1O66A

Crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
260
structure length
249
Chain Sequence
LITVNTLQKMKAAGEKIAMLTAYESSFAALMDDAGVEMLLVGDSLGMAVQGRKSTLPVSLRDMCYHTECVARGAKNAMIVSDLPFGAYQQSKEQAFAAAAELMAAGAHMVKLEGGVWMAETTEFLQMRGIPVCAHIGLTPQSVFAKAQALLNDAKAHDDAGAAVVLMECVLAELAKKVTETVSCPTIGIGAGADCDGQVLVMHDMLGIFPGKTAKFVKNFMQGHDSVQAAVRAYVAEVKAKTFPAAEHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-methyl-2-oxobutanoate hydroxymethyltransferase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transferase
total genus 73
structure length 249
sequence length 260
chains with identical sequence B, C, D, E
ec nomenclature ec 2.1.2.11: 3-methyl-2-oxobutanoate hydroxymethyltransferase.
pdb deposition date 2003-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1o66A00
1T5AA 3LG3A 1F61A 2WQDA 3ME3A 3EOEA 1S2TA 1O5QA 3M0JA 2V5JA 4B5XA 4KCVA 1F8IA 4DRSA 1MUMA 3BJTA 3PUGA 3OYZA 4ROQA 4IQDA 2VGGA 3MA8A 2VGBA 4L7ZA 1A49A 2HROA 3EZ4A 1JDEA 4QG9A 1DQUA 3IS4A 4IQEA 3G2GA 4JPGA 3T0TA 3GG8A 3E0WA 1OY0A 4L9YA 3QTGA 4YNGA 4TV5A 2DIKA 1KBLA 3QQWA 3KHDA 4MF4A 2G50A 3SRKA 3QLLA 1XG4A 2ZE3A 1O68A 1OQFA 1GGOA 3BJFA 1E0TA 1S2VA 3VAVA 1F3XA 4YJ5A 2V5KA 2VGFA 4IMAA 3LYEA 3QV8A 3QV7A 1F8MA 3E5BA 1KC7A 2HRWA 4HYVA 4QG8A 1VBHA 1DXEA 2VGIA 4QGCA 1VBGA 4KS0A 4G1NA 1IZCA 2X0SA 1A3XA 3R4IA 2VWTA 3HQNA 4B5VA 1M1BA 2L5HA 1M3UA 2XDFA 3QZ6A 4L9ZA 3I4EA 1PKMA 1UJQA 4B2DD 2OLSA 1Z6KA 3N25A 2BG5A 3QV6A 1ZLPA 4KCTA 1E0UA 2VWSA 3SRFA 3P0XA 4B5UA 4FXJA 3T07A 5TAOA 3SRDA 4KRZA 4KCWA 1O66A 3QV9A 2KX9A 1U5VA 5JVLA 3H6OA 4QG6A 4B5SA 2XZ7A 3EOOA 3GQYA 3OYXA 3KTXA 4B2DA 2QIWA 3T05A 1XG3A 1SGJA 4MG4A 1ZJHA 3HQPA 2HJPA 1A5UA 4KCUA 1PKYA 4RPPA 1PKLA 4B5TA 2E28A 1DXFA 1PYMA 2DUAA 3FA4A 3M0KA 3SRHA 4B5WA 4L80A 3E0VA 2XZ9A 1S2WA 3U2ZA 1AQFA 3EOLA 1U5HA 3FA3A 4IP7A 4TV6A 3HQOA 3B8IA 3PP7A 2R82A 4FXFA 1DIKA 1PKNA 1A3WA 1F3WA 4HYWA 1S2UA 2HWGA 4WJ8A 1IGWA 4LSBA 3OQ8A 3GR4A
chains in the Genus database with same CATH superfamily
1EPVA 3AXXA 1XHGA 3OHIA 3IEBA 2V3GA 4HJWA 1TV2A 4CU8A 4H2CA 3I68A 4KGJA 3MW7A 2Y7EA 4FX8A 1IHIA 4GFIA 4E3TA 2QIIA 1DQXA 2A7PA 1PX3A 2WC4A 4PTXA 2QJHA 1VH7A 3H26A 4EXAA 4FX7A 4JKKA 4W8LA 3S9ZA 4LB3A 1YNYA 2NT0A 4AC7C 4IISA 1QNVA 3IJ8A 1BRLB 4GUGA 4R7JA 4FI4A 1FUYA 3W74A 1GEHA 2CKSA 4HPXA 1K7XA 4GYPA 1ZPTA 3FN9A 3TZFA 3GXPA 1XRVA 2OYMA 3IJ7A 1IWBA 3PBGA 4XIAA 3FLUA 3NVTA 1BYCA 4WCJA 4ZZ9A 3ZYZA 3NAVA 3SEPA 4GKLA 3A3HA 4AD0A 1F76A 3KZSA 1JF6A 3C3NA 2X1SA 2X1TA 3FS2A 2EJAA 4S3DA 1MXDA 1PSCA 3WQWA 4F9JA 1EJWC 4ZENA 2PRMA 2HS6A 2PTYA 3PBVA 3UVAA 3EWDA 3LA4A 4HA4A 2X41A 4XD4A 1E70M 3DECA 1CB7B 1VIWA 3GNOA 4X9YA 3F2BA 1ALDA 3AS3A 1PWMA 3F4DA 5AC7A 4BZYA 5I77A 3SN0A 4M6QA 4O0ZA 3VIIA 3WH8A 3MA8A 4JOMA 3GLCA 4U10A 3AXHA 2YDAA 4N9DA 3MPGA 5LIWX 1E3XA 1CW2A 1X1NA 2REQB 3VKAA 3N9KA 1XPGA 3HG4A 5FL0A 2AAMA 3CO8A 1K6AA 2WHMA 1TR1A 1K7FA 3QR0A 1GOQA 3AXKA 2X2YA 4IPIA 3UT0A 1FY6A 2VFIA 4QP0A 2VGFA 4DWSB 2UBPC 1ZJAA 1QPKA 3KFTA 1XKJA 4O13A 1MDLA 1A4MA 2ZA2A 7CGTA 3U2OA 1N55A 1LL7A 3JVAA 4XBJA 1DWJM 4W88A 3G1SA 3GNPA 3I10A 4NG3A 2PWGA 5I7GA 4FB7A 4AD2A 5AHIA 1GKRA 3SFWA 5BU9A 2Z2BA 2NLYA 1TKKA 1RLCL 1EC7A 2ASHA 5DT5A 2XU2A 3E74A 4I3GA 3CTLA 1EC9A 3CNYA 3ISIX 1OFDA 1ZJHA 4K2SA 3UGRA 3KTSA 1I1XA 3VNIA 7XIMA 4AVOA 4KF1A 3DFOA 3MSRA 5FF3A 3B4YA 3DHUA 2QJMA 1MXSA 2QUMA 2FH8A 3EKLA 2I16A 5CBIA 3VDCA 4HSOA 3GUGA 4PMQA 3EB2A 1V6TA 3WKZA 1TRDA 3SADA 3CAVA 2J9XA 2A7RA 1XIIA 5CEWA 1MQQA 3W02A 1ZS2A 3RIKA 1MQRA 3BLIA 5E93A 3FV9A 5C9XA 4HZ6A 1JFHA 1NVMA 4IXXA 4C91A 4A8RA 4B90A 1PX8A 2GFTA 4AYGA 3QW3A 1TQXA 3QR3A 3PAJA 2Z1XA 1ME9A 3WY1A 1EIXA 4H3DA 4RL3A 3VAVA 1F3XA 3LHTA 1LOLA 3VU2A 2UWFA 1HJVA 4LU0A 4EE9A 4I9JA 1OF6A 1FCBA 4ZL1A 1BQGA 5TD4A 3MKVA 3BG3A 4Z2IA 3NEHA 2TSYA 4B2DD 3NUKA 4IMDA 2ZRZA 1WNOA 2QCDA 4GOAA 4M80A 1KO0A 1RVGA 4DI8A 4JIEA 3WLMA 4PTNA 4CVUA 4OJYA 2BVWA 3H55A 4NILA 1EWEA 1VFSA 4PCNA 1V7YA 2QIWA 1E4MM 2WJDA 4LALA 3CHCA 3T8LA 1GYLA 1KBBA 2J13A 3OP2A 1FH9A 3RPDA 4DZHA 1ML1A 1XD1A 4N4QA 4RDYA 3RPMA 1KR1A 4KIEA 4AD5A 4LJ3A 2CBVA 2J6XA 2WMGA 1ADSA 1R5YA 4K38A 2IPJA 1W3IA 4LH8A 3S9IA 4K6AA 1Q63A 4WDXA 3UWQA 2DVUA 4HPGA 3VGDA 1GHRA 2PDKA 1AL7A 2YLLA 4X61A 3ZR4A 3FKKA 4XSMA 3ID7A 4F66A 3RAOA 4FR1A 3QC3A 4JCMA 2Z26A 1TE6A 1TPH1 3U7VA 1FKWA 2XPKA 1QNRA 3NZPA 1G7UA 2E8ZA 3DFSA 1KWGA 1TZ9A 5XIAA 1T7LA 1G67A 3EAUA 1CXIA 3LCGA 5AC4A 2RHGA 1XYAA 4RE2A 4ADTA 5T91A 4Q22A 1DXEA 2X7VA 4N0RA 3T08A 1QI5A 4C5YA 1KFJA 4M29A 3AWOA 1SVDA 2OTDA 2ZWYA 4CGTA 4LUSB 3N9RA 3PVFA 3BAKA 3VDBA 2Y7GA 4ZQOA 3TSMA 2W0UA 2YA0A 2VTFA 2F2HA 4IL2A 1Q45A 1KTBA 4NNAA 2YCEA 2NZLA 4C7DA 3MVIA 1D3HA 4HA0A 1HN1A 1WDRA 3Q37A 4IZGA 2NVAA 1V0LA 3Q65A 1PIGA 2D0GA 2QVNA 5JBEA 2I14A 2QW5A 1DPMA 4YHEA 4CQDA 1CCWB 4KRTA 3W7EA 4WR3A 3GDMA 3QY8A 3RLGA 3O6DA 3KWXA 3O0FA 3VDGA 3UBPC 3PP7A 1DWHM 2XVPA 5TNVA 3LGGA 3USBA 5LNSA 4Y6GA 2DUXA 3DYMA 4L65A 4F40A 3GW0A 4DPQA 4Y8FA 2X0YA 1HO1A 1UR0A 3FDGA 1F07A 1J10A 4N02A 5IRPA 2XSBA 4Q6XA 2VD9A 4IQDA 2C91A 1C9DA 4V1XA 1E9ZB 4UZUA 2J78A 3CB3A 4D6EA 2NQ5A 5EKYA 2ESCA 1H7RA 5LNWA 1QMLA 2BY2A 2BHYA 4LF2A 1BSIA 1KC7A 4O15A 