJ9A 3DLEB 1Y5NB 4DWIA 3EJMA 2YQ3A 4C7QA 2J9DA 1C1BB 2R8GA 4TYAA 3P96A 2IJFA 5D6GA 3KG1A 2LQBA 3M1VA 3CULA 4OV1A 1VQ7S 2HFOA 5ETOA 1VQPS 4KC5A 3KLIA 4C8YA 3G8TA 3E8OA 4RW7A 4TQSA 1Y9OA 4MJKA 3HX9A 1IBLJ 2J8AA 1HARA 1MLAA 1NRKA 3CCRS 2MGZA 2HSEB 2CJYB 5DDOC 2ZH5A 2E5LJ 3J7YU 2B4PA 2V8HA 4HI1A 2OEKA 1AROP 1JJ4A 1VJWA 2FC9A 2XMKA 1AUSL 2I6WA 4IDKA 2FLOA 2OMLA 1RTJA 3D3BJ 1FTRA 3KYLA 4BC9A 5J1PA 3C66A 3ZZYA 3VGTA 1O5JA 3HCXA 4FPIA 5AE3A 3IA0A 5D0EA 2JWNA
chains in the Genus database with same CATH topology
5C25B 1IQZA 2WHOA 2W9CA 3TA2A 3DMJA 3GIJA 4UY8T 1TKTA 2M8HA 4KIAA 2DJWA 1A9NB 3G4SS 1CQNA 3MECB 3HVRA 2XS7A 4I2PA 3OTOF 3H5XA 4CTAB 1UWBB 2BDPA 2F8EX 1WG4A 1QSSA 4DFKA 4HHJA 1IR0A 1QAIA 2UVUA 3OFHA 3HK2A 2R7OA 4QU6A 2V2KA 3AY0A 2X51A 3TQ1A 4TLRA 3QIPA 2W7PA 2K7KA 5T7LB 1RT4B 4FVCA 2IFXA 2KYZA 5JJBA 2Y1JA 4YMEA 4BBYA 1X7VA 5CD4H 1JLBA 4HVZA 3CJ4A 1NU4A 1PC5A 1ZOTA 4O4GB 3UWTA 4O3SA 4HH0A 3POTB 1VIOA 4QWAA 3DRPA 1W25A 2POKA 3RR7A 3O1LA 1SXLA 1HPZB 3J7Z5 1NK6A 1VQ5S 1M0SA 1AXQA 4OJ1A 4C97A 4KV8B 4JV1A 2CG4A 2MXYA 4YR2A 2ZZNA 2DNNA 2W4CA 1Q79A 2UV8A 1HBOB 1DQ8A 4JI6F 1CSJA 1IKXA 3K57A 2R2UA 4HKQA 3PDNA 2YWKA 3P5TL 4IH5A 5KFOA 3EZUA 4KKOB 4USJC 2OPPA 4ED7A 2DPJA 4CO3A 3Q2TC 4YB6A 4ZPTR 2ZH7A 2NUHA 3ENWA 4C8LA 1NEEA 3THVA 1U6FA 3M2VB 2LU1A 4ZPBA 1N8RT 5J2MA 2OFHX 3LP2B 3OLAA 3PX0A 2IRXA 4HDGA 1K0TA 4RBUA 2A10A 5K8NA 2AX0A 1T05A 3VQSA 3V6KA 1LQ9A 2M7SA 2PMHA 3D1OA 5KT5A 3OBIA 3M6VA 1NJWA 3SV4A 1WF1A 1C4AA 3GV7B 2YKNB 3S01A 4WFBQ 4DUYF 5LL6d 4DV6F 3DLLQ 4E0DA 1FKOB 5E41A 1UW4A 4LFCF 4HEA9 4D3GA 2WSEC 4ZLPA 3RYLA 1NHUA 2QE5A 4I1TA 1TKXA 3N6LA 4M5DB 4ZPVR 1RT1B 2FGOA 2XB2D 4F8RA 4OHXA 4L6V3 