1O66A

Crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
260
structure length
249
Chain Sequence
b'LITVNTLQKMKAAGEKIAMLTAYESSFAALMDDAGVEMLLVGDSLGMAVQGRKSTLPVSLRDMCYHTECVARGAKNAMIVSDLPFGAYQQSKEQAFAAAAELMAAGAHMVKLEGGVWMAETTEFLQMRGIPVCAHIGLTPQSVFAKAQALLNDAKAHDDAGAAVVLMECVLAELAKKVTETVSCPTIGIGAGADCDGQVLVMHDMLGIFPGKTAKFVKNFMQGHDSVQAAVRAYVAEVKAKTFPAAEHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-methyl-2-oxobutanoate hydroxymethyltransferase
molecule tags Transferase
source organism Neisseria meningitidis serogroup b
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
total genus 73
structure length 249
sequence length 260
chains with identical sequence B, C, D, E
ec nomenclature ec 2.1.2.11: 3-methyl-2-oxobutanoate hydroxymethyltransferase.
pdb deposition date 2003-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1o66A00
4KRZA 1S2TA 4KCTA 1F3WA 3FA3A 1A5UA 3OYXA 1F3XA 3QV9A 1DQUA 3QLLA 3SRDA 3R4IA 3OYZA 4HYWA 1IGWA 2VGBA 1A3XA 1PKNA 4QG8A 2G50A 4ROQA 1Z6KA 4FXFA 1KC7A 4L7ZA 3QTGA 4MF4A 3H6OA 2HJPA 2XDFA 1XG4A 4IQDA 4B2DA 3T0TA 1PKLA 2VWTA 3MA8A 3E5BA 1F61A 3B8IA 4YJ5A 2V5JA 2VGIA 2QIWA 1O68A 3P0XA 4B5UA 3EZ4A 1S2VA 1AQFA 3IS4A 4WJ8A 2DUAA 2HRWA 3BJTA 4QG9A 4TV5A 1E0TA 4MG4A 3SRHA 1SGJA 3PP7A 1PYMA 1DXEA 1E0UA 2OLSA 1T5AA 4IMAA 1M3UA 2XZ7A 1KBLA 2HWGA 2VWSA 3BJFA 3FA4A 3M0JA 1ZJHA 5JVLA 4B5XA 3LYEA 3QV6A 1ZLPA 4B5TA 2WQDA 2X0SA 1U5VA 2E28A 2BG5A 3HQOA 4IP7A 3E0VA 1OQFA 3GQYA 4FXJA 1VBHA 4L80A 1O66A 4DRSA 4QG6A 4KCUA 3QV7A 1PKMA 3T05A 3OQ8A 3KTXA 3KHDA 5TAOA 4G1NA 3G2GA 1VBGA 2HROA 4IQEA 2L5HA 1DXFA 3VAVA 2ZE3A 4L9YA 3LG3A 4TV6A 1OY0A 1U5HA 1M1BA 4L9ZA 3N25A 4RPPA 2V5KA 1GGOA 3EOEA 2VGGA 3SRKA 3EOLA 1S2UA 1A49A 4KS0A 1F8IA 2KX9A 4HYVA 1A3WA 3E0WA 4KCWA 4B5SA 3HQPA 4B2DD 3QV8A 4YNGA 1F8MA 2DIKA 3I4EA 2R82A 3QQWA 1IZCA 3ME3A 4LSBA 3GG8A 3PUGA 4JPGA 3GR4A 4KCVA 1S2WA 3M0KA 1JDEA 3SRFA 1UJQA 3HQNA 1MUMA 1XG3A 2XZ9A 3EOOA 1O5QA 3U2ZA 4B5WA 1DIKA 4QGCA 3T07A 2VGFA 4B5VA 1PKYA 3QZ6A
chains in the Genus database with same CATH superfamily
2VEPA 1S2TA 3OLDA 3WL0A 4W7WA 4EVZA 3PN8A 1QVBA 1LRQA 2DVUA 3RMEA 3FGCA 3VDBA 3NZQA 4JN7A 1DBTA 2PE4A 3IJ7A 4L1GA 4HSNA 5K4XA 4C6JA 2V5JA 2VDIA 3QKEA 5A8GA 1S2VA 1UR2A 2ZUNA 2DU2A 4CD5A 4ZB5A 4HP5A 4V27A 1YADA 2PF0A 1RD6A 4B3KA 3OZOA 4J3VA 1E3ZA 3T4CA 4RNHA 3QTPA 3EBVA 4LUSA 1PAMA 1OYCA 3C2VA 1TCDA 4AY1A 1CLVA 4S3GA 2A5HA 3UU0A 5AC5A 2W9MA 1VBJA 3M7WA 2WPBA 3WF3A 1L0PA 4JAWA 1RXOB 4HOWA 3I7QA 3W7IA 3VKJA 5IXEA 3LCIA 4MNKA 1PKMA 3DAQA 3QY8A 1SSGA 2XH0A 1ISZA 1W9VA 4J3TA 3OTRA 1WAUA 3AU2A 3EOEA 1JGMA 3M1ZA 1DWFM 3AXMA 2OKOA 4HOZA 1B9BA 4I7WA 3VC5A 1QMLA 3AMGA 1O12A 4OVXA 2YXOA 3DIPA 1VFHA 3V0TA 2WWDA 3P80A 4RNJA 4F8XA 4J5NA 3U2OA 4BWLC 3N13A 4RZ6A 4JQ1A 1ESWA 1ECEA 3E6EA 3FDGA 3NQ7A 1SMDA 2ZVIA 1LL7A 3T09A 3CT7A 2O55A 2WJEA 1SZRA 1TWIA 1EJUC 4YJ5A 4E8DA 5DT5A 3HGOA 3NCOA 7TAAA 5HNUA 3VD3A 3QKZA 2QXWA 2X2YA 3Q2DA 2A3AA 3KBVA 3O8AA 5D38A 3ANYA 1AW1A 3CMGA 1XIMA 5IDIA 1YDOA 3D3AA 3WH7A 3HV8A 1PSCA 4QE4A 4C6NA 2WBGA 1V5XA 1W5QA 1UH3A 3NZ1A 3QC3A 3O6AA 1C91A 4TUFA 5E9XA 1A0EA 3SI9A 1AL7A 1ZFJA 4XZLX 4DJDA 4N42A 4PCFA 3RNDA 4GISA 1W3JA 1KCXA 1XISA 4XB3A 3E5PA 4GQGA 3S1VA 3WLTA 4FXJA 5FSEC 3I10A 3UA3A 3BICA 1F5ZA 1AJZA 5H91A 4M51A 1UR3M 3CUGA 1I9CB 4MY9A 2EPHA 4A29A 5CJMA 1JPDX 2FHFA 2VZTA 4UFHA 4P7NA 2I16A 3LS9A 1H7XA 3TW9A 3V0SA 4M8UA 3H2EA 1Q3NA 3LGEA 1H7RA 2X1TA 3F4DA 1X8CA 3UZJA 5G2WA 4WKFA 4R9XA 1GCYA 1B0IA 2C0AA 2YDQA 1F3EA 2QW5A 4OE7A 3QF0A 4NI3A 3NYDA 3RRAA 2VCCA 1CXKA 3W1AA 3WKZA 3B8SA 3NDYA 3N15A 4JDBA 4K37A 1DJQA 3NIYA 2Z00A 5A5WA 5CPMA 3TP4A 3QM3A 2YL9A 1XIBA 3MKCA 3POHA 3AZSA 5I3JA 5F4SA 4FIRA 1E1FA 1F4HA 2FZNA 2OWCA 3KBJA 2NW0A 2PBOA 2XZ7A 3MV01 3BJFA 3AICA 3THUA 3BW4A 3N2XA 3VZZA 3ITLA 4GVHA 5AYYA 3GTHA 4H6KA 2E28A 1HKIA 2V3DA 1KKRA 1TFVA 3CMFA 1UD2A 3K4WA 2NXHA 4M81A 2QUVA 1DIEA 1XPGA 4XO7A 1HW6A 4IQLA 5AECA 3ZSSA 4Q4OA 1G7VA 4PBFA 4UOZA 3PK7A 1Q6EA 5FA5A 1PZ2A 3IIPA 1K8XA 2ZUSA 3Q4DA 2BV9A 2Y89A 1E4LA 3BGJA 3S0CA 2WSYA 1KWKA 4ACYA 4GGHA 1V6XA 1Q6OA 1ZUAX 3FYOA 3OIHA 4IG2B 1KM0A 1OBAA 3URNA 5K3VA 2OYMA 1EIXA 4PH6A 1W5PA 5EMKA 1HXJA 1OCJA 3WX7A 4AWEA 1EYEA 3VI2A 4EAYA 1VFFA 4HKPA 2YL6A 2O9OA 4U5KA 3UWVA 3S6DA 2CLHA 4JS3A 4L5ZA 1NDVA 1B3VA 2Z27A 3IRSA 4CNNA 3E96A 1RJQA 5I09A 4AIBA 3BV7A 1OZMA 4NZ5A 1WOAA 3V1PA 3SY1A 3O7UA 2POTA 3EEGA 3RCMA 4C91A 1XSJA 3VGEA 3P5ZA 3ZJ8A 2FPYA 2I9UA 4YLWA 2V5DA 1XS2A 4C6EA 4UBPC 4WK9A 5I3IA 3NL5A 1NFPA 3VMPA 3FKKA 4XZMX 1WXYA 1Z32X 4PYSA 4LALA 5LHEA 5I03A 2TSYA 1O7AA 3NTYA 1H60A 3VNJA 4A35A 3CBWA 1Q6GA 3QV8A 3PWGA 3MHGA 4GO8A 4ZO6A 3IWPA 5GJPA 3OP2A 2C1GA 1XH0A 2FGZA 2GL5A 1FKWA 2V3EA 4RX0A 4CCZA 4J4KA 4QCFA 1DQWA 3OZPA 4RXFA 5A95A 1ZZMA 2E6DA 4GUGA 4V33A 3GHRA 1XQKA 4JFSA 2PGEA 5DEZA 4YWSA 3VTRA 1KRMA 3NAVA 1TPVA 4J3WA 1GVOA 1JXKA 2GUUA 3O05A 5XINA 2PDPA 4H9YA 2ZWYA 3CWNA 1QO5A 3VIFA 3T0DA 1K3UA 3TROA 4WY0F 3MB9A 3LRKA 1VHCA 4Z2JA 4PL2A 1QR7A 2ZRYA 2J9XA 1TV3A 2XG9A 2QPSA 4H7VA 3ZLGA 3B0UX 1TCMA 4LX4A 2EXOA 2INZA 4JHMA 2UY3A 5K9XA 1MDLA 2YJQA 1SFSA 2WVSA 4QITA 3GNNA 1MFUA 4IOTA 4O11A 1W1YA 