1O6BA

Crystal structure of phosphopantetheine adenylyltransferase with adp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
163
structure length
163
Chain Sequence
ASIAVCPGSFDPVTYGHLDIIKRGAHIFEQVYVCVLNNSSKKPLFSVEERCELLREVTKDIPNITVETSQGLLIDYARRKNAKAILRGLRAVSDFEYEMQGTSVNRVLDESIETFFMMANNQYSFLSSSIVKEVARYDGSVSEFVPPEVELALQQKFRQGGSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
total genus 52
structure length 163
sequence length 163
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1o6bA00
4DNXA 4OJMX 1CT9A 4MUFA 2QJFA 2A1UA 3K9WA 1JECA 4K0RA 1TYDE 4XFDA 4CT0A 2QTRA 3AG6A 4ND7A 3S3TA 1NYLA 3ZGZA 2A86A 2JA2A 1P7PA 3CLSC 3COYA 2A1TS 1VLHA 3PRHA 1WJGA 2X3FA 4MULA 4NZPA 3ZJVA 1O96B 2GOYA 2Z08A 3CLRC 3FETA 3GMIA 1QRUA 3IOBA 2DXIA 1KAQA 1GZUA 1MB2A 4ZT6A 3A04A 4CDNA 1J09A 3L92A 1VBKA 3IMCA 3N8HA 4P2BA 1H3EA 2I1LA 3RBAA 3KT0A 1T9GR 4DDKA 4EG6A 5AHWA 5K0TA 1T6YA 1X8XA 1T9GS 4EG3A 1OBCA 1YULA 1NSYA 1OWMA 3AKZA 3A05A 3UC5A 1Q15A 3HFJA 3FWKA 1KR2A 3FI0A 2WB2A 1V8FA 1B6TA 2AKEA 2A84A 4MUKA 4DLPA 4MW6A 2QJOA 4MW5A 1N77A 4YBRA 2E18A 1XJQA 3VRHA 3AIIA 3IUEA 3N05A 5TGTA 4L2IB 1N2IA 3KT8A 4J75A 2HGZA 1KQPA 1ZUNA 3IOEA 3TZEA 3FG9A 4Q93A 5HUHA 3RK0A 4ZT5A 4NX2A 1PFYA 2WQ6A 1O97D 4WNYA 2A1UB 4ARIA 2CFOA 1JEDA 3CLUD 1TQ8A 3FNRA 3LCJA 1PFWA 4F4HA 4JXXA 2DPLA 1KAMA 1RQGA 1WQ4A 4EG7A 4KPUB 4JYZA 1N2BA 1F4LA 1PG2A 1ZH0A 3IOCA 4NDAA 1NUTA 2GM3A 1N2GA 1MAWA 2CYBA 3A2KA 1O96A 4MVXA 2YWCA 2PZAA 4L2IA 2PXHA 4KPUA 1OWOA 3P0JA 4HJXA 1N3LA 2CYCA 3ZXSA 1K4MA 1BS2A 4MUIA 2HZ7A 3DO8A 2X1LA 1MRZA 4HK4A 3KT6A 2HMAA 5HUJA 4CDMA 2DUMA 2PZBA 4HPWA 1ILEA 3A4IA 1WXIA 1G8HA 1MBZA 2R5WA 3IDFA 1WXGA 3ILVA 1WKBA 1NUUA 3HZRA 3ZJUA 1OBHA 4QREA 5IHXA 1M8PA 1I2DA 1NI5A 3SDBA 2QUIA 1O94D 4YP7A 5J58A 4MUJA 2YXNA 4ZT4A 4EFKA 1T6XA 2RD2A 1KP2A 2PZ8A 2A88A 1J21A 3ZIUA 4GU5A 