2AF6A 4ZCMA 2ZD1A 3NL0A 3IBWA 3MGJA 4GO5X 4ECVA 2UV8G 5FLXY 4HT7A 2JEIA 2EG2A 1U1NA 3ENQA 3AB4B 2C2RA 2ZH2A 4F26A 4ECWA 1UA0A 4IRCA 2FVSA 2ROGA 4HDHA 2RQ4A 2AYBA 2B7CB 1QE1A 2DNQA 4KBIA 2QSWA 5D4LA 3SMZA 1S1VA 5CCMA 4R5PA 4DV2F 4RWXA 3EXCX 3QGHA 2RKIB 2X3GA 1S9GA 4J9OA 2L41A 5KFNA 1I1GA 3M9MB 2XSJB 1VQMS 2QLXA 5IM0A 1FJ7A 5D77A 1GXUA 3G6ES 2J6TA 3CWJA 4XO0A 2DK2A 3GV5B 1GNKA 4EU0A 2HVIA 2ROEA 2FLLA 3HVTA 5DO2A 4Y2IA 2JLEA 2B4VA 2HAIA 3IS9B 2R8IA 5A8RB 1L3KA 3GYNA 2MJNA 3NS5A 2CQCA 5KFHA 1W2IA 3TW0A 4KHRA 5U47A 4ZPAA 2K3IA 3GG0A 2DNZA 3WC0A 4DQQA 4A8FA 1HNWF 5CQGA 3ITHB 1NJYA 1HD0A 3OR1B 2HS4A 3DLEA 3HHEA 3CCUS 2I8EA 2JJ4D 1F2GA 2DHGA 2ERRA 1DAXA 3O3LA 4WXWA 5F8NA 2Q66A 3NNCA 1RQ0A 1KLMB 2FJBB 3GV8B 2QA4G 4C0HA 2IM3A 4PPDA 3FMWA 2RS8A 3JAMY 4PUOB 1KVJA 4U9RA 5FDLB 2HYIB 3I87A 1ZBTA 2WTFA 3B8HA 1TK8A 1H7WA 3MUVP 5J2PA 1SV5B 3KLVA 2YVSA 5T14A 1R8AA 2FB0A 3L09A 2UVRA 2KM8B 1DQ9A 2JC1A 4O0IA 5D8HB 2YWFA 4WYWA 2KN4A 1RT5B 3PR5B 3LW5C 5HQ8A 2XI2A 4K4XA 5KFCA 1PGZA 1N4LA 2E5GA 2PD1A 2M8DB 2WSFC 3DXSX 6FDRA 2BW2A 3DOLB 4WJBA 3M9NB 3OPKA 3CE8A 1UA1A 3TVYA 1E6VA 3CCLS 1UFLA 2LCWA 3HF5A 1URRA 3MM7B 3M2UA 2MQQA 4NRTA 2R7SA 2ADBA 2NXUA 3T6BA 5KG1A 5F8MA 4O3NA 3MMBA 5DG8A 2ZBIA 4Y2MA 1M5OC 3DOMA 2VUGA 1WTBA 3P6YC 1FJGF 2XC9A 1G2EA 3BM7A 4RX6A 1JMTA 5F8LA 3QMQA 3QO9A 3PVXA 4X65F 3UFCX 2D9PA 1FXDA 1HBNB 3IGNA 4Q7AA 3K58A 1S0MA 4ZCIA 3M1VB 1Q8LA 3KK1A 1FF2A 3G96A 3ZZRA 4NYOA 3KLEA 2QYCA 5M2PA 1KEKA 1ZAWA 4B3OB 2WOMA 5M2UA 3IFEA 3DRRB 4HL9A 1YJNS 1JX4A 1WELA 3C6UA 2JLGA 5DQHA 5E33A 1RYSA 1SC6A 1RTHB 4Y00A 1DJ0A 1FA0A 3LH2S 2CPJA 3D28A 3DI6A 3PX4A 4FXVA 1HMVB 1UJ5A 4PQUA 4NL5A 4TN2A 2O67A 2XHWA 