3C2FA 1Q4NX 1R3SA 1KM4A 1MUCA 3ZYZA 1HJSA 3T05A 1UUOA 3WNKA 2VDGA 1ONXA 2XIMA 5MF5A 3WUFA 3SQLA 2RJHA 1Q7ZA 3Q67A 2PWHA 1RBOB 5HBFA 3EMQA 1KW1A 2PGWA 4AUBA 2CHNA 2RH9A 3N2MA 4LNYA 2QLYA 3G1YA 1IEWA 4UOQA 3K5XA 1GVRA 1NWTA 5KITA 4I6VA 2HE5A 1NDWA 2FLIA 4NG3A 2V38A 4I9JA 3EKGA 3HBLA 1TUFA 2G37A 1PWMA 4HYWA 3ZIZA 5EPDA 5L9FA 5AZ1A 3LPFA 3DGRA 3NEVA 1PDZA 3CK5A 4LUTB 3EWDA 1J0ZA 4HQVA 3LERA 1GOXA 2PDHA 2NQJA 2PC8A 3CZKA 1TQJA 1VHNA 4PTVA 4MUPA 1H0GA 1VZWA 1Q2SA 2FPTA 3MCMA 3H54A 2J9YA 3G3DA 1F4AA 1AUSL 1E1CA 3NXFA 1GKRA 3SCNA 3M4HA 2R6OA 3LCLA 5IBXC 5HATA 1QOPA 1RR2A 4AQLA 4D6FA 3G0UA 2QF7A 1D8WA 2Y5SA 4OUEA 2Y8UA 3PTQA 3S9ZA 1JUKA 4XTDA 3FDKA 1EUNA 2CZDA 4W5ZA 2L5HA 3TIMA 3ZZ1A 2HVOA 4DX3A 1PZ0A 4K68A 5A6LA 1Z41A 3OVGA 2YL5A 4L6DA 3HQPA 3W1QA 3PUGA 1RY8A 2PDQA 4HMDA 1GQIA 3CMJA 3USZA 4KIEA 1WBHA 2XFRA 3IV3A 1GOOA 2A6LA 3TJXA 2DV0A 3VCRA 3L4YA 1LQ2A 3SIMA 3WMLA 5FD0A 2UBPC 3ALFA 4CQAA 3KL3A 4DWSB 3A47A 3EX6A 2QCEA 3DC8A 2RFGA 4H83A 3UFYA 3TW6A 3LXCA 2FQIA 3MSYA 1U30A 1PO9A 1TZ7A 2AQVA 3W81A 2UV8G 2VFEA 3EWUA 2ZX6A 4F0MA 5BMWA 2VZSA 3U7BA 3WLQA 4IIBA 1V0MA 1HGYA 3D46A 3TQPA 4GBDA 2DSWA 4QEEA 3AXKA 1M41A 2FVLA 1HKWA 1R2SA 1TRIA 1I6NA 3R0DA 4WOQA 5AC4A 3PZGA 2WJDA 2QGHA 3LI0A 4CNOA 2F6KA 2OR2A 4LY4A 3KHDA 3L0KA 3MDUA 1VFUA 4GX9A 4IQEA 1R3WA 4PGLA 2PWVA 3EOLA 3W7DA 1I2PA 4GD0A 1BKHA 3V16A 1KRBC 5I3FA 3P62A 2DH3A 3RRXA 3NO3A 2O92A 1CECA 2WK2A 4Y8FA 3G77A 3N4EA 3W73A 4DZAA 2VC7A 1VS1A 3EDJA 4WOZA 3HJZA 4NASA 4MJ2A 3UD6A 2Y8KA 3M0LA 3R4IA 3IIZA 2J7BA 3N9RA 5E9AA 4PL1A 6REQB 3CEUA 3AIQA 3S1UA 5HUOA 1F61A 2VGIA 4MVAA 1ZCCA 3QR3A 4B5UA 3P2VA 3NZGA 3DENA 4IPJA 3SCOA 1FWJC 4CQ9A 2QQ6A 1DVJA 2ZZ6A 1PVNA 3GS6A 1CXFA 1YPXA 1JZ7A 3MWCA 3NSXA 4G7EB 4LF2A 2J79A 3E1F1 1ITCA 3FA4A 3URAA 1FA2A 3WH8A 3AIRA 2XSBA 4FO4A 2XH2A 2VUYA 3ITYA 1OFDA 3SUUA 3OBAA 1RQBA 2QF8A 2V81A 3OQEA 4PB4A 3GNPA 5EY5A 5H8UA 4NU7A 3L4ZA 3RM8A 1J79A 2Y6ZA 3FJNA 3W75A 4D6CA 4UTWC 1W31A 1ZB5A 1EWDA 1JYWA 4LU0A 4AD0A 6TIMA 3S4TA 1UOKA 2RKXA 3M7SA 2EG8A 3DFTA 3S5YA 2G0WA 4FI4A 2NVDA 2JALA 4PMRA 1LL6A 2Z1SA 3NEHA 4QE5A 1HO4A 4V1XA 1QNOA 1K4GA 2NUWA 1L6SA 2EKCA 1ZS2A 4J1OA 1QATA 3W2JA 2GUBA 2PTWA 3N9SA 5DXXA 1LM1A 1CGVA 3EOOA 3KL5A 2PDBA 3FYPA 3TR9A 3QPZA 1TQXA 2QHAA 3FYYA 1RCQA 2WM1A 4OFCA 2P88A 2ZADA 1SSDA 5D4YA 5TIMA 1UH4A 3TSMA 2CHOA 2XUCA 4DM1A 1GK8A 1G5AA 1Y5XA 1UR0A 3HF3A 2XISA 1B90A 4BF5A 5AKQA 1P7TA 4C6MA 3G1HA 1LZOA 1AH0A 2PPGA 3NNTA 2YCLA 4FX8A 1QNRA 1V79A 5I7GA 3FIGA 5E70A 4BQ4A 5T91A 5IHSA 3DG6A 4PTMA 3W71A 1W56A 4G1KA 2YB1A 2X1RA 2ACSA 3KCLA 1C7TA 5C2XA 2VRQA 1R9ZA 4BK9A 2XGZA 4ZOAA 2PAJA 3PBYA 1HZYA 4JX4A 4HSOA 3VIPA 3CH9A 4J2PA 2Z6JA 4HPJA 1LOSA 2WAGA 1EX5A 4LVAA 4AW7A 4GQQA 2C79A 2PD9A 3GXDA 3AO0A 4CCDA 2OELA 1KBIA 2MUCA 1LUCA 3S83A 2DY3A 6XIAA 3GR7A 5LIYX 5GQBA 3GH7A 3ZLHA 5A6BA 4L1WA 1MDRA 4C6QA 2OEMA 1QPKA 4B9ZA 1KNWA 3SB0A 3MO7A 5AYZA 5B80A 2Z26A 1M7JA 4Z1BA 3WH6A 1P7TB 2XN0A 5IM51 2O7QA 1X1NA 4E8CA 4IUGA 3QGKC 4CNPA 2OPJA 1BVZA 1TWWA 2QV4A 4QJ3B 1R3RA 1E71M 1V3LA 1IXPA 1JD9A 3ZMRA 2YCLB 5D2WA 4EAMA 2QAFA 1GJUA 4LCRA 4X2PA 2I5IA 3TZFA 5GJNA 3KVMA 4KWSA 3EPMA 4CNSA 2OVLA 5F1UA 2YBTA 1EZWA 1ZJHA 3PG9A 2DSVA 4EXBA 3BZGA 1VFTA 2B7NA 3U5UA 1PCKA 2WQDA 4ZQMA 3BCDA 4MAVA 4FALA 1AD4A 1B5TA 4QX4A 4AZGA 1MO0A 5CBJA 3CQJA 1TVPA 2QJNA 3W2UA 3I3BA 3WDHA 3IGXA 2Z29A 1LBLA 4M1BA 3MSGA 4WVXA 2ESCA 4ZSUA 3AFBA 4UMBA 3B0YA 4Q8NA 3KLLA 4M56A 2PLCA 3U48A 4XZHA 1UWQA 4B2DD 1K8ZA 3PR2A 4KPLA 3V1HA 5K9CA 3TQVA 1QNPA 2ICSA 1FX6A 2JGQA 3WMCA 4KKXA 4CD7A 1K1DA 1PZ1A 5A2AA 2G3FA 2QPXA 1DWJM 2VFIA 4F40A 3QV9A 3WNNA 3AS3A 4ZQPA 5E93A 3C0SA 3WK1A 4U2YA 4JYEA 2DIJA 4GIRA 3WJXA 2PDWA 1YEYA 1MXGA 1GEHA 4IM4A 3VOIA 3DX5A 1W3LA 1NWSA 4L6HA 1K7XA 4KEMA 2FJKA 4PMVA 2VZOA 4XV0A 1A4MA 1BYDA 3NVDA 1F6PA 1QK0A 2ACUA 4L4MA 3GY1A 1V3HA 1BYCA 1VLIA 1XWYA 1DIOA 4LB4A 1S46A 3WG6A 3G1AA 1WPCA 4L80A 3V18A 1WUEA 1CGXA 2W92A 4O8RA 2P1FA 1AMKA 1Z8AA 4HU8A 4PCSA 3APGA 1ITXA 1P6BA 2ZVRA 5TQLA 1M5WA 1TG7A 4C6CA 1GPFA 2YA2A 4I3GA 1F3TA 4IGSA 2E8ZA 4UTHA 4YHEA 1PWLA 1JDEA 2DJXA 1Q65A 4Q32A 1LLOA 1VRDA 1E1EA 2QCDA 2WSKA 4LUIA 5CLWA 4N0RA 4PMUA 4BF9A 3RCYA 5D05A 5CGQA 4IICA 4DJED 2VO5A 3NVTA 4DAFA 4DN1A 1Q8JA 5CJ5A 4Q8TA 2VVNA 1OJXA 3BK0A 2DSKA 2ZWZA 3FX4A 2C16A 4C5YA 4JHOA 4R9OA 4XVDA 1AQFA 3M43A 3IK4A 1XYBA 3DUGA 1SYTA 3NDZA 4ZXLA 3GVVA 1TMHA 4MG4A 4F0LA 3VOHA 3WBWA 1WUFA 5JH2A 3WQCA 2ZYFA 1AD1A 2YYTA 1E6SM 3D47A 4Y9NA 1M7OA 1SZNA 1BWVA 3A9BA 1EC9A 1O1ZA 1GUVA 4YIWA 3AIBA 4QJ4B 2CITA 2CFFA 3WIJA 3KZSA 1H51A 3S5NA 4RL3A 4IQJA 2FVKA 1UYQA 3P67A 3DXIA 2VQTA 1GYNA 3M6DA 2J13A 2B81A 2ZE3A 4H04A 4AZBA 1KA9F 4EF9A 3BLDA 3U9IA 3PVFA 4KCWA 3B06A 3BAWA 1QI5A 1EKOA 3TTSA 4UR8A 1QI3A 1V7AA 1L2QA 1FHUA 1Y0EA 5BOOA 2X7WA 3BANA 1E3XA 3NO1A 1JYVA 3D5HA 2BHYA 1J8VA 4DBWA 3P5YA 5U7SA 4P8XA 4PEKA 1SJAA 2VELA 3MT1A 1HL9A 3B4UA 5CGTA 4ZZ9A 3QTGA 1X6UA 1ITUA 4W86A 3M44A 4LOCA 4FZIA 1OCNA 4JFTA 4JX6A 2NX1A 3LZ5A 3TOYA 3WH5A 1H61A 5LGXA 1YPIA 2OSYA 4GCXA 3GXMA 2BS9A 1O5XA 3LTYA 2WC3A 2P5NA 4FIQA 3CHVA 1RQEA 2E40A 4UWMA 3UJRA 1XFCA 1MNSA 2OGYA 3AYSA 4PB3A 3NUKA 2HSAA 5CC3A 3K30A 