1O5JA

Crystal structure of periplasmic divalent cation tolerance protein (tm1056) from thermotoga maritima at 1.95 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
HHHMILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIFKTTEEKEKELYEELRKLHPYETPAIFTLKVENVLTEYMNWLRESVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords periplasmic divalent cation tolerance protein
publication title Crystal structure of Periplasmic divalent cation tolerance protein (TM1056) from Thermotoga maritima at 1.95 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Unknown function
total genus 24
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1o5jA00
2EG2A 3LF0A 1QY7A 2Z0GA 1V9OA 3DFEA 4Y6IA 4C3LA 4OZLA 2ZOMA 1NZAA 2XZWA 2VD3A 4YB7A 4USJC 5DS7A 1V3RA 4CNZA 1GNKA 1V3SA 4RWWA 3TA1A 4CO0A 2XULA 4C3KA 1O5JA 4CO5A 3M05A 2NUUG 1VHFA 2JJ4D 1OSCA 5D4LA 4USIA 2J9CA 4CO3A 1Q1KA 4USHA 4RLEA 3X3UA 4R25A 1KR4A 4CNYA 5D4NA 3AH6A 4RWXA 2J9DE 1V6HA 4WK1A 4YB6A 4ZK7M 3TA2A 3OPKA 4CO2A 3GSDA 3BZQA 4D3HA 2DCLA 3HLUA 2GNKA 3AHPA 2J9EA 3L7PA 1HWUA 5D4PA 4OZJA 3TA0A 5DRKA 2ZFHA 3NCQA 2E66A 4CO1A 2O67A 3NCPA 2NUHA 3CE8A 1H3DA 4CO4A 4OZNA 1VFJA 1NH8A 2EG1A 1PILA 3MHYA 2GW8A 1UMJA 3AA9A 2O66A 3NCRA 1UL3A 2GX8A 2NS1B 3N5BA 4YB5A 4D3GA 4WK3A 3T9ZA 3O8WA 3O5TB 1XK8A 2PIIA 2J9DA 4Y65A 4AFFA 3AA8A 1P1LA 4C3MA 4NYPA 2CZ4A 5L9NA 2RD5C 1UKUA 1J2VA 1NH7A 2V5HG 4RX6A 2XG8A 4E98A 2XBPA 4IYQA 1NAQA 4NYOA 5D4OA 1O51A 1UFLA
chains in the Genus database with same CATH superfamily
4DR7J 2YQ1A 1C4AA 4MKYA 3GFXA 5CXTA 3K59A 2P9CA 4NA2A 1U2FA 4QWDA 4I2PA 5FIIA 4TNOA 2F9JA 4MIBA 3KTQA 2X1AA 3BKFA 2FJEB 1ZA1B 2B5JB 4O44B 3KK2A 1I6JA 1SC3B 1Z1ZA 2BR0A 5KG3A 3M9OB 2ZD1A 1R0AA 5I3UB 2RRNA 3HVRA 2IJFA 5T7LA 4LBHA 5ETSA 4K0KF 2ADBA 4QQBA 2DGOA 4OI1A 1YLXA 2QLWA 3UVJA 3ILJA 1X4EA 3DLKB 4UZBA 2DR5A 5KTQA 2DH9A 2C3YA 3CCWA 4F3MA 4EWTA 3NEKA 1SQFA 4DZ6A 4LVNP 2MKKA 1S0OA 4OV6A 1Q5VA 1FX4A 3SIPB 1KQKA 4MFBB 1RT4A 2LECA 2RILA 1M5HA 4UF4A 1PAUB 1TKXB 3JSRA 1DTQA 2DNHA 2VA2A 2Z2MA 1FTRA 3FMBA 1UW4A 1RKJA 5ETLA 2YWGA 5F3TA 2ZHOA 3MR2A 2R8KA 4ATNA 3N79A 2R7WA 1D8ZA 4OZ5A 3NGSA 2HAFA 1N5SA 2DYAA 1X5TA 3R1LA 2BQUA 3PG9A 2GV1A 4NI2A 1VYAA 4DV4J 3KK2B 3IBFB 4Y2CA 2ASDA 4QWAA 2DISA 2XWYA 1WACA 2ZD1B 2R2RA 3CMAS 3GFYA 5E3AA 1NK6A 2HAIA 1NJYA 5KFMA 1ZPWX 3EWGA 4NXMJ 4A47A 3D6MB 3K5LA 2G0CA 2DVIA 1R8PA 4DSLA 1IBCB 4LMZA 2WB4A 3UVJB 1TL7A 1Y9OA 2XY7A 2HS4A 5IC6B 1NAQA 3DLEB 2ZM6F 3UFCX 4PG5A 5JVGQ 2EVZA 2QL5B 2V34A 3V6KA 1C4CA 2GO8A 1YI2S 1U26A 2IC3A 4QPXA 2Z57B 1X5PA 1IUJA 2CJAA 1FWPA 2KHDA 1NDCA 3MM9B 2PEHA 4UOFA 4CLSA 1QD1A 1RT4B 4DL4A 3K5PA 2CKWA 4LIRA 1N33F 2IVMA 1HNWF 2GIQA 2HNZA 3HZEA 2DCLA 1APSA 2AWZA 3H2LA 1DTQB 2DHHA 3W61A 1NK8A 2N3OA 1R43A 2QL7B 4KGVB 2BZ2A 4F8RA 2DNZA 2ZBPA 4B3RJ 1JLGA 2DEJA 2VOOA 3FQLA 1NO8A 3I96A 2HK2A 5H9EK 1OY9A 3DGPA 1B3TA 4XAKA 2K06A 3Q89A 5KG5A 2RD5C 4M5JA 4IQXA 4X4TA 1UVLA 1K1SA 4HTJA 2PA3A 5IT4A 1H0HB 4DSKA 2NXUA 4JYAF 3JQKA 2KB2A 1VMBA 1SL1A 5H1SV 2U2FA 1TL3B 1OY8A 1TL7B 4J9KA 2LQ9A 5KOWA 2NUUG 3ZZZA 1MU2B 3C6UA 1VLOA 4BC7A 3QT6A 4ANEA 1Q7LB 4FBUA 2IC3B 1S7HA 2Z56B 2K7JA 4L72B 2NZ4A 1IWGA 2FGOA 2BYCA 3ZZYA 5THWA 2MY7A 4B17A 4H4OA 2GQQA 1U09A 1IKWA 2UU9F 1DZ5A 4KGMA 1T3OA 5G0RA 2DHGA 4DQPA 3EGNA 1WSRA 3BBFA 2PO4A 3MEGA 1SJ3P 1Z4UA 2ATCB 3J7YI 3TEGA 1U0SA 5C2CA 1JLGB 3FCHA 1PYOB 3F44A 2CDQA 5GAEI 2YWHA 2C3MA 3CJ8A 1R8AA 2J76E 3ULHA 5LM7E 1B70B 3OTOJ 3RYLA 2NPIA 4X4NA 3DGPB 4KGXB 3W5XA 4ZIWA 4FBTA 2XMAA 1FERA 1QDUB 1RAJA 3G8QA 2V67A 3ILIA 1SKWA 4FF3A 5F8JA 4Q5VA 4IKAA 4USIA 2DRDA 4QU7A 1JXEA 2Z58B 1KR4A 3PNIA 1S1WA 3KHHA 1ZTTA 4DPOA 2J9DE 4BDPA 3M6XA 5CD4H 3DKDA 1U7LA 2AV5A 4OX9F 3AHPA 4ZP9A 1HWUA 3C6UB 2BKOA 1HW9A 1AYEA 2VONA 2C2MB 4V19X 1JLFA 5LJ5Y 1N34F 2M2BA 4WU3A 2QYCA 2V0NA 1P1TA 3ZXWA 2CQ2A 4H4OB 4LRBA 1IKWB 4I64A 1WF0A 2C3UA 1GTHA 4MMOA 2ZBRA 4F04B 4LF9F 2DNQA 4CYUA 1M5PC 2XMJA 4JI7J 5BYQA 2B4OA 2GVZA 1MSWD 4IYQA 3MEGB 4WFYA 2HWIA 3Q2TC 4OYOA 1YX2A 1RUSA 1Y11A 3CCES 4CIOA 3FQKA 1WJ9A 4M8LA 3MDFA 2R3VA 1QVGR 2D7SA 4MKAA 5B0GA 5J2MB 1T3NA 4YR3A 1RHJB 1QUPA 3MUTP 4WE1B 2CQGA 5GAEU 4R25A 3CCZA 4GKKF 4FYXB 1R6VA 4HVZA 4I7FA 3B54A 1V6HA 3DLJA 3A4TA 2WSFC 3SSRA 2Q43A 3DLGA 1AZSA 3W8PA 1S1WB 2DRBA 1BUXA 2V8PA 1IBLJ 5F3ZA 3TI0A 3BGUA 3NGUA 3GYXB 3PY8A 2OI2A 2AIRB 1Z2ZA 2BABA 1RLCL 3OL7A 2ZKTA 2CWKA 1E6YB 3CCQS 1GXTA 4KTQA 2E44A 3BSAA 2VG7B 2K1RA 1T9XA 5KG1A 3PDNA 2LDIA 2IJRA 1OMSA 3HJVA 2DGWA 3R5DA 3D0GE 2JRSA 2CPIA 3EVOA 2GMJA 5M2UA 4CNZA 3UN2A 1TV6A 3TA1A 3Q24A 1YJNS 3PW0A 3IGNA 1N4LA 1QUVA 2Q6BA 1M5OC 4EUVA 2DNPA 4K0KJ 4Q2MA 1N5YA 5HP1A 2WSEC 4IH7A 4LF5J 1UCNA 2F4VF 5CD4A 3GSDA 5K8MA 4O3SA 3ZTSA 1NUEA 1CG2A 3DLHA 1VGYA 3MEKA 2WHOA 4LSLB 3GJQB 1S5ZA 2VBWA 2MZTA 2HGNA 1TMJA 2E66A 4UUWA 5FD1A 1RDRA 4I7FB 2FDNA 4OYPA 2QLFB 3T5LA 4F36A 1RISA 4PKDB 3H59A 4KAIA 4QR0A 1FJCA 4DV7F 1AZSB 3R2CJ 3R5BA 1JQGA 2DGTA 1IKYA 2XMKA 3S01A 1VIOA 2JDJA 1MWYA 1HD1A 1DFDA 1RACB 4PG6A 2BXJA 4X84A 2WONB 3AXKA 2LYVA 1VC5A 3EICA 1F0XA 5FDLA 1U8WA 2K1RB 1MNEA 1RA6A 2HVEA 1GH8A 4C97A 4XDCA 1NPRA 3KHLA 4X64J 2CG4A 2OGUA 