1R0AB 1HYSB 3ENVA 4M94A 4OX6A 3E01B 4NPOA 2GQ2A 5I42A 2YTCA 1VBZA 1N5YA 3US5A 3T5KA 3HHKA 2A2DA 4MIWA 2KRBA 2B6AB 2CPEA 2EK6A 3NLCA 4QR0A 3DYAB 1QVGR 3EX7B 3FSXA 4F67A 5HROA 3DCAA 5E3CA 4LFAF 2VQEF 3FJ2A 2QSFA 4RUHA 3MI7X 1JLEA 2W9AA 2W24A 5CH7B 2D74B 1RT3A 1LWFB 4ELUA 3I56S 4I68A 1VK8A 5KT2A 3MFIA 3JYTB 1VQOS 2DGOA 2JHEA 4ATNA 4OHZA 3IAM9 5DM6Q 2C3MA 4ZHRA 1HL6A 2ASLA 2ILYA 3N01A 4OHYA 2CPYA 4KSEB 2E7WA 4LIWA 5KFLA 4PWDB 4B3MF 3HMJG 2WK4A 2VBYA 3BDEA 4IO1A 2ZVSA 3OJSA 3N6MA 2GCFA 5KFWA 1FTCA 3CT9A 1XMQF 2A3JA 1LKZA 2JVRA 2UZAA 3MM6A 4IRDA 1MMNA 1HWIA 4B9TA 2RU9A 2ZNZA 5L1IA 3MEDA 5AXLA 5A6PA 1NKCA 4JI3F 2VA2A 1TL1A 4FF1A 2OSQA 3EGZA 4MMOA 4OX8A 2KO1A 2VG7B 3SXLA 4DMZA 1X4HA 2E29A 2WBMA 5CZVA 4IG0A 4QOTA 2RRAA 2LXUA 3WZ0A 2HGMA 4DL3A 2C3PA 3H5UA 3N6NA 1U1QA 3RTVA 1GX6A 1OO0B 1R8CA 4R8UA 3F44A 3UR3C 2NYIA 2CYYA 5E3AA 3H2UB 4DN9A 4C0BA 3HT3A 1IKYA 3TANA 2WONB 2DB1A 2BV3A 4ES3A 2DNOA 2JZ5A 3CDBA 3R27A 2CVEA 2EW9A 5C25A 4PQAA 5DGAA 2G9OA 4ZVGA 5ITHA 4A48A 3MECA 1V9OA 3DGPA 1QUPA 1UWBA 3TX8A 4A8XA 1WG1A 5B0BA 1WEYA 3GR1A 5HL7Q 1R7IA 2KT2A 3V6DA 4LF5F 5B0EA 3BDPA 3CB4A 2VBWA 1H38A 2N82B 2BVZA 2R7VA 5EHHA 3K59A 1FRHA 4DS5A 5THWA 1FEEA 3DRXA 4JV2A 4Q8EA 2ZC3A 4NLPA 3MM8B 3BO3A 1RT4A 2RJZA 4I2QB 3S1TA 3DDNA 1B0TA 3B78A 5DQGA 2CQIA 3K2YA 3GMGA 1VHFA 3LO3A 4PG7A 4UQGA 3KHLA 1OPIA 1LK5A 4QR1A 3DMJB 4ZP8A 5AXMA 2ASDA 1TKTB 2J6UA 2BJEA 2HG4A 4MYUA 2FVPA 2BJDA 2RE1A 1HPZA 3H2LA 4JV0A 3GYXB 1N56A 3DFEA 4ED6A 4KV8A 5EWGA 1ZTWA 5J1EB 2EBEA 4J9LA 3QIPB 2RQCA 3NNAA 3BF4A 3FFIB 2HHHF 2FUG9 4JI4F 4NZ7A 2QFJA 1SUQB 2GIQA 2EG1A 3P3DA 4AE5A 1AFIA 2BBEA 5L39A 3L3CA 3SI8A 2ADCA 4KKOA 1NO8A 2MPUA 2KU7A 2XGQA 