4NXSA 1VIWA 3B8VA 3CL6A 3REQA 3UT0A 1KXVA 3HGRA 4I5XA 4JCMA 3TNBA 5C5YA 4BY3A 5E0KA 1I2QA 3QZEA 4RNFA 1P1XA 2J24A 1EHNA 1ZJBA 3PBGA 5ABTA 1I1WA 3D0CA 2V5BA 4JOMA 1TPWA 1LUCB 4M24A 1TVNA 4ECLA 2QV5A 2JKAA 4HBKA 1J12A 2OQLA 4S3CA 3S5OA 2JE8A 1J18A 1RV8A 1EF2A 2FHCA 4JNZA 1Q4WA 2ISFA 2VRJA 2BGQA 4JTSA 1DIDA 1E4IA 3F4VA 2CYGA 5I77A 1P5BA 4EF8A 1NQKA 2A2IA 3NQEA 2FKPA 4JQAA 4FB7A 2D0FA 5FESA 5I3HA 5BXTA 3OVPA 4XZBA 2NLIA 4UTWA 1OD0A 1HKVA 4PFHA 3K8LA 2J77A 5F2LA 5FEWA 3F2DA 1TIWA 3LTPA 2I14A 2WNWA 1G4PA 4GJJA 1VPYA 1P43A 2PMQA 2PD5A 1IXOA 1NAL1 1KGWA 3GU2A 2QIIA 1YE6A 2IUZA 3JZEA 3S6TA 4ICNA 1M68A 2P8BA 4IP4A 1ELSA 3ITCA 3CZJA 3HQOA 2POZA 3L9CA 3R0UA 2BVWA 1EGMA 4S23A 1JCYA 3CAKA 4JTGA 3LA4A 2OGJA 1VD6A 1WKDA 1GW1A 3G8RA 1TWSA 4GA8A 4MIMA 3WF0A 3U4AA 3DKJA 3H4GA 1AK5A 1BKSA 3UR8A 3OG3A 2F8QA 1WDQA 3IJ8A 2E9LA 3TC3A 3DFSA 1QWKA 5I6SA 2Y8VA 4O4VA 2NSXA 2XM1A 4OIFA 4ERGA 2OT0A 2CLLA 3LLDA 1JFXA 3WLIA 3W53A 2NZLA 4BS0A 4KBXA 3IPWA 3ITVA 4L4PA 1FH7A 5HJLA 4CNTA 1R47A 2RDWA 4UTIA 4LRSA 3OYZA 4JD4A 4MKSA 5CLTA 3UETA 1VYRA 3UY7A 1MYRA 2XIOA 3ID7A 1WAWA 4R3UA 1H2JA 4AZ6A 1DE5A 1J96A 3P14A 1AW5A 2R1PA 4WLCA 3TKFA 5DQPA 4RE4A 1UQYA 1E0TA 4A2SA 2ZA3A 3GHUA 1W54A 3ARVA 3UEQA 2NT0A 1MSSA 5G5IA 1G1YA 1BXNA 1EJ7L 4QSHA 1KXHA 1ENUA 1KM6A 1XIHA 3HZ3A 4H2CA 1A47A 2XU2A 1VCFA 1ICSA 3E0VA 1K8YA 5HDRA 2VD8A 1X6NA 3M6YA 1EDTA 1VIZA 1KD0A 1IT8A 1DYSA 3IIOA 4L9YA 3G3MA 2VQUA 4D1IA 5TNVA 1MNZA 4ZFMA 4N9BA 3SURA 3GVQA 5E6ZA 1SJCA 5AC6A 5HA7A 3KTCA 1JGIA 3QJAA 2PU1A 1JCMP 1NWUA 1D9EA 3B9OA 2F38A 1NY1A 1EP3A 1JCXA 1H09A 2IXVA 2NSOA 3VYLA 4KCVA 4IXXA 5E09A 4XD6A 4AAJA 1UKTA 1NQ6A 3MZNA 1VP5A 5A6BD 3B0VC 5JMUA 4EXAA 1ADOA 1SO5A 2DT1A 4GYPA 4DO6A 3PSWA 4S38A 4LYPA 1W1PA 2ZXQA 3T0BA 2TAAA 1NOUA 3BLPX 1BWKA 1HNYA 3CYJA 2FZ9A 2D0GA 5DCEA 4OJYA 2R14A 3Q65A 1FHLA 2ZE0A 3R8RA 3W7KA 5LA0A 3EDKA 2PCEA 1DXEA 3TUUA 5HWJA 1NEYA 3MUXA 3LCGA 2E5DA 5IBXA 3VFLA 1C8QA 1FWAC 3KW3A 1E6ZA 3EWZA 1IWBA 2XVNA 4LCSA 3S3GA 4K1WA 4GI6A 2A79A 1OZQA 1KLYA 5TAOA 4YCPA 5KSWA 1DQXA 3C0JA 3B03A 3PS7A 1W32A 3LNPA 2XH7A 1DOSA 3OLGA 2BLEA 3UJ2A 3H2CA 2G3MA 2OWWA 1JXJA 4AIUA 1Q7MA 2NWSA 2BVYA 4AYGA 3T0AA 1YNPA 1C93A 5F2MA 4ZE5A 4UZUA 1OFBA 2WKLA 1N82A 3AHTA 3ZJ6A 3W37A 3ZOAA 1UD5A 1W1A1 1GTEA 4REQA 3DFYA 5ECUA 1A80A 3QVQA 1H4PA 4D6GA 4US5D 1A5BA 1A3XA 1Y5WA 3WEZA 3YPIA 4Z08A 4JXCA 2R1LA 4DBEA 3UZ5A 9RUBA 1PJ9A 1O68A 3W9ZA 4AY7A 3ITGA 4DPPA 3PB2A 2X1SA 4K7VA 4GE8A 1V3JA 3MUAA 1I75A 3PAJA 3A12A 1J10A 3GTXA 3CXOA 1J4EA 1A5KC 3R1ZA 1DJWA 3ZM8A 2C19A 3MMTA 3W02A 3KOZA 3WUEA 5SWUA 2Y85A 4IMDA 4QLJA 4CUCA 3RX4A 4E4PA 2C8NA 2GGIA 2BG5A 1GVEA 2P76A 3UPWA 1NTHA 3VNKA 4Q4MA 2WPGA 2UY4A 4R88A 4I9MA 3VO0A 3RUBL 4PUUA 1CX9A 2BVTA 4MB4A 1QO2A 1ME9A 1V8EA 1TREA 4DF2A 1QAPA 2NQLA 1AG1O 3QMSA 2D2OA 2HBVA 3JW7A 5FEXA 4S2BA 3EMCA 1UHVA 2Y61A 4HMEA 2HXTA 1S2WA 3MUZ1 3WBXA 3ITOA 3EPNA 2C1HA 3EXRA 3UCDA 1DJNA 4AHPA 2CKSA 5JU6A 4NT0A 1OYAA 4LY8A 1FXPA 4NY2A 4DXXA 3BTNA 1VF8A 4C1NA 3UZWA 2VGBA 4GIAA 1UWAA 1TTQA 3HMJG 3R5EA 1XX1A 1BXCA 3ZFHA 1XPYA 5BXSA 2EG7A 1YNYA 2Z7GA 1PZ3A 4UTLA 4KH2A 4NRRA 3U8GA 4HZMA 5BCAA 5JIPA 5D09A 5LKYA 1YYAA 2CLKA 1LDCA 2DW6A 3KVKA 4MOZA 2OX4A 1HN1A 3VD5A 4WXYA 4GYFA 4JHZA 4UNLA 4MNLA 5A94A 5LHFA 3K4AA 4U3CA 4P2VA 3JU2A 4L56A 3FA5A 4DZ5A 4WRHA 2VEFA 3M41A 3TCEA 1TV2A 3W3OA 4CCEA 1FWFC 4Q6JA 1RLDA 2Z1BA 3R58A 5FJUA 1WBJA 3RX2A 3LD5A 1A3HA 1YBQB 4MYAA 3N2BA 3NPXA 3C6CA 4NXKA 5D30A 2QULA 4XKYA 4CD4A 4N4PA 1FWWA 1VC4A 3KWSA 1GJPA 3FFSA 4GXMA 3W2LA 3LHUA 1WNOA 2X8RA 4PUNA 1M53A 1KBJA 1ZENA 2DFAA 4AIOA 2OFJA 3S2JA 3IJQA 3UGVA 4LC8A 3QQ1A 3ENLA 3BMVA 3RILA 1PCWA 3P7YA 3LGDA 1YW1A 4AB4A 4P5UA 4DI9A 4LVFA 3TDFA 3GC2A 1XIEA 5KMYA 1XINA 3WQVA 4AWSA 3WZ0E 4IPNB 1JG9A 4LBSA 2HPIA 3TONA 3APYA 3FSTA 3HFTA 3F4WA 1E56A 1V02A 2RAGA 2DUZA 2H9AA 4ML4A 3GVWA 4O16A 4DZIA 1V6TA 2NXGA 2VC6A 3NO5A 3CUFA 3LSCA 4HVXA 1LLZA 1KGUA 3AWOA 3W6LA 1I8JA 1EJSC 1E4NA 1P48A 5EU9A 3F2BA 1UKOA 2Q6ZA 1ICQA 4LVDA 3DH7A 1O66A 1YDVA 2EPMX 1X38A 3HOJA 3DHFA 5C70A 3WUBA 3RHGA 4HIBA 5E6YA 3TYDA 2HVNA 1A5NC 4IG2A 3EXTA 1ALDA 8RUCA 4PZVA 1IR2A 4LANA 5K9DA 1AJ2A 1W1B1 2W61A 3JZUA 3W88A 2VXNA 4GKTA 3ABQA 2P3EA 4LW7A 1CYGA 1R9XA 4FEZA 2QAPA 3GR4A 1IWPA 2QCMA 3RPTA 1A5CA 1I2OA 1YLVA 1XM3A 1AFSA 3BLIA 2NWRA 1FTXA 4ZB2A 1MEHA 4GZEA 3KP0A 1K9EA 1X8FA 3WQPA 2VZUA 3QLDA 1OG0A 3T9PA 3EX3A 4FNSA 3KXQA 3QZAA 5C9UA 1PTAA 1O6IA 2FDMA 2VEGA 3V5CA 4MJ4A 3CZEA 1TV8A 2ZX7A 3KRBA 3W6MA 3P81A 5AHNA 1YQ2A 4AZIA 3I65A 4DNMA 1V3IA 1SJBA 3EA2A 4W88A 1HP5A 5AHFA 5C7VA 2B0MA 2JGYA 2G96A 4ZODA 3QW3A 1TTPA 4UTJA 4HMNA 4PODA 2BHUA 4DYEA 1WYIA 1P6CA 5M2FX 1FBAA 1EFZA 4QTGA 3CQKA 3U5YA 2P10A 5E5CA 1P4CA 3ARXA 1SUXA 1GQNA 3BCJA 1Q6CA 2Y62A 4MLJA 4O1EA 3RF9A 5CQ1A 5JBDA 3TMLA 1XDJA 2PLMA 5K4ZA 3N19B 3W86A 4AC7C 3TE9A 1WCGA 4DJDD 3OO2A 2TPSA 1F8MA 2E8YA 4JIRA 4AFYA 2PB1A 3ONCA 5IDZA 3II1A 3E0IA 4MM1A 4OV9A 1PS9A 2ZDSA 1TJPA 1R30A 2PDGA 2WLYA 1QXLA 3LCWA 1WKEA 5AC7A 3VA8A 1B30A 4UCFA 4K3ZA 5BMXA 3POCA 3PBMA 3W01A 4FXFA 3DHDA 3VD7A 2WC4A 2QDGA 2X09A 3M16A 3V0UA 4W7UA 2WB5A 2YLLA 4PR4A 1Y65A 3O06A 2ZBTA 1JUEA 4MJMA 1TX0A 