2Y8WA 3QWPA 3F73A 5HVFA 2R8IA 2U1AA 3AH6A 2LA6A 4I2QA 1TV6B 4IRKA 4IDKA 3C14A 3HSDA 2GNKA 4H4MA 1FJGF 4M5GA 2HEKA 2H5JB 2CZVC 1RAOA 3M2UB 3IAS9 2W7AA 1N5YB 4WF9Q 5HP1B 3HHNB 1W25A 3K58A 2PA8D 5A76A 3QJPA 4QCLA 4OYAA 3KFWX 1OJ4A 1R0CB 4TLRA 2XYHB 3SSQA 1ITPA 2ZM6J 2YX1A 2ZH2A 4K8RA 2GX8A 1V5VA 4P74A 1SKSA 4IR9A 3P5BP 1JWWA 1R8CA 4ED3A 2YXLA 3U27A 4C8LA 2F1FA 2BOPA 2DKOB 1F60B 2EFPA 3MFIA 4E98A 1HBUA 3R3TA 1WTFA 2UVVA 5A8KA 2FHMA 3AAWB 2UUAF 1IKYB 1AT1B 3HVAA 3MTJA 5CYQA 2FVRA 1HNWJ 2KI2A 5F8GA 2K2PA 5AE1A 2NXJA 4JI8J 3W8GA 3WIUA 4GC6A 1C0UA 4KKOA 2LEAA 5D0RA 4FXWA 1JMTA 4K4UA 1K0TA 4DWIA 1HWLA 2Y1LB 3J80Y 1RAAB 3MMAA 4FNHA 1ZAWA 4JI6F 1I3OB 1PJ7A 1YWXA 1VQYA 3M8QA 1R0BG 4QIVA 5JVHQ 3PW2A 1R27B 4RW9A 3R5GA 2VKZG 3C14B 5A8WA 3N4WA 1U49A 1S10A 4H4MB 2BE2A 4OMFG 2G9OA 4WTOB 2KH9A 1L3TA 4JYAJ 1TTHB 1RWWB 2L48A 2J8SA 3KJNB 4P9SA 3A3OB 4P75A 4IOCQ 2YQ3A 2CAJA 3DRYA 2BKNA 3IXQA 4TY9A 1KEKA 3CEDA 1SBRA 1VRTA 4C3LA 1NBEB 2VH7A 4P2MA 2VPXB 2X3DA 3UDCA 2PGCA 1HBUB 1O5JA 1VHFA 5ETKA 3DU6A 3M7VA 2ERRA 5CYQB 5A6PA 4DR4J 4KT0C 4QWCA 4LF8F 3FEZA 5B0BA 4M5NA 1VRQC 4TU8A 4N5SA 4HL9A 1C0UB 3PVXA 2OFGX 3T5HA 4ZMMA 3MGJA 2DO0A 2RMLA 5L9XA 3D54A 3HHEA 1KC8T 3MMAB 1ZM3A 4Y2KA 2XNQA 4K4TA 2LU1A 2WSCC 2BJ1A 3FUYA 4Z2XA 3MR6A 2IAJB 4U8YA 4RW9B 4UQGA 2K7KA 4B9MA 1AUDA 5A8WB 2E5JA 4Y0FA 3VALA 4YR2A 4IO1A 4A8XA 1H7XA 2VF3A 2VQFJ 3SQOP 1BD6A 3HHLA 4P2XA 3K0JA 4P6QA 2FJDB 4OX9J 5H9FJ 2DO4A 1ZAVA 3EDRB 3MEEA 3DXSX 3FSYA 5GMKa 3MECB 1CQNA 1RGVA 4RKUC 3T6JA 4IRCA 1NRKA 5C7PA 3SSSA 2QFIA 4NA3A 4N8NA 1KVKA 2JL9A 4LF9J 3GYGA 2BE9B 4ZP7A 1VISA 7FDRA 4NZ7A 1VI7A 4KR0B 5ETPA 5IV3A 2HLTA 1LV5A 1UVJA 2VJVA 3ZZUA 1I94J 2MB0B 2QIFA 2HRYA 4O4GA 1YJWS 4DR1J 4C0OC 3QAEA 2DH7A 2IFXA 4ES2A 2YPYA 3MMJA 4NLWA 4QWEA 3LF0A 1CPZA 3EPIA 1HNXF 1RYRA 2GMHA 2FB0A 2FY8A 1N36F 2BANB 4ED4A 2J0WA 4KYZA 4OZ1A 2BVZA 5HN0A 2XGQA 3TZYA 2MGZA 2VKRA 4TY8A 1S12A 1T02A 3LWLA 3LQVA 2D9OA 2WVEA 2PMZD 1HBNB 1RHKB 3MEEB 2NYIA 3CJSA 2QA1A 2JFDA 1PIEA 1HPZA 3CDUA 2HMIA 2OLWA 4DV0J 2QA2A 1OPIA 3NCRA 2R8JA 4TU9A 4D3GA 4RNOA 3T9ZA 3NP5A 1X4CA 2R42A 2KL8A 4G1QB 2EXUA 2G0IA 3CJTA 2D3UA 3R5JB 4DX8H 5KT2A 2KN4A 2KM8C 4O4GB 3QNWB 2EC2A 2WVBA 1B7YB 1W2IA 2Y3YA 3QYYA 2UUCF 2A1BA 2OFHX 3ICLA 3LUYA 2CQDA 2AYEA 2E7XA 3W65A 1RSCA 2I9SA 4NMXA 2AJQA 3UI3A 4AQYF 4HT7A 5AJ3F 1Q8LA 3PFOA 1PCAA 1MMNA 3OV7A 2IDEA 4F3OA 4WJBA 1NEEA 5A6WA 1RZMA 4FVMA 3BGRB 2XMTA 1L3KA 4AUKA 2MGZB 4TY8B 1AB8A 4N76A 5DG9A 3BYPA 1UFWA 4ID8A 1GMWD 2XLKA 1HPZB 2RB7A 3AD8C 4KH1B 1Y00A 1BGXT 4FN5A 3LO3A 4GMKA 3NBPA 1N54B 3GJTB 3KLVA 3W2WA 3S7RA 2I1RA 3VAFA 5D78A 3M2VA 2QA4S 2RU9A 4B08A 1ZZFA 3C15A 4C3KA 2OKQA 1FJGJ 3CO9A 1PSDA 4WKRA 4KIAA 1VJWA 2YNFA 3MEDA 4IRDA 1S0MA 3NRBA 3OPKA 1N6QA 3J80U 3TWZA 4RW4A 4JOUA 1U8SA 4NCAA 1FTCA 3UCGA 3L4BC 2XSJB 2POKA 3KJQB 4ZCIA 1RWMB 2ZE2B 3PXGa 1ULRA 2CQ3A 1WTBA 1GMVA 1JLCB 4B3OA 2Z2ZA 1UL3A 2DRAA 3SYZA 2V4RA 3D1OA 3P49B 3M8SA 3AD9C 3UCUP 4F67A 4ECWA 2G1HA 1S1VA 4C0BA 1RWXB 3RRHA 4DV3F 9ATCB 1NXIA 4EEYA 2WW8A 2V2KA 4U7UD 3JSBA 1RK8A 3DFEA 2ZH7A 2ALZA 2G13A 4P72A 1YGYA 1WC3A 2FZKB 3K5OA 3QLHA 3THPA 1VQ4S 5AXNA 3GJSB 3DRRA 3NBPB 1I5OB 4JI6J 3G6VA 2R2UA 3W2WB 2H1YA 2CDRB 3OBIA 4C6AA 1HNIA 5D0HA 3C15B 2QN6B 3AOAA 2KG1A 4RNNA 1Q8BA 1YTYA 1DTTB 1B0TA 3H40A 2MQPA 5HL7Q 1ZTWA 3IFEA 3GV8B 1N6QB 5K9FA 3M8PA 5J2QB 3GFZA 3MMBA 4RW4B 2O66A 3OFEA 2W4PA 3AFGA 2HVZA 4TYBA 1ACMB 2JSXA 3TW0A 3O1LA 4WU2A 4CLTA 1H2VZ 3S1TA 1U4BA 2QSFA 2OMOA 1QAIA 1TP7A 3KLGA 3Q2SC 1DLOA 3CC7S 1VQ9S 4LF8J 4OZ2A 4JI5F 1S7IA 1SV5A 2CQBA 4N56A 1KWMA 1S1VB 1X7VA 2CWXA 4PUOA 3A1YG 2PDAA 1TK5A 1LFWA 3Q8QB 2FD2A 2XHCA 4USVA 2EKNA 2YTCA 2PC6A 4RLEA 3ET6B 1UEUA 1YK9A 5L1IA 2ALYB 2MZ1A 3CWJA 4M5DA 3EE3A 4DS5A 3OR1A 3K5MA 3C19A 3VGVA 3BZQA 2R9LA 2AX0A 2NREA 3L09A 4JV0A 2CNLB 1KBRA 2YNIA 5HQMA 4KO0A 1BWEA 2AT1B 1HNIB 4KE5A 3CDEA 3ZNJ1 1JNZB 4MAKA 4PXDA 1IXKA 3G8TA 4J9VA 3NGKA 3W62A 1WWHA 5CYMB 4CQ1A 3M8RA 3WX8A 1GQEA 5BJRA 1VQ5S 3U1MA 4BWJA 4CLZA 3MMBB 1EETA 4DCJB 3MOZA 1GK8A 5KFCA 5J1PA 3BV8A 2XNRA 3MD3A 2FJBB 1XIQA 2QMWA 1WEZA 2CJQA 3BPSP 5IV4A 2Y1JA 1KNZA 1ZM4A 1G4CA 3RW7A 4OJHA 1TL1A 2GIRA 3TX0A 4BBYA 2CQ4A 1DLOB 5F8MA 4ZPVR 4K4SA 1UPPA 4I6YA 3GE9A 2J6UA 1NJZA 1SV5B 1FJ7A 4XTTA 2DCUB 2EFVA 4PUOB 2HSEB 4D3HA 2J9EA 4J5OA 1C0TA 1RT3A 4WFBQ 1TKTA 4M5DB 2DEIA 1LXNA 3OR1B 2R2SA 2ZNZA 3ZZPA 4DPTA 4RW6B 5GAHI 4P71A 2C2KB 1RT2A 1NSKL 2LCWA 4X4OA 1HNXJ 4GKJF 2B56A 2MYFA 2YNIB 1VCTA 4KO0B 3H2VE 2B9XA 2BMBA 2L9NA 4OV1A 1KHWA 2R7OA 1T9YA 1Y5IB 1WDDA 3JXOA 2XMVA 3IR7B 3PW7A 3I4PA 4DR5F 3LALA 2FZGB 2LQ8A 1V9OA 2DIUA 3OVSA 3I87A 4USWA 4FVCA 3WC0A 4LVOP 2XZWA 3CNQP 4YB7A 2MTLA 4HDGA 1GX6A 4E0DA 1SL0A 4DDFA 4L3KA 1K73T 1EETB 3KLIB 2B4PA 1FWLA 4USHA 5KFTA 4YMEA 2V4QA 4WYLA 5F41A 3D3BJ 4HI1A 4MTPA 1RT1A 4B9TA 3PHTA 1T8EA 2UVUA 2DY9A 3EDQB 4ZPAA 1VQSA 2PFFB 4LUBA 4I56A 5IWAJ 3UE2A 1V5IB 3VAGA 3IRXA 2R7VA 2EG1A 2MHNA 1WC5A 1JB0C 3IWXA 1C0TB 2XGPA 3BSNA 2JNJA 1JLAA 1SKUB 3R97A 2DXFA 1RTJA 3BKTA 2XY5A 4NLXA 1XR5A 4J9SA 1X9SA 5KFSA 3IBCB 2DGVA 3SCJE 5IOLA 1LWXA 5KFWA 2NYHA 3HFVA 3NGRA 3AJDA 4NYOA 3RBXA 3RAQA 