1MC1A 1M8GA 1WXEA 1IQRA 1M8FA 1J20A 4R2LA 2Z09A 1EFVB 1VBNA 3UK2A 3AG5A 3SYTA 1MOPA 1JEEA 2BTEA 3L93A 2B7LA 3D6VA 4Q16A 5J59A 1EFPA 2WSIA 1WZ2A 4ZCPA 4MW4A 4KR9A 3G59A 5DB4A 1WXHA 3MLBA 4U8HA 1T6ZA 4ZT7A 4E1AA 2C5SA 4R0NA 2H2AA 4JZYA 2DEUA 1XNGA 4MQ6A 1ZJWA 2J4DA 3X1MA 1NUSA 3IMGA 3ND5A 3FH0A 5DASA 3CLUC 2O5RA 2Z3VA 2E21A 3TZLA 1H3NA 2D13A 1GTSA 3UMVA 2CUZA 1U7DA 5KHAA 2YY5A 2BYTA 3RJZA 1I6LA 4PBSA 1XNHA 3N2YA 4DDHA 1A8HA 1JMVA 2QJTA 3CLTC 3M5WA 5IJXA 2V0CA 4MUHA 2QTNA 4MVWA 1M8JA 2ZP1A 5K0SA 5TEWA 1NZJA 2YWBA 4EGAA 1IQUA 2J07A 2IJGX 2CV2A 4AS1A 4KR6A 4JFAA 2RE8A 2QUKA 4MUGA 4TS1A 1QTQA 3H05A 1M8KA 2IELA 3HL4A 4OUDB 4RPIA 4MUNA 4MW0A 4PY2A 1GAXA 2G36A 1VBMA 1K92A 1NUQA 1Q77A 1G59A 3CLRD 1N1DA 1EE1A 2OQ2A 1YUMA 4XFJA 4MVYA 3P0IA 4DJAA 3CR8A 3LOQA 5FNZA 3OTWA 2TS1A 1KH2A 1EFVA 4EG5A 3H9CA 4UZEA 2CV1A 2H29A 3HGMA 1R6UA 3CVWA 4JXZA 4ND6A 4G5FA 4MUEA 1U0BB 3FOCA 2ZUEA 3VGJA 1F7VA 4KKVA 1JIKA 5JBNA 4ZCTA 3FHJA 1QU3A 1EUYA 1QQTA 2VTBA 1IHOA 3H97A 4I6GA 4OUDA 1D2RA 2NZ2A 2EJCA 3CVYA 5EKDA 3G5AA 1GLNA 3ND7A 5KCMA 3C8ZA 3IVXA 3CLTD 3Q10A 4WSOA 2QUJA 3SEZA 1GN8A 3BL5A 1KH3A 1YUNA 3RFFA 3FIUA 4MWCA 1F7UA 2PG3A 4BWVA 3IMEA 4MVCA 4GRIA 3QTTA 2X1MA 1GTRA 4R2MA 1X6VA 1JGTA 1LW7A 1XNJA 1YIDA 4NAHA 1PFUA 3HMQA 4ZT3A 3CVUA 2DERA 3P52A 5HG0A 1JIJA 2IP1A 3TNJA 4S1OA 2AZXA 2QUHA 5FO0A 1WY5A 1JHDA 3JXEA 1WXFA 1O0CA 1DNPA 3DV2A 3F3MA 1S4MA 4X0EA 1N2HA 3PNYA 4RUKA 1VL2A 1U7XA 4U7JA 3K32A 4QBTA 3IVCA 2XRYA 4MWDA 3UY4A 3NV7A 2D5BA 3GLVA 4PBTA 1N2EA 1TYAE 3Q12A 3QE4A 1H1TA 3I05A 3DLAA 4F3RA 4MWEA 4NATA 1TFUA 3TQIA 4U63A 3ELBA 1OWNA 2D54A 3N9IA 2CYAA 2EL7A 5F23A 2ZUFA 2PIDA 1EUQA 3MUEA 1R6XA 3IUBA 1O95D 4MW9A 3CA8A 1QNFA 1YI8A 2V0GA 1J70A 3NBKA 4EG8A 3COZA 2PFSA 1LI7A 4MAFA 1QRSA 2DLCX 1NP7A 5FO1A 2J08A 2O8VA 4KR7A 2J09A 1OWPA 1H3FA 1O6BA 4EG4A 3CVXA 1QRTA 