3L4WA 2PTZA 3VDAA 3OU8A 3RU6A 3AROA 4A22A 3MZ2A 3BZJA 1FDYA 4L1XA 4RE3A 5G2HA 3RLGA 4AWUA 4QSFA 1FP9A 1ZTVA 8CGTA 1E9YB 4NUWA 3WF4A 4AYSA 3ELFA 6PTDA 4ZO7A 4AMAA 2FYMA 1JIBA 1MXDA 5BROA 1TYGA 2PCQA 2HCVA 3ZJKA 1EA0A 2EEXA 1ODZA 1E0VA 4H9UA 4OV4A 2NQ5A 4R5EA 4Y8EA 2JKEA 2VKZG 3VU2A 1TPDA 1REQB 4KW2A 3B97A 3H7RA 4WD0A 1XIGA 1UG6A 3E38A 4E2VA 4UCGA 1U33A 4M3PA 3N11A 4R7OA 2CXEA 3PG8A 1GOKA 4NJJA 4JTFA 1R5YA 3B9DA 3FJLA 1S2AA 1PTDA 3L2IA 3MVTA 1IGSA 3UESA 3QLLA 1UMLA 3ABXA 1VJZA 1QW9A 3LQGA 3EX2A 1W9XA 3FK4A 2BMBA 2X7VA 5T9BG 3AYTA 4RCXA 4J3UA 3LMYA 5HNTA 2XIQA 3H2NA 3WLNA 4V2XA 3IS4A 1FWIC 1DJYA 4C6FA 1LT8A 2E1DA 3LCFA 3UQNA 3SQMA 3LLFA 2HNHA 5AY7A 1HJUA 1K7EA 1K7FA 3BARA 3WL1A 1OFAA 2GGGA 2HISA 1LT7A 4GI8A 1S5VA 3OBKA 3IJ6A 4ROPA 1CT5A 4WDXA 3PJXA 1AQMA 2J7GA 3WD2A 1XRVA 2X41A 1OX4B 4JICA 3SSJA 4NNAA 1NF7A 1FKXA 2GVYA 1TUXA 1RY0A 3FCPA 4OU1A 3VILA 3VUPA 1EUAA 4D6IA 1J0JA 2GQAA 2FH8A 5AYXA 2DSUA 3RAOA 4PCPA 2QCLA 4UTMA 1H3GA 3DZ1A 4IMGA 1TV5A 4GY0A 1R85A 4ES4A 4U31A 1XKJA 1S2CA 1GOMA 3NG3A 1R87A 2ZC1A 4O1CA 5LGZA 4GO9A 1QBAA 2WQPA 2X30A 1UZ4A 2OEJA 4DNHA 3E0FA 2HE8A 1H7OA 3IANA 3EA3A 1B31A 4KRZA 3FA3A 4JR5A 2ABAA 4OUIA 1T8XA 1UROA 4F3HA 4ZB0A 3VZYA 2GK1B 3PY2A 2Q02A 4HD5A 4C60A 3ARTA 5D9NA 2VC5A 2Y0FA 1JF6A 1FWDC 3OIXA 5AFDA 1RA5A 1F74A 4RR4A 1OIMA 4QDWA 1IEVA 1XYLA 4O0ZA 3UCQA 4NI8A 3BPWA 2QJGA 3L7RA 3CU2A 4GUJA 3KRUA 4GGBA 3NQAA 3L21A 4HB7A 4AU0A 1DE6A 1WXJA 5DANA 4B90A 3G0XA 1TMQA 1Y5VA 1HVXA 4M6UA 3ZVHB 5LYRA 2CZ5A 3GSMA 4TQTA 3WK3A 4ADTA 3MI2A 3DBPA 4IISA 1A50A 3BSMA 3W2MA 4JBRA 2HS6A 1CBGA 3W7QA 1S5NA 4DQWA 4F2UA 1EIBA 2A3CA 3SCUA 4EANA 5H6HA 4O14A 1RQHA 3S9YA 7XIMA 3MW7A 2VJXA 2JQXA 3TWBA 1US3A 3S46A 4H8NA 3FN9A 3BURA 1EH9A 3R7MA 3GG0A 6CGTA 5KTLA 4FX7A 3MO4A 2BSLA 4KWVA 4UFIA 1POKA 3TQ0A 4I8YA 5DELA 2FGBA 3KVLA 3UZXA 3CLWA 2VC9A 1XD0A 1PKNA 1PPIA 3BJSA 3VNLA 5M03A 1XLFA 1EJTC 4UQAA 2VNCA 2FZBA 1DORA 4UTUA 1OT1A 3GH5A 4YTTA 1XSKA 1KXQA 1PYFA 3AJXA 2CLIA 4PFMA 3MP5A 3LRLA 3V3WA 5H2ZA 2OG9A 3Q94A 3RMJA 2WVVA 3GXPA 1UZHA 7A3HA 1BHGA 1HJXA 5ABHA 1EA9C 4F0SA 3RM4A 1H0IA 3VKBA 3W7NA 1HP4A 1XQLA 1RK6A 3W0KA 3VIJA 1KTNA 1AH3A 4GH1A 4R7WA 3DG7A 4Q8UA 5HXMA 3W22A 1IXNA 3LHVA 4CQ8A 1R7OA 3SEPA 2RUSA 2REQB 4MDOA 1L8PA 3GZAA 5LA2A 3O6YX 5BU9A 3SZ8A 4PMOA 2VEMA 4UIOA 5AHIA 1ICPA 4CQCA 3HPSA 4HCHA 5A6JA 4FSAA 3CASA 1FOBA 2EF9A 3C3UA 2Z2AA 4RXGA 1G67A 3GDKA 1EPVA 3S47A 2HEJA 3PZVA 1H1NA 2A7RA 3VKKA 3QHMA 4LPCA 4TVDA 1OX4A 4XWUA 4FS9A 3QPEA 1R2RA 5FCZA 2G5WA 4GNVA 2AMGA 3SCVA 3HV9A 2E67A 4IHCA 5AC8A 1ZQ5A 2ZICA 2YGYA 3T0TA 1TPC1 3I6TA 3GU9A 5XIAA 1N7KA 3BAJA 3E5BA 4GOAA 4OQVA 5PTDA 4H9TA 1V08A 1BG4A 2FFCA 1D2KA 1TE6A 3TQKA 2QCNA 4IJBA 3W83A 3PZOA 4IZGA 3GW0A 3THQA 4O28A 4K2SA 4YHGA 4FPSA 3P74A 4OT7A 4TOQA 3RFAA 1QNSA 1UKQA 4GCAA 4OOUA 1JUBA 4C1NB 3IV8A 1W5OA 4S3JA 5FF2A 2YFNA 3S2LA 4NL1A 3UR2A 2ZX9A 2J88A 2YX0A 1E0XA 2E4TA 3LV6A 4D6JA 4MPKA 2E7FA 3MP4A 3TYCA 2BY2A 2YDRA 2XIIA 3DFHA 3GUWA 2XN2A 1KFLA 5KZDA 2PDLA 4DLFA 1BGAA 1XP3A 3N29A 1W17A 3K4DA 3GDBA 2WWCA 1VENA 1LQ0A 4MNJA 5HULA 1R3YA 2GYIA 3TNOA 3WLHA 2H8XA 2O0TA 1US2A 4QQ3A 1KBKA 4L9XA 3WQDA 1WKYA 2G50A 2GJXB 2XWDA 1JYNA 1UQZA 4YTQA 5FF4A 1RAKA 2GOKA 4QFUA 1GJWA 2RGLA 2YBUA 3N9KA 3BUVA 1PBGA 4WJ8A 3GVGA 2PDIA 2V68A 4TX6A 5HMSA 5CAHA 4JKMA 3CTLA 2J27A 1V3KA 2AAMA 2JK2A 3A4AA 1E0UA 3TTEA 3COTA 1UH2A 1J01A 3R11A 4PA8A 1BTCA 4LAZA 2VX5A 5CSSA 1AQ0A 3H2MA 5G1MA 2X0SA 3H2FA 4D2JA 4ENLA 4P7OA 1WZLA 2YW3A 4ZQRA 5DT7A 2OO0A 1B3OA 3TN4A 4J3XA 1PUDA 3UZZA 2HMCA 2YCJA 4MSSA 1WDRA 3GBDA 1W0MA 1OC5A 4HK7A 5G4HC 1MW1A 5DRCA 2GWNA 1MMFA 2QUUA 1WV2A 2HPMA 2OZ3A 1L6FA 1V6VA 5J8LA 3KX6A 5CZ0A 3GNXA 2XVKA 2E25A 2J74A 5AZ0A 1X98A 4KEUA 3FXYA 4H7CA 5CCZA 3AOFA 5DY2A 4CEUC 5C2CA 3VGFA 2ZRUA 2PDFA 4PUDA 1AZ2A 1QNVA 2EBNA 4PMXA 4IQDA 1PKLA 2E09A 4N2YA 3MA8A 1PV8A 3AHZA 3BOFA 3JVAA 1XL9A 2C3ZA 1FDJA 4HPGA 3TV8A 2HVMA 2I1OA 2Y24A 3UF9A 1JPIA 1U1HA 3IRDA 1QPOA 5BNKA 2NVAA 5FAJA 4ORIA 1W9BM 2E77A 2I57A 1BPLB 3F5JA 4MYXA 3LCXA 1CLKA 4R34A 2O4QA 1EC8A 3B0XA 3T2OA 3LHZA 3FV9A 5EMLA 4QJ1A 2PDXA 2REQA 4NF7A 5BXRA 3NFUA 2AL1A 4DELA 3WNPA 2PDMA 1ONWA 4DBSA 1IYXA 1XBVA 2Z0IA 4LUSB 3H7VA 3E2SA 3KCJA 4EACA 4UTTA 5D2YA 4UTFA 3FJ4A 1HKJA 4TVUA 3I6EA 2WKJA 3W74A 3ARWA 4LBRA 4RNIA 4MHBA 3RJYA 3GDLA 1FXQA 3VUSA 3AYRA 4ILSA 2ZX5A 2BGSA 1DKWA 3RK8A 1MI3A 1EGZA 4WY0B 2BHZA 3LQLA 5D9PA 2PP1A 4KCTA 4NJIA 1XLKA 3BLLA 3CPUA 4M6VA 2A3LA 3T8LA 2V0TA 2WOQA 5G4EA 2X16A 1IEIA 5LSMA 1R86A 4LYKA 1MZRA 3FVDA 3AALA 1EC7A 3BCFA 3PM6A 2VFHA 1YMYA 2QJMA 3MKVA 1SPQA 4LJ3A 1M03A 2CBJA 4KF1A 5MKGA 1DL3A 1LL4A 2D20A 5AYBA 3R2GA 4CU7A 2XSXA 4PUEA 5DRIA 4PRTA 3HG2A 1MW3A 1RCXB 2Y4SA 3HGSA 4IGHA 3PULA 3UCCA 1E5NA 1W9UA 5DMNA 2Q8ZA 4IP7A 3R25A 4GNKB 5F1VA 2QS8A 4AZCB 5CBBA 1TMLA 4QBXA 4BQ5A 3CQIA 1K6WA 1U1JA 3LHTA 2ISVA 3I7SA 1LOLA 2EHHA 2INFA 5L6UA 1UWUA 4NVTA 1UBSA 3CWOX 5CZJA 3S2CA 2QUTA 3C8NA 4LUYA 3LU2A 3DERA 3SGUA 1RVKA 3WMSA 1CGTA 2DZVA 4FA3A 3ABSA 3BSGA 3VINA 4N6FA 3MTWA 5C7HA 4FAMA 1L6YA 1PEZA 4PTDA 4MJZA 3WK2A 1U22A 2E68A 2ZUUA 3VNYA 5HWMA 1EJXC 3HPAA 3AI0A 3TN3A 1PIFA 3A24A 2IPWA 1BQGA 