2C3OA 4NLRA 2KDOA 1ZBTA 3NG8A 3D6TB 3GIRA 3ZZRA 5DLGA 3OFHA 3TAMA 3JYTA 4OHYA 3ZTQA 5HQ8A 2UXBJ 2XEXA 4FXDA 4WKYA 3U1LA 1RHMB 2PN6A 4U67Q 2M5YA 1PKUA 2UZAA 4W92B 1WUUA 2MLYA 5KOXA 4DF8A 1Q79A 3Q8RB 1S99A 2V9WA 3DCAA 3CJRA 4UT4A 2G1DA 5DRKA 3CJ3A 3LP0B 3KK3A 4WYWA 2ZUAA 1HNZF 4IR1A 1N32F 1D9FA 4Q2LA 3B78A 1RT1B 1RU1A 1UWBB 2GHVC 3O5TB 1RA7A 3IS9B 1Y0HA 3SXLA 3T9NA 4ZPTR 3JSYA 1RBAA 4RR5A 1HI0P 4EGLA 3ELHA 2F5GA 3VVUA 1RTJB 2K8GA 4LFBF 1MW7A 4L6V3 4DV6J 2YKNB 2PD1A 1MROB 2R2TA 3EXYA 1OQ6A 2MMYA 1BMQB 1EP4B 1NB7A 1ZETA 2GGPB 3MPVA 3FDSA 1X8DA 4DU8A 2F63A 3QO9A 5LXRA 3GPAA 2C22A 1M1GA 3JYTB 3V4IA 1RT5A 4DV1J 2IA0A 9RUBA 1CJUA 3KKFA 4IH5A 4I67A 1VLYA 2UXDJ 3PEHA 1M5SA 2IRYA 5I3PA 5ADZA 4B9NA 2P5VA 2VPYB 2OD6A 4DR6J 3IR6B 2VC0A 2A6MA 3BBBA 3W2VA 3HT3A 2HNDA 1EKRA 2CQIA 3TJ8A 4GRSA 4EK2A 2P6TA 4F4YA 2JLFA 3OL6A 1P8GA 2YH1A 2ZZMA 4U8VA 1MMDA 5MAOA 1N56A 3MAQA 1PJ6A 2HBYB 4Y6IA 5KFAA 4LSNA 3SCKE 2YKQA 1V3SA 2WVDA 1WNEA 3M05A 1KLMB 2HZCA 1U47A 1Q1KA 4JV1A 3F56A 2PE8A 2VASA 3CT9A 3BDEA 1D0EA 3AJ1A 5CZXA 3BM7A 2HZAA 4B3TJ 2L41A 1JXVA 1RKIA 1WG1A 3QO9B 2OPRB 1T9VA 3TO8A 3T41A 3DN9A 1RT5B 3DOKA 4RNHA 2CPEA 2M0GB 1WHWA 3MPDA 3PR5B 3KOAA 1RYSA 3Q8SB 1U1QA 2ZC3A 3E01A 1HBMB 4NYPA 3LAKA 2WB1D 1H73A 3DOLB 4DPWA 1CBKA 2W7PA 2I38A 5K8OA 2HVIA 3PO5A 3W2VB 2B7BB 3AB2B 3KHRA 2KT2A 3FSIA 4ELTA 1BE4A 2HW3A 1DQAA 2R7UA 3FCVA 1UTAA 2Q79A 1NK5A 4CT8A 2ZBCA 2W8KA 2W2QP 4ZHRA 1UJ4A 1UEVA 5GADU 3OL8A 4IG0A 3TOQA 5KT6A 2ZHBA 5E3QA 1Q95G 4LSNB 2YKPA 4F4AA 3B6BA 3PRBA 1ROFA 2CJBA 5KG0A 1UZDA 4EZ9A 1JJCB 4H54A 4P7TA 1NHUA 3A8KA 2R7XA 1MLAA 2ZFHA 1IBMF 3GV7B 2B9WA 1R7IA 2EBGA 1S9FA 1S1TB 2BJDA 2KZZA 3PJ9A 2KYXA 1S6QA 2PEBA 4H4KC 2BE7D 4KV8A 2A3JA 3MPUB 2ZITA 3C16A 2VZ9A 1XR7A 4DI6A 1IVZA 4ICLA 2JEJA 3W66A 3M6UA 3MM5A 1UP1A 1FKPA 1UJ6A 3E01B 4B3MF 1ZH5A 1YJUA 4DUZJ 1HR0F 2QV6A 2V68A 3LW5C 1SQEA 2I8EA 1S4EA 4HH1A 3CCJS 4MT1A 3RBEA 5D4LA 2VOPA 4ES1A 2OIHA 2XQCA 4ZJOA 3E8OA 2OPPA 5DO2A 3PIPQ 3ETOA 4DX5A 7FD1A 1X4DA 1UEKA 4UW2A 2D9PA 4IG0B 3MXHP 1A0OB 3F0NA 3KWMA 1QE1A 4YDXA 3D67A 2XSFA 4ZN3A 4Q0BA 4EBDA 4DV2F 2GHPA 4J90A 4KHPJ 1BHNA 1X4GA 3DU5A 4PXBA 3RW6A 4TQSA 3R1HA 4TN2A 4F25A 3EPGA 3QGHA 1SH0A 1CULB 2C2EA 4PABA 3UR3C 2CJKA 1KOHA 2QFJA 1H2UX 3MCOA 4WZMA 4NLUA 2G0JA 2JZ5A 1N8RT 3KMQA 1FNXH 1YRTA 1S9EA 2C2OB 4OYWA 2MJNA 3ILLA 1C1BA 4KV8B 3SFGA 3CCRS 3GYNA 4WTYA 2H5IB 2LDYA 1LEOA 4OHZA 4GO7X 5KFOA 3OJUA 2FUG9 4EO6A 1WOPA 4DSFA 2F8EX 3MPYA 4QR2A 1TK8A 2KU7A 3CJQA 1SUQA 3ILOA 1WKJA 4UOGA 1T05B 2DIVA 3QGGA 4RUCA 3HHKA 4NRUA 3QSYB 3J81j 5J2NA 1V3ZA 3LP2B 3KK1A 3TYTA 2QLJB 1OQ3A 1JKHB 1B99A 4QBUA 1G1XA 1UZHA 2BM1A 4OYXA 5HLFA 2VBZA 5L1LA 2MHEA 2VFVA 2GQCA 2A2DA 3QMQA 3QT5A 4LRCA 5KG4A 4AFFA 1F2HA 2XZTB 5HMXA 1WKKA 2RJZA 2RDDA 3CSKA 2EEYA 4JI4J 4CRJA 1SJ1A 2MQOA 4JI1J 3C6TA 5AXLA 1UVKA 3HD2A 3ZZ0A 1UETA 3WC2A 1X4FA 1S0NA 2GHWA 1TL5A 2XS5A 1FDBA 5L8RC 4PXEA 1S0VA 5LMUF 1S1UB 2H9ZA 4LIWA 1C1BB 3JTNA 5D6GA 4TLQA 1ZS6A 4JUZA 2HHTA 3JSMB 4KY3A 3PJXA 4ZS6A 4YOEA 1S77D 1HNZJ 1AA1B 2ZH9A 3MCNA 3N01A 1N32J 3QFWA 2HHHJ 1UJ5A 4X65F 3QRRA 2IPOB 5A8RA 2QL9B 3TVZA 1SUQB 3L7OA 3W7BA 3T1HF 3T1AA 4J9NA 1YRXA 2XCPA 4JP8A 5J2NB 1IBKJ 2B6AA 3M8WA 2IRUA 2OP5A 2YKMB 1WC6A 2PI5A 2YBVA 1VOMA 3T6BA 3AA9A 3NLCA 4ZVUB 4P10A 1SJFA 3V81B 1TFWA 3EZUA 3QQCD 3LWMA 1SPBP 4J9LA 3QT8A 4KHRA 2GAHC 3TUPA 2NXNA 1FRLA 5HLFB 6AT1B 4IFYB 3G6XA 4M5LA 4P2FA 4U9RA 1XNRJ 4RBVA 5J2PA 2FVCA 2HVHA 3MUVP 4FXVA 5EDWA 1VBZA 2OJ3A 3MCSA 1YITS 4OLOA 3C6TB 3FJ2A 4K5SA 1VRUA 4IG3A 3VZHA 5BR8F 2QE5A 4UY85 4LF7F 1K8AT 2CJYB 3GR1A 2FY1A 2RHQB 1FCAA 2PFDA 1Y5LB 5B0FA 4DX6A 4WP3A 3FNNA 3GZ7A 2VV5A 4J9OA 4PG7A 4PXCA 4DL0C 5EX0A 4NPOA 1RWOB 5A8RB 1KS2A 4OL8A 2AJ0A 3BQ0A 4O0IA 3GWCA 3W9JA 1AFIA 2PI4A 4F02A 5DM7Q 2VIHA 5DJBA 4X4RA 3VGTA 3BR8A 4YP3A 3R8YA 4ER8A 2DHSA 2YH0A 5I3QA 3PACA 2O5DA 1IKXA 4TKTA 2YKOA 3GJRB 1FRXA 4DXLA 4DQIA 1Q5YA 2JEGA 2QA4G 4M5KA 4MJKA 2MLZA 3DLKA 1RT6A 4ILRA 3MWBA 2KO1A 2J7KA 3W9HA 1XMQF 2L08A 4C8NA 4WK1A 4YB6A 4IUFA 3D9BA 4OI4A 1VRUB 4IG3B 1RWVB 1KFSA 1VBYA 4KRWA 5L38A 4MFBA 1VQLS 1XTZA 3OD2A 3QZ7A 1RP5A 2VPWB 4U95A 4B3SF 2OTLS 1TKXA 1XNQJ 2ZH8A 4ZPWR 1PJ5A 5HSPA 2LFVA 3M1VA 3GR0A 3US5A 1ZA2B 2XTJP 3I5BA 2N4DA 2CPXA 2ROGA 3KNGA 3R7SB 4ECYA 3HVTB 4Q8FA 1RWUA 3I82A 2KT3A 1L3VA 2R7TA 5E33A 1DJ0A 5ETVA 4LR8A 2OSQA 2WAQD 4G6VB 4NRTA 2BQ3A 1DHMA 1N52B 2FIUA 2JWNA 4IO9Q 2RRAA 1VC6A 2IYGA 3IM8A 1Q7YT 4BS2A 4QW9A 1WOSA 2ZDPA 4X4SA 1SL2A 3JB9k 2B43A 1IKXB 1W26A 1UVMA 3G4SS 1TUVA 3HSZA 2ZKUA 2KTQA 4Q43A 1LKZA 2KJVA 5KG7A 1RT6B 3J7A1 2BX6A 3DLEA 3VVTA 3G86A 2XWXA 1MG7A 2J6TA 1S49A 2ILYA 3EZOA 2D3OR 4Y2AA 2WRMA 4C8KA 3ENWA 3MM9A 3C3LA 2YQ0A 3NWGA 5LSOA 2XMMA 2HK3A 4B3MJ 1AROP 3H5SA 1DARA 3ZC4A 3R6GB 4QYZK 3UW1A 4QR1A 2DGQA 5LSRA 1SQGA 2NCKL 3M1VB 1LWFA 1RTIA 1CVJA 2F7VA 2YPZA 4K59A 1WDTA 2HVDA 2G2ZA 1LOUA 3I6PA 4ILMA 2O01C 1QLNA 3IRWP 1VQ8S 5HQLA 4EYHB 1L3SA 2ROPA 2A6OA 2MLXA 1IQTA 1TR0A 3HKZD 1G6BA 2G2YA 2E5LJ 4N77A 3N9UC 1JJ4A 1EHWA 1M5KC 4OX6A 2DNGA 3THTA 3V2UC 1RU2A 3HULA 4FP9A 1S79A 3AJ2A 3EYZA 3CO0P 2VBXA 3KUHA 1TL3A 3C66A 2D41A 3ISNC 