2AG6A 2J5BA 1IVSA 4XSVA 2JAXA 4EG1A 1JILA 5LM3A 5DEOA 4ZCRA 4ARCA 1EJ2A 1KH1A 1KQOA 1UFVA 4I6JA 3IH5A 1OD6A 1U3DA 1JZQA 1TYCA 4MW1A 3H99A 4UZFA 4ZCQA 3ZUGA 5H16A 4I6EA 3PNBA 3KFLA 1EXDA 2CSXA 4PBRA 3MMXA 1KQNA 1NUPA 3RHSA 1TYBE 5J5AA 1Q11A 3COWA 1SURA 5TEVA 3ISJA 3UOWA 1O0BA 4K03A 1N75A 1O94C 3FDXA 4G5YA 3IVGA 4YP5A 2A1TR 3TS1A 2E0IA 4A91A 1WOYA 1F9AA 3P0HA 3PNVA 2VXOA 4MWBA 3MLAA 3MXTA 3X1JA 3ND6A 2DETA 1FYDA 1I6MA 1IRXA 3OP1A 5LLTA 4MLPA 5BNZA 4CQNA 1GPMA 3SP1A 3AFHA 1MJHA 3NBAA 3SEQA 3E27A 5KWVA 1KKUA 4YMIA 1COZA 2A7XA 1J1ZA 1Y42X 1JIIA 3COVA 4NAUA 1PG0A 3FY4A 2XRZA 3G6KA 1IQ0A 1HYBA 1Q19A 3LE8A 3SZ3A 3Q4GA 1J1UA 1KP3A 4EF6A 4MW7A 4DE5A 1JZSA 3KT3A 4ZT2A 3RK1A 3ZJTA 1TEZA 4ZCSA 1V47A 4G6ZA 3ZXIA 1O95C 1K97A 1G8GA 1M1ZA 1N2OA 2QTMA 3X1KA 2DR2A 3AL0C 4AQ7A 1IFXA 1YIAA 1G8FA 5LFAA 2E89A 1KORA 5TS2A 5DK4A 1PFVA 2GKSA 2JANA 4J76A 4QRDA 3HV0A 2CT8A 1ULHA 4HJRA 1QJCA 4MW2A 1MB9A 3GUZA 1MAUA 2NSYA 3DPIA 1ZH6A 1O5TA 1N78A 1IH8A 3QTBA 2WQ7A 1O97C 1QU2A 2OV4A 4FZJA 1NURA 3CVVA 2A4MA 4H3SA 5H7XA 1K4KA 3TQOA 3CLSD 3INNA 3SZGA 1OWLA 3D6UA 1M83A 3H9BA 3IODA 4YP6A 1WQ3A 1R6TA 1U3CA 3VU8A 3PXUA 2VTBB 1I6KA 1FFYA 1EFPB 2X0KA 1LI5A 3U1VA 1N2JA 2CV0A 4DDMA
chains in the Genus database with same CATH superfamily
1C0KA 4RTJA 4N0MA 2R8OA 3GVXA 2IPOA 5A7GA 1A96A 3UFXB 3DEKA 2ODEA 1I80A 1YS9A 4BO3A 2ZEJA 3MAJA 1ULBA 4ZVKA 1IEQA 4WOCA 4XPZA 5JFOA 2PS9A 1CR2A 3LQRA 3PC8C 3ZXXA 4ZMSA 1CD5A 3H86A 3I9V1 5ERXA 1GGKA 2X0EA 1N5KA 3DMDA 4RD3A 3OMXA 3U09A 2P68A 3BWYA 3R0JA 5C1OA 2W6NA 3PTZA 3U62A 3ZE2B 4V1CA 3GLIB 4YBZA 4Q00A 5FTNA 4OQQA 1EXWA 4YRFA 3VA7A 1XMQB 1LV7A 2V4MA 1USVA 4HQ6A 3A04A 2V5AA 2EGHA 3UAGA 3TLAA 3OT5A 3L92A 4G56A 1Y9EA 3MTBA 3THRA 4FE3A 1P6UA 2AMJA 3U4HA 4ESEA 4GZ5A 3DOCA 3AHIA 5IX8A 5JAHA 3S2SA 1FDRA 3D8SA 1O57A 1W4ZA 4RIEA 3FDZA 5ALSA 