4O11A 4GQGA 4MKNA 2QCNA 2JIEA 5U7SA 1HGWA 4QQUA 1UWTA 2YXOA 3SY5A 5LKYA 4MJ2A 5CPOA 4KMQA 4UR8A 2QPUA 3LOTA 4YWSA 3SJNA 3WJWA 4LANA 4DZ5A 3MSYA 3R43A 4KQNA 1FWHC 5I03A 1JCXA 3NPXA 2Q8ZA 1XLFA 3WD1A 4HD5A 4DBUA 5I6SA 1XYLA 2VC7A 3EX4A 2QT3A 4KCUA 4U31A 5AHEA 1UKQA 4F4RA 4BF7A 1V3IA 4QXIA 2Z4GA 3ZM8A 4O1BA 1TZZA 2V30A 2J79A 2NUXA 2KAUC 4GINA 2OJPA 3NG3A 3A21A 4BHYA 1QW7A 3KEHA 1P0KA 5FJOA 3VOJA 3WF3A 2VM8A 3IK2A 4EKJA 3JUGA 1XIGA 3NWRA 4UQAA 4CNPA 1JCMP 3BLOA 3NDOA 1WOAA 3ITXA 3WH9A 3AIWA 3AJ7A 3AZRA 3IV3A 3TTOA 5IDZA 3GIQA 3B03A 4ZOCA 2WM1A 1BYBA 4G2DA 7ODCA 2POZA 3JZUA 3HBLA 2J7GA 3H53A 1Q85A 1FWFC 1O1ZA 1XGEA 5G4HC 4I9TA 4LS2A 4K8GA 2FLIA 1GG0A 3W2JA 3I6EA 3KVKA 4C1KA 2VGIA 3W7LA 1L8NA 1XINA 2HTMA 4C1NA 3WH6A 2Y89A 1FVPA 3VE7A 3IGHX 5C55A 1U5JA 3CV1A 4IJRA 2NSXA 3MSGA 4D6DA 2OZ3A 2V8ZA 4XKYA 3LQLA 1U83A 4CCZA 4HSHA 3DHFA 1UP3A 2ZZ6A 3P82A 3PTDA 4CNTA 1XYMA 2VUNA 5EYWA 3T44A 2GJNA 1GOXA 1SO3A 5JBFA 2I56A 2PLKA 3TTEA 1EB3A 3CBWA 1SR9A 1Z69A 2X1UA 3W6YA 1VAHA 3E6EA 2A21A 2QAPA 2JIWA 3KL3A 1UR2A 3GG7A 2INEA 3PTMA 3UZJA 3L21A 5IDIA 4J1OA 4PTWA 3W1XA 3CMGA 7A3HA 1F8IA 3GE7A 3C8NA 3CUJA 3PUOA 1FWIC 5EMLA 3BE7A 3KCLA 4HZ8A 2Y70A 4RE3A 4JQ3A 1XYCA 1RJRA 2DGAA 1XJBA 1D3GA 3GYEA 4YPJA 1KGWA 3GK0A 4MNLA 3WQ8A 4O50A 4BFAA 1SZFA 4ZOAA 2B81A 1JIBA 1EHNA 1MI3A 3JRKA 2E5DA 3W7RA 3EB4A 4BF5A 1XXXA 3TYEA 3OHMB 4L4PA 1K7EA 4K37A 4G1NA 4GE8A 1YNPA 3PM6A 4A2RA 3NQBA 2OCZA 1EBHA 3I4EA 3AYSA 3FHQA 4J3TA 2HCVA 1ITUA 2WCGA 3BV4A 1A5KC 3WQOA 4DNMA 1UOKA 5LHEA 1ZJBA 1V3KA 4AX7A 3GKAA 4PRRA 2OGJA 2Z7KA 3GIPA 4NVTA 3HM7A 4LWWA 3RX2A 4MKSA 3TJLA 3T0BA 4X22A 2CU0A 3IUIA 1RY0A 3OPSA 2HK0A 3W07A 1F3TA 1O60A 3A6OA 2QXWA 4O53A 2V5JA 4UNIA 1UHVA 3VMOA 4PUEA 4D9PA 4GZJA 1M7XA 1XWYA 3PZMA 6ALDA 2HEJA 1J2WA 3RU8X 1H5VA 2F38A 3A5VA 4O10A 2V3DA 3BG5A 4L9YA 2P5NA 3ZFHA 1E15A 4HNOA 4XAFA 2FTYA 1WBHA 3PZVA 1OCBA 3BJFA 2PBOA 4L61A 2XFYA 4AXNA 4PUUA 3FGCA 3FNDA 1BXBA 4FNUA 1FDJA 2PDYA 4HHLA 3POHA 2E9MA 1TV4A 1V93A 2ZXBA 5A8QA 3VOGA 4AHPA 2V0TA 4BKNA 2C0AA 2QGHA 3CASA 3L5MA 2G37A 3W28A 3NYZA 5I3FA 1NM9A 1X6UA 4YMZA 5AYZA 4K36A 5HK4A 4MWAB 3THDA 1OFAA 1OJXA 3WLPA 3LCWA 3MCMA 3MQTA 4AIEA 1OYCA 1LT7A 3HFTA 5HMEA 2WSKA 1TSIA 3B40A 4PUDA 1EX5A 1WX0A 2XIQA 2FHCA 3ARPA 1NOUA 3S8HA 3K4WA 3OA5A 4F0MA 4DY1A 2QULA 2WSQA 3THAA 1I45A 2P3ZA 2RKXA 1A3WA 2DIEA 2UY3A 4ZSTA 3CQIA 3QY7A 2UY4A 4MZYA 1RBLA 2JALA 2OQHA 2WMIA 3W4RA 3WK3A 4JQ4A 1JXKA 3DFQA 4Z1YA 4AY8A 4GY0A 5JQ9A 3MJMA 5AVHA 2SFPA 2R14A 3FA5A 4DF0A 5FJPA 1KBKA 2B7QA 3LD5A 4LT9A 4CD5A 4ZOBA 4P8VA 2WCSA 1FTXA 4M5PA 3HB9A 4FX6M 2VZUA 4J5NA 3RLUA 2XH4A 1VJIA 2V5KA 3OVQA 5AC5A 4XBKA 3R25A 1H51A 1ZAIA 1MVYA 1VKFA 4FIQA 3TR2A 3I3DA 4Y7EA 3MMTA 1M7OA 3N12A 4WJXA 4BJHA 4JTLA 3T78A 1IGSA 3LU2A 2XYLA 3PPFA 1V3JA 1C7SA 6PTDA 5EY5A 3BGJA 1I75A 1FHDA 1P6CA 3ANUA 3N3TA 4NJHA 2PAJA 1E0WA 4OT7A 4MNJA 3C6CA 3WDIA 7REQA 1J2BA 3KBWA 4HN8A 3V0UA 1S2WA 2WJFA 5EMYA 4L64A 1TE1A 1E5JA 2ZE0A 2HWGA 4E38A 1H7XA 4GZEA 3N2TA 3KX6A 3LG3A 5BWFA 3T0DA 2QVHA 1K9EA 1JD7A 1UQYA 4IP5A 1I2QA 5HNTA 1UD3A 3MUAA 4TXEA 1HL2A 3QHMA 1WO2A 3T40A 2ACRA 1W1ZA 1H3GA 2R1MA 7ENLA 3E0FA 1DQUA 3IS4A 3VIMA 2X1IA 3T0TA 3WF2A 4LB4A 4R9XA 1PDZA 1VYRA 3NXLA 3VNMA 2ANUA 1BWLA 4WKAA 2QDDA 1TVNA 1WZAA 3C2YA 2Q8LA 2PLCA 3W72A 3AHZA 1UKPA 1SQ7A 1R3VA 3OA3A 3E1F1 4O18A 3DESA 5C9ZA 1K02A 4B91A 2ISWA 1JCLA 5FF4A 4IMCA 1QI4A 1AD1A 3VGEA 3DENA 1M3UA 2YXGA 3QZ6A 2ZFAA 3TTYA 3OLIA 3B0VC 2DJLA 5C9WA 1XLAA 2LLEA 2QGYA 1ZCOA 4XBSA 2QHAA 1H7OA 4W85A 4WOQA 4Q8WA 2WNWA 2VC5A 3HPSA 3LZ3A 4M56A 1O66A 4R7OA 3WEMA 1H41A 1CXEA 1TWDA 2I5IA 5D33A 4EVZA 4JQ2A 5SWUA 2A5HA 5EFFA 2BXYA 1WUEA 3BCDA 3WQ4A 3DKLA 4PTMA 3L5LA 3MV11 1MFVA 4GI8A 4ZGYA 1Q4WA 3S2LA 1QTWA 3W76A 3KHJA 4HCLA 5CQ1A 2HPIA 3AXIA 3W7DA 4P7QA 3SO7A 4OE7A 2IPWA 1QU4A 3LENA 1AJZA 1J0YA 4ZE5A 2BXVA 5K4ZA 1ZAJA 4QX4A 5AC8A 3HGRA 1TRIA 3LDVA 3W2MA 1GGOA 4MNKA 1H0IA 1OIMA 1KB3A 1ZBKA 3TC3A 4YIWA 3S83A 3WL1A 3CPGA 1BYDA 3B9NA 3N2XA 4BQ3A 3T4CA 1G0CA 1YPIA 1DJIA 2PSNA 5A8GA 1VFTA 3MWAA 1FWBC 3VPLA 1M03A 1CXLA 1TPVA 3MUIA 4Y9MA 3CV6A 4LRTA 1E72M 2PDMA 2DJXA 5TQLA 2ISFA 1R3YA 3O1NA 3LLFA 3DFTA 1I2RA 2J27A 2BXZA 2REQA 3CAWA 4I7WA 1AG1O 4YTUA 4RPPA 1PKLA 5EMKA 3CXOA 4DBSA 4EWND 3CUFA 1JCTA 4HU3A 2YB4A 1PIIA 1S3TC 3HU7A 1GOWA 1W31A 1T8QA 4JCLA 1OFQA 1RBAA 2QUNA 3UZYA 3VUPA 3OG3A 4E2VA 4CUCA 2Z29A 1FWAC 3ALFA 4PR4A 3W1QA 4Z2KA 2OFJA 3SB0A 1EP3A 3SZ8A 4QITA 3LI1A 4F2UA 1RK6A 3PFRA 1IE7C 4Q4RA 4E8CA 1K9TA 3S5OA 4ML4A 1VBJA 1VRXA 4HMDA 3W1NA 1W9BM 4DAIA 5BWAA 5BW6A 1AODA 4ILSA 2GGEA 1KXHA 4C7GA 3IAQA 1UH2A 2C1GA 1OT1A 3UR7A 3CL8A 3A64A 3SQMA 1WA3A 4IQJA 2V5LA 2UY5A 3W81A 2OLSA 2OT1A 3V16A 4IQLA 4KCTA 2PWFA 3CPUA 2GJLA 1WKFA 5JVLA 3CQ0A 3W01A 4JX4A 5EL1A 5D32A 4CKQA 3BW2A 1KXVA 3QM3A 2Y0FA 4MNMA 4QBXA 3LBOA 3A5FA 5J5DA 3P93A 4H9ZA 4DPPA 3W7KA 2WSPA 2CXGA 4WRHA 3OU8A 4AWSA 1PKNA 4MWAC 1ZBCA 2YA2A 1HP5A 3IRDA 2BODX 5DANA 2B7OA 1YNQA 1CGTA 4CU7A 2ALDA 3CL6A 1EYWA 3KBVA 3URAA 2VQTA 2QDGA 1B3VA 3ITVA 5A6BA 2JF7A 2ISVA 4FNRA 4GCAA 1MYRA 4LF1A 4FR6A 3QQ0A 4V2XA 3W83A 2A3HA 4QRNA 1G4TA 2CITA 2WVTA 1KRMA 