3WIVA 1QAJA 2NS1B 5HVHA 1MU2A 2V63A 1B0VA 3PYEA 2QYGA 4Y00A 2RSQA 2V8GA 3I9ZA 2M52A 2UUBJ 3QWUA 5L1JA 5F9LA 1FKAF 1DURA 2LP4A 5K14B 5IS2A 5AT1B 4G3IA 5DQIA 4USMA 2QMXA 5AXMA 2J5AA 2ATLA 2UUTA 4WXWA 1KFDA 3BO4A 3SCIE 3GFHA 2HQGA 4ED5A 1FRIA 3FBEA 4LF6J 1LWFB 1RTIB 5GMEA 3JAMY 4X62J 2KM8B 3IM9A 2H51B 4WIQA 3BGLA 3NMAA 4DHVA 3A3NB 2HQ3A 3CCTA 4IH6A 1NCLA 5LL6d 4PG4A 2VA3A 1HQEB 1SC1B 1F9HA 5L39A 2HFUA 4ECZA 5AXKA 3CUNA 4LFAF 2MKYA 1U1RA 1FEEA 2ZHAA 2AKWB 2HFVA 2FHJD 4OHXA 1EARA 2VC1A 1XJWB 3TEHB 1NPKA 4EI2A 3GG0A 3TJAA 4ERDA 2M9KA 1J5OA 4ITSA 1RJJA 4WK3A 4JI2F 3PKMA 4KPYA 3ENQA 5LMUJ 4B9LA 4DLEA 1UKUA 2RIJA 4CDIA 2XG8A 1QVFR 1MMLA 4O4RA 1NNDA 1WEYA 4UTGA 3E51A 3N5FA 1GAOA 3EX7B 2GQ2A 1X9MA 5ETQA 3A8IA 3FFIA 3PZPA 1D1UA 1RWKB 3HO1A 1RABB 1XMBA 2HHUA 2CVIA 2ZOGA 4EMDA 1REVB 4AXJA 3LGHA 4HDHA 4PPDA 3RG6A 2EKYA 2QTWA 4Y3CA 4RUBA 1ZM2A 4WFXA 1RHQB 4DPXA 5L46A 2N7YA 3P4UB 3CD0A 2FJXA 3CPWR 2HRUA 1YBUA 4R5PA 3R2DJ 1HQ2A 4EZ6A 1Q78A 2JOQA 2J8AA 1TZ0A 1VDHA 2MQLA 4ECSA 2BJ3A 2OMLA 3HT0A 5J2MA 4MYTA 4A8MP 4AXIA 3TNVA 4WE1A 5RUBA 1RTDA 1HYSB 2LXIA 4Y34A 4K7QA 4LREA 5HJXA 4LFCJ 1J5OB 4OJ3A 1U6BA 4ES3A 2E5IA 2F4FA 3GG1A 2E1RA 3DC2A 1NU4A 3DRSB 2XMUA 2JLEA 1HNVB 2QX0A 1R8HA 3JQMA 4LF7J 1FDAA 2M8DB 4L74A 2X7IA 3QGPA 3HKWA 2HWHA 2Z30B 3TUJC 3THVA 3M8YA 5IQ6A 1EJ7L 4DQSA 1KHVA 1FFSB 1HWJA 2GVDA 3KXDA 1E6YA 4Z7CA 3I0RB 1FI4A 1WG5A 1S97A 3FFIB 2VG7A 4ZN1A 1NKEA 3I0SB 4CLFA 4LF1A 2C2RA 2A18A 5B0EA 1T7PA 2IBKA 1FJEB 3AOBA 1PYSB 2ACYA 1FVQA 2Q1LA 2XCAA 2MPUA 2P6SA 4DR7F 1N0UA 1VFJA 1R6YA 4R8UB 2V69A 5MLCV 4R5PB 2AHOB 2CPDA 4G1PA 4ELVA 1WI8A 3MTKA 3Q8UA 2X1FA 4A46A 4U7CA 2GAGC 1FXDA 4CCHA 4MIAA 1F9FA 3IO1A 4O3NA 3UN5A 1LW2B 2CNNB 4NXNJ 4FF1A 1NB2A 4LSLA 3BBCA 1KONA 1RTDB 5JMNA 5I42B 1T11A 2CPZA 4L3NA 4FYWB 4X4UA 3DYAA 5E3RA 4CP5A 1OSCA 4HHHA 1DAXA 2DBBA 4O23A 1YRUA 1KLNA 5KT3A 2XM3A 2KKHA 5HVGA 3KG1A 2QLBB 3CIZA 4NCBA 4K4YA 3QRQA 4YFUA 3GCXP 2FJAB 2GJIA 3TVYA 2DT9A 2CQCA 4DL6A 2WONA 2GVDB 1P27B 4ECXA 3B4MA 5K8PA 3QATA 5CYJA 2HHSA 1SH2A 2DGSA 5E0OA 1RXOB 4J7CA 3T3FA 1KQGB 2DXEA 3NNCA 5B0CA 2DTJA 3D66A 5GVQA 3MPWA 1FWKA 5DDRC 4HHJA 2J9DA 4NX9A 2FVPA 2OD4A 1SCJB 3CD5A 4PQUB 3KLHA 3D6FB 3O3LA 5LMNF 4ECTA 2VG5A 4DUTA 2CXEA 3M2UA 4DV5F 4OX7A 3A12A 4DPUA 1FRJA 1V3RA 3HM9A 2V2VA 4DV4F 4ECRA 3TUIC 1ZPVA 2CJXB 4OYZA 1FEHA 1O6XA 1U2CA 4ECUA 5DETA 2D1CA 2FLLA 5HO4A 4NXMF 2MZSA 1R3NA 2YWEA 3DYAB 5C25A 1AXQA 2WVFA 4FS2A 3CF5Q 1WOOA 4N41A 4YQWA 2H3EB 3FC9A 3LANA 3W3SA 3B82A 2HFSA 2QT7A 4RW8B 1ELOA 1NK0A 3C8YA 2ZH1A 1QSLA 4DPYA 4ZPCA 1LWEA 4PPZA 1X5OA 2MKSA 1SKRA 1X4HA 3MMCB 4OHVA 3J81U 4EBCA 5BYSA 4ZVTB 4ED2A 3M32A 5G4DA 5HMZA 1J5EF 1NSAA 3KUEA 1JLQB 3G6YA 1T03A 3HZGA 3MM6A 4ZVPB 4BC9A 5K20B 3DDKA 4XDDA 3PCOB 2EFOA 2RHSB 2YX4A 4B3RF 2AEJA 3VAHA 3KLHB 2GO9A 4NWBA 4B02A 4YEAA 3D1HA 2XULA 2DXDA 2DNYA 1JLBA 2I5JA 2RKIA 2VG5B 4UUXA 2ZBQA 4OYIA 3JAMU 1YSJA 3W1YC 1P9QC 3HK2A 4W90B 3U02A 4ETXA 2XS7A 2COLA 3CJ0A 4RUAA 2AX1A 3CD6S 3S8SA 1RADB 3SV3A 3HLUA 3P6YC 3SMZA 2R8GA 5K5MA 3D3CJ 4DSIA 1TVRA 3B4DA 5C25B 3TVKA 1Z2LA 2SXLA 3F41A 3M2RA 2GCFA 3DXBA 1D3WA 4ZP6A 3RAMA 1LWEB 4C8MA 4C98A 1P1LA 2FHJA 1N33J 4C3MA 3R7NB 2H48B 1RE1B 1URRA 3DMJB 2D3O1 5DLFA 3GONA 2BRKA 1O8BA 1HKAA 3M32B 2AJ1A 2FVSA 3KUGA 2KRRA 1NDKA 3FVYA 4L75A 1BQMA 3GSIA 1T03B 3MM6B 4YY3F 3R6LB 8AT1B 2IAJA 3OTEA 3MURP 2JEIA 3ZTOA 2AF6A 2QZ8A 2PMHA 1JLBB 2I5JB 2RKIB 2OO4A 2UVRA 2V4JA 3I32A 4WCEQ 2G2OA 3OTCA 4N47A 3N6NA 3RB6A 2VB6A 1SIWB 1K1QA 3FEXB 3H98A 5IM0B 3KMSA 4NOHA 1VQOS 4GC7A 1BXNA 4F4ZA 2BV3A 3CTRA 1TVRB 3PIOQ 4PG8A 3MECA 4NEZA 4F4KA 3HSJA 4JB8B 1HIYA 4HYKA 2NQPA 3M2RB 2MKIA 2PT0A 2YNHA 3LTOA 3G8SA 2UU9J 4LBPA 2XI3A 3DRPA 1U6FA 2AJ4A 3FKBA 2F9DA 2JVOA 3ZTRA 2KRBA 1NMEB 3H8YA 2P9GA 4RBTA 4K2XA 3K7RA 2KJWA 1HHSA 1U24A 2RUGA 2Q66A 3JQJA 1BQMB 3TUZC 4NLYA 1S1XB 1G3OA 2ILZA 3H20A 3NXZA 4OLPA 4X66F 1PYTA 3DNCA 4M5MA 2Y1IA 1I1GA 2BKPA 4DN0A 4CO4A 2XI2A 4OFZA 2B8QA 5IZHA 2XHWA 4ED7A 3HF5A 3NWRA 4ZKAA 3PTWA 4FYYB 2HHVA 2V4JB 1CS4A 3SEOA 2BANA 4AYBD 4JI0F 2W4DA 3QFHA 4IFVA 4RBUA 1B7FA 4C7QA 2ZH3A 3Q8VA 1CJKB 3FZBA 5L9NA 5GAGU 1OYDA 1KVIA 3RR8A 8ATCB 1QY7A 1HBNA 5EN1A 1B0PA 1N34J 1TELA 4DCOB 2VD3A 3CCVS 4Q8EA 2XLJA 3AB4B 1H38A 2X1GA 5CCLA 4QWBA 2DNNA 2YNHB 5FLXY 2F3JA 1H72C 3U7JA 4YR0A 1Q16B 2RF2B 2IVFB 2LMIA 3DRPB 2NPFA 2W7OA 4G1QA 3RB4A 1D8YA 4KSEB 2HNYB 2LEPA 3QGIA 2XYGB 2LLZA 4OZJA 2FYXA 3BS9A 2NR0A 2EFNA 3NCQA 1S6PA 3FSXA 3QT7A 2CADA 2OH2A 3OJSA 2B7CB 4ED0A 1GMUA 1YBTA 2VJUA 3BN7A 1FKOA 1T9WA 3SDEA 4GKKJ 1VK3A 1XK8A 3OXFA 3CD7A 3SI8A 2FJVA 1U2RA 1K47A 4H4KA 4LF5F 2HPUA 5FJ4A 1QTMA 1CS4B 3RRGA 3AD7C 1HA1A 1FA0A 4IFVB 2DITA 3EGZA 4ZVHA 3BGRA 1TL4A 2KHCA 2HQIA 4BHQA 4ZVEA 3SQGB 4CO5A 5LXYA 2FHOB 4RNFA 3KHGA 4NYZA 1VR6A 3BKUA 4RUHA 1VHIA 1LQ9A 1M1KT 4XPEA 1DRZA 2HS3A 1T95A 1RTHA 2CQHA 4W98A 2IY5B 1YVFA 3DHXA 4USKA 2ACMA 4OQJA 5IXUA 1FXLA 4QIWD 4NZ6A 4MK7A 4V1Ak 5LMNJ 2RS8A 4LRDA 2XC9A 2VDHA 1RWNB 4I2PB 5F8NA 4KHMA 3IWNC 4X64F 4YB5A 2MZRA 2GFFA 1IR0A 1S6PB 4I68A 3JS9A 4DV5J 2E1CA 2BJ7A 2F4VJ 2B51A 4A8KA 1NH7A 4DLGA 2DR9A 4I6WA 1NSQA 4CH1A 1FKOB 