2MHEA 4B17A 4CH0S 1SI9A 3K5MA 1FVQA 1R6YA 2ZOFA 1TL5A 3FRYA 3OFEA 4CQ1A 4RNMA 3J7YI 4ECYA 4WE1B 2B5JB 3LP2A 2E66A 4ZCKA 3LWMA 1P27B 2ZZMA 1SJFA 4OI4A 4YEAA 4UY85 1TFWA 3BSNA 1ZM9A 1U47A 2IVFB 4WFAQ 3S8SA 1BWEA 1KD1T 2BA9A 1FD8A 2PSZA 2AP6A 2FTRA 2YKNA 3UE2A 4YB1P 1VC5A 1NKEA 4GKJF 2UVWA 4C8NA 2CJAA 3RRHA 4EUVA 2FJAB 1N0VC 3CCQS 3PO5A 2YNGB 3MPWA 1DZ5A 2ZH3A 4N47A 1D8ZA 2CJBA 3MAHA 2OMOA 4TY8A 1U6ZA 2KG0A 2AGPA 1RT1A 3K5PA 2AWZA 2ASJA 2DGUA 3T19A 1IJEB 3LALA 4IFYB 4A4JA 2D3OR 4RUCA 5J2MB 2Q3PA 4D3HA 1OPZA 3K5OA 4WCEQ 3J80Y 4YOEA 2MQPA 4F4WA 5CYQB 2DTJA 1UJ6A 3FEZA 4I6AA 2L48A 1VC0A 1WG5A 4UQTA 3DC2A 4DFJA 3RBEA 5KG0A 4HYKA 1FERA 2LMIA 4Y34A 3MR2A 2J9EA 5CA5A 1FESA 1CVJA 1DFDA 1S1UA 1VRUB 4JI8F 3NCQA 1VOMA 3PR4A 3NMAA 2C2EA 4QYZJ 4AL5A 3N28A 3TRGA 5HLFA 3H20A 1SJ3P 4X4SA 3C6TA 2XSJA 3CD5A 3MM5A 2G1DA 4ZP7A 2MB0B 2VG5A 3MZIA 4DLGA 5IFMA 2WRMA 2OFGX 2DNLA 1NK0A 2FHJA 1YVFA 4KGKA 3N9UC 4ZP6A 3I96A 4X4VA 2P9CA 3BREA 1FT8A 2CJQA 2XNRA 4QWEA 3LGMA 4CO2A 3NG8A 5JVGQ 1SKSA 3OQ2A 1D9FA 4I67A 2XG8A 2GJIA 5C24A 3ITHA 3PV8A 2RVJA 3HZEA 4AXIA 3OR1A 3RB4A 2YKPA 2UVVA 3OL6A 2HVZA 1CG2A 2LYVA 4ZK7M 3AJ1A 1T8EA 1JLGB 1XMBA 4USHA 5L1LA 4DFPA 1IBKF 2MKKA 3PY8A 4PUOA 3MOZA 1WI8A 3O6QA 1YJRA 2HGNA 4J9QA 5FDLA 3DXBA 4RZRA 3HVTB 1RT6A 1KLNA 3DRSB 1SV5A 2BQRA 3M4XA 3HZGA 1O51A 1CQMA 1T95A 4WXOA 1G6BA 3CEDA 2VB6A 3H59A 4PG6A 1RYRA 1RT5A 3EXYA 2PT0A 2F40A 2R8KA 4CT9A 3QJLA 1WEZA 1QM9A 1N5TA 3DOLA 3BGFA 2IBKA 3OSNA 1RTDB 2CQGA 1Z1ZA 3GWCA 3I9ZA 2F3JA 1JK9B 2MSSA 2M3DA 4OI6A 2FDNA 3MM7A 5I3UB 2MZRA 4LJMA 4OZNA 4O3OA 4NLOA 4PXBA 2R7WA 4IQMA 2QIFA 2Q79A 1DARA 1N5SA 1N54B 4G1IA 1VQSA 1LK7A 3S7RA 1AFJA 3UDLA 