4D6FA 3KWSA 1E0TA 4HIBA 1A5NC 1VLIA 1XICA 1R0MA 2ZWZA 5FA5A 3MHFA 2P10A 1IT7A 3QQ1A 3QPYA 3TC7A 2NV2A 2H9AB 4US5A 3NSMA 4JNZA 2GZXA 2F6KA 2RJGA 5BXTA 5IXEA 2BG5A 4DI9A 3FKRA 3RJXA 1DXIA 1E9LA 2VENA 4HOZA 2E6DA 3WQPA 4QG6A 1OFOA 3F5JA 3ZWTA 3P5ZA 3I7QA 5KMYA 3NQCA 3GR8A 5K2ZA 5TBOA 2C3ZA 3K46A 2D0HA 5FF7A 1AK5A 1ENUA 3TW9A 3IIXA 3LBCA 4POCA 1S3HA 3NDYA 4B15A 5AYXA 1V6VA 1RD5A 1NAL1 3UR8A 5H2ZA 3R0DA 3TYZA 5EB8A 1RXOB 3R0KA 3N17A 1NIUA 5I3JA 3G18A 4Y90A 1T8XA 1C8VA 3BANA 4ZB5A 3WZ0E 3EA2A 3WJZA 4J35A 1PX4A 2PDPA 4LPCA 3WLRA 2VQUA 1XSKA 4TVCA 2Y5SA 3G1XA 3GXDA 1ZHAA 4MFEA 1HKVA 1PYFA 3VD5A 2VURA 3N2OA 1S39A 1UZ4A 1RV8A 4X2PA 3G0SA 1XL9A 5A8NA 4JIPA 1CTNA 2EPMX 1CGXA 5D4YA 1A5CA 3PNZA 1TPDA 3L0GA 4UTTC 1DJQA 2C18A 3RILA 1D2KA 1GVRA 3BCFA 2V5CA 2HNHA 2XG9A 3STEA 2YYTA 3FHAA 3KRSA 4WY0B 1OEPA 2BVYA 4C6LA 4PODA 1VFUA 5M03A 3BL3A 4LVAA 2F8QA 1J0IA 1KFCA 3DI0A 3NEVA 4NAEB 3EEGA 1FBAA 5F4XA 1B3ZA 1FDYA 3H7VA 3NPVA 1DVJA 4UTKA 3C0LA 1C91A 4UNKA 4XD3A 5DXXA 3CL7A 1W3NA 4DO4A 2ZUVA 2ZOXA 2XWDA 1NWRA 2X7WA 1VF8A 3SUWA 1XIFA 3GNXA 3WQVA 2NT1A 3VZYA 1FHUA 3EA3A 5EA9A 2PP0A 2FGBA 3BMXA 2YR1A 3R11A 4E4PA 3BZJA 3Q4DA 4L56A 4HNUA 2ZA3A 4FSAA 4GISA 3GDKA 3QN3A 1HKJA 3W88A 1PZ2A 4MPQA 1XLJA 3P6LA 1MW1A 2XH2A 1H50A 2Z1WA 2NXHA 5G5IA 2E9LA 3WDJA 3DG6A 5DELA 3UXIA 3A4XA 3OVGA 2GYIA 4CLMA 1QWGA 1E71M 1HJUA 4HT3A 1OGSA 1EHAA 5D8WA 4LNYA 3UNTA 3RRAA 4XQ6A 3BLDA 3VVGA 1VFFA 1BHGA 1ZBWA 1JGIA 3TNBA 1SUXA 3CZGA 7TIMA 2CHNA 4I8YA 4F3HA 1SW7A 3QFEA 3BSHA 4KFNA 1QOQA 5DN1A 2VEKA 1WYIA 1FA2A 3FY1A 2XM1A 4AEEA 5C7VA 1BF6A 3OVPA 1F74A 4S3FA 2VR2A 4ZO9A 4GNVA 1P6WA 2E6FA 3E0VA 3P8IA 3EWCA 4RNIA 3C61A 3B0YA 1E0XA 2ZZ2A 3KBJA 3N19B 3IAPA 1BXCA 4MGGA 3U0HA 4JTDA 3OB8A 3TE9A 2D2HA 3EOEA 3MV01 3P74A 4DELA 5GQBA 5HQEA 4XZNX 3LPFA 2HVOA 5FAJA 1J93A 1E1FA 1TTQA 1ISVA 3VGFA 1VBRA 4L7ZA 4M24A 3DCPA 1DE5A 1US2A 4F0RA 3BLKA 5A8OA 2ZXAA 4MY8A 3QQWA 5BMXA 1ZSXA 3UWVA 3LERA 4MVAA 3N4AA 3WLNA 3REQB 5KZEA 3VIHA 2TPSA 4GGBA 2X09A 1W17A 2J75A 1M04A 1YADA 1KXTA 3LNPA 3QYSA 4PULA 4R88A 6REQB 2WV8A 3CB8A 4L5ZA 3CGTA 5T8GA 1LJYA 2QMJA 4HMEA 5D9NA 3DC8A 5BRPA 4TVDA 4W89A 3WSUA 4GUFA 1FXPA 5HPOA 4AXKA 2J7CA 4HPHA 1VQTA 3V7PA 3GDTA 2A3EA 2NVDA 4NXSA 2WKLA 3KW3A 3BGGA 1A0CA 3PANA 3VINA 1DJHA 1RY8A 4WZHA 3UZWA 3A9BA 1GPWA 4MYAA 5E70A 2WLZA 3NVDA 2PMQA 2FVKA 3NSXA 2MUCA 3RM4A 5DO8A 3ORWA 3U4FA 5I3KA 1A0DA 4IGSA 4YWIA 1EDGA 1J18A 2XN2A 4MOZA 2OR2A 2WHJA 4U3AA 2HROA 4EAMA 3GVQA 4IFRA 5MHBA 1VR6A 1FWDC 1U22A 4B9YA 1TVPA 3IJ6A 5HINA 4H6EA 1FP9A 4N6EA 3LM3A 2E68A 3W71A 4O8RA 4OBTA 4GIYA 5BCAA 4LUTA 2Y1HA 4HPNA 3RM8A 4PFMA 2YDQA 4IXHA 2P0OA 4XAYA 3A4WA 1K9FA 3E5BA 5J04A 2OQLA 4IX2A 1YE4A 4QG8A 3L4XA 2IKGA 3GNDA 4GLEA 2DSUA 4LBRA 4LYKA 1R7AA 2H90A 3M0IA 5DCBA 3BGAA 2PRHA 4LY8A 1CYGA 3TFXA 5A2AA 1H60A 1XDMA 5F4SA 4J3SA 1XFBA 4TQTA 2FB3A 1NH6A 3VXGA 3TMQA 4UNLA 4DJEC 1W56A 2PRLA 1IEXA 4P8WA 3TYDA 5M17A 2BNJA 2HE8A 3B06A 4O1EA 1SO5A 3WLSA 4Y9AA 1SO6A 3LQGA 3EOLA 5I07A 1G1YA 4I5XA 3ATZA 4GQRA 4XZBA 3LX9A 4LYPA 1AFSA 1XIHA 4YN5A 5J5RA 2OODA 3OGVA 2NX3A 4PRTA 5LHFA 4LUIA 1I6NA 4XTDA 2IPGA 5CC3A 3VKCA 1TTJA 3M7SA 3JU2A 1DJNA 4GBDA 3LHUA 4MWAA 4RW3A 5CLTA 5AECA 3IVUA 5F2IA 5LIYX 5I06A 4K7VA 5AY7A 3WJSA 4WSKA 3UPBA 3VD9A 5LGXA 2V81A 4TX9A 1GVOA 4WSJA 1WB0A 3VNDA 8A3HA 5HMFA 1GG1A 1KV8A 1EX1A 7PTDA 1WBJA 4M8UA 4S3GA 1D8CA 2W91A 1KWKA 4UOZA 3S2CA 1ZAHA 1EQCA 5CC6A 1ZBVA 5FEZA 2HE5A 2PDIA 1G5AA 3KXQA 4FLQA 1VZWA 4RW5A 4XZ9A 1TV3A 1JAKA 3MANA 1S46A 3QV6A 3P84A 4WLCA 4U2YA 3GUWA 4GXPA 2WLYA 4V33A 4LY4A 4FA3A 3ITGA 5H91A 4LVFA 3M46A 4X2RA 3E96A 2VRKA 1J11A 3MYPA 1DYSA 1P1XA 3D3FA 3WBWA 2IXUA 1B54A 1HX0A 4RK8A 1GVIA 1OC6A 1W1YA 2Y7FA 2E3ZA 2ZTJA 3AU2A 1XYZA 3SSJA 5C5YA 3R13A 4XSLA 4REQB 1F6KA 4LS0A 5BOEA 4YCOA 2O55A 3M0JA 4W5ZA 5HNNA 3KBSA 1OGGA 5D9OA 3H7RA 4GNKB 1KBIA 2PWVA 4JTRA 1EGMA 2PDHA 3TW6A 1ZY9A 1C93A 5HDRA 1G69A 3H54A 2XTKA 4KFPA 4BEUA 4NI3A 1W1PA 1J9YA 2GWGA 1R8LA 3SGUA 1XGZA 2EPNA 2XINA 3V18A 3D5HA 3KOFA 2PDUA 4KEMA 5LNRA 3S6OA 1MMFA 4GQBA 4HK6A 3UXAA 1AZ1A 1HKMA 3G6MA 1YBQB 3PSVA 2PWEA 3U8GA 4LCRA 3S3GA 5A6KA 1PV8A 4O17A 1V0NA 4UTTA 4XD6A 1PTDA 1WPCA 3M0XA 2GPTA 1GK8A 4GUHA 1QHZA 1Q6GA 2KX9A 4A8IA 3C2FA 2AOSA 4JFWA 5AHNA 3SBFA 3W24A 1B3YA 2XFWA 5LZLA 4JEQA 1MEIA 4D8ZA 2O9OA 2BVDA 4MG4A 4DLFA 1DKWA 3UCQA 2QLYA 2W92A 4LV9A 3TKFA 1WAUA 1UB3A 2EAWA 3CUIA 3ELFA 4B92A 2IXVA 1M5WA 3OLEA 1GKPA 2NVCA 5LXXA 2VVNA 3VYLA 4A4AA 3AHVA 3I6TA 4I9MA 3QYQA 5T9CE 4Q7BA 1RAKA 3WN6A 2J7DA 4FNSA 5AYBA 1MFUA 4JHMA 4DRSA 1FWGC 1GQLA 2C79A 1NTHA 1WZMA 3G1VA 2VR4A 1F4HA 3TWAA 5D02A 1VJSA 1XV8A 1AQMA 2GUBA 1IF2A 4R3UA 4DEFA 2G50A 4KW2A 1SU5A 4WK9A 3VX1A 4PEKA 4GVFA 1KLYA 4MWAE 1P6BA 1KM1A 2AQVA 2WZMA 5LNUA 1Q66A 1LBLA 2PWHA 3FXGA 2ZX8A 1GOIA 1X1ZA 4DAFA 2D1ZA 3VUSA 1J5TA 1Q4NX 6TAAA 3ZIZA 4W9TA 1O12A 3MVTA 1XH0A 4AIOA 4GC3A 1SSGA 4A3UA 3GVWA 3PPGA 3SUUA 4RZ4A 2VEFA 2Z00A 1TX0A 2AAAA 4MB5A 4PFHA 1YTDA 1DJZA 2W9MA 4Q4KA 3W26A 3W3OA 3VKKA 3BAYA 5D2YA 1YTKA 3DEQA 1CXKA 4ONVA 2CCRA 1MW2A 2I9EA 1B4KA 4QNEA 3B0XA 4C65A 1XW8A 4ZVJA 3T0CA 3CTTA 3MUY1 1HJWA 4IG2B 2QV5A 