3SDEB 1R0AB 5AE3A 1NJXA 2DB1A 5T7LB 3MCMA 2XSJA 3ZNUA 3BO3A 5LJ3Y 3PRDA 2MQ8A 2ZOMA 2ZE2A 2LEBA 3G96A 4USJC 3VCDA 4DR2F 3H4DA 3I31A 4OX8A 4DV7J 2FHKA 4NCGA 1JLCA 1L5UA 1FNMA 5E5NA 4O0NA 2YWKA 3D68A 5KFEA 3VQTA 3IBWA 4LQ9A 3TA2A 3BREA 3H25A 1RT7A 2KFZA 5F8HA 5D4PA 2ZOFA 2EK1A 2DD8S 2M3DA 3ISND 5HATA 4AL7A 2JH3A 2PMWA 1J5EJ 4OI2A 3H42A 4YS2A 1RTHB 2MQMA 2CYYA 2RQ4A 2GW8A 3IC1A 1OPZA 3KLEA 1KN6A 4JI8F 2C2NA 4F7VA 3NKYA 4KH0B 5CH7B 2E29A 2B9EA 5B0DA 4ZIVA 2RDIA 1TU0B 4HACA 3R27A 2IIHA 3UDEA 3UD3P 4C8YA 4J91A 4Y2IA 3Q8PB 3P8BB 1QTNB 4OZ3A 1A6LA 1XR6A 4PEOA 4FF4A 3UWTA 1PO6A 1FRKA 1DTTA 4NI2B 2CUYA 3OFFA 3TARA 3CVKA 4DEZA 2DR8A 2CPYA 2JC1A 3CCLS 2LXUA 1VK8A 2P9EA 1GFWB 5J2QA 3LGNA 4CZCA 2EC0A 3X3UA 3VAMA 4QYZJ 3D7SB 2CQPA 1S59A 4NCGB 5KFKA 5DQHA 3A8JA 2F65A 4DMZA 2UUAJ 5B7WA 1HHQA 3MAHA 1I51B 1YZ7A 1FD8A 3IA0A 4UOCA 2NSBA 1RT7B 2BUNA 4ANCA 5HJYA 1UMJA 3X1LB 3I55S 1ZOTA 1VQ6S 4ED1A 3ET6A 4URGA 3BH7B 2K3KA 3OSPA 4DR4F 3UO0A 2CNOB 2HNZB 2VG6A 2XBPA 5DZ6A 3KLEB 2ZBIA 4YY3J 2V8DA 4NZ0A 5KFGA 5KFUA 1IR1A 3DRXA 2R7RA 2XZDB 1QAXA 1KQSR 4HACB 2UUWA 4KB7A 1E6VA 3ITHA 2GJFA 2HRTA 3GIIA 5KFZA 5F0UA 2OPQA 2C28A 2KZMA 5F0WA 3MFHA 2FLNA 1IR2A 2GS8A 4K50A 5CYMA 4M95A 4PCQA 2DHAA 2CVEA 1ZAXA 2RE1A 3CC2S 1X60A 3TZXA 3V4MA 4G65A 2CPFA 2WBMA 3FBCA 4UQTA 1T94A 2GIFA 2W25A 3PV8A 4R0EA 5HBMA 2VQFF 4HEA9 2QMUB 1RWPB 3BO2A 1XERA 4EBEA 1IKVA 2W01A 4BWMA 3G9CA 3Q86A 2AW0A 1T9UA 4O3PA 3UDVA 3MI7X 3BSCA 2EBEA 3TQ1A 1SJRA 2J0XA 5H9EJ 2UXCF 3K8WA 2EG2A 1LWCA 1QSYA 4WBFA 2JX2A 1HWIA 3HHLD 5G0RB 4I6AA 3BJYA 2VG6B 4RW6A 3QRPA 4Z7YA 2HG4A 4FPRA 1CC7A 2Y1RI 5FLXU 4X66J 4OI0A 5CA5A 4OYBA 3W64A 1CJVA 1I94F 3OQ2A 2JFKA 4QJVA 2W9BA 1P9YA 4DR1F 2F8MA 1Q8KA 1G7CB 4XK8C 1E6VB 3ITHB 3J7YU 3L7PA 1Q4RA 2OPQB 3KJVA 4ZLJA 1U0HA 4JI0J 3R7BB 4AD6A 1S6UA 4J9PA 3PX0A 5IFMA 4OZNA 3L3CA 1QM9A 1FE4A 1NDPA 5A0YA 2KG0A 2M88A 3KLIA 3I5CA 4KQZA 5HBMB 4ZVOB 3MAAA 1ZYQA 6FD1A 2RVJA 1FRHA 3HI9A 4C8ZA 3ENAA 1IKVB 3AQPA 3TX8A 3BQ1A 3TZZA 2YVSA 3QJLA 2X3GA 3EZ5A 2XS2A 4GO5X 3PYGA 1F5AA 1JLFB 2AYGA 2C2DA 4K2JA 3IR5B 3J7AN 4PWWA 3QSIA 2DR6A 2CIMA 4ZVSB 4AL5A 2W2OP 3Q8YA 3PYDA 2OTJS 4DV0F 1LWCB 3HMJG 4NA1A 3RJMB 4E2FB 5EWFA 2GJ2A 1RTZA 7AT1B 2XO6A 2BEFA 4CYUB 1M1HA 4YHHF 1HL6A 3Q22A 2JVRA 4ZVGA 1D9AA 2GVZB 4WXOA 2DNOA 1UVIA 5DDPC 1KVJA 2ZEJA 2AP6A 2FGCA 1CJVB 2V2ZA 2W9BB 1GEHA 3NCPA 4P73A 3K17A 2RQKA 3HVWA 3UD5A 3LPYA 1N36J 1Q53A 5CAAA 3KJVB 1TUWA 1U0HB 1Q82T 1B64A 1PAEX 1S9GA 4XPCA 3M9MB 3IWLA 3SCLE 4G1IA 2ZC4A 1HI1A 1KTVA 2E1PA 3HXMA 4RX6A 4K4VA 5A0YB 3T1YF 1CSJA 4Q45A 4CM2A 4TXSA 2LA4A 3VWSA 1IN0A 3DLGB 1BC6A 3SFUA 3LP0A 3MAAB 1SC4B 3QIDA 2QLXA 1GNKA 2R7QA 4F3QA 4FS1A 3EMTA 3M30A 4DU7A 4J9RA 1X5SA 4K4ZA 1UWBA 5K8NA 4LF4F 3IS9A 2KXFA 1LFPA 2X51A 1IQZA 4WP9A 2VQEF 5DZ7A 2Z2YB 3PO4A 3TP2A 2IA6A 2L9DA 1N0VC 3OTBA 3D5MA 3OXGA 2YKNA 3QAUA 1MROA 2E7VA 1FFGB 4KPCA 2UUCJ 5HMWA 4JV2A 5EUHA 1TKZA 2AEMA 1EP4A 1IJEB 4TQRA 1MN9A 4FYVB 3RZAA 3PR4A 2GGPA 4C8OA 2HQDA 2HHXA 3LAMA 1GMWA 1F2GA 1KP6A 4Y65A 1AW0A 4DR2J 4AQYJ 4NEYA 5AJ3J 1TAUA 3H5UA 5LSLA 4TVAB 4HTIA 5HI7A 3UD4P 1NK9A 4RNMA 4DQQA 3NL0A 1U1PA 3NNHA 1S9GB 5KFBA 3DLLQ 4PYDA 3HPOA 3VAIA 3AXMA 4I69A 2HIYA 3RU0A 4ZCKA 2EI5A 2DHXA 3BGOP 3OVAA 2CPJA 2C42A 3QZ8A 2IHR1 4HLBA 4DFJA 5D0GA 2UP1A 2ASYA 4F2SA 1YJRA 3EUNA 3M30B 4EU0A 1K0VA 1OWXA 5FDLB 1EAYC 5I4MA 1NPPA 1S48A 3P45B 4FNIA 3KG0A 4OJGA 4LRAA 3JTPA 2VFRA 4YDDB 3J7ZT 4HI2A 2Y9HA 1F1BB 1KLMA 2HYIB 2HHPA 2E7WA 4GVBA 2PIIA 1PBAA 1DQ9A 3AA8A 1NM2A 4I2QB 1VQPS 1TKZB 4B9VA 4IDKB 1FNOA 4IOBA 3W5ZA 4A4JA 4ECQA 3DHWC 5C24A 1QSSA 4ZPBA 3JTOA 4ALZA 2OEJA 1PC4A 1X0FA 4ZLPA 5KFYA 3NMRA 5ETRA 2OPRA 1KTQA 3PFEA 2ZVIA 4HT5A 1BY9A 1JLEA 2RQMA 1WHXA 2KYZA 1WHVA 4C0HA 3T5KA 2B8PA 2VU5A 3FRZA 1WELA 2IYIA 1HBMA 4DBQA 2HGMA 3BQ2A 3AY0A 4DV3J 2CQ1A 3DOLA 1VQKS 1GT8A 1Q0NA 2DPJA 5A8KB 2BOAA 4CLWA 4U96A 4NMLA 3L7UA 4A48A 3EGVA 3WZ0A 5GADI 5KFPA 5J1EA 5KFRA 3DGVA 1SC6A 5E3CA 3UNGC 1KQFB 1U48A 5DDOC 2HURA 1XQIA 1W7WA 3BYRA 4KKOB 2FC8A 4DL5A 4O3QA 3WHIA 2EWHA 2R7SA 1EX8A 2QGFB 3D4JA 4MYUA 1FDNA 4NASA 4JBCA 1Y7PA 4GVBB 4OJ1A 3HJFA 3M8QB 1RBOB 1HBOA 3DOMA 3HSGA 3EVWA 8RUCA 1NDLA 3K89A 1S1TA 3EJMA 5C24B 1YJ7A 2BE2B 3O44A 1RHRB 2ZJRQ 3EM1A 1FHTA 3W5YA 4XO0A 1JLEB 3K2YA 1YG0A 5HAOA 1KD1T 2W9AA 3MZIA 3SZ2A 1VRTB 2V94A 1H74A 4USTA 4ZPDA 5HROA 4RZRA 4JI5J 4S0MA 1TKDA 1KOOA 2V8HA 5BXIA 2M4MA 1MWZA 2YWWA 4DOZA 1PILA 2UXCJ 4X4VA 1U02A 2ZH4A 1N5TA 4ZJQA 3M8ZA 5DG8A 2FLPA 1KDNA 2FC9A 3SV4A 5J1EB 2RU3A 1PBUA 3I9V9 2V5HG 1NK4A 4FKYA 1UFKA 1XWLA 5KAKA 2RH3A 2I6WA 3CJ2A 3VTIA 2XLIA 1N88A 3EGWB 3KNAA 1HARA 3UNYA 1WC1A 3KLFA 3CW2C 5M2PA 1XC9A 2F40A 5DS7A 4ZA1A 3OVBA 4CTAA 4N8OA 1HW8A 1CULA 1YBAA 1HBOB 3DOMB 3FRYA 1S76D 1RAGB 3H7HB 4ANDA 2ZJQQ 2DY1A 3FGVA 2IM2A 2HQFA 1FF2A 3HHLB 4NLOA 1RCXB 2HWTA 3PYFA 1FD2A 5HROB 1C1CA 1T05A 3OL9A 3NS6A 4WPAA 2KXNB 2QO3A 2FTRA 1YZ6A 4MK8A 3LP2A 5D8HB 5KFXA 1CEZA 2H4YB 3OR2A 1S72S 3CJ5A 1JKHA 3GQCA 3CCUS 4YHHJ 3CGIA 3AOCA 3NOGA 5IWAF 4Y28C 3OHBA 2KT5A 4GKJJ 1YQHA 3V6HA 2IDLA 3WQPA 5KFNA 3PM9A 4A8YA 1F6TA 1T0TV 1UWAA 5U47A 3VGUA 4DFMA 4NLPA 3VQSA 