4B3SF 4JI1F 3HO1A 2UUCF 2GHWA 5HI7A 1ZETA 4RW6B 5J2QB 4LIRA 4DQPA 2ZNYA 3M8RA 4NCBA 4FXDA 1FDDA 2OD6A 2PFFB 4B3OA 1TR0A 1E6VB 4P7TA 1ULRA 3DRRA 3VZHA 3CSKA 2MHNA 1RA6A 1B0PA 1RKIA 2JX2A 4JI2F 3Q24A 2DRBA 4QZVB 2OPRB 4WKRA 1RTHA 2MZQA 3TARA 3HKZD 1REVB 1WHXA 1HMVA 3OFGA 1HYSA 2IM1A 2KHCA 1IJFB 4NLRA 2CFXA 3E01A 3S6EA 5KFAA 5DDPC 1X4CA 1K9MT 4ZVFA 1HWLA 3AHPA 4DSKA 1JLQB 1I94F 2Q6CA 2A2CA 1U45A 4ECZA 3HHDA 3KWMA 4IG3B 2YWEA 4ZPWR 2DR8A 2XS5A 1GH8A 1F5BA 3KLEB 2K2PA 1CC7A 1K1SA 1O8BA 2LLZA 3FQLA 4YHHF 4N41A 3GZ7A 5LXYA 4U7UK 3C6UB 3VAIA 3JYTA 2CJKA 3DI6B 2CQ0A 4DQSA 4GKKF 4F4KA 2FLPA 1VBXA 4PQUB 2R8JA 1K0VA 4PWDA 2ACYA 4ZCLA 2CPHA 3DNCA 5GVQA 1PILA 5KG5A 1U1OA 4KHPF 2XS2A 1UVNA 3GFHA 2YNIB 4FBTA 4H4KC 5IXUA 2NZ4A 4CH1A 5L8RC 5GMKa 1NZAA 1X4GA 2MSTA 1WWHA 4ED5A 2WSCC 3ZZUA 3K5NA 4J9RA 2DR7A 2P6TA 4TU8A 4MFBA 3DDKA 2KJWA 1DURA 2MKJA 1S1XA 4Z37A 1S6QB 2QMWA 5E3PA 1UAWA 2Z0GA 3U1NA 3U02A 5AE1A 5LMUF 1RT3B 1X9WA 2PI5A 4ZPCA 2VG7A 4BCAA 4QIEA 3DLKA 2X1AA 4ID5A 3PKMA 2H9ZA 1TQLA 1QAJA 1QAXA 3Q2SC 3SQGA 2LXFA 1VIXA 3RAMA 3BR9A 4A8WA 2DVIA 1GTEA 4HLBA 1JWWA 2WONA 5AXKA 4I6YA 1P6TA 4USIA 3M2RB 4Q44A 1ZM2A 4X4PA 4X4QA 3OJUA 1ZPWX 4DV4F 4KO0B 3PACA 3KLFA 3ONQA 4DLEA 3V4MA 4DL6A 4C11B 5K8PA 1UVMA 1TL1B 4MK9A 2D1CA 2E1RA 2FGCA 3G71S 2RB7A 7FDRA 4DR4F 1FDNA 3KLHA 4MK8A 2V4QA 5HN0A 2B9YA 4WFZA 2KG1A 2QEXS 1NAQA 3I5BA 3OFFA 5IS2A 1MU2A 1HQUA 2B4UA 2W9BA 4O23A 5H1SV 3C46A 5GAGI 1S9FA 2W7AA 4I2QA 1IKYB 4LSLB 2DNHA 1W2BR 5EWEA 2QZ8A 2KI2A 4B08A 4X4UA 1HNXF 1KC8T 3IAS9 1J2VA 1QUVA 4K0KF 4AL6A 1H7XA 1BQXA 2GV1A 2M70A 4URSA 2J0WA 2N3LA 2XWYA 3V6DB 2ZUGA 2ZITA 3CJ2A 3CO9A 5J1EA 4K4TA 3KKFA 4CT8A 1B0VA 5F0UA