3O47A 3QI2A 1BKYA 1XB2A 4OK3A 3EODA 4YJGA 4BFZA 3QVLA 1Z22A 4IFEA 4OGLA 2Q1XA 3TAXA 1JFRA 2C2ZA 1KY2A 1NSYA 2BJWA 3C4QA 3R2JA 4N5LA 4ZYWA 4YMVA 3EWAA 1SIOA 1CEEA 5EXDA 1QS0B 2BDTA 2FSHA 4ZI7A 4Q1AA 3EX7C 1C3EA 3E22A 1A9PA 2C78A 4JJ4A 4JLKA 5BQFA 3IA7A 4O4JB 3NHYA 5KCZA 1DC8A 3REQB 3MAGA 2CVPA 3OECA 3D1VA 1FW8A 2I2FA 3Q3JB 2OYRA 5KINB 4MLZA 1YRYE 1N77A 5HHTA 2H4XA 1PLKA 2PPVA 1P31A 2ANBA 3LY8A 1USIA 3MWYW 4BEVA 2E5LB 2AUMA 1ZUNA 3CLKA 3EXHC 1EFRA 4Q93A 4F5ZA 1AGPA 3DWIA 4C2AA 3ZQKA 3M7IA 4O2AF 3T3OA 2XY4A 3KYCB 2UZ1A 3LFTA 3KJFA 1JR2A 2BVNA 4D9JA 4CLOA 4E1BA 2NNLD 2UUOA 3BA6A 4WXYB 4IV5A 2CUKA 4MIKA 3TW8B 1KYQA 1TQ8A 2GT1A 2I71A 4LOJA 2EZTA 1KDOA 3U26A 2O06A 2WJGA 5LP1A 1QV9A 3WMRA 1S0UA 2XGJA 1L6IA 1ZN9A 2H4HA 3ZWOA 5BSKA 1RBYA 8LDHA 5EWMB 2V45A 2M9MA 2H48A 2PZAA 2RGGA 2VXCA 2M1XA 2XSZD 1NG9A 4IDHA 1DDIA 4F3CA 4QT0A 4H1HA 3CEJA 3W6NA 5E38A 4A8PA 4AJHA 3F7NA 1L1EA 4M8IA 4ASUA 2PYZA 4GFDA 2LP4Y 3KC2A 4OXRA 3U61B 4CMHA 3RUPA 3F78A 3Q41A 2CBZA 2FKAA 3ZW8A 4BO7A 1X1SA 3TTYA 1RKUA 1WXIA 1NSFA 1EA7A 3B1YA 4EHHA 4Y0VA 3PQ2A 4CR7A 5KSZA 3B1WA 3WGLA 4GT1A 4O3FA 4R5HA 4RPKA 4WJLA 4CKEB 2ODNA 2ORYA 2A0WA 1QDEA 1E96A 1ZL0A 1A72A 1HDEA 2WHXA 2NUAA 2J3HA 4E1VA 4HFJA 1GQQA 1NN0A 1NJ1A 4Z6KA 1WUKS 4A10A 4FM9A 4BUCA 1FUKA 1NF8A 1YONA 3KQVA 5F77A 5M5BA 3ZS9A 1P0FA 3VKGA 1CP3A 3ZLVA 5EHXA 3UKJA 1U9IA 4TKVB 1FSZA 2B1IA 2VT2A 2MHCA 3EXIB 1EVLA 1WDTA 4U2DA 4MS4A 4UFPA 4X71A 4YH1A 5AI8A 3MT8A 1Z5WA 3IQGX 4Q3EA 4G5RA 4KQHA 3KPUA 2PIAA 1IAQA 2ZGVA 3O7MA 5ICCA 5JCOC 3D3WA 3F6PA 3IUNA 4RK6A 1FJ2A 3BE5A 4WZ6A 2R7KA 4GM0A 5H82A 5JSHA 3QA3E 1YH3A 1FQJA 1L5VA 4R54A 3R9KA 1OH8A 1C81A 1NVGA 2C3OA 4OSPA 4Y0AA 3U1TA 3DS8A 5IAAA 2GO7A 4BX0A 4ZU1X 4R31A 3JD2A 2QT9A 4CI9A 1EXNA 2I5PO 4I4NA 5FWYA 1ZJ6A 4QUJA 1E9RA 3TIIA 2DFDA 2PMKA 2JFVA 2GEFA 2R3SA 5FFNA 2EJUA 3E0QA 