3GNRA 1TPFA 3CZ8A 3OZMA 3R0KA 4MGGA 4B2DA 2GK1A 3TYEA 4JTDA 1T6MA 2DT2A 3DESA 3C2EA 3NQBA 1O4UA 1JQVA 1W5NA 2P0OA 1IHIA 1XH2A 5E1QA 2DORA 2PTXA 4Z1AA 3PP7A 2W67A 1E72M 5A2BA 1JYXA 2DW7A 1V77A 4IMAA 2WNQA 2WM0A 5D33A 4FOKA 1M3UA 3PPCA 3VIOA 2FB2A 1NF0A 3PSVA 1ZAHA 3AMDA 4S3EA 1EXBA 1XCWA 2WBKA 4MKNA 3K13A 4M7TA 3PBVA 5C2GA 3UW6A 1QOXA 4PMZA 2B7OA 2SFPA 4G7EA 1JDCA 3N6QA 3WNOA 4X9YA 2VX4A 4WJEA 4EWND 4AG0A 3LPOA 2X0HA 2F61A 1OADA 3LLXA 1XC6A 1ZY9A 1Q6RA 3TVAA 4LRTA 3C5QA 3UXLA 3AQUA 3UNDA 4HNNA 1GG1A 1A0CA 4UMCA 3IVUA 2R9RA 2CZEA 1OK4A 4WGXA 4ALDA 2ZCGA 4C6IA 4JTCA 1UD8A 4KFOA 3HB9A 4S3FA 3WFLA 1WKFA 4E6MA 1XIJA 2C7FA 1V6YA 5AYIA 1CCWB 2QJJA 1P0KA 3NPVA 1XYFA 2DH2A 5BOEA 3H23A 4O18A 3WD1A 2XGBA 1UR9A 2GSHA 2CZFA 4PN2A 1NOWA 4F2BA 1BAGA 4QROA 4UQBA 2FTWA 1KM3A 1BSLA 3A23A 4GINA 1E51A 1XLDA 2E6FA 4LV4A 5HAOA 2XHYA 1FWGC 3UXAA 3FKRA 4ERIA 5CPQA 3U57A 3W7JA 1OFOA 4QCEA 2DUXA 3NQGA 3NXLA 1VLWA 4NZJA 4RKAA 4B5TA 2BASA 1KWGA 1Z3NA 1XRFA 4IJCA 3WY1A 5KINA 4N6EA 3GQYA 3KEHA 4DWSA 1DJIA 2EPLX 2VZVA 2QPUA 3FAXA 3U7VA 1GQKA 4ATDA 1TPB1 2AMXA 1JPMA 4HA4A 3G8EA 4GI9A 3N4AA 2GGHA 3TSDA 1NVMA 4X2RA 5A8OA 5CEWA 2Z2UA 2DZXA 3VGBA 3HIJA 3O0FA 1NWRA 2UY5A 4YCOA 5U4NA 1UJQA 3MSDA 1V03A 4LAUA 4QE1A 1LBFA 4EWJA 1PXGA 3CHFA 3AJ7A 1UWRA 1PIIA 1W9PA 3UJSA 1XC4A 3LMZA 3VGDA 2RDUA 5DMYA 4U3AA 5G4WA 1I0DA 3UJEA 3EA1A 2C0HA 3LEPA 1CGWA 1VQTA 3TFXA 5CPLA 2BXYA 1QASA 2JFEX 2VD9A 3TTYA 2V3FA 1B4EA 5FIPA 5BZAA 5EFDA 3L2LA 1PL9A 3OHMB 4XAFA 4EK7A 4KWOA 1OM0A 4M82A 1YDYA 2OSWA 4Q7IA 7PTDA 4YU1A 1EO5A 2BOEX 1VR6A 4JIIX 2XWEA 3URQA 3IGUA 2WHKA 3H4XA 5HK4A 3M0JA 3EOSA 3FNDA 3MQTA 3WLRA 2W0UA 4AVOA 4DY1A 1GHRA 2TMDA 1KR0A 4JYFA 1KR1A 1E1CB 5CG7A 1FRBA 4PUKA 4JTKA 4UNKA 4B91A 1FDZA 2ZIDA 3PWAA 5K2ZA 5MHBA 4OKDA 4ZENA 1D7KA 2Z28A 4Q8VA 1WDSA 3CUZA 5A69A 1IQ8A 1TB3A 3PZUA 2VMFA 2KX9A 2Z6IA 4A8RA 2VCBA 1UC4A 1WXZA 1FWHC 3MWAA 4JIQA 3N1AA 4I7UA 3B40A 5I78A 3N2TA 3WDIA 1H63A 4DUVA 4Y6GA 4GXWA 3CGTA 1DWIM 3NQFA 5BW6A 4GHRA 3S8HA 3ATZA 5BWFA 1Q6DA 1A53A 3SJNA 1W6TA 4OOZA 4A3QA 1XFBA 5XIMA 3N6HA 1C3FA 2ZTKA 1CB2A 5BWAA 5F2GA 4UQ9A 2EGZA 4AX6A 1CIUA 1GVSA 3RCNA 3W1LA 3RLHA 1SR0A 3GIPA 3VPLA 2NX3A 2QDEA 2F7FA 2H3DA 3QQ0A 1EOKA 1RSCA 3GFXA 4U5IA 4YYCA 2GVGA 1EBHA 1K9DA 3RGTA 3MV11 5FL1A 1JI2A 2DVXA 2YLAA 5CZKA 4ZMGA 4NIRA 5HJYA 3L4UA 4XIAA 5BOFA 4E2BA 4MWAD 1NU5A 2JIEA 1HVQA 1YE4A 5HMFA 3XIMA 1CEOA 3M9YA 3E3HA 3SFWA 2WMJA 4LAMA 5FJJA 2OCZA 3W7GA 4HNLA 3EDDA 2XIBA 1K70A 4B9YA 5FEPA 4P8WA 2H9AB 3UWUA 2EO7A 2QUMA 2BXZA 1CENA 5EMJA 4E3VA 2PC4A 2AOSA 2CKRA 4ADUA 2ZX8A 1XHGA 3MYOA 1F3WA 2Y5EA 1WP6A 2BVDA 4XD5A 3AS0A 3STEA 7TIMA 3IGSA 1G0CA 1KFWA 4LF1A 4A2RA 1RPXA 4Y7EA 3DDMA 1FFQA 3T55A 1V7YA 3ES7A 4O57A 3LX9A 5CBIA 2A7PA 1FHVA 3M46A 3WFAA 1QPQA 5BRBA 3GAYA 2D2JA 2QVNA 3LHWA 3H7UA 4CD8A 2YPIA 2Y7FA 1ME8A 3NL3A 3MUY1 1IZJA 3TN5A 4JCLA 3TA9A 2HDJA 4JNMA 4Z2LA 4IIFA 4S1FA 2D1ZA 3MI6A 2ZA2A 3MS8A 2PGRA 4TIMA 5J04A 1K9FA 4DUWA 3AIVA 4CKQA 1VEPA 2DP3A 2ZZ5A 3VOGA 1QW8A 1ZRQA 2GFTA 2PODA 1I45A 3PZIA 3R43A 2QMKA 1QOQA 2ASHA 2PGFA 4M19A 3V4BA 2C91A 3R10A 1AVAA 3C2RA 1GTHA 4FLOA 2PZNA 1J5SA 2AQWA 1VAHA 5M17A 3T8QA 3RG6A 2Z1VA 3UA4A 3SY8A 1UR4A 3ARPA 4HCDA 3I4KA 4Q7BA 5AB3A 3OVQA 1YKWA 2BY3A 1XLMA 1HJQA 4DJFD 4AVFA 1YXYA 3TTOA 3BGGA 1AW2A 3S1XA 3QXBA 3T2PA 1F7BA 4FLRA 1TWDA 3WO8A 3P0WA 1JAEA 2WVTA 1OT2A 2HK1A 3ZR5A 1YPFA 2VURA 3H22A 3GBEA 5EKYA 3LXAA 1QI2A 3G1DA 4HK6A 5CJNA 3GVRA 3A5FA 3DU0A 1OHLA 2ZXBA 1P0DA 3CZLA 1B1YA 2YCEA 4HNVA 3G24A 4Y9MA 1BQCA 3ZVIA 1TJRA 2ZXDA 2QCFA 1XW8A 5C55A 4MZ1A 3CV6A 4ZTYA 4UXDA 4JQ3A 2RGMA 3N3TA 4IMFA 5ABGA 3QFEA 1EQCA 2A3BA 3N4FA 3WQ4A 4QG6A 4J28A 1FCBA 3QPYA 3DG3A 1BEUA 4LB3A 3VKCA 1P0BA 3E74A 3H21A 1S5MA 2V67A 2Z25A 4X0NA 4IP5A 4BEUA 3VDGA 2DDXA 1MZHA 2GLKA 3BQ6A 1NIUA 4XAPA 3U4FA 3AXHA 3E0WA 5H1WA 2EG6A 4U28A 6ENLA 4JKKA 5CSYA 5BRQA 3DYOA 3MBDA 1S1PA 3VE7A 5CSRA 4HNTA 4K8EA 4LS1A 3W1TA 3TCSA 2OU4A 1FH8A 1EX1A 4ZE4A 4LVBA 4K39A 4MWAA 5FF0A 1LG1A 3TWAA 5CGMA 4IL0A 3DCPA 4U4MA 2BTMA 3W4RA 2QCCA 5I3KA 3RDKA 1LWJA 1O1HA 3GXFA 1EWEA 3ARYA 4D8AA 2CLPA 4QAWA 1HGWA 3RITA 4D8ZA 1LWHA 1IIGA 2J9ZA 1IR1A 2J47A 4H01A 5J5DA 5EFFA 1ISYA 4BFAA 3TYUA 3GH4A 4HNUA 3ARRA 2G41A 5JBFA 2W91A 3VXGA 2FPVA 2VHLA 3BLEA 4YL2A 3IJLA 3MJMA 5HUPA 3AS1A 1UKSA 2J7CA 1IV8A 1TR1A 5FJIA 3UWEA 2C71A 1W8GA 3WD4A 3MC5A 2QDHA 3B8WA 3O1NA 3TXZA 1G4SA 2GJLA 4QDMA 1XF0A 1D3CA 4M6PA 3NQMA 4C65A 2BY1A 4QISA 2EAWA 1RJPA 4F0KA 2WANA 1LF1A 1J6PA 4RPPA 2ZOXA 1XIIA 4AC1X 1S2UA 1IEXA 4YTSA 1GVIA 1XH1A 4KRTA 4NNCA 4X0VA 3G1VA 3P3BA 1H5VA 1UUMA 3NGFA 1QTWA 4MB1A 3PWIA 3DYPA 4UFJA 3SRDA 2CLMA 3CC1A 5JIWA 3DI1A 2NV2A 4L65A 4JYDA 1KQYA 3C8FA 1CPUA 1WE5A 2YSWA 5D8WA 1XGZA 4C1KA 2WZHA 1BG9A 2VEIA 1M7PA 3DEQA 4HN4A 2VWTA 4W8LA 3GK0A 1HF6A 1AZ1A 1W1TA 3G1XA 4FF7A 3QY6A 4RDYA 3GW3A 4KEVA 1DPMA 1MQRA 1Y7VA 2XINA 1XCXA 3PANA 3S42A 4FNRA 3JS3A 8XIMA 3BDKA 3RM9A 2G3NA 3QGAC 2PU0A 4RJEA 4V28A 4HZ6A 3F1QA 1TV7A 3SIZA 3NR0A 1X39A 4GZJA 1ZALA 3PTKA 3VKAA 1AJ0A 2MANA 2O56A 2FZDA 3G18A 4O52A 4BHYA 3ECQA 3CO8A 1IWAA 1GZGA 1SFTA 2HTMA 4MKVA 5B7YA 3B0PA 3A4XA 2J78A 1JRCA 