2W1BA 3KLFB 3TRGA 2FPHX 4UOHA 4RU9A 4CTAB 5E3PA 1SJQA 3VAJA 3IMQJ 3UQSA 1Y3JA 4PWUA 4DR5J 3MD1A 4CM0A 3IN5A 1OO0B 4M1KA 2HLUA 1OS5A 2O67A 2HFOA 3BGFA 2W8LA 2AQ4A 1O0PA 3CB4A 5BYRA 1S1UA 2DGUA 3T1YJ 2VICA 4B9SA 3MR5A 2UXBF 2JLGA 4IQMA 2WW4A 5EWGA 4L76A 3JSMA 4F0KA 2LU2A 1KRPA 3G71S 3D6HB 3MUMP 1DQ8A 2KVQE 3MOJB 2E1MC 1UFLA 3RTVA 3PX6A 3NNAA 4LF4J 3J7Z5 5M2RA 1C1CB 1JIHA 1JJHA 4J9QA 4P52A 2HBQB 3B8HA 2HMIB 1RHUB 1X9WA 2VQEJ 4PRFA 4RWWA 1REGX 1FT8A 2YKMA 3D2WA 3QPIA 2QC3A 4ZDNA 2VFSA 3OXLA 3V81A 3OR2B 5DGAA 4M94A 3NAIA 2YX7A 1Q86T 4EFAC 1ZZNA 4IFYA 1NJWA 2RAQA 1CC8A 3R5CA 1ZM9A 2CFXA 1CJTA 2N4CA 5L1KA 2ZZTA 1WC4A 4DV6F 2I2YA 2UV8A 4ZCLA 2OSRA 2RNEA 1NH8A 5KFLA 4R0JA 2EW9A 1U1MA 3PJWA 3PKYA 2DPIA 3MHYA 1N48A 3ZZOA 2HHWA 4FKXA 1QAYA 4LF2A 2BQRA 2PSZA 2RQCA 3H90A 2J7UA 2N7CA 4LR9A 3CJKA 5HMYA 4FZVA 2LKZA 4CI0B 2CZ4A 2BJEA 1EB0A 3MM7A 2WOMA 4DV1F 3LH2S 2MEWA 2UXDF 4C11A 3TAQA 2WCXA 6FDRA 1FX2A 1WC0A 2E9ZA 2VHGA 4CO0A 4DR6F 3R5AA 1N5VA 2RS2A 1RCOB 1U25A 3VHQA 4ILLA 4F50A 3ZFVA 4RWXA 1VQ7S 4HKQA 3BH6B 1IWAA 2HFZA 1TUGB 2BW7A 4KJIA 4LJMA 3V6DA 3NS7B 5AE2A 1UAWA 4LFBJ 1DBDA 4ECVA 1AUSL 3NY0A 4NL5A 1F5BA 3LPEA 1JXLA 1D9DA 4URQU 3M2VB 3DDIA 2RRBA 3ONQA 1Y3KA 5J1NA 3TR5A 2Y0BB 1CJTB 3HP6A 4KC5A 2NZCA 3HDSA 2YNFB 3MEDB 1YJVA 3G2XA 3N6LA 4B9UA 3K8VA 2G4BA 1YDLA 4JV5F 1MN7A 2NXCA 1PG5B 3WBZA 2APOA 2Z0GA 4MKBA 2R8HA 4B3TF 3CJKB 3ISZA 3V6JA 2MJUA 2CJ9A 2AMCB 4DZDA 2NLWA 4ZVQB 1H2TZ 3MM7B 4E8UA 2WOMB 2M7SA 3AQOA 3GLJA 2ZZNA 4OZ0A 3ZZTA 2MKCA 1TMMA 5CZVA 4B3OB 1EKSA 2M8HA 2Q6CA 4C11B 5SZTA 2H54B 4HR2A 4BLGA 3OLAA 1X4BA 3RB3A 1YJTA 4K5RA 1S4FA 4DJBA 2OAUA 1U1NA 2CQ0A 3HVTA 5B0AA 1FK9A 2HS0A 4P7VA 4CO1A 2BM0A 1Y10A 3MM8A 1GXUA 3QLHB 4X4QA 2C1EB 3V6DB 3DRRB 4DUYF 5F8IA 1KSPA 3CC4S 3GIKA 3LOUA 1K9MT 3RBZA 1HLWA 1GTEA 2WZ1A 2QJ3A 4RW7A 5B09A 1VQMS 1Y4ZB 5LT5A 4Z37A 3FBBA 4TYAA 1WHYA 5D0EA 1NLKL 4PZVA 1C2PA 3LP1A 4O3RA 3M8PB 4KBIA 1UA0A 1SVDA 3IAM9 3ETMA 2WVCA 3GIJA 5D4NA 1LW0A 1WSVA 1YIJS 1K44A 3VF0B 1U1LA 4ZVFA 3TJ9A 4DR3F 4X2BA 1FE0A 2WK4A 3TZWA 2D69A 3EVMA 3KLGB 4DFPA 3OLBA 2VDIA 4X4PA 2MQNA 2OELA 2RDJA 2Z2LA 3FZ2A 3QBCA 5SUHA 2HHQA 3M6VA 2AJFE 2EFGA 4DUZF 4ELUA 2WTFA 3E3XA 2MSTA 3GIMA 1EQ0A 4QYRA 3RRKA 5F8LA 2YWFA 1FK9B 3WX4A 1BQNA 1RAIB 4GVLA 4F2RA 4RU2A 3VZIA 3MM8B 3T19A 5GMDA 3PEJA 4ZVRB 3GV5B 1IBMJ 3Q23A 4CLPA 3M4XA 4A8OA 2VPZB 4OZLA 1NZAA 3PW5A 2HFNA 1RI7A 3BDPA 5F9NA 3O6QA 4RW7B 3PX4A 4DL7A 3MF5A 2LVWA 1A9NB 4KHPF 3T5JA 4DCPB 4XIUA 3VV2B 2B3TB 5LOQA 1LNQA 4A8WA 4PQAA 2DNRA 2RT3A 2Q3PA 3P3DA 1YKWA 2KXHA 3CMQA 2MQQA 3LP1B 4CO2A 3RB0A 2AGQA 3CDBA 3I56S 1J27A 3P96A 3L9ZA 2P8IA 4Y2MA 5K14A 3GMGA 1LW0B 1HR0J 2NUHA 5HK4A 5T41A 2WBRA 2QG9B 3FK4A 2B4UA 4K4WA 2ZWPA 4DN9A 1IJFB 3CJ4A 4HHUA 4CT9A 5B08A 3NAHA 1R89A 1TL1B 1F9EB 2V8VA 1S6OA 2FVQA 3CIMA 5IT9Y 5KFJA 5KG6A 3PW4A 1FO1A 3OUYA 1X4AA 1BWVA 1HQEA 5D4OA 1BQNB 1RT3B 5EGYA 4QW8A 2ZH6A 1TKTB 3WDOA 1T9TA 4ZITA 3TANA 2V2QA 4DV2J 3HFZB 3RGIA 4RPFA 2HBZB 4IOAQ 2EPIA 1RT2B 4LT6A 2J0QD 1FFWB 4RO0A 4UZCA 2KVIA 1ICEB 1DY3A 5GAHU 4QU6A 1XMOF 2B0GA 2V50A 2L9WA 1RAFB 3J81Y 3DDNA 2HIQA 2AU0A 2W2PP 4JI4F 2E9TA 4JI1F 4A8QA 1PC5A 2F8HA 5DM6Q 4NLVA 1SH3A 3POTA 4F0MA 2E9RX 4WP8A 5A2QY 2JHEA 1REVA 1HQUA 4YN3B 4JI3F 1WD6A 1NHKL 4NLSA 2P2CB 1LXJA 5ETOA 2CG8A 3G87A 3Q0AA 1JX4A 1NSPA 1U6ZA 1UPMB 3UN3A 2HHHF 1TQLA 1U1KA 4DF4A 4DS4A 4M5IA 3M6WA 1JK9B 3NGTA 2HQCA 3CDAA 3OUYB 3IRXB 5KFIA 1UA1A 1IBKF 1FESA 3D1QA 3I5AA 3VAKA 1M0SA 1JJ2R 1KKHA 1OY6A 1JLAB 2J9CA 4U6PA 4CNYA 1HYSA 3H0PA 3OFGA 4Q44A 2ROEA 4ZK7M 2H5EA 3D0HE 4O3OA 1XNRF 3H2UB 3DRSA 3DLBA 4ED8A 1HNVA 3H5XA 2D3ZA 2BDPA 2A10A 4C4WA 1U45A 3AT1B 2IBOA 3CE8A 1FVSA 1EZZB 2V9KA 3TAMB 1WEXA 2LXFA 3RUBL 4EO8A 3I0RA 4J9UE 4I4BA 5CQGA 5JXSA 4DFKA 2BJ8A 3NS5A 1B4SA 4DL3A 4LQ3A 3KG4A 3POTB 4X65J 4LRFA 1S57A 2HBRB 3I0SA 4AL6A 1HQUB 2QEXS 2MSSA 4EYIB 3T1HJ 4M5HA 5IQQA 4CH0S 2MXYA 3SBMA 5JUMA 5DGBA 3KK3B 4ZLNA 5ETNA 3RR7A 2HZVA 3N28A 4R8UA 4ZCMA 4CLUA 1UW9A 3W63A 3KDOA 4I1TA 2NSCA 4CO3A 5KFVA 1XEZA 3FMWA 1RB0A 3RAXA 2FLOA 2V6AA 2FZCB 2I0XA 1WG4A 1YJ9S 2XO7A 1G2EA 1LW2A 3R9LA 3DI6A 4F0HA 4CLLA 3ADAC 2CA9A 3UDLA 3BB5A 2A0FB 1NKCA 5I42A 2W24A 2YY3A 4MIWA 4JV5J 3OW2R 3P5TL 1NJIT 4QOTA 2IVYA 3N6MA 1LK7A 1SB6A 1R8BA 5BR8J 1VIXA 2DJWA 1HWKA 2AGOA 4DSJA 3GTYX 1VBXA 3A8EA 2IM3A 2ZH5A 2DNKA 2J7WA 1XBWA 3GU0A 5D15A 1J2VA 2EK6A 3V4IB 1CJUB 3BF4A 4BCAA 2C2ZB 1SJ4P 2ZVSA 1HD0A 3HHLC 2Y8YA 4CH7A 4ZLLA 2KFYA 3D28A 4A8FA 5KT7A 4NLTA 2A2CA 5JJBA 2BRLA 1FXRA 4LR7A 2HNDB 4UY8T 1XNQF 2MZJA 1OSDA 4CLKA 1R31A 2W9CA 2ZUGA 3I4HX 3K57A 4PQUA 5IC4B 5EHHA 1XN9A 4DUYJ 4DX7A 2VFTA 5DG7A 4K4XA 3RBDA 2OPSA 3A13A 2JC0A 1RLDA 1GX5A 3BN4A 5DDQC 1H3DA 2AZ1A 2AD9A 2ADCA 4WZQA 2X1BA 4OI3A 3OHAA 3DI6B 1Y5NB 3UPFA 3PHEA 4DG1A 3IP0A 4QZVB 1VBKA 2MKJA 2UV8G 4F4WA 2Z8QA 1XMQJ 1WF1A 5EWEA 3OTDA 3KDNA 4NLDA 4V19J 1EIYB 2Z4PA 4NE9C 3GP9A 5C2GA 2E5HA 2IRXA 4RW8A 1A7GE 3S6EA 3LA0A 4CWBA 4N7TA 1MWQA 4B3SJ 4DR3J 3DOKB 2EFQA 4RJVA 3MMCA 2JJ4D 1VC0A 3BEGB 1NHVA 2DNLA 2K3IA 2CPHA 1H6KX 1NZ8A 2DNMA 3G6ES 2GC8A 3IG1A 4WFNQ 3UCZP 3KYLA 4PAAA 1N5QA 1JLQA 3FCWA 3QJJA 