4HOXA 1EO5A 2ZX7A 3WG6A 3MUCA 4UWMA 3SCSA 1XLCA 3D6NA 3SQLA 1TWWA 1B2YA 1GQNA 2YKKA 2BHUA 3NIYA 3CQHA 1VENA 4NP7A 4D6HA 2WW5A 2XSXA 5C7HA 2AL2B 4YS1A 4NJJA 2PGFA 4ZTYA 1QBAA 4C6EA 2Z6IA 1W3TA 1JUBA 2AKMA 5BRQA 1ZLPA 4ZXOA 1UKOA 1A0EA 1OD0A 2XHYA 3SRFA 3WNOA 1OCNA 4RZ5A 3FYOA 1VEMA 1QUMA 3B4UA 2EO7A 1XLKA 1GUVA 3AFBA 1XIJA 3TC6A 1LM1A 3T7VA 4AZGA 1QFEA 2QV4A 1CXHA 3L9CA 2VDIA 4L1WA 4DF2A 4PC8A 4IFKB 3WNLA 1DIEA 2EPKX 2DZWA 3I7RA 5I3HA 3B8IA 1KA9F 1YLVA 1UMYA 1ME8A 4EPKA 3A3XA 1E6ZA 4P8UA 3KVJA 3ARWA 4I90A 1D9EA 1HQTA 3HFYA 3G3MA 2BY1A 1UZ1A 4JDBA 1Z89A 1OYBA 2PWDA 4QJ4B 4Q4OA 4JFUA 1WZKA 2QJIA 3BTNA 4PZVA 4O1FA 1PUDA 3PN8A 1ECQA 2VL4A 1BVNP 1YEYA 4PCSA 3M5ZA 1SZNA 2PDNA 5M2FX 2G0WA 2V2HA 1ISXA 4AX6A 4DNHA 1M6JA 3LI0A 1WUFA 5FJRA 1J12A 3OTRA 4XZIA 3V3WA 1VEPA 4C1LA 4CEUC 3PS7A 4HYVA 3WLLA 4TO8A 4KFOA 1WXZA 4UFMA 2FZBA 5G2WA 2H8XA 1QHOA 1A53A 3NQMA 1RZMA 2PODA 2ZADA 2UV8G 3LZ5A 1N2VA 4B9ZA 5CZSA 2A3AA 2ON3A 1YMYA 3FSTA 1QPOA 3BAJA 4Q3MA 2JFEX 3C4UA 1ONWA 1SZEA 1XG3A 3WLTA 3MMWA 1QATA 3ZR6A 1DP0A 2FZ9A 2XH0A 2CLPA 4YYCA 3OGRA 5E0FA 5U4NA 3PZOA 4K39A 1AZ2A 2WOQA 2Q09A 3EXRA 1OD8A 1S5TA 2E5BA 5E5CA 1E1EA 4W84A 4DJEA 3OVRA 5FAGA 4FP1A 5CAKA 1D7KA 4JR5A 4AFYA 1UKSA 5JBDA 3OO2A 4QFUA 4JEJA 4KCVA 3GR7A 3P8JA 1CX9A 4WOZA 1GWJA 1IWPA 3OYZA 4DJFD 5A2BA 2ISSA 5LYRA 3TWBA 5A1AA 1W1VA 4H6RA 3RLHA 2OXNA 5DCEA 3LCIA 2NX1A 2QKFA 3S5SA 3NZ1A 1VFHA 3MBDA 4B3ZA 3O6CA 7TAAA 3R10A 1KQYA 1UWIA 3ERPA 3G1AA 1R3RA 3N11A 5GJNA 3S46A 1GOMA 2G3NA 3L65A 2IW0A 2X16A 2O4QA 8RUCA 3RMJA 3ARVA 3LUTA 5AVNA 3IWPA 3UY7A 4PMUA 4DUXA 1GJPA 2ZUTA 1D8WA 3DOPA 3GY1A 1XH2A 1TX2A 4CN4A 4ACYA 4RZ6A 4RX0A 4BQ5A 4NYYA 5REQB 4TX6A 1X6NA 1CGVA 3N6HA 3QXBA 2DH2A 3WDPP 3EDEA 2H3BA 2MANA 3TTQA 3AROA 3M1ZA 1GEQA 3S9YA 1TCDA 4PCFA 2Z2UA 1IR2A 4UZSA 1TPFA 1HJSA 4GIRA 1G6CA 2GUYA 1KGXA 3AOFA 3FA3A 5AZ1A 1VYPX 3IVTA 4O14A 1KFEA 2A1YA 2I5GA 3EX2A 3NQDA 3SCWA 4GX9A 4DO6A 5D8ZA 5KTLA 4UTHA 3OZPA 1KTCA 4HK5A 4M7SA 1WDWA 3SFKA 1GZ1A 3FVMA 1JGMA 4LYQA 1J0ZA 1LUCA 2O56A 3QGKC 4ZO6A 2VFHA 1ESWA 1SJBA 1AA1B 4NAEA 4QG9A 1K9DA 2OQYA 3SCOA 1VPQA 1W5QA 2DZTA 5K9XA 1OY0A 2H6RA 1MUWA 3CZLA 4PN2A 3QMTA 3DGBA 3ITLA 2INFA 1NEYA 1N8WA 3ARSA 1WAWA 4MAZA 1S5WA 4J4KA 1B3OA 2A6LA 4LAUA 3RF9A 4YL2A 3CU2A 3T8QA 4PBFA 3WLHA 5MKGA 4LVGA 2Y85A 2I17A 3EPOA 1Q2RA 3SQSA 3SDOA 1FWTA 3ANYA 1CGYA 5AZ0A 3O6AA 1H1ZA 1XISA 1UBPC 4B2DA 4OV4A 3ZLHA 4O1AA 2WZTA 4WEVX 2Z1VA 3PNUA 2E28A 5F4WA 4GFSA 1CT5A 3RCYA 3TP4A 3SRHA 3KTCA 3B8SA 1OK6A 4GBUA 1B5TA 3TW7A 2BP1A 4LVBA 2YCIX 4RLIA 5DMLA 2CERA 3OOQA 4ZE4A 1VFLA 3QKZA 1AW2A 3M0VA 1XF0A 4NL1A 2DW7A 1TG7A 1MUCA 5DF0A 3N4EA 3P67A 5JMUA 3TA9A 1TWIA 3AUOA 3G2GA 2W61A 4XV0A 3E0WA 3CUGA 3O63A 3B0UX 3WD0A 1RQBA 1JPHA 2WPGA 4M1BA 4AZCB 1J6OA 4HVXA 1W5MA 2CHRA 1KV5A 1VBGA 3GTIA 3LCFA 3CAKA 4DB7A 5D2VA 3SURA 1R7OA 3IACA 4P7NA 4GO9A 2J7EA 4K3ZA 4EAYA 3TEVA 3ZMRA 5H8PA 3V5FA 5I3IA 4WQ6A 1QT1A 4MDOA 3KRUA 3LXBA 4I7UA 1C3FA 4IMEA 2DPEA 2Z7GA 2HNEA 3II1A 1L6GA 2J4GA 2JE8A 3B97A 1EJ7L 1GZJA 2PDJA 1UUOA 3A22A 2DUZA 3P14A 3INPA 2E25A 1OGBA 1HVXA 1H49A 5DY3A 1WKEA 2YCJA 4R5EA 1Q6DA 2ZICA 3KL0A 3REQA 2BX7A 3E49A 3DYPA 2O92A 3LHZA 3LPPA 5LSMA 1YRRA 3AIEA 4MB1A 1VCFA 3BXWA 4Y9NA 6REQA 3BO9A 3GR4A 3IARA 3AU6A 1HKIA 4FMVA 4B5XA 2JEPA 2ZRUA 3GH4A 1A5OC 3FOKA 3IJLA 2OSWA 2OT0A 4AZ5A 3BOXA 3LV6A 3GRIA 3NPWA 1SYTA 3ALGA 4ZO8A 4Z1CA 2DEPA 3WQDA 3D0CA 1ICQA 1B57A 4CQ8A 3PB2A 4GG9A 3PUEA 1Z3NA 4NSBA 4A2SA 1XKYA 4P7LA 3RUBL 6ENLA 3VI2A 1VIZA 3W9ZA 2PZNA 3THQA 1JQVA 1V77A 5HNRA 1S2AA 1S2CA 1V3LA 3EWBX 2Z0IA 4Q8NA 3ABXA 2F7FA 3CC1A 3MZNA 3APTA 4KWOA 2VZSA 3W27A 4PSPA 4PB5A 3UP8A 4S2CA 4AD3A 1TR9A 3Q2DA 1LROA 4IIDA 3MO4A 3NQEA 4MFDA 4EP8C 3M4HA 3ITYA 2F6XA 5HWNA 1OWQA 4JTQA 3BDKA 4S38A 6A3HA 4GX8A 3BMVA 5BOFA 3L23A 1E6RA 1AUSL 2ZDSA 4IIEA 1CLKA 1QOPA 3MHUA 2P3EA 4H7CA 2PU1A 4JTSA 1EKOA 1CENA 1OX5A 2JGYA 5IHSA 2OWWA 1M01A 2BGNE 2YW4A 3D47A 3PWAA 1YDYA 3H22A 4D8AA 4UFLA 2G97A 1UZDA 3KRZA 2VMFA 3R8HA 4DZAA 3CM4A 2PURA 2B7PA 3G77A 3QZAA 4YLWA 5A6SA 1V4YA 3TQ0A 4J3WA 1QBBA 3KZPA 4ML9A 4AISA 4IIFA 1TO3A 1XQLA 2OMAA 3FFSA 4CD6A 6XIAA 3T2PA 4IICA 3WNPA 4QEEA 1J0KA 1GQJA 4ENLA 5G2IA 1YE6A 5D37A 4YJ5A 3NZRA 2V9DA 3TUUA 2VKZG 1SMAA 1EA9C 4ZCWA 3LNMA 2XVLA 1C7TA 4JTKA 3APGA 1VC4A 1QWKA 1I9CB 1W32A 2VHLA 4NU7A 4AU0A 4Q7IA 4B5UA 4JTTA 1B4EA 5C70A 4KCWA 4OUIA 5F2LA 1AQHA 2DZSA 5LGZA 1ZP3A 1XPYA 4WKFA 4AMAA 1U1JA 2GDUA 2YJQA 4L6OA 5I78A 1BYAA 2OELA 3H4XA 2VI0A 4IJCA 3PC0A 5XINA 1YXCA 2RGMA 2WVUA 4F0KA 1V6XA 1VYSX 3HTWA 4C90A 3BK0A 3ITCA 1S5MA 2YCKX 3LSBA 1DIDA 5A8PA 2R1NA 4N2YA 3KP1A 1GCYA 2HVNA 4UMAA 2W27A 4AF0B 1W37A 3OLDA 3BVJA 1UZHA 3W29A 4V27A 1B3XA 4MUZA 2BASA 2G4FA 4BCEA 3TNOA 4AZ7A 2A7NA 3GG8A 5B7ZA 1EUAA 2VZOA 3PK7A 4WIWA 3ZXWA 3DZ1A 1M41A 4AD4A 1UMLA 4ZB2A 4HU0A 1N8IA 2Y8UA 1EUNA 2ZXDA 3PY2A 3FEQA 1E73M 4NY2A 2QJGA 3TAKA 1QPNA 3THUA 1XUUA 4HSNA 4DHGA 1I2NA 4REQA 4A3HA 3AAMA 3MJYA 4Z2JA 1FCUA 3MHGA 3N73A 5KETA 1Z42A 1JPKA 2EG7A 1Z7AA 3NR0A 4G56A 1OX6A 2VC9A 1Q2SA 1OZQA 1A80A 1V79A 3IGSA 3CHVA 2TODA 3XIMA 5TAOA 3TSDA 3WNNA 3LN3A 3BSMA 3O05A 2YPIA 1SW3A 