5FF3A 1XYZA 2YCIX 3OA5A 1NDZA 4A4AA 3INPA 1RBLA 4XQ6A 1CGYA 2VL4A 5HMEA 2ZRXA 2JEPA 4D72A 3MJYA 3VNMA 2ISSA 3I3DA 5JXQA 4JNYA 2WMGA 3LI1A 4HGXA 4D6DA 1Z42A 3HURA 2WLZA 3KOYA 2YKKA 3EX4A 4A8LA 4R7JA 4AEEA 3UJFA 2DPEA 3DHPA 2Z1XA 3CAVA 4DUXA 5EB8A 4WF7A 3A21A 4JKLA 4JFWA 2BZNA 5EMYA 1W3TA 5DBUA 3B05A 4JTAA 3GD6A 1J2WA 1MQPA 4QS6A 4PMJA 2WMIB 4JTHA 3F5LA 5C54A 3EZ4A 2A85A 7ENLA 5DFAA 4IUOA 4IIHA 2ZRVA 3G22A 3QY7A 3QR1A 4H4IA 3VOFA 4DJEC 5DMMA 5CZSA 4O12A 2XM2A 3W1MA 2WZMA 2VX7A 1G6CA 4X61A 4GYKA 4QR6A 2V3GA 1WDPA 1T5AA 3A4WA 3WBAA 5E0CA 1HT6A 4V1YA 2V63A 4C6LA 4F4RA 4JEQA 2YA0A 5J5RA 2D3LA 2GPTA 5CZTA 2VCAA 1MFVA 2ZUTA 3CTTA 1MEWA 2PURA 3BLKA 3Q45A 2V30A 3BE7A 3O2LA 5LNRA 2J6XA 3F7JA 3P84A 2WVVB 4O4WA 1CXEA 4HA0A 1D8CA 3TJIA 3HTWA 4JY9A 4LFYA 1NJJA 4AXKA 4J3SA 1KM2A 2VX6A 4RV8A 1LWIA 2QUNA 5C71A 3GR8A 3R79A 3TYZA 1KTBA 1QT1A 1BLIA 4GQRA 4ZOEA 4LTSA 3W7MA 2TYSA 5A2CA 3BW2A 4DEFA 2Z1WA 4JGDA 1J0IA 4H9MA 5E0FA 4AD5A 2EJ1A 3OB8A 3JR2A 2R1NA 2PRLA 3W2KA 1J93A 4J7RA 4Q4PA 3H6OA 4I90A 3GG1A 2ANUA 1BYBA 5DXYA 4F48A 1ML1A 4FR6A 4TR9A 1TSIA 4HOXA 3PZMA 1JULA 1T99A 3W84A 4JN8A 4H19A 1XLLA 1FUYA 3UR7A 1QDSA 1U5JA 2F2HA 3TOPA 1VPXA 3GTFA 5GNYA 3EWYA 1W3IA 4DJDC 2C13A 5I0DA 1LJYA 3WJWA 1S3HA 3VZXA 5T8GA 1VBUA 1YHTA 4Z2HA 4ICMA 1FFRA 2VWSA 2UZ9A 1H62A 3WLKX 1B3YA 4MPQA 1F07A 4CLMA 3FY1A 3KBWA 3QFWA 1ZNNA 7REQA 3PJTA 4GBUA 2CHRA 4LBUA 4B3LA 5F7UA 3E2QA 4PMQA 4TO8A 1OQFA 2JF6A 3FJ6A 2Z2BA 3RR1A 1GZ1A 3WD3A 2LLEA 4O1BA 3GIQA 4AD2A 1TPUA 2ZZ7A 4E4UA 3WQOA 3W6YA 4M6QA 1V02E 1UOZA 3CAQA 5JUVA 3W1RA 2OO6A 1K9TA 1GONA 3WSUA 2AGKA 2XJ7A 2R1KA 1FQ0A 2YZ5A 4NRSA 5HPOA 1THFD 3GLCA 4KQNA 1A5UA 4PULA 3U6WA 1YXDA 2YFOA 2BGNE 5ABEA 4HHMA 4Y96A 2PDUA 2ATSA 2J7DA 3K1GA 4IPLA 2OZ0A 3MMUA 4IPPA 1HX0A 4TTGA 3SJ3A 5KEZA 4IMEA 1OC7A 1RP8A 4LWWA 3TJLA 3ZJ7A 1OC6A 3WCZA 1KO0A 4CVWA 1E55A 4R27A 2WKGA 5JQ9A 1NDYA 1JF5A 3BAXA 3KVJA 4FXRA 3SRHA 4KT2A 4UNIA 3MU7A 2F84A 2CLFA 4N9CA 3TJ4A 2WC7A 2XVLA 1MUWA 3LOTA 2DIEA 1JJKA 3EB2A 3M0HA 3L5LA 1RPKA 3BOLA 4HPXA 1OX5A 1KRCC 2F2KA 4FXSA 3LXBA 1Q5MA 3WELA 5F2IA 1OB0A 4NJGA 3LUTA 4NZFA 3HPZA 3KDNA 4WUIA 4PTWA 3G5EA 1ZJAA 4D6HA 3LG3A 4E3TA 4KFPA 1H1ZA 2VTFA 1JCNA 4WDUA 1SFJA 3MKKA 5GVJA 3CUIA 4KS0A 1H7PA 4CQDA 1MWOA 1V0NA 1SO6A 2DIKA 3GE7A 1JL8A 4CGTA 4XKMA 1ZGDA 2Y5JA 3WQWA 4RZ5A 2HQAA 2YDSA 1C92A 3NM3A 3KP1A 5AOUA 3VNIA 5H8MA 5BRPA 2OEKA 2I56A 3M07A 2GWGA 4K36A 5HR7A 1WZMA 5IFTA 1UASA 4A3YA 1Z44A 3AHYA 2VFDA 4AMCA 2OODA 2IW0A 3GXIA 3TXVA 3SFKA 3C0QA 3VIMA 3ITTA 4ATWA 3T7VA 4YXGA 2W6RA 4GACA 4DWSD 4E2DA 1V51A 2AGTA 4XISA 2YZRA 2O9PA 3DOPA 1BRLA 1ISXA 5FSDC 1GOWA 1YRRA 3O0KA 4OTKA 4XK2A 1JVNA 5I3GA 2PWEA 3SAZA 4W9TA 3WK0A 2VDHA 2X1IA 1B3ZA 3L66A 3T08A 6ALDA 4AZCA 5D32A 2WMIA 2QVHA 4XUYA 4Z42C 2OTDA 4XSMA 4DRSA 3IUIA 5FJOA 1E9ZB 4WX2A 3QR0A 1OFPA 4HCLA 2IS7A 3MUCA 1CNVA 4O19A 2PTYA 3U3HA 3ABRA 2YA1A 2VGGA 1GQLA 5MKGB 1ONEA 4PSRA 1RUSA 1W3NA 2QCGA 1JPHA 4NAEA 3GRIA 2V5CA 2NUXA 5TD4A 1IIHA 3GKAA 1TJ0A 3EWXA 3QH2A 2G95A 3BOXA 5AVHA 1DJHA 2RHGA 3WMBA 1HKKA 3OZYA 4DJEA 3PJWA 4GK8A 4ZQNA 3PUOA 3WYZA 5HQMA 2IMRA 3A64A 3K46A 1E9IA 3GHSA 3ICJA 6A3HA 4HNCA 3H53A 4HHHA 4J9JA 1ADSA 4E8GA 3M0ZA 4WKHA 2QIWA 3N04A 3OHIA 3L67A 2HRWA 4IFKB 4YWIA 3A4JA 2NVCA 4N9DA 2XGIA 4MZYA 2J7EA 1H50A 3T1GA 4TXEA 3H70A 3OEXA 4IF2A 1PHQA 4S2CA 2IQDA 2W27A 4JY8A 3MI3A 3KCOA 1CDGA 3GU1A 1ZLPA 1XGEA 4E4FA 4S3AA 5REQB 1X7FA 5CC6A 2W79A 4CVUA 2O7SA 1ODUA 4XVEA 3W7LA 5C9XA 4LUJA 1PX3A 3WDPP 4IFRA 1OCBA 3PTDA 4PMYA 4Y9OA 5HPCA 3N18A 3ZS4A 3KHJA 3STFA 3KBNA 1VH7A 4H41A 1E6QM 3AU6A 3SN4A 2BDQA 2VR5A 3FOKA 3BH4A 3MHFA 5A6SA 4WDWA 3E9AA 3W25A 4ZBCA 1O5RA 4XG1A 2PDYA 1P0EA 1XICA 1LRNA 4AD1A 1C8VA 4ADSA 1S3TC 2NQ9A 3AMKA 1Z89A 2PFHA 3VGGA 4GG9A 1EYWA 1FWNA 3NPUA 3QOMA 2XVGA 1S1RA 3TK7A 3WJYA 1VFSA 3N17A 4HJWA 1KLZA 1LTDA 1XBZA 1U2YA 4LV9A 4CNUA 2RJGA 3GO2A 1UIPA 2QMJA 4MY8A 1A5SA 2RDXA 4DM2A 3IAQA 1Q63A 3ISIX 4H00A 1BYAA 3WF2A 1I0BA 1KCKA 3AZRA 4G9PA 1HL8A 4R85A 2PA6A 2ODOA 2PI6A 2Q3OA 1TTJA 1X1OA 2FMOA 2YOCA 1TIMA 2H6RA 5K7JA 1EO7A 4BQ3A 3CZGA 3B9NA 3L4VA 2OQHA 1HO1A 1OK6A 2ZDRA 2WHMA 1YDNA 5C8BB 3BLFA 1OF8A 3GDTA 2ZFAA 1GPWA 3T42A 4G8TA 3G1SA 1JDDA 3LENA 1EB3A 4JIHA 1Q8AA 1XDLA 5EGRA 3VDHA 2A3HA 1SZGA 1R3TA 5M1TA 2P8CA 3L0GA 1F8IA 3OLIA 3OGSA 3R94A 3G0SA 3HG3A 1WA3A 3N12A 3RJXA 1B3XA 3S1GA 2W66A 1KV5A 3XISA 3W2NA 3O6DA 4D9PA 2J6VA 1RJRA 4P7QA 1UP0A 3C86A 1JR1A 3AIUA 3VE9A 5B7ZA 1EXPA 1RP9A 2D0HA 1JZ6A 2V6AA 3KAOA 3AZTA 3SN1A 3GX9A 2Y2WA 3NZRA 4JL1A 3CO4A 2XYLA 1F76A 3WQGA 1ZCOA 3AS2A 3DECA 2OXNA 3VIGA 3WQFA 2V9DA 3OBEA 2E3ZA 1AODA 4LS0A 1RH9A 2YYUA 1KB3A 4UFLA 3CHCA 2ZRWA 3DFPA 5CPOA 3WNLA 2NT1A 4QXIA 2YCKX 2UWFA 3E12A 3KL0A 2R94A 3WH9A 4AD4A 2OJPA 4GVFA 1XD1A 3C2YA 3HPFA 4NILA 2OX1A 1TRDA 2PUZA 3GTNA 2CPUA 1E40A 2DZAA 3GAKA 4GNJA 2C15A 2PWDA 2HV5A 2PS2A 4BEQA 1JNDA 2P0IA 1E5JA 2DT0A 1FWRA 1CWYA 4QQUA 3F03K 3VGHA 2WCSA 2CBUA 4D8LA 4KGLA 4CEXC 3EDFA 4B4FA 2WXDM 3NWRA 2Z7KA 3H26A 2P50A 4K8GA 4FNPA 1J5TA 1XIFA 3K8KA 1P0NA 1V0KA 2XN1A 2MNRA 3AMCA 1DJXA 4HT3A 4LEQA 3AIEA 3GG7A 3QSRA 1W1VA 3TYBA 4QLKA 5HOSA 4YYFA 1KFEA 3UPMA 