1RQ0A 1PGZA 3D0IE 2J0SD 1NK7A 2IMWP 3BR9A 1NKBA 2W9CB 4ID5A 2ABYA 2E1AA 4C48A 1RAHB 4WFZA 1FRMA 1X31C 1F5CA 2YKAA 4ZHRB 1HFEL 2OPSB 1H98A 4PYAA 2IM0A 2VUGA 4ZOSA 5HANA 2E5LF 5IT9U 1Q81T 4F26A 3TQEA 1YHQS 4ZJLA 5KFQA 5E2QA 4DG1B 4USUA 3MR7A 1VJQA 3ENVA 2HKEA 2LQJA 1WORA 3HX9A 2AYBA 2JEFA 4FDFA 4YUDA 3HCXA 3HHDA 1OIAA 1S6QB 3IGVA 2LQBA 2NXEA 3TAPA 2QSWA 3C16B 1SI9A 5KT4A 5KT5A 1VQNS 4ICLB 4W4MA 2N82B 2UUBF 3DMJA 3MM5B 2R4FA 1RBLA 3TA0A 2ASJA 1BLUA 2GMLA 2O3DA 4QIGA 1FKPB 1P6TA 3IG1B 2AYMA 4RL1A 1TK0A 1HHTP 4ETZA 3H4BA 2UVWA 4ZP8A 5KFFA 2CZ9A 5CCMA 5D77A 4HH0A 5A2QU 3V5RA 4LF6F 4P2SA 3C2PA 4ID5B 4AT1B 2BW2A 4X62F 2CRLA 2KFNA 2OPPB 3LGMA 2W2NP 2AGPA 4OIXA 3VR1A 2ZJPQ 3N0VA 4ED6A 1HI8A 1QE1B 2XYPB 2MKHA 1IM6A 1XMOJ 4Q0BB 3AODA 5D3GA 4I0WA 4CLYA 5ETTA 2DK2A 4KGKA 2E5GA 2C3PA 2O1PA 5IM0A 3M9NB 2DGXA 2J6SA 2AEFA 2B9YA 2VFUA 2OEKA 4KFBA 3A3PB 2FJWA 1S9EB 3MR3A 2GA7A 3GCWP 5EX3A 4JI3J 4J37A 5CABA 3BSOA 1URNA 1AFJA 5ITHA 1UVNA 1H7WA 1GXLA 4U7UK 2B4VA 4C2MA 4DQRA 3K5NA 2BACA 2QRRA 5C5JA 2DH8A 3W60A 1VS3A 3N5BA 3ZTPA 5C42A 5KG2A 5H9FK 3L95X 3G82A 1CLFA 1F3VA 4MH8A 3FBFA 4WWSA 4OYMA 5KFHA 2XB2D 1HMVA 3H5YA 1W2BR 1M90T 1S1XA 1TAQA 4J9MA 3KK1B 1O51A 4FF2A 4LFAJ 3O2IA 4ENOA 2ZNYA 1FDDA 4PWDA 4TU7A 2M70A 3DM2A 3BPDA 1WKLA 2CNKB 2HGLA 4OHWA 4JI2J 5KFDA 3OTOF 2Y0SD 4DL2A 5GAGI 2DR7A 1M5VC 2VBYA 2H4WB 3QIPA 1D09B 2H65B 5D3GB 5T14A 1CJKA 2OUGA 1OYEA 1CQMA 2W4CA 3VGSA 4Q7AA 1SIZA 3GILA 2VODA 4LFCF 3KJFB 4URSA 3EXCX 4AE5A 2YNGA 3CXCR 2GZOA 4MK9A 4QPTA 3NOCA 4KFBB 2FQQB 3ZO7A 2BA9A 3CCSS 2XMWA 3FEYB 2BBEA 1F3FA 2LQ5A 3HD1A 1QJHA 2RF2A 5DQGA 2ZDOA 2MDAA 3CDWA 1L3UA 4L73A 2IM1A 2W2MP 3NGDA 5E7OB 2N3LA 4PR6A 3W9IA 5C42B 2HNYA 2BJ9A 3G82B 5ETMA 4DSEA 1HMVB 5CHCB 2IMOA 4KGZB 4QIFA 4JI7F 2B6AB 2VL1A 3CCMS 2B5JA 4O44A 2AJ2A 2ZWOA 3C46A 4NLQA 2OEMA 2L3MA 4FPIA 4LSZB 3OT9A 1Q8IA 5I3UA 2AZ3A 2MY8A 3GB0A 4LBIA 1EQMA 4PWDB 3PRVA 3HFKA 3DM2B 2IJNA 5J2PB 2OHDA 3CULA 3E2EA 4WFAQ 3OSNA 4WIIA 4NXNF 1IM4A 4FYDA 1RAEB 2XY6A 1LK5A 3Q83A 3U1NA 1WF2A 1JNRB 3QIPB 4A8SA 1TFYA 1WI6A 2D74B 2ASLA 4YB1P 1SXLA 4MKVA 5E41A 3SQGA 2MZQA 4M63A 3CMES 4F4XA 2YNGB 3O8WA 5IT0A 4NLGA 4OI6A 3UR0A 1X0PA 1U1OA 4QIEA 1IBLF 2RUSA 4C9DA 1BQXA
chains in the Genus database with same CATH topology
3EGWB 3MOZA 3KNAA 4LSLA 5KFCA 1KONA 1RTDB 1HARA 5J1PA 2XNRA 3MD3A 2FJBB 1C4AA 2QMWA 4MKYA 1WEZA 2CJQA 3KLFA 5M2PA 5I42B 2CPZA 3GFXA 2Y1JA 2F40A 4L3NA 5DS7A 3K59A 1XC9A 5CXTA 4ZA1A 3OVBA 2P9CA 4NA2A 4CTAA 4X4UA 3DYAA 5E3RA 1KNZA 4N8OA 1U2FA 1HW8A 1ZM4A 1OSCA 4QWDA 3RW7A 1DAXA 2DBBA 4I2PA 4O23A 4OJHA 5FIIA 1TL1A 2GIRA 4TNOA 4BBYA 2CQ4A 1DLOB 1YRUA 5F8MA 2F9JA 1YBAA 1KLNA 5KT3A 1HBOB 4ZPVR 2KKHA 4MIBA 4K4SA 3KTQA 2X1AA 3KG1A 3FRYA 4I6YA 2FJEB 3CIZA 3GE9A 2J6UA 4NCBA 1NJZA 1SV5B 4K4YA 1FJ7A 4YFUA 2FJAB 1S76D 2B5JB 2DCUB 2GJIA 4O44B 2EFVA 3KK2A 1I6JA 4PUOB 3TVYA 4D3HA 2DT9A 2CQCA 2ZJQQ 1Z1ZA 2BR0A 4DL6A 2WONA 2J9EA 5KG3A 4J5OA 1C0TA 1P27B 3M9OB 2ZD1A 4ECXA 3B4MA 1RT3A 1R0AA 5I3UB 2RRNA 5K8PA 4WFBQ 2IJFA 3FGVA 5T7LA 3HVRA 1TKTA 2IM2A 5CYJA 2HHSA 4K0KF 4M5DB 1FF2A 1LXNA 1SH2A 3HHLB 2ADBA 3OR1B 4QQBA 2DGSA 2DGOA 4OI1A 5E0OA 2R2SA 2QLWA 2ZNZA 3ZZPA 4RW6B 5GAHI 3T3FA 1KQGB 3NNCA 4NLOA 1RT2A 5B0CA 2LCWA 2DTJA 4X4OA 1X4EA 3DLKB 5GVQA 2HWTA 4GKJF 2B56A 3MPWA 2MYFA 2DR5A 1FD2A 2YNIB 5KTQA 4KO0B 3H2VE 2DH9A 2B9XA 2C3YA 4HHJA 5HROB 5DDRC 2L9NA 1C1CA 2J9DA 4NX9A 2FVPA 4OV1A 3CCWA 2OD4A 1KHWA 2R7OA 4F3MA 1T05A 3OL9A 1Y5IB 3CD5A 4EWTA 4PQUB 2XMVA 3KLHA 3O3LA 5LMNF 3NS6A 2KXNB 3IR7B 2QO3A 4ECTA 3PW7A 2FTRA 4MK8A 4LVNP 3LP2A 2MKKA 5D8HB 3I4PA 2VG5A 5KFXA 4DR5F 1S0OA 3LALA 1CEZA 1V9OA 3M2UA 2DIUA 3OR2A 1S72S 3CJ5A 3I87A 3OVSA 1JKHA 3WC0A 4FVCA 4LVOP 4MFBB 1KQKA 1RT4A 3GQCA 2XZWA 3CCUS 4DV5F 4YB7A 4OX7A 1FRJA 1V3RA 3CGIA 3HM9A 2LECA 4HDGA 2RILA 4DV4F 1GX6A 1M5HA 5IWAF 4Y28C 4E0DA 1SL0A 4DDFA 3OHBA 1K73T 1EETB 1TKXB 2KT5A 1YQHA 3JSRA 4ECRA 3V6HA 3TUIC 1DTQA 3KLIB 2B4PA 1ZPVA 2DNHA 5KFNA 2VA2A 2Z2MA 1FTRA 3PM9A 3FMBA 4A8YA 4USHA 1FEHA 1UW4A 5U47A 5KFTA 4YMEA 1RKJA 2V4QA 2YWGA 4DFMA 5F3TA 4NLPA 3VQSA 2ZHOA 3MR2A 4ECUA 2R8KA 5DETA 4WYLA 2D1CA 3TRGA 3KLFB 2FPHX 2FLLA 4RU9A 5HO4A 4NXMF 4CTAB 2MZSA 1R3NA 5E3PA 2YWEA 3DYAB 5F41A 5C25A 1SJQA 4ATNA 1AXQA 3N79A 3VAJA 2R7WA 1D8ZA 3UQSA 4FS2A 1Y3JA 4HI1A 4MTPA 4OZ5A 4PWUA 3MD1A 3CF5Q 4N41A 4YQWA 1N5SA 3IN5A 3LANA 1OO0B 1RT1A 1X5TA 4B9TA 4M1KA 3W3SA 3B82A 1T8EA 2UVUA 2QT7A 4RW8B 1ELOA 1NK0A 2HLUA 3R1LA 1OS5A 2BQUA 3C8YA 2GV1A 4ZPAA 2ZH1A 2O67A 2HFOA 1VQSA 1QSLA 3BGFA 2W8LA 2PFFB 2AQ4A 4ZPCA 4LUBA 1LWEA 1O0PA 4I56A 3KK2B 3UE2A 3VAGA 3CB4A 4PPZA 4Y2CA 1X5OA 1S1UA 2MKSA 5BYRA 2ASDA 3IRXA 2DISA 2XWYA 4QWAA 2EG1A 2R7VA 2MHNA 1SKRA 1X4HA 2DGUA 3MMCB 4OHVA 1JB0C 1WACA 4B9SA 3IWXA 1C0TB 2XGPA 2ZD1B 3BSNA 4EBCA 2R2RA 3CMAS 1JLAA 3MR5A 2UXBF 5BYSA 3GFYA 5E3AA 2JLGA 1NK6A 1RTJA 2XY5A 4IQMA 2HAIA 5EWGA 3JSMA 1NJYA 5KFMA 1ZPWX 4ED2A 3M32A 4NLXA 5G4DA 1XR5A 4A47A 5HMZA 2LU2A 3K5LA 4J9SA 1J5EF 2G0CA 1KRPA 1X9SA 5KFSA 2DVIA 1R8PA 2DGVA 4DSLA 3SCJE 4LMZA 2WB4A 3G71S 1Y9OA 3MUMP 1DQ8A 5KFWA 3MOJB 2XY7A 1JLQB 2HS4A 1NAQA 4NYOA 2E1MC 