5TF0A 4J2PA 3MY9A 5AHMA 2YB1A 2INZA 3MYOA 4P61A 3ZLFA 4Q8VA 3RCMA 3WEZA 4EACA 4CNUA 4O1DA 6CGTA 4NNCA 2ZUSA 1F3EA 1XD0A 4KRUA 4EIVA 3SIMA 1W8SA 3VMNA 1W9XA 5DMYA 2ABBA 5CG7A 2P1FA 4TR9A 1L6FA 3NNTA 3VFCA 1Z48A 4NYUA 2Y24A 2QPXA 3BSGA 1DJGA 5PTDA 2Y2WA 4A8NA 4NUWA 3QPZA 1C8XA 4Q8TA 2GVJA 4EWJA 3QLLA 1HUVA 3L66A 3UPMA 3STPA 4PA8A 4A29A 4ZXLA 3IJQA 4PMZA 4S3EA 1FCVA 5I3GA 3AYTA 2YXXA 3PZIA 2QAFA 4TVUA 1ZUAX 2GUUA 3MKCA 4IOTA 5DLCA 2XJ7A 4WSHA 3R4IA 3KDNA 2PDWA 1CB2A 1Q8JA 2NQ9A 3WFLA 2E5CA 2IQ0A 2P76A 4MPKA 5ABTA 4OQVA 1AJ0A 5FACA 4HHPA 1XX1A 1V0MA 4O0QA 3G1YA 5I0DA 2XZ7A 3DG7A 1H09A 2Z1KA 1RBOB 4JTJA 3U5YA 5M1TA 4JIQA 3TK7A 2GOKA 1OYAA 3EDKA 3LTYA 4JTAA 3TZNA 5ABHA 1R2RA 2FGZA 5I23A 3OJGA 5GNZA 4Z2LA 9XIAA 5CJ5A 3SW6A 4RUBA 1S2UA 1G94A 3QW4B 3KCOA 2XIMA 3FXYA 3MCOA 1M7PA 4Z0JA 1CGUA 2PE4A 4I7VA 3VNZA 2R24A 2EPLX 1B9BA 3KS5A 5HWMA 3S6TA 2PGRA 3TN3A 3UCDA 1W9VA 3SJ3A 3Q58A 4DUVA 2C1IA 5G2HA 3LPOA 3VOHA 4JL1A 2G96A 2V2DA 1FOBA 3KUMA 3NSNA 1KXQA 2CLIA 4O54A 4RE0A 4H9MA 3O6YX 1AH3A 3ARYA 3HMJG 1H4PA 4NZ3A 3H8AA 1KKRA 1FWRA 6TIMA 1IZCA 2X0SA 2ZZ7A 1KW1A 4KEZA 1LP6A 2AQOA 5CSYA 5E6ZA 2VX6A 1IXOA 4QJ1A 1PCWA 4EPEC 4Z1DA 5I5RA 2PDCA 3LV5A 3GIYA 2PB1A 5KZDA 1X8FA 3DXIA 1ZP4A 3EWYA 3G1RA 3G3DA 3UGVA 3V5OA 3VNJA 3M41A 5D2XA 2YX0A 4IUGA 2AL2A 4GYKA 3MB9A 4UIOA 1QNSA 4GPNA 3WBXA 3HGSA 3QRHA 3CK5A 4FLRA 3G24A 5AYIA 1NOWA 4K1WA 1OHLA 1UD4A 3E0IA 3DHPA 3KP0A 3LMZA 4ICMA 3G1DA 5AYYA 1JZ2A 3SGGA 2PEVA 1GVSA 3U7BA 3C86A 3EX1A 3R8GA 5E9XA 1IIHA 1ADDA 2Y8KA 4BA0A 2HZGA 1TPB1 4K8HA 2CNCA 5DMMA 4BF9A 3WFZA 4CCCA 1GQIA 2X0HA 3R79A 2DU2A 4J3XA 5IOBA 4M19A 2OO6A 4B16A 2QCDB 4Z42C 4CNOA 1X39A 3WENA 3N2BA 3MP5A 3PUDA 1E6QM 4Y96A 1QW8A 1FH7A 1K8CA 3NQ7A 4JHZA 1YPFA 1PZ1A 2A3BA 1XRSA 4P8XA 3OIHA 1UKTA 3QMRA 4HA1A 4NJGA 4UR9A 4UUIA 3AMDA 2QR6A 4AHQA 3DBPA 3E2SA 5CPTA 4IM4A 3EX6A 3ENLA 4JIRA 1EDQA 4E4FA 2Q6ZA 3SUSA 1HJXA 1HT6A 1JR1A 3KOXA 4AVNA 2E40A 2OYKA 2Z6JA 1PXGA 2BSLA 4S2BA 1PKYA 1QK2A 4UMCA 1Q6OA 1K4HA 3GXNA 1IXQA 1FWCC 3FIGA 1PAMA 2CZDA 5IM51 3R6IA 4JTEA 1E51A 4FXFA 2DSKA 1Z32X 4C6FA 5C71A 4GI9A 3VIGA 2BDQA 1QNOA 1OC7A 3WCZA 3TXZA 3PWGA 2E7FA 2IQTA 1BG4A 3GFYA 3E3HA 5FL1A 4JN8A 2YGYA 1IT0A 4ROQA 3A13A 3H2EA 3VNKA 3KBNA 4TUFA 4W86A 3W6LA 1EZWA 3S42A 3GB6A 1F7BA 1EJTC 2DZUA 4YNGA 3HPXA 3VNYA 1KNWA 3TJXA 2YL6A 3NQAA 3EPNA 3BICA 2X2GA 1VEOA 3IJDA 3OW1A 4H9TA 4HNNA 4AIBA 1JYNA 1YDOA 4X0VA 3RGTA 1LWIA 4YVXA 2WK2A 3GNRA 1KLZA 3DBNA 1B3WA 3PZ9A 4HTYA 1F8MA 3N04A 1A5BA 2QQ6A 1TV7A 2FHFA 3ARRA 1E55A 3W1RA 1EC8A 3K4DA 1US0A 4JKLA 3G0UA 2HS8A 3ICJA 1LLOA 2EQDA 3S1VA 2GVEA 1REQA 1TUXA 2OB3A 2YCLA 2ZRYA 1EH9A 3OIXA 2ZX5A 3EXTA 1ICSA 1OINA 1NARA 1XIBA 4ZQMA 5DQPA 5EBUA 1YKWA 1ZALA 4RR4A 3M0YA 5HANA 1NF0A 3A9IA 4UFHA 1OSEA 1LG1A 1PS9A 3AS0A 2Y88A 3BUVA 4H41A 4H9YA 1U1HA 4GWEA 3GTFA 3UJEA 5HQLA 4XISA 3WUGA 3QVQA 4QISA 3AYVA 4LAOA 2JGQA 3C0QA 3BLLA 1PDYA 3V1HA 3S1WA 2GDVA 1QI0A 5CZ0A 4PMRA 2GQ3A 1E0VA 1HFBA 2NLIA 3VGHA 1A49A 1TZ7A 1OG0A 5REQA 3M5YA 3VILA 2J66A 1TFVA 1YXYA 1O5XA 1D7FA 5BZAA 1RVKA 4HHHA 3F4NA 3DFNA 4F9DA 1W91A 2DT1A 5T9BG 4QE5A 4MZ1A 1OX4A 1QW9A 4M6UA 1P0EA 1LORA 2DT0A 2CPUA 4TTGA 3WMBA 4JAWA 4DWSC 5I02A 4YCPA 4X0NA 1EL3A 2EXOA 3TJ4A 3AJXA 4XAZA 4Q33A 3EBVA 2CESA 3PZGA 2I9UA 3O9NA 4UTJA 1Q7ZA 1DTNA 3PAOA 2TAAA 2EG6A 3P5YA 2PP1A 4DF1A 1RJQA 4MKVA 4C5ZA 2CKRA 2J77A 3PF3A 1EPXA 5HBFA 1QPRA 1Z6KA 2CXEA 2TMDA 2PI6A 1K3UA 3R1ZA 1YPXA 2OWXA 2CLFA 1UD6A 3NZGA 1V5XA 3G1HA 3M16A 1EF2A 4S1FA 4DJDC 3KL5A 1ZCCA 3HQPA 2NWSA 1GYMA 4UQCA 1HTIA 3DX5A 4N6FA 5BRBA 4JIIX 4WGHA 4D2JA 3WBYA 4C6IA 3ZZ1A 3UQNA 1IT8A 2RDXA 3U3HA 1O6IA 4W7VA 1ONEA 4M0XA 3XISA 3ZT6A 3P2VA 2VEPA 4LUJA 2Y62A 1BPLB 3GTXA 3H2NA 2R1KA 4S3JA 2PC8A 4PH6A 2VEGA 1X97A 3B0PA 5EMJA 2HBXA 1JPMA 4JQAA 4OFCA 1RCQA 4MSSA 4QJ5B 3IK4A 3PJWA 5H8UA 4QLLA 1W2PA 4JXCA 2FPYA 4GRSA 3T6CA 2D20A 1TUFA 2RH9A 2PU0A 2NV1A 3KS6A 4C1NB 1G9HA 3GG0A 5D30A 4KWVA 2FDSA 2GDQA 3V0TA 4JICA 5FESA 3UZZA 1UPMB 1T41A 1E4NA 1P0DA 3GU2A 4GVIA 4CQBA 2Z1BA 4ATDA 3C8FA 2E0PA 4Z1BA 4LBUA 1PE1A 4B5VA 3WMSA 2G3MA 4O57A 4L9ZA 2PP3A 3SM0A 4CQCA 1LLZA 2QCHA 2IKIA 1TJRA 4UFJA 4UCGA 4O8AA 3UPWA 5E6YA 1POJA 4ERIA 3GYCA 2W63A 1ME7A 2JBMA 1BG9A 4LC6A 1V7AA 2VJXA 2A4AA 1UR3M 3K8KA 5DBTA 1SGJA 4MIMA 4C7FA 2CZ5A 3VDAA 3P61A 5DRCA 1VCVA 2CWNA 1PYMA 1CNVA 4JDYA 1X98A 4GC4A 3U2ZA 1EWDA 5B80A 2BVTA 2FHBA 1UR8A 4H7VA 1FWWA 2BOGX 4TMCA 5JIPA 1NFGA 3WNMA 3RR4A 3S5YA 1R3SA 2WMJA 4GNJA 1IYXA 3M07A 4O28A 4QROA 2QDHA 2VT0A 5GNXA 3WLIA 4JTFA 1KTNA 4GI6A 5GNYA 3MO7A 2RGLA 3UR2A 3P3BA 5LIKX 3QR1A 3AMCA 4W5UA 3UJFA 4QS5A 2HQAA 1LYXA 1RP9A 2ZZ5A 3MUZ1 1OFEA 2E67A 4GZIA 3EWXA 4H9XA 1XLGA 1XIDA 4J9JA 1I60A 4CN6A 2FKPA 3N13A 1TWSA 3GG1A 2CC0A 1VP5A 1XRTA 2GK1B 3TMLA 1DL3A 1JI1A 3SUTA 4R33A 3P7YA 3H2OA 3H21A 4DYJA 1J6PA 3P0WA 4AZIA 1I0BA 1NP0A 2GGHA 2WC3A 4PMJA 2VWSA 3ZJ6A 3ZVHA 4DUWA 3CH0A 4QAIA 2QJJA 3RR1A 2FB2A 3V1PA 3SCPA 4YHGA 2BS9A 4JTIA 1LRTA 1FRBA 4DO7A 2YL5A 3B3DA 4HZ7A 2PLMA 4KWUA 5HMSA 5JXQA 3FJLA 4DYKA 1L2UA 1TV8A 4BI7A 2IQDA 1NDYA 5KITA 1SJAA 2VRQA 3WX7A 3B8VA 3A4JA 1DIKA 1NJJA 2JF6A 2IPFA 2C1HA 