1QJWA 2D22A 4B92A 4M5PA 4M29A 3WEOA 3E2VA 4IH3A 1J0HA 4TU1A 1L6WA 1W91A 4JFUA 6REQA 4US6A 1H7NA 3STPA 8XIAA 2ATMA 4BI7A 1TZ9A 3MCOA 1QPRA 2IPJA 1BF2A 4GKLA 2GUYA 5A8NA 3D3FA 1GG0A 3P0XA 5A6MA 3ANVA 1XLHA 2IQ0A 1V6WA 4H6EA 4W89A 5EMUA 1K4HA 1Q13A 4C6OA 3BJTA 1QHPA 1M65A 3GC4A 3IVTA 3LRMA 5HQEA 4XBKA 1Q45A 3CIXA 1R2TA 3NJ3A 1KKOA 1B3WA 3CJPA 3PAOA 3GHTA 4TX8A 4HU3A 2C1IA 3URBA 2EKGA 1EF3A 4F0HA 4D1JA 1FHDA 3I7RA 4CN4A 4FNUA 3BQ5A 3A13A 1L6GA 1UJPA 1W3HA 1A0DA 5ABFB 3LM7A 3TLLA 4XD4A 3NM1A 1TA3B 4PB5A 1RD5A 3BVJA 1BWLA 1M1BA 1C8XA 1GEQA 3KWXA 1H41A 3NZPA 1UZDA 3W38A 3GIYA 4JN6A 5EBAA 2A7NA 1AL8A 4GQ0A 3E02A 4GVGA 3O63A 3GFYA 3QEZA 4BCEA 4LYRA 3C2OA 2QCHA 3IAPA 3MMDA 2WJZA 4FOJA 4LQ1A 1DJZA 2BB0A 2VFFA 4AZ7A 4REQB 3W7OA 7REQB 2Y7DA 3DYMA 4PE8A 3M0MA 4AWTA 2QGYA 1FCUA 2AKZA 4YVPA 1MEIA 4JX5A 1IEQA 4GC3A 2F9RA 1ZBVA 1Y8BA 1ME7A 1VFLA 2YBVA 4YVVA 3SUVA 2ZUMA 4CD6A 4H9VA 5DMLA 1EL3A 3F2CA 2D2HA 4DF1A 3GXNA 3P82A 3AISA 5FF7A 8TIMA 3EYPA 1Z9AA 1W8SA 1N2VA 4N02A 3ZWSA 4GFIA 4W84A 3WNMA 4S3DA 1KCZA 1OCQA 2BODX 4I5RA 1MRAA 3LPPA 3M0XA 4OBRA 1ZU8A 1SO4A 3ZT5A 3I6RA 2J8GA 4MFDA 1V93A 3OLEA 3GNDA 4Z2IA 3CS2A 2QJIA 4NKCA 3UYIA 3MUIA 2CWXA 3R8GA 4TV6A 3QYSA 1UWIA 2OLAA 1GGOA 4H8VA 4PMDA 2GDQA 3ARSA 4C7DA 1VGAA 2BP1A 1ZP4A 3H55A 2W4XA 1IZCA 1I60A 3VNZA 1OFRA 1OABA 3H2OA 3GWQA 3LBOA 3NQDA 3SCTA 1UMYA 4GX8A 4LUTA 4HTBA 1OG6A 3M5YA 1XJBA 3HQ1A 4FX6M 4C7GA 5CC7A 1A5AA 1OF6A 1TE1A 5M5DA 2Z4GA 4AD3A 4WSHA 3TLQA 3WFZA 1LP6A 2G4FA 3LHYA 4ZFCA 4RW3A 3IUHA 4NAFA 1YXCA 1XSIA 2H3BA 3V35A 3RO6A 1EP2A 2ZZ3A 4UR9A 1F2JA 5FAGA 1R6WA 3FGCB 5F4XA 1JQXA 3T2QA 4DF0A 2OYKA 1RA0A 2D73A 1AH4A 3SUSA 4GABA 1QNQA 2D2GA 1YTEA 1U83A 4LAKA 4KWWA 4KCUA 1T96A 4ZCWA 4HU4A 4PRRA 2Q3RA 1EJRC 4A21A 1TZZA 4GFSA 3RN6A 1T41A 3CM4A 4PTXA 4JFVA 3W1NA 1V0LA 4NAFB 1X97A 3WDRA 5DCDA 4OZOA 1H1YA 1JEZA 1MVYA 1XKYA 2I5QA 4XUGA 4BWLA 4TMCA 4TX9A 4A8NA 1LYXA 1P6WA 2XZ9A 3EOUA 3MDWA 1NARA 4P8UA 1BFNA 4D71A 2EPKX 2CESA 1XV8A 3R8HA 3UYCA 1QWGA 5GJMA 4NX5A 5A8PA 2FVMA 3KDOA 3PTMA 4C90A 3O3RA 1X7IA 2WHJA 4RDVA 4S3KA 1GQJA 3AAMA 1Z6KA 3ERPA 2BOFX 4GPNA 4NHVA 1Z48A 3CB8A 2WSPA 4UOJA 1RZMA 3BWWA 1BRLB 5G1TA 1EEXA 1T0OA 4JTTA 1VCGA 4H6RA 2WNNA 3UG5A 2W3ZA 4RE0A 3G6MA 4MADA 4HZ8A 5KZEA 1Q7QA 2VR4A 4RPQA 1JZ3A 1TTIA 3NL2A 4QAIA 3S5ZA 1E70M 1CXHA 1XRSA 3DKLA 2DZWA 4GIYA 3HG4A 1DWHM 4V15A 5AHLA 4MFEA 4KRUA 1XRTA 3ZQ9A 3BL3A 3QMTA 2GJXA 3EWBX 1HTIA 4DXKA 4XBJA 4Q8PA 1ZP3A 3BLOA 3IJDA 1UZ1A 4DLMA 4K6AA 3ZSTA 1R8LA 3VX1A 4B5SA 4PUJA 3I4EA 3TH6A 4IWWA 1W37A 3NYZA 4JQ4A 1XLBA 2C18A 4U33A 1KFJA 4I6KA 5BU6A 5GNZA 2BY0A 3U2EA 1KM5A 3OGRA 1R3QA 5JH1A 4M1RA 1D3GA 3CUXA 4DO4A 3UWYA 2A6NA 1S39A 1US0A 4ICCX 5EBUA 3GZ3A 3W23A 3UXIA 1XYMA 3N34A 5I02A 2B7PA 4W87A 4FLSA 2ISWA 1BD0A 3AXIA 2ADAA 1LCOA 2TODA 4Q22A 4EPKA 4WGHA 4MWAB 3SADA 4WXZA 1L2UA 2WMHA 3IUDA 3WDJA 3STGA 4YTUA 2PWUA 4LVGA 2ZZ4A 4I5UA 2YR1A 3PUEA 1KBLA 2HWGA 2CEQA 4ZVJA 1SW7A 4RLIA 4Q8MA 2CETA 4GYPC 2QYGA 2F6XA 4L64A 4XX6A 3VIKA 1DXIA 4F79A 3WN6A 1XLIA 2GOUA 2NQZA 3OPSA 3LGGA 4BJHA 3SUWA 3UVAA 3KTXA 4OBTA 1FWCC 3CV7A 1MXSA 4DWDA 2OOGA 3DFOA 1B54A 2ZA1A 4Z17A 3MMWA 4MTVA 3C56A 4EPDC 1M9HA 4CU8A 1XLJA 1KGXA 4O54A 2Q8LA 4LSBA 4WZHA 2BNJA 2GSEA 2KAUC 4G5DA 3K2GA 3ZLFA 4NJHA 5LNUA 2XTKA 2GVEA 3WF1A 3W1UA 4UMAA 1OFQA 3SCRA 1EDQA 1SZFA 1DQUA 3MVIA 5IRPA 4GUHA 2DZPA 1GHSA 3EDEA 1IXQA 4A3UA 4Z0SA 1KC7A 4MF4A 1NFGA 4G6CA 5T26A 1C9DA 3FXGA 1TKKA 4N7QA 4O0QA 4TMBA 4HNOA 2J7HA 5JBEA 2CBIA 4KGJA 1VFMA 4GJ1A 2PDJA 2H8ZA 1CXLA 2DUAA 1DHKA 1S5WA 3QYQA 3VABA 4P7RA 3GB6A 4XD3A 4XBSA 7ODCA 5HNRA 4QLLA 3A22A 1NM9A 1QRQA 4AF0A 1B57A 4Y9PA 1RLCL 3QSTA 4H3DA 4PBEA 3WEMA 3TW7A 1N8IA 1JDFA 4HN8A 4PSPA 3PBUA 3PFRA 3RU8X 4ZR8A 4I8DA 2GVJA 4AEFA 4O13A 4Q4KA 2JEQA 2E6YA 2BBFA 2H90A 3L5MA 1CB7B 1J2BA 3VAVA 2J4GA 2IKJA 1LG2A 2Q01A 3WQ6A 1E6NA 1BSIA 1GVQA 1KBBA 4RZBA 3EB4A 4MWAE 3WBYA 1A3WA 4UTKA 1E6PA 4W8AA 1VEMA 1EEPA 4H7ZA 4A05A 1KTCA 4ZGYA 4PUWA 4F2TA 1LOQA 4EP8C 5DY3A 4ML9A 4DBUA 2PWGA 2G97A 1PDYA 2FGLA 2YDAA 3SCQA 3CIVA 1EP1A 4WKAA 4N4QA 4TTUA 4TVCA 1I2RA 3FHAA 3CPRA 1F3XA 3KRZA 4ZO9A 1OWQA 1J9YA 3VMOA 5LNVA 3PPGA 4M0XA 1IT0A 4NSBA 3LDVA 4KIRA 1AMYA 1JI1A 1JZ2A 3SBFA 4WR3A 3AMLA 3L68A 2NV9A 2EPOA 3AHXA 2PRHA 3PZQA 2QNEA 4PCTA 4XKYB 1OD8A 4AIEA 1IZKA 4DI8A 2ALDA 3J7HA 1EPXA 3PPFA 1Q6FA 1YBQA 2DVTA 2PDNA 3N73A 3TC7A 4QDPA 1GW9A 1LLWA 2O9RA 4EPEC 1CI1A 4OECA 3NSNA 3CAWA 4HHPA 3GM8A 2ZZ2A 4JZ5A 3B9AA 4UQDA 2V2HA 3WUGA 4BKNA 1TJ1A 3LSBA 5D9OA 1JZ8A 3TA6A 1WO2A 4G1NA 1NH6A 1LRTA 5D8ZA 3P93A 5REQA 3V36A 1YIXA 4ERAA 1QW7A 1XUZA 2GGJA 1DTUA 2XFFA 2WZIA 1XDMA 4L6OA 3CWHA 3KRSA 1ONRA 4QJ5B 3ME3A 3C3NA 3SCPA 2HNEA 3B8TA 3K8MA 3W76A 3NQ8A 4EPBC 3PB0A 3R6IA 5A6TC 3U2CA 6TAAA 1O5QA 5IFPA 2WSRA 3ATYA 1M7XA 3DHUA 4LT9A 3GUGA 2ISDA 3WLSA 3SY5A 4LYQA 3UBPC 1IGWA 3IJ9A 1TWZA 2A1YA 4O8AA 3W7PA 3ABZA 2VI0A 3ARUA 3NA8A 4XAZA 4HSHA 3VMNA 4H6QA 1JD7A 3V75A 4IT1A 4L4LA 4UTTC 1XIDA 5KZ6A 3OJGA 4PRWA 3ES8A 4DJFA 3R12A 4DUOA 5AN7A 3MANA 3E2RA 4JTIA 3CL7A 5M3WA 2V2CA 2J25A 1LORA 3GFZA 3RPMA 1E6RA 2V2DA 1SQ7A 3QMRA 1XR2A 3SR7A 2EPNA 3FEQA 4IPIA 2ABBA 