3G6YA 3DLEB 1UFLA 2ZM6F 3RTVA 3HZGA 3PX6A 3MM6A 3UFCX 4PG5A 4BC9A 1T03A 3NNAA 3RAQA 3DDKA 5JVGQ 3J7Z5 2C3OA 5M2RA 1C1CB 1JIHA 1JJHA 2EVZA 4XDDA 2EFOA 3V6KA 1C4CA 4NLRA 2KDOA 2GO8A 2YX4A 4B3RF 4J9QA 1YI2S 1U26A 1ZBTA 3NG8A 3VAHA 2IC3A 4QPXA 3KLHB 3B8HA 2HMIB 1X9WA 2GO9A 1X5PA 4NWBA 1IUJA 3ZZRA 4B02A 2CJAA 4RWWA 5DLGA 4PRFA 3OFHA 4YEAA 3D1HA 2XULA 1FT8A 2DNYA 2KHDA 2YKMA 3TAMA 3QPIA 3JYTA 3D2WA 1JLBA 3MM9B 2I5JA 2RKIA 4ZDNA 2VG5B 4UUXA 5HQ8A 2VFSA 2XEXA 4FXDA 2PEHA 3OXLA 3V81A 4WKYA 3OR2B 1YSJA 3U1LA 5DGAA 1P9QC 2PN6A 4U67Q 3HK2A 1RT4B 2M5YA 4W90B 2UZAA 3U02A 4M94A 4W92B 3NAIA 2YX7A 4ETXA 1Q86T 4DL4A 2XS7A 2COLA 3CJ0A 3K5PA 4RUAA 2CKWA 2AX1A 4LIRA 1N33F 4EFAC 2IVMA 1HNWF 1ZZNA 3CD6S 2GIQA 4IFYA 1NJWA 3S8SA 5KOXA 1CC8A 4DF8A 2HNZA 3SV3A 3HZEA 2DCLA 1Q79A 3Q8RB 3R5CA 2AWZA 3HLUA 1S99A 3H2LA 1APSA 3P6YC 1DTQB 3SMZA 2V9WA 1ZM9A 2CFXA 3DCAA 1NK8A 2N3OA 1R43A 2N4CA 2G1DA 5DRKA 2R8GA 5L1KA 2BZ2A 4F8RA 2DNZA 3CJ3A 5K5MA 3LP0B 4DV6F 3KK3A 4WYWA 1HNZF 1TVRA 2I2YA 4DSIA 3B4DA 2UV8A 4ZCLA 5C25B 4IR1A 2OSRA 1JLGA 2RNEA 1NH8A 5KFLA 4R0JA 3TVKA 2EW9A 1U1MA 1Z2LA 3PJWA 1N32F 3PKYA 2DPIA 2VOOA 3MHYA 1D9FA 4Q2LA 2SXLA 3B78A 3FQLA 3ZZOA 1NO8A 1N48A 3I96A 2HHWA 1RT1B 1QAYA 3F41A 2BQRA 2PSZA 3M2RA 2GCFA 1UWBB 2RQCA 2GHVC 3O5TB 3DXBA 1RA7A 3IS9B 1D3WA 1Y0HA 2J7UA 3DGPA 2N7CA 4ZP6A 3RAMA 3SXLA 1LWEB 4C8MA 4XAKA 3CJKA 4C98A 1P1LA 5HMYA 3T9NA 2FHJA 4FZVA 5KG5A 2LKZA 4C3MA 4CI0B 4ZPTR 3JSYA 2CZ4A 2RD5C 2BJEA 3MM7A 2WOMA 4IQXA 4X4TA 1URRA 3DMJB 1HI0P 4EGLA 4DV1F 1UVLA 1K1SA 3LH2S 4HTJA 2PA3A 5IT4A 5DLFA 1H0HB 4DSKA 1RTJB 2UXDF 2K8GA 4C11A 2NXUA 2BRKA 4JYAF 2KB2A 1O8BA 4LFBF 1MW7A 3M32B 2AJ1A 2YKNB 4L6V3 3TAQA 2WCXA 1VMBA 1SL1A 5H1SV 2PD1A 6FDRA 1MROB 2FVSA 2U2FA 2R2TA 3EXYA 2KRRA 1OQ6A 1TL3B 2E9ZA 2MMYA 3FVYA 4J9KA 2LQ9A 1BQMA 1EP4B 1NB7A 4CO0A 4DR6F 3R5AA 1ZETA 5KOWA 1N5VA 2RS2A 2GGPB 2NUUG 1T03B 3MM6B 3ZZZA 1MU2B 1U25A 3C6UA 3MPVA 4BC7A 4ILLA 4YY3F 3FDSA 4F50A 2IAJA 3OTEA 1Q7LB 3MURP 2JEIA 1X8DA 4RWXA 3ZFVA 1VQ7S 4HKQA 3QO9A 4FBUA 2IC3B 5LXRA 1S7HA 2AF6A 2HFZA 2QZ8A 2K7JA 4L72B 2C22A 2NZ4A 2PMHA 2FGOA 2BYCA 3JYTB 3V4IA 1RT5A 1JLBB 2I5JB 2IA0A 2RKIB 4KJIA 4LJMA 3ZZYA 5THWA 2MY7A 3V6DA 3KKFA 4IH5A 4I67A 1VLYA 4B17A 5AE2A 3PEHA 1UAWA 1M5SA 2OO4A 4H4OA 2UVRA 2V4JA 1DBDA 1U09A 2GQQA 3I32A 4WCEQ 1IKWA 2IRYA 4ECVA 5I3PA 5ADZA 4B9NA 4NL5A 1F5BA 2P5VA 3OTCA 4N47A 3N6NA 1JXLA 2UU9F 3RB6A 1D9DA 4URQU 1DZ5A 3M2VB 4KGMA 1T3OA 2RRBA 3ONQA 2VPYB 2OD6A 5G0RA 1Y3KA 3IR6B 5J1NA 3TR5A 2VB6A 2DHGA 4DQPA 1SIWB 3EGNA 1K1QA 3FEXB 2VC0A 3H98A 5IM0B 2PO4A 3KMSA 4NOHA 3MEGA 3W2VA 3HT3A 1SJ3P 1Z4UA 1VQOS 2HNDA 3HP6A 4GC7A 4KC5A 4F4ZA 2BV3A 3CTRA 3J7YI 1TVRB 3HDSA 3PIOQ 1JLGB 3FCHA 2YNFB 3MEDB 4PG8A 1YJVA 3N6LA 3F44A 2CDQA 4B9UA 2CQIA 3MECA 3K8VA 2G4BA 4F4KA 5GAEI 2P6TA 2YWHA 4F4YA 2JLFA 2C3MA 4JV5F 1R8AA 2J76E 3OL6A 4HYKA 2NQPA 1P8GA 2YH1A 3ULHA 2ZZMA 1MMDA 5MAOA 1N56A 3M2RB 3WBZA 2MKIA 2APOA 2PT0A 2YNHA 3MAQA 3RYLA 2Z0GA 2NPIA 3G8SA 4MKBA 2R8HA 4X4NA 4B3TF 4Y6IA 3CJKB 3ISZA 5KFAA 2MJUA 3V6JA 2XI3A 4FBTA 2CJ9A 3DRPA 4LSNA 1FERA 3SCKE 1RAJA 1U6FA 2AJ4A 2NLWA 3G8QA 1H2TZ 2F9DA 3MM7B 4E8UA 2WOMB 2YKQA 1SKWA 1V3SA 2M7SA 4FF3A 5F8JA 3AQOA 2ZZNA 2JVOA 4Q5VA 4OZ0A 1WNEA 2KRBA 3ZZTA 4IKAA 2MKCA 3M05A 5CZVA 1KLMB 2HZCA 4B3OB 2M8HA 2Q6CA 3H8YA 4USIA 4QU7A 4C11B 1U47A 1Q1KA 1JXEA 2P9GA 5SZTA 4JV1A 3OLAA 1KR4A 4RBTA 3PNIA 3F56A 4K2XA 3K7RA 1S1WA 2KJWA 1HHSA 3KHHA 1X4BA 2PE8A 1ZTTA 4DPOA 2J9DE 1U24A 2RUGA 3RB3A 1YJTA 2Q66A 4K5RA 1S4FA 4DJBA 4BDPA 2VASA 1BQMB 2OAUA 1U1NA 3M6XA 5CD4H 3CT9A 2CQ0A 3TUZC 4NLYA 3BDEA 1U7LA 2AV5A 1S1XB 3HVTA 4OX9F 1G3OA 2ILZA 1D0EA 3AHPA 4ZP9A 3H20A 5B0AA 1HWUA 3C6UB 3AJ1A 5CZXA 1HW9A 1FK9A 2HS0A 3BM7A 4OLPA 2L41A 2VONA 4X66F 1RKIA 1WG1A 3DNCA 2Y1IA 1I1GA 3QO9B 4P7VA 1JLFA 4CO1A 2OPRB 5LJ5Y 2BM0A 4V19X 4DN0A 3TO8A 4CO4A 1N34F 2M2BA 2XI2A 4WU3A 2QYCA 3MM8A 4OFZA 1GXUA 3QLHB 3DN9A 1RT5B 3DOKA 4X4QA 2V0NA 3V6DB 1P1TA 4RNHA 2XHWA 3DRRB 5IZHA 2CPEA 3HF5A 2CQ2A 4ZKAA 4ED7A 1IBKF 2M0GB 4DUYF 1WHWA 2HHVA 4H4OB 5F8IA 2V4JB 3SEOA 1KSPA 1IKWB 2BANA 3PR5B 4AYBD 4I64A 3CC4S 3KOAA 1WF0A 2C3UA 4JI0F 1GTHA 3GIKA 3LOUA 2W4DA 1RYSA 3Q8SB 4IFVA 4MMOA 1U1QA 1K9MT 4LF9F 2DNQA 2ZC3A 1M5PC 1GTEA 3E01A 2XMJA 4RBUA 1B7FA 1HBMB 4C7QA 2ZH3A 5BYQA 4NYPA 3LAKA 2WB1D 3FZBA 5L9NA 3DOLB 2W7PA 2B4OA 2I38A 5GAGU 1KVIA 4RW7A 5K8OA 3RR8A 4IYQA 5B09A 2HVIA 3MEGB 3W2VB 2B7BB 3PO5A 1MSWD 3AB2B 4WFYA 3KHRA 1QY7A 2HWIA 2KT2A 1HBNA 1VQMS 5EN1A 1B0PA 1Y4ZB 3Q2TC 3FSIA 4ELTA 2HW3A 5LT5A 1DQAA 2VD3A 4Z37A 2R7UA 3CCVS 4TYAA 1WHYA 4Q8EA 2XLJA 3AB4B 4CIOA 3CCES 3FQKA 1H38A 2Q79A 1C2PA 2X1GA 3LP1A 4O3RA 4M8LA 5CCLA 3MDFA 1NK5A 3M8PB 1QVGR 2D7SA 4MKAA 5B0GA 4QWBA 2DNNA 4CT8A 2ZBCA 2W8KA 4KBIA 5J2MB 2YNHB 5FLXY 2F3JA 1T3NA 4YR3A 4ZHRA 1UA0A 1UJ4A 1UEVA 3IAM9 1QUPA 3U7JA 4YR0A 3MUTP 4WE1B 2CQGA 1Q16B 5GADU 5GAEU 3GIJA 2RF2B 4R25A 3OL8A 3CCZA 4IG0A 2IVFB 5D4NA 3TOQA 2LMIA 4GKKF 5KT6A 3DRPB 5E3QA 2ZHBA 1LW0A 4LSNB 2YKPA 2NPFA 1YIJS 3PRBA 4HVZA 3VF0B 4I7FA 1ROFA 1U1LA 1V6HA 4ZVFA 2W7OA 4G1QA 4DR3F 2CJBA 5KG0A 3RB4A 4EZ9A 1D8YA 4X2BA 1FE0A 4KSEB