5FF0A 1KGUA 2EPOA 1HJQA 4QCEA 2GWNA 5HQMA 4W8BA 3GHUA 4IMGA 5E1QA 2CZVA 3PJXA 3U48A 4J3VA 4AC1X 2WVVB 3FGCB 3HG5A 4XD5A 4BS0A 3BOLA 3EGJA 3MI3A 3KVMA 1UPPA 4KEUA 1GYNA 1R3TA 2B4GA 1OZMA 3BQ6A 3NOYA 1ICPA 2R91A 3GH7A 3UJ2A 1RJPA 5M5DA 3MBFA 1CDGA 3A12A 3LYEA 3M43A 5F2GA 1ECEA 1FH8A 5GVJA 4AY1A 3QTPA 5CGQA 3VGGA 3MKKA 1HO4A 5ECUA 2E09A 2ZYFA 1TJ1A 1DOSA 3EDDA 1YIXA 4MHBA 4RZBA 5A6JA 1BD0A 4AG0A 3IUHA 1BGAA 4E2BA 3M0HA 4GJIA 3W2UA 3GQYA 5K9CA 3NTYA 2BOEX 4D71A 1JCJA 3TU9A 3QPEA 3ZQ9A 4RDZA 1NFPA 4FXRA 2DSWA 1TYGA 1H1YA 2G8ZA 4PMNA 3KCJA 5KZMA 1F3WA 1IGWA 3EDJA 3L4WA 4TTUA 2P50A 3K5XA 4AWEA 3OBAA 5IBXC 3LY0A 1W9UA 2WAGA 4XK2A 2FFIA 2YDSA 3I7SA 4QQ3A 3QGVA 1X7IA 2CLLA 3HZ3A 5BXPA 4UMBA 3UG8A 3FVDA 4O4VA 2PCEA 1E1CB 1E6SM 4U33A 4Q8OA 1NP2A 4FLOA 3T0AA 3BURA 4IPNB 1LWHA 1KQZA 3M7WA 1XLBA 1MXGA 3TCEA 1WV2A 3QTGA 4A22A 3U9IA 3VFLA 5F7UA 3GX9A 3L0KA 3WDQA 2PDFA 5CLWA 3EOSA 5A6MA 3K8LA 1V6YA 1UD8A 4UTWC 2XGBA 1OFPA 2ADAA 1JZ5A 5CZJA 1BVZA 1UASA 3WFAA 5BU6A 3WL0A 5HR6A 3W22A 3QHNA 3UERA 4JTCA 2WMKA 1BRLA 4XUGA 1V51A 3MCNA 3UEQA 3GNNA 3L2LA 3I4KA 1L0PA 1VHNA 1TVLA 4QS6A 7REQB 1Y8BA 4L4LA 1EP2A 3RX4A 2WHLA 4KPLA 2RAGA 4RXGA 4BY3A 1R2SA 3IVSA 3O0KA 4LV4A 3M0KA 1KFBA 3CZEA 3VCNA 2GVGA 4RV8A 3AZTA 3D3AA 5H1WA 3MU7A 6XIMA 4KETA 4XKMA 3C0JA 4H01A 3GVRA 1OIFA 4EXQA 1GOOA 3FAXA 2WQDA 3ME3A 1PBGA 3EOUA 2ZZ4A 3T09A 2A3LA 4GY7A 1PZ0A 2C19A 4QJ3B 4ZQNA 1TELA 4ES4A 4GXWA 4QDWA 4Z08A 2V68A 1XLHA 3N29A 4I8DA 1ODUA 1D3CA 3ABSA 2V2CA 3UWUA 3V75A 4GK8A 5E0CA 4QNWA 2R6OA 2WNQA 2C16A 2I7GA 2KZHA 3HF3A 2PC4A 3URQA 5C6MA 2ATSA 3GU9A 1RCXB 1EGVA 1ISZA 3UG5A 1GTHA 2D22A 2ONEA 4BWLC 1FHVA 1CBGA 4JFSA 4LBSA 3E2RA 4DN1A 3HO8A 1UIPA 4DWSA 4BQ2A 1BFNA 3NL3A 5HUPA 4EPBC 4HNLA 1A3HA 1HXJA 3LXAA 1IEIA 3HQ1A 4Q8MA 3T42A 1GT8A 2YIHA 5BMWA 1V02A 4HCHA 2BB0A 3NPUA 3VABA 4WHBA 3WD3A 4YTRA 4QDPA 1ZTVA 2R94A 3TX9A 4G7EB 3U5UA 4WUIA 1IWAA 2OZTA 4WD0A 1U2YA 3DFYA 4DJDA 3HPFA 3NL6A 4WJ8A 1HF6A 4Q7NA 2W5FA 1H61A 4DJED 4AIUA 4EANA 1I0DA 3M6YA 4DJFC 1JULA 2Z28A 3CPRA 1W3LA 1LQ0A 3DYOA 2GSJA 3ABRA 3C0SA 1DWAM 4V15A 3VIJA 4CCDA 2WSRA 4BK9A 1EEXA 2FJUB 1RPXA 2C14A 1X1OA 1PCKA 3CUZA 3TTSA 3NL2A 1PVNA 5A2CA 3WLQA 4ROPA 4QGCA 2J8TA 3PHAA 1LCOA 1QVBA 1BGGA 5EFDA 4FEZA 3P80A 4IGMA 1VD6A 1W0MA 3VA8A 3VZXA 4RNJA 3T2QA 4NAFB 3M5XA 1H63A 1FX6A 3CIVA 3K2GA 4DXXA 2WJEA 4WDUA 1NF7A 4AQLA 2D69A 2GJPA 2GQ8A 1S1PA 3QOKA 1A5SA 1XBZA 4A05A 4D1JA 1DBTA 4M82A 2E6AA 4TU1A 3S2JA 1H1NA 3AIVA 5HXMA 4JBRA 3BLEA 5L9FA 5GPRA 1Q8AA 2WYSA 2VX5A 4HYWA 1HG3A 4MY1A 2WB5A 2PDLA 1Y5XA 5A8MA 4F0HA 1XBXA 3CJPA 3HURA 2CLOA 4OBRA 3TYCA 3FX4A 1PEZA 1ZRQA 4XZWA 4RDVA 4KKXA 1UP0A 3FW6A 3IIZA 5CGMA 1G7VA 3ABOA 5I00A 3SN4A 1W5PA 3BAIA 2A6NA 2PF0A 4KH2A 5JH1A 1R47A 5HR7A 4DM1A 1CZ1A 1ODZA 3SAZA 2XGZA 1XFCA 3RYSA 3ES7A 1Y5WA 4OWGA 1DIOA 3VD3A 1JUKA 2ZUWA 3QBUA 2ZRXA 1RA0A 1XG4A 1G01A 3Q94A 3M0LA 3NQ8A 1QNPA 2OGYA 1BWVA 2ACSA 1M53A 4OOZA 4MZ8A 3ITTA 2Q01A 3GZAA 4FXSA 4QEHA 4E3VA 1DWFM 1SR0A 4D6GA 2Q3OA 3KE0A 1XYBA 3TAOA 2AQWA 2IKHA 3S6DA 1XRFA 1VRDA 4M1RA 3GS6A 4NT0A 4KT2A 3GTHA 1DHPA 4UQEA 3TYAA 2OX1A 4N42A 4C6KA 3FSUA 1ZJIA 4LUSA 4ZOEA 5LNVA 5CZTA 4IL0A 1W1TA 4ALDA 2FVMA 4RV3A 4XX6A 1DEDA 2XM2A 1ISWA 4B5WA 3B8UA 1XLMA 3CWNA 3WUBA 3H4GA 3HPAA 1FHLA 3R5EA 2FQIA 2GGGA 3N6QA 1S1RA 1V02E 4L4MA 1RK5A 2WQPA 1S5VA 3PJUA 2ISDA 2OKTA 3F2DA 2BY3A 4MY9A 2BHZA 3H4WA 3EX3A 1IV8A 2ATMA 4AH7A 2YYUA 4J27A 5HAOA 2A85A 2R8WA 3PBUA 2YOCA 4LVDA 2DVTA 4F0LA 5K3VA 3PTQA 2DIKA 4BR1A 3U4AA 3DKJA 1OF8A 4S3KA 3KOYA 2G95A 3J7HA 4XZLX 2HVMA 4LS1A 1US3A 4HKPA 3APYA 3URBA 2FJKA 5D9MA 1WKDA 4GKTA 1X7FA 3HGOA 3TQPA 1E0UA 3PPCA 1P0NA 1DE6A 3W7MA 3WDHA 3VM7A 4NZ4A 3ANVA 2ZX6A 4B5SA 1GKQA 3ARXA 3WF0A 2RUSA 3IV8A 4UCFA 1RLDA 2DIJA 3B9EA 3CWHA 4ZFMA 2JKAA 4JTGA 1E3ZA 1JJKA 1ONRA 3Q45A 1E56A 2J62A 2PGEA 2YBUA 3UWZA 3U2EA 4XVDA 3W1LA 3W0KA 3PG8A 1P5BA 1IQ8A 4IPJA 2V3FA 2DT3A 2V63A 4GVHA 2CZFA 5DXYA 1E6XM 5FEWA 1DHKA 1S2TA 4MJZA 1K4GA 4WGXA 3BW3A 2DDXA 3CQJA 3L2MA 8CGTA 3N14A 3M5VA 5D04C 3G5EA 1T40A 5CPQA 3W75A 2QEZA 1JRBA 3W23A 2B31A 5A5WA 4G5DA 3BZGA 4FNPA 5IBXA 3TN6A 2OWCA 3V4BA 1BWKA 2EPHA 1GNXA 3LXCA 1BVWA 5JUVA 1YHTA 1W54A 5F1VA 2VFDA 1NOFA 1FCQA 3QV7A 2NW0A 4ZSUA 4FS9A 4GMEA 4KS0A 1HKKA 1M1BA 2XDFA 4UC5A 5CG0A 4UTWA 3IPWA 1T99A 4IWWA 5CBBA 2GJXB 3G22A 4ZTXA 2WHKA 3W6MA 1XSJA 3B04A 3VE9A 3HG2A 4OGZA 5CPSA 1RPKA 2QYGA 5FJUA 3OYXA 3GM8A 1C90A 5ABFB 3LTPA 1VB9A 3WYZA 3BWWA 5DBUA 1E40A 3N3MA 3MP4A 3NFUA 1ONXA 3T9PA 3UF9A 9XIMA 3W7CA 3ES8A 1KFLA 4Y2WA 4GYFA 4H8NA 2ZKMX 3PZNA 4L1XA 3W1MA 1Q6RA 4LSBA 4U5IA 3W70A 2XVNA 1XLEA 5IHRA 4XAPA 3VDHA 1E4IA 2PWUA 1UWUA 2QCMA 1O5QA 1UWQA 5EBAA 3WLKX 1JG9A 4R7WA 2JQXA 4QR6A 3WQEA 3W87A 2HSAA 1GJUA 1Q6CA 4HGXA 1LQ2A 4NASA 4ZEPA 1LRNA 2GOUA 1JVNA 1DJXA 3DUGA 5FEPA 1VFOA 2BV9A 3VOIA 1R30A 4QHRA 1XLLA 3F4VA 3PBYA 3B8DA 4S3BA 4X9SA 2OKOA 4H8UA 4NZ5A 1JRCA 5K9DA 4WY0F 5C2GA 3HPZA 2NQJA 1NDZA 3KLLA 1KD0A 1UR9A 4WDTA 4L1GA 2ZVRA 3TCSA 1XSIA 1MWOA 3SRDA 4EXBA 1FKXA 3W2LA 2Q71A 2WM0A 4BWLA 1RR2A 3U2CA 4QLKA 1TPUA 2PUZA 3O07A 4G7FA 4MMWA 2FH6A 5DFAA 3BH4A 2D2GA 3WUFA 2R1PA 2E4TA 