2WHLA 4NJKA 4NZ3A 2D3NA 4IGNA 1FY6A 1Q2RA 3MP3A 1Q66A 3G2GA 3NOYA 4KERA 1DXFA 5CSUA 2BWGA 3UG4A 4B3ZA 1XUUA 1F05A 3CIWA 1N8FA 6XIMA 5GNXA 2PLKA 3KOXA 3RLVA 1VJIA 3QQWA 3IJIA 1QHOA 4FR1A 1EJWC 5FOOA 3FLUA 4R33A 4PTNA 4X60A 4FHAA 4Q8QA 1G94A 2VGFA 3L4TA 2NXIA 1VYSX 5LIWX 1G7UA 3UWQA 2G3IA 2CU0A 1E43A 1LQAA 3O6CA 2ZTJA 4M7SA 1OEPA 3OGVA 4B15A 3CV2A 5DLCA 2Y63A 3IVSA 2Y1HA 3NSMA 5I00A 1I4NA 2Z24A 1VPQA 1O95A 3VCNA 1DWGM 1C90A 4Q3MA 1UD3A 4MUZA 4ATLA 3A3XA 4AY8A 4GUIA 1UB3A 3ONBA 4UUIA 4DXVA 3SUTA 1JPKA 1V6UA 5D37A 1CW2A 4Q33A 2VM8A 5HWNA 2ZXAA 2WYSA 2VEKA 1UBPC 4G56A 3O07A 4HK5A 4RE2A 1WB0A 4O15A 1GT8A 1M6JA 3IIVA 3W70A 5BXPA 3PJUA 3TSBA 1DTNA 4KESA 4POCA 4F9JA 5LNSA 1UP2A 3M0IA 1BXBA 3R89A 3UG3A 3RYSA 1VFOA 4JIPA 2OZTA 3WBEA 1UD6A 1XBXA 1VBGA 3LN3A 1WX0A 1I2NA 1A5LC 4KEZA 1JRBA 3PFMA 1A5OC 2ON3A 3NPWA 1A49A 2PEVA 4X9SA 4HYVA 2PTDA 2QJHA 2Y70A 3SCWA 2VOMA 2W62A 3LZ3A 3T4WA 2OZ8A 5LXEA 2ZRZA 3O15A 3U0HA 3TAKA 1NELA 1EQPA 1ECQA 1K02A 4C5ZA 1UR8A 3S1WA 4WSKA 1SU5A 5D04C 3PNUA 3GYCA 8A3HA 4LNCA 3M64A 1SR9A 3VD9A 1TA3A 3PZ9A 2F6UA 4B5NA 4S39A 3BSHA 1WQ5A 1DJGA 4X3ZA 3W28A 5ABFA 5I2UA 1W3KA 2TRSA 4WSJA 4ZQCA 4MDPA 3GDMA 4CN1A 5CG0A 2ZZ1A 3L4XA 3L12A 3IACA 2NX9A 5GPRA 4QNWA 1UKPA 3CPGA 2E1WA 4DIAA 1L8NA 4E38A 4XSLA 4FLQA 4FF5A 2W63A 4R53A 1JZ4A 1HJVA 3GXTA 2WSQA 5A1AA 1VBHA 1R0MA 1EDGA 1O5KA 3AXXA 1CLXA 5C9WA 2Y7EA 1AQHA 3A9IA 2CNCA 3W07A 1TO3A 4GJIA 5G2IA 3TTQA 2OB3A 1TX2A 1ZJIA 3TX9A 2OYLA 3UP8A 4I9AA 2WMFA 4DWSC 4AHOA 3JRKA 5C9ZA 4ZSTA 5DO8A 5TBOA 1ZAJA 2FTYA 1RK5A 3NURA 4JTLA 3TEVA 1VBRA 1KXTA 4GIEA 5CAKA 3TN6A 1F6YA 3LTSA 1SJDA 2X1UA 3CT2A 3LB0A 5CPSA 1MRQA 5A8QA 3FAWA 4N9EA 4Q4QA 4QG8A 4ROQA 4BI5A 3P8IA 1PE1A 4HTYA 3QRHA 2INEA 2D23A 3EWWA 1QPNA 4P7LA 4W4QA 4H9XA 2IKHA 4HA1A 1ZBCA 3P6LA 1HFBA 3KFTA 4JTRA 2B31A 2XSAA 3NOEA 4QIUA 5FI8A 3H8AA 5FL0A 3VCCA 3T40A 5T9CE 2GQ3A 4DYJA 3CV1A 1GKQA 1QFEA 9CGTA 1F6KA 1XYAA 1BTMA 1R3VA 3KOFA 4O50A 1C29A 1FWTA 4QP0A 3V7PA 1ZAIA 1HQTA 3QW4B 3RXZA 1MQQA 4IL2A 4JDYA 1UUQA 1E6XM 1VJSA 5A6KA 3DFQA 1XLGA 4XZNX 4L4OA 2X2GA 3W1XA 5H8PA 1LBMA 4WHBA 4IJRA 1TPH1 4ZO8A 5D2TA 4EIVA 2XFYA 5HINA 2D69A 4BR1A 4HJFA 4ZQOA 1R46A 4DVOA 4EXQA 3THCA 3SDOA 3V5FA 4DB7A 2DT3A 2OSXA 2HS8A 1POJA 3DC0A 3R13A 4JQ2A 1JCJA 1UC5A 3CQ0A 1Q6QA 2OQYA 1NOFA 1B4KA 2D24A 1ZBWA 4K7YA 4RK8A 4Y90A 2P53A 5HJXA 1WZKA 4ASTA 2FIQA 3NGJA 5I79A 3C4UA 4ZL1A 3SQSA 3SO7A 4GZ7A 2EJAA 4HPNA 3RX3A 4J3ZA 2WCGA 3HO8A 1OVDA 5EL1A 4E2OA 1C7SA 1JCTA 2XPKA 3ABOA 3KE0A 3TMQA 3OVRA 1UPPA 2R1MA 4TV5A 2OLHA 2A0NA 3W7HA 5EYWA 5D03A 1J0KA 4NNBA 2B4GA 1Z7AA 4CU6A 1KM1A 1UPMB 4A3RA 1QK2A 4E0CA 2AL2B 1UIOA 3VD4A 3HU7A 3UXDA 1VEOA 3EPOA 3NDOA 5F4WA 3TU9A 3WLMA 4ACZA 1GOIA 2J66A 4GZIA 3OG2A 3W00A 3L65A 1QHZA 3BG3A 3W85A 4JEJA 1CZ1A 2YXGA 4AEOA 2JBMA 1VB9A 2PP0A 1KQZA 2DQXA 4K1GA 4NYYA 2V82A 3WENA 3T78A 3P60A 4CQBA 2VVSA 3RLUA 3BW3A 3CLMA 1NFBA 2CC0A 4A8IA 3PBWA 1FP8A 3L2MA 3T07A 3FHQA 3ARZA 4O1DA 2VT0A 2X42A 3MCNA 3W29A 3ZXWA 2WO5A 4Z0JA 4C6KA 2CCRA 3RR4A 5D9MA 4C6PA 2AL2A 4J2MA 2WNZA 5AHEA 3JUGA 3OODA 1GYLA 3B8DA 2FB3A 1M04A 2ZUWA 5EA9A 4IXHA 1TR9A 3PUDA 3FVMA 3SCSA 3S9IA 5TF0A 3B8UA 3H4WA 4P8VA 4QG9A 2DJLA 1QI4A 4EOUA 4A3HA 1J11A 4QRNA 2DZBA 2ZC8A 1EHAA 5C6MA 1UP3A 2DZUA 4DAIA 3HA1A 3MY9A 3LY0A 4NZ4A 3FS2A 3QHNA 3BAIA 1OGBA 2ALRA 2J7FA 4C6BA 3STCA 4IFKA 4GRSA 2C6QA 2ACQA 4NQ1A 5FJTA 3CNYA 1DHPA 2WZEA 1GOQA 3CUHA 3VM5A 1T8QA 2CXGA 1HKMA 1WZAA 1OX6A 3RIKA 2V5LA 3OQ8A 3AHVA 3EMZA 4W85A 4IIDA 4GC4A 3W87A 5DN1A 3HFYA 2E5CA 2PF8A 5FEZA 1OIFA 1ZL1A 5HR6A 2JKPA 3HPXA 3CB3A 1TPEA 3KBSA 4W5UA 1HIZA 3L23A 1O94A 2X40A 4Q4RA 3WD0A 3AUOA 4G2DA 4W7VA 1T7LA 2R24A 5FACA 3SRFA 2ZQ0A 3UZYA 4KFNA 4MZ8A 2QR6A 1KFCA 4O1AA 1PKYA 4JIEA 4E5TA 5RUBA 3SN0A 3ALGA 4WDTA 5D2VA 4YMZA 4X63A 1XG4A 1SO3A 5CPNA 1K6AA 4AZHA 4J27A 3NL6A 3HMCA 2ZKMX 4HZ7A 2OMAA 4GH3A 1MW0A 1CTNA 2HXUA 2CERA 2A21A 1UW9A 1JAKA 3HJEA 4O0KA 3W26A 4GLEA 3PF3A 2Y88A 1K8CA 3SGZA 1UD4A 3QV6A 4EX4A 1PIGA 2Y7GA 3LM3A 1G01A 3B04A 4CCCA 2G4JA 3FW6A 4Z1DA 1OFEA 4MB5A 3LBCA 3B9EA 4PC8A 3UERA 4H8UA 4HPHA 4MB3A 1XLAA 1FCVA 4YPJA 2O9TA 4Y9AA 5I07A 3LCHA 3WLLA 1DWAM 4YVXA 3AUJA 3BAYA 5I5RA 3UGRA 1T40A 2WVUA 2R82A 3PNZA 3GG8A 2PDKA 4WQ6A 1ZSXA 3SSZA 3BGAA 1GNXA 3EWCA 3PPHA 4AZ5A 3KS6A 1KFBA 4O1FA 5FJRA 3QZ6A 2VRKA 3D6NA 3H24A 1YTKA 2GZXA 4QM1A 4H1ZA 3W72A 3PC0A 2FJUB 3BG5A 4C7FA 2E5BA 3LNMA 1WDDA 3C52A 1R9YA 2XDFA 1N55A 5LXXA 1P1MA 5KETA 3W1PA 5G1YA 4J40A 1HL2A 4UFMA 1FWEC 1E9LA 3CH0A 5D02A 2OT1A 5HMDA 3FEMA 1PYMA 3DFNA 4IIGA 2EQDA 2A3EA 3T81A 4US5A 3PHAA 4HU0A 4ONVA 1F73A 4BI6A 3F5KA 2Z1KA 3S5SA 4FNQA 2GDVA 2VR2A 4F9DA 3ZO9A 3LBMA 3ZR6A 3A5VA 3EXSA 2X05A 1G4TA 2OKTA 3KOWA 3VIIA 3QC0A 3S2MA 1ZHAA 3VC6A 1W1ZA 9XIMA 2PDCA 3LK6A 3C0LA 1W5MA 4OGZA 4LCQA 2WZTA 1SMAA 4OWGA 4RZ4A 2GGEA 4AISA 1EJVC 4YNGA 1OYBA 3M0VA 3EX1A 3BMWA 1F9CA 2HZGA 4M80A 1ISVA 2Q71A 3TAOA 1CGUA 3IEBA 2DEPA 3AWNA 3S6OA 4IX0A 1CXIA 4QGCA 4QHRA 4EE9A 3SGGA 4EKJA 3M47A 1PB0A 5D2XA 3OYXA 3THDA 2DGAA 4JTJA 4XO6A 1FWBC 1HJWA 4RW5A 4L7ZA 3TR2A 3M5XA 2HJPA 4NZCA 3TYAA 3VM7A 4XAGA 3TC6A 3VNDA 3CQHA 4CN6A 2IXUA 2G8ZA 2XFWA