4GBMA 1KZYC 1XL1A 5A5FA 3AEKB 1U5BB 2XMDA 5DASA 1JLLB 3H0CA 1Y3DE 4JU9A 3V3KA 2MSEB 5ER9A 5D3QA 3UMVA 1N5MA 3C87A 1EZ1A 4XXHA 3KK0A 1I9CA 4LHEA 4OQEA 3MVEA 5I9SA 5B58C 4YDHB 4DWOA 5MGBA 1IOZA 1L5HB 3CB2A 1UJ5A 4DDHA 4YYEA 5K20A 1RLMA 5EIWA 1NE2A 1Z82A 4MUHA 3G2NA 1WTAA 5IN4A 2C3MA 2QEQA 4Q24A 4Z49A 5BQPA 4W5RA 3PITA 3TDMA 5EQTA 4YUWA 4AP5A 5BSVA 2CHQA 1ZC4A 4U2BA 4MS4B 3VKHA 5EXPA 3DNPA 4JOSA 1FX0A 1JVNA 4DCPA 2O48X 5H02A 4PCLA 3SM9A 3C3DA 3H6GA 1DFHA 1HE4A 2CL7X 4HAOA 3WMEA 5LQCA 1P3DA 1XTUA 3DA8A 3SICE 4O1IA 3AZPA 5KVAA 2XXAA 4O33A 3L7KA 5KOHA 2C5GA 3HKCB 4N7JA 3C5EA 1GNRA 1R4AA 4OQ4A 2D1RA 2XDWA 4Y6QA 2WF7A 3QXHA 1RCUA 1U5AA 1NF9A 1X86B 1YOBA 2A5FA 2J9GA 5T4HA 3WLAA 1AXGA 3LLVA 2J9FA 5EYPB 3WR5A 1H4SA 1J33A 1W1IA 3GO4A 1N2CE 1FQOA 3ETDA 4BZQA 3A9CA 1B6RA 3I83A 1ZVQA 3L1HA 5I4KA 3AUFA 2Q7DA 2EKQA 2Q6TA 4OREX 2GUGA 1H2ZA 2BZ0A 3EW9A 1RM0A 3DDOA 3NFRA 3PQDA 1TAUA 3OM8A 5JZOA 1QQAA 2M32A 3D7NA 1M2VB 1K3UB 1KSJA 3GEBA 3PD7A 1P29A 3P27A 2H85A 2Z30A 3RVSA 2C07A 2NV0A 4ZCTA 2VJLA 1RABA 5KHOC 3V8PA 3O8RA 4BDSA 1NU6A 2BFPA 4CTKA 3SCZA 5COBA 3RYIB 3LX5A 1TC2A 2XUHA 3FOZA 3UHPA 3NAZA 4K6HA 1UJBA 4GMXA 1L5ZA 4LTNA 2J9XB 1GV1A 2ZWMA 3DOIA 2F6RA 1CRLA 4TRRA 4YCLA 2AE1A 2WW8A 5KTTA 2HBRA 1TT5A 1GXSA 1ZICA 3H2IA 5CURA 5DGTA 4GMGA 1Y3HA 4LXYA 1XQXA 2GXUA 2K2WA 3TUZC 2BGGA 3G2JA 5REQA 1A2KC 2AXPA 3GGDA 5DM4A 4A4DA 2IOYA 5K3FA 4RA6B 3ST7A 3D7SA 1J42A 3A3PA 3D8HA 2OTCA 1KAGA 2XE6A 1YSCA 4KXXA 2HPVA 4JYMA 4Q1BA 5FPHA 4U2FA 1H9CA 2AJTA 3HEAA 4ZT3A 5CAEB 1WCXA 5BWLA 1H9AA 2QDKA 2JCSA 1BEZA 4RY2A 5HF6A 2P6PA 3OEEA 1PFGA 2QUHA 2C98A 2XVZA 3ECAA 1E3JA 3CONA 3CUKA 3IAUA 2JGIA 3I01M 3P9PA 4LX8A 1YC5A 3IIKA 4N8DA 4OHCA 3D0QA 3O7WA 3R5KA 4M98A 3QEOA 4V0LA 3T5CA 1WD5A 3DCNA 4X0EA 2V6JA 4Q4JB 1FSGA 5DWVA 4LJ8A 2XNHA 3I4FA 1SHKA 2QUZA 5B1IA 3V9PA 2H4YA 1RI5A 