1GQKA 3HOJA 1IIGA 3NQFA 3NQ2A 3STFA 1OADA 5KSWA 2Q02A 3KVLA 3VOCA 3AS1A 3LMYA 4OOUA 1U5HA 3E0LA 3H24A 3LLDA 1W5OA 1PJ9A 2ZCGA 3GVVA 2Y8VA 1MSSA 4OECA 5A6LA 1EJXC 4QLJA 3VKBA 4FF5A 3B9OA 1BF2A 3RDKA 4PUNA 1L6YA 2WZIA 3SI9A 1PL9A 1VJZA 3LRKA 5RUBA 3BG9A 4XZHA 3HJEA 1Z9AA 5BROA 1QNQA 4WDWA 4DXKA 2J9ZA 4PB4A 1TPC1 1XCXA 4DJFA 3NXFA 4E8DA 4MB3A 3BAXA 3LBMA 2NSOA 1SW0A 4FZIA 3W7HA 3T81A 1F73A 3AIUA 4GGHA 5BYWA 1YDNA 2VEMA 1JDDA 2NUYA 4U5KA 3A23A 5AHLA 1HGYA 1Y0EA 2F6UA 1F6YA 2FVLA 3CLWA 3WDRA 2JKPA 5FKYA 3A4AA 3S5NA 4C6DA 3K30A 1KKOA 5HPCA 2ZRVA 4L4OA 5ENLA 3L4VA 4Y9PA 3SCQA 2DQWA 4UTMA 5CGTA 2XUCA 4HNCA 3BLPX 1WKYA 3AO0A 4QE1A 4DUOA 1NDVA 1R85A 5DY2A 4B5TA 4MJ4A 1SO4A 1J8VA 2UY2A 2XZ9A 4PRWA 1NQ6A 4C6NA 2GK1A 4I9AA 3W73A 1K77A 4GO8A 4QSHA 5ABEA 1VPYA 3F4WA 3NQ6A 1GOKA 3UYCA 3VKJA 3AS2A 3L12A 3UWYA 2J74A 3FJNA 4KERA 2DZXA 4LUTB 1OM0A 4U3CA 1UA3A 1MRAA 3N2CA 1T6MA 1GVFA 3VNLA 5KZ6A 1UG6A 3E5PA 1W8GA 3VGBA 2AGTA 2WWCA 4H1ZA 3KHDA 3UYIA 4E0CA 3DFPA 2J7HA 5BXSA 2J47A 4LAMA 1LBMA 3V0SA 4JYEA 1S2VA 5F1UA 1SFLA 1KCKA 1UWRA 1JDAA 3ABQA 3KOZA 3W38A 1L6WA 3MSDA 2J7FA 1P7TB 3TSBA 4GIAA 1H0GA 3AXMA 4JN7A 3DDMA 4PMYA 4US6A 3BC9A 3VCRA 4AW7A 1UD2A 2WVVA 3GHSA 2Y4SA 3SCTA 3UXDA 4E2DA 1FFQA 4Y8EA 1PTAA 1KM6A 4R9OA 3C5QA 2W67A 3CMJA 1QOXA 3I3EA 4P7RA 4EPDC 2A2IA 4LQ1A 2QJNA 2VRJA 1OK4A 2RDWA 3AC0A 5I3DA 2ZC1A 1R87A 3LGDA 2PA6A 5H6HA 2DUAA 2OEJA 4Q4MA 4JNYA 4L80A 3WD2A 1AQFA 3UFYA 1CI1A 3GXIA 4MDPA 4LGXA 4GJJA 2FIQA 2PTXA 1OABA 2A3CA 1J0HA 2HV5A 1OG6A 2QF8A 3WO8A 3S2NA 1MNSA 3TN5A 4IUOA 1EXPA 1BXNA 3BJTA 3L4UA 4GXMA 1ZQ5A 1DV7A 3FDKA 3EZ4A 3AWNA 2ZC8A 4TX8A 4PEEA 3W7OA 1EF3A 3NDZA 3QZEA 2VEIA 4IHCA 3WF1A 4IX0A 2BLEA 1XGDA 1HW6A 5CJNA 1KBJA 3FJ6A 3OLGA 3VD4A 3RJYA 4HZMA 2XVKA 3UZXA 1W3HA 4C6MA 3POCA 2WKGA 3P60A 1O5KA 1PHWA 4R53A 1ITQA 3LRLA 1TJPA 3TQVA 3HQNA 3WBAA 1THFD 2P88A 1XLDA 3LGEA 4WXYA 4ZR8A 1W9DM 3ONBA 1YYAA 2D2OA 1N8FA 1KR0A 5C0QA 1E1CA 3BV7A 1CGWA 2AGKA 5JU6A 2ZXQA 4N9CA 3V35A 1V6UA 3O3RA 4NHVA 8XIAA 3M44A 3TR9A 3AMLA 2ZIDA 3AIBA 1PIFA 3W7IA 3S0CA 1HL9A 1IEVA 2F2KA 3H7UA 2HJPA 3G8RA 5CCZA 4CNSA 3UXKA 2XIIA 1SJCA 1O1HA 3GVGA 1OC5A 4NIRA 4G1KA 3BW4A 3L4YA 4ZQPA 4D6CA 4HYRA 2P0IA 3CZKA 1EFZA 1TQJA 1E9IA 4FHAA 5C9RA 3MI6A 5ECVA 3N1AA 4N9EA 3O16A 5FIPA 1DWGM 1Q3NA 3L2IA 2XSAA 2G3FA 3WD4A 3PSWA 4LRSA 3RU6A 4ZA0A 3W25A 3WH5A 4LEQA 4H9UA 3HGJA 4DVOA 2R9RA 1MZHA 1S38A 1ISYA 3TYUA 4PMOA 4UBPC 2YFNA 5AN7A 3O2LA 4PUJA 2EHHA 5HULA 3HJZA 3VX0A 3DFHA 2YZRA 1W3JA 4CD7A 1JDFA 1ZU8A 4IIGA 3CT7A 3KLKA 1SM9A 1RALA 1PZ3A 4DBWA 1SJDA 1UUMA 1OT2A 3BMWA 3RO8A 3UJSA 3AHYA 3GTNA 4E8GA 4BQ4A 2EEXA 3GXTA 1EEPA 4WKHA 4ZB0A 4IJBA 4JYFA 1C92A 4LAKA 4S3AA 5D03A 4J7RA 4JTHA 3YPIA 2ACQA 2EG8A 4HK7A 1RA5A 5CKSA 3F7JA 4WVXA 1EO7A 2W6RA 3OG2A 3TVAA 1S5NA 1DXFA 1QI2A 3FA4A 1WDSA 3TXVA 3RRXA 5G1TA 4C6BA 1CLVA 2PDGA 2ODOA 1UC5A 3IJIA 2J7BA 4Q8UA 2WBKA 4Z2GA 1KRAC 3EMCA 2O9PA 1TB3A 1G4SA 3VIPA 2WBGA 3F5LA 1BAGA 2WWDA 4MADA 4PYSA 4TIMA 4QE4A 2GL5A 3R0UA 2YBVA 3QHOA 1EJUC 5I24A 2ZUNA 4DBEA 4G7EA 2D2JA 4P2VA 3JZEA 5DT7A 1K03A 5B7YA 1NSJA 1I1WA 1KM3A 3EKGA 3MI2A 4LW7A 3OBEA 2BGQA 4A6GA 1AMYA 2VWTA 2VX7A 1A5LC 3NYDA 5I79A 2PDXA 2QUTA 2B7NA 4AUBA 3Q67A 3M0ZA 3TA6A 1LT8A 2YSWA 3L5AA 5BXRA 3LHYA 3CEUA 2I1OA 1HIZA 3I65A 3CWOX 4C6OA 1XLIA 1WOBA 3L4TA 4LXFA 1R46A 1LL4A 4PBGA 4W8AA 1Q6FA 1LG2A 5D2TA 2OZ0A 3RX3A 4ATWA 1TV5A 3NCOA 3TIMA 5A3HA 5J8LA 3NOEA 5CPLA 3F4CA 3QMSA 5CPNA 4FO4A 2Y61A 3DG3A 4NZCA 3SGZA 1TTIA 1X96A 1WDPA 5AFDA 4UOJA 3AUJA 5JIWA 5GJPA 4U2ZA 3LRMA 3ZT7A 3C2OA 2Q3RA 4NZ1A 3NGFA 2O9TA 2CZEA 3F1QA 1MDRA 3C2RA 4NAFA 3T1GA 4GUIA 3TJIA 4L6HA 1WXJA 2WZEA 3S1XA 1ZL1A 2OOGA 3H12A 4Z2HA 2VFEA 2E1DA 4F0SA 5FF2A 4HU4A 4NZJA 4G8TA 3LM7A 5EPDA 2NQHA 4M7TA 3H23A 1AJ2A 1U30A 1BTCA 3IGUA 4ORIA 1K8YA 4HHMA 4LCQA 2QCCA 3QV8A 1MEWA 2V5BA 3LSCA 2WC7A 3WNKA 1VFMA 3UA3A 1XQKA 3UG4A 3WQGA 4MAVA 3V36A 3EB3A 1NU5A 1XCFA 3U6WA 4UQDA 4AB4A 3DAQA 4NZFA 1PKMA 4D72A 4FALA 1AH4A 2OX4A 2DP3A 4PSRA 3OQEA 1GZGA 1TA3B 1I8JA 1MW3A 2BWGA 1SPQA 3UJRA 5AOUA 3ITOA 2H9AA 4EOUA 1JYVA 2I5QA 2QNEA 1ITCA 1GVYA 1FDZA 2YW3A 1NQKA 1O95A 3DH7A 3S1GA 1F05A 1IEWA 4X3ZA 3WIJA 1K70A 3N18A 1J79A 2Z25A 2J9YA 4HOWA 1UR1A 3B05A 4PB3A 3QC0A 1MEHA 4A8LA 3LK6A 4XB3A 2XN0A 4GABA 4CD4A 2WMHA 3GFXA 2IUZA 3CS2A 3OQ8A 1MQPA 3ARUA 3LS9A 4FOUA 4B4FA 4CN1A 2OYLA 4CEXC 3UR5A 3BQ5A 3SUVA 1YXDA 4QSFA 3B8TA 1G4PA 2D0FA 2C8NA 1A4LA 1QO5A 4GJ1A 4IPLA 2PPGA 2QMKA 4M81A 1W1A1 4H00A 1EGZA 3CT2A 3BOFA 1GW1A 1M7JA 4BI5A 4HPJA 3DC0A 3IGXA 3OZOA 4Q6JA 3FYYA 4MLJA 2VOMA 2ZRWA 3QJAA 4F48A 2CBUA 1TWZA 1H7PA 4PCTA 3CV2A 2CBIA 3LLXA 3WQCA 2CETA 1KM2A 5CSSA 4UQBA 5A94A 5DRIA 3UNDA 1UP2A 2J8GA 3UCCA 2QCEA 1JQXA 3F5KA 3S1UA 4LX4A 5IFTA 2VR5A 2O9RA 2GSHA 3PR2A 4AWTA 3G0XA 3WEOA 3E2QA 3UD6A 4ACZB 3EWZA 4KIRA 1UW9A 4WXZA 3PBMA 1KRBC 5AKQA 3H2CA 4WY0A 2FMOA 1UJPA 1L9WA 1ELSA 3CUHA 3TOPA 1UYQA 1UIOA 3ONCA 3XINA 3FK4A 3QOMA 4OIFA 3RPTA 3ZS4A 1XDJA 5MF5A 1P4CA 1TJ0A 1TMLA 1UH4A 2PDBA 1JZ4A 2EGZA 4OKDA 2QF7A 2RFGA 1UBSA 4O0KA 4E6MA 3M6DA 2FPTA 3ZSSA 4HCDA 4G6CA 1LBFA 3ARQA 3LB0A 1H2JA 5TIMA 1OB0A 4KGLA 3IUDA 4IF2A 4Q4SA 1JDEA 4PBEA 2VP8A 1NY1A 2C13A 3G8EA 4M51A 5FCZA 4OZOA 3M9YA 2CLKA 2OLAA 2VO5A 2FMNA 2BTMA 3UY8A 2DQXA 4P5UA 4XVEA 4OTKA 3UA4A 4NX0A 2J24A 2X40A 4ZO7A 1B1YA 1P0BA 4RJEA 3QKEA 2DVXA 4W93A 2VX4A 4RNHA 3LCHA 2BMBA 3LHWA 2GLKA 4K68A 2XFFA 1Q6QA 3P62A 3N25A 1RQHA 2DORA 2D23A 1PWLA 1IXPA 3CMFA 3T07A 4YXGA 1IEQA 2GSEA 2F9RA 3NQGA 1EJVC 3HMCA 4F2TA 3WELA 3GDLA 4C6QA 5DEZA 2Q8XA 1UWSA 1CIUA 1UWAA 4KBXA 3MDUA 3RO6A 4C6CA 1UR4A 3WJXA 5EU9A 1LUCB 1OFBA 4NRSA 3WK1A 3AIQA 4YTSA 2Z2AA 3MS8A 1H5YA 1KFKA 2PLJA 4N4PA 4M3PA 2O4MA 4XG1A 3STCA 2H3DA 3HV8A 2GJXA 1RCOB 4FOKA 3NO3A 4H4IA 2VELA 5L6UA 8XIMA 2FZMA 3AMKA 1I2OA 2W3ZA 3VTRA 3UG3A 5ABFA 2ZZ3A 4BI6A 1RHCA 2DZAA 1KCZA 4L6DA 1FWJC 1W3KA 2HXTA 3TLLA 4IIHA 2JEQA 1AW5A 3IIVA 5MKGB 5LA1A 1HZYA 3FCPA 3VIFA 2BZNA 2OEKA 3JR2A 2D3NA 4B5NA 1JXJA 5AC6A 4S3CA 2V5DA 1UC4A 4AZBA 2EKGA 1GJWA 1EYEA 1XC4A 5D9PA 3GFZA 1Q65A 1JF5A 4RNFA 2WO5A 4NJIA 3GD6A 1L8PA 3GWQA 3NJ3A 3SCVA 3IJ9A 3CO4A 2HMCA 2OO0A 5JH2A 4PUKA 2YL9A 2PTWA 3AHXA 4YVVA 4JQ1A 3RM9A 3UWEA 3DERA 4GIEA 4ZBCA 1YQ2A 1R6WA 1GVQA 1QXLA 4XIMA 1UOZA 3L7RA 1Q6EA 3PZUA 2DZBA 2QUVA 2VC6A 1A5AA 3BCJA 1MZRA 1T5AA 2JK2A 3N6JA 3NA8A 2QS8A 2J88A 1E43A 3RXZA 5I2UA 3K13A 4GI4A 4ZODA 4WF7A 2QDEA 4UTFA 2V67A 1MO0A 4GACA 4X60A 3ZSTA 2NQZA 1KBLA 1WQ5A 2E9BA 4AY7A 1O68A 1J0JA 2PCQA 2GGJA 2A0NA 3RMEA 3QF0A 2PS2A 4R34A 4C6PA 3M0MA 2PD5A 2CFFA 2WJZA 4PUWA 2WANA 5K7JA 3QFWA 3NL5A 1XM3A 3RHGA 1K8ZA 1EOKA 2D3LA 5CZKA 3C56A 1GHSA 4OHQA 3MP3A 2FTWA 3VC6A 4I5RA 3W84A 1NWUA 2C15A 1JPDX 2V38A 1GW9A 4H8HA 4TMBA 3W7GA 4YYFA 3W2KA 3C2VA 3UW6A 1R3QA 3KBMA 2YFOA 1XIMA 4JX6A 3RCNA 1YDVA 1VPXA 3AISA 3L67A 2C6QA 4ZQRA 2QCGA 4DYEA 3D46A 1RH9A 4MJMA 1LDCA 2J6VA 2V82A 2G3IA 3WMLA 1CPUA 5LIUX 1N82A 2EF9A 2WNZA 3LTSA 1UD5A 2DY3A 4KESA 2VGGA 3AICA 3DU0A 2Z24A 3KDOA 4EF9A 1UROA 3FEMA 4ECLA 1U1UA 3GBDA 1K8XA 5HOSA 4ADUA 4HMCA 4Q4PA 3CYVA 4TV5A 4MF4A 1ZFJA 3SRKA 4ZMGA 3WK0A 4IFOA 4RCXA 4PTDA 1LRQA 3LCXA 3WMCA 1H62A 1LQAA 2PBGA 1FFRA 4JX5A 3QLDA 3PPHA 1JPIA 3STGA 5CH9A 3NQVA 1AH0A 3PG9A 2VFGA 1C8YA 4TOQA 2ZVIA 1V08A 4FNTA 4AEOA 2V3EA 3F2CA 4FAMA 1CEOA 4GH1A 4LCSA 4PMVA 2YZ5A 4YTTA 1Y65A 1EZ2A 1LZOA 1RQEA 4C60A 2OVLA 3W1AA 2GQAA 1OVDA 2FGLA 4R85A 4DWSD 3WLJA 1WDQA 1JYXA 4CU6A 1TTPA 5GJMA 1KM0A 1TMQA 1QRQA 3W2NA 1E6PA 5FJTA 3P81A 3K8MA 3G6LA 2MNRA 2W66A 1N7KA 2WXDM 5BOOA 2OEMA 2HXUA 3WJYA 2D73A 2IMRA 4J3ZA 3VD7A 4W4QA 2QPSA 3FJ4A 1R86A 1P7TA 5E0KA 1Q13A 3N34A 3IRSA 1R9ZA 4HBKA 2QUUA 5C2CA 4DJDD 2Y5JA 1EQPA 3HIJA 5M3WA 1B0IA 5HA7A 4IH3A 3WUEA 2BGSA 2VGBA 2CLMA 2WNNA 2WZHA 4LEFA 1BQCA 5FJJA 1J01A 3RK8A 3E12A 4CNNA 5F2MA 3WQ5A 3GHTA 3UXLA 3EYPA 1YX1A 3QGAC 2ICSA 3AZSA 1ADOA 2NV9A 1CWYA 4ERGA 5FSEC 3RITA 4I6KA 3SCRA 3R7MA 1GORA 3U57A 2Z1SA 2YDRA 1LL6A 1B90A 1JL8A 1FP8A 3GC4A 4LYRA 4MB4A 2CW6A 1CXFA 3GC2A 1EOMA 1BEUA 2CBJA 1A47A 4CQAA 1V6WA 1YBQA 2ZUMA 3RNDA 1YTEA 1E5NA 4ADSA 5D05A 1OCQA 1EBGA 4JTUA 1QO2A 1QHPA 4YVPA 4AZ6A 2CIPA 4AEFA 1A5UA 2Y5EA 4O16A 4IP4A 1JYWA 1RSCA 3RN6A 3VZZA 4TV6A 3B8WA 5A6BD 4H7ZA 3GDRA 1JCNA 2RDTA 3BAWA 4N7QA 1VHCA 2Y7DA 3MMUA 4O19A 3PTKA 4EK7A 3R89A 3W7QA 4GYJA 3ZO9A 3WH7A 4AWUA 4W7WA 4PL1A 1XIEA 1T0OA 1V0KA 1NWTA 3MT1A 1O5RA 3CV7A 5CAHA 4MUPA 1A50A 4US5D 1OQFA 5C2XA 2IKJA 5CPMA 4P7OA 1C29A 4YU1A 2WCAA 4GQQA 4RE4A 1DORA 4JY8A 5CSRA 2X30A 5EMMA 4NQ1A 2DFAA 5FEXA 1VGAA 3K1GA 4A21A 1W5NA 1O94A 3MDWA 4AHOA 3DHDA 1BKSA 3SY8A 1W1IE 2CLHA 4A3QA 3V5CA 5DMNA 1AQ0A 3ZLGA 1EP1A 4LAZA 1GVEA 4E2OA 2NXIA 2DV0A 4M6VA 2VCBA 4E5TA 3TROA 1NFBA 1J4EA 4OV9A 3IIOA 3OZYA 1C8QA 3CIWA 3CQKA 2FZNA 3SR7A 2DSZA 3ARZA 4HNVA 3KM8A 3ZJKA 3GXFA 3FYPA 3GH5A 5IFPA 4XWUA 2D24A 1EJRC 1Q6LA 1Z41A 3ZVIA 3IIPA 3W37A 1E4LA 4RDWA 3N4FA 4E4UA 4W87A 3EMZA 2GVYA 4S23A 1Q5MA 2E1WA 4WX2A 4MYXA 4S39A 2XVGA 3AQUA 2IS7A 3A3WA 3R94A 2O7SA 4HMNA 4CD8A 1LF1A 1XH1A 2PFHA 1JFXA 3DIPA 3GDBA 3PBWA 3SSZA 3MUXA 4HN4A 1JI2A 1DQWA 3EMQA 2AMGA 4DLMA 4GH3A 3SIZA 2RJHA 5E9AA 3CUXA 2HPMA 2VDHA 4HP5A 4M6PA 1K1DA 2YBTA 3PULA 4Q4QA 1OCJA 3BPWA 3NO1A 2CYGA 4IG2A 1SMDA 4QAWA 3W85A 1QCWA 3O8AA 1H7NA 3W7JA 1V3HA 2ALRA 5BNKA 4DZIA 1AW1A 4V1YA 2J8FA 2GJRA 3VM5A 5HUOA 3EWUA 1GTEA 2NX9A 3QEZA 2L5HA 4RXFA 3PFMA 1HNYA 3MC5A 3HV9A 5E09A 1FWNA 2XH7A 1SZGA 1UUQA 3OEXA 4FXJA 4G9PA 3W1UA 4H04A 2EKCA 3EA1A 1AMKA 3E2VA 4KRZA 5FSDC 3GKFA 2R1LA 2OPJA 2ZQ0A 2GGIA 4UFKA 4DXVA 1WDDA 3TOYA 5XIMA 1B31A 1QASA 2E6YA 3ZR5A 2WVSA 4O1CA 4GZ7A 4MM1A 3GSMA 4CCEA 2VVSA 3E9AA 1CLXA 3PZQA 4FLSA 1LWJA 2XIJA 4XAGA 3AMGA 1VBUA 3PB0A 1SFTA 2AKZA 1X8CA 1XBVA 4F8XA 1QAPA 3MWCA 1J5SA 2X8RA 2G3JA 2XIBA 4Z0SA 5G1MA 3EDFA 3L0NA 1WE5A 4OVXA 3H2AA 4ICNA 4IFKA 1R3WA 5CC5A 3TH6A 2E77A 1IR1A 4H6KA 1RUSA 4HU8A 3NM3A 2RDUA 2ZX9A 1XC6A 1KRCC 5C9UA 5D09A 4H83A 1XBYA 3CHEA 5HWJA 4IIBA 3VOFA 3TYBA 4XUYA 2XGIA 2P8CA 4CQ9A 3H70A 3B9AA 2X1RA 4DIAA 4J3UA 3GHRA 3UU0A 1PB0A 4QIUA 3EKZA 1TREA 2F84A 2CEQA 4IMAA 1X38A 2ZDRA 5KINA 2XISA 2HDJA 3B9DA 3JW7A 3COTA 1AD4A 1SFJA 4NX5A 3NZQA 1UJQA 2PD9A 1T96A 3CIXA 3W86A 5AB3A 2OG9A 3VC5A 1R9XA 3MTWA 4K8EA 1H7WA 3ZOAA 3USZA 4JKMA 4H2HA 1Y7VA 4UOQA 3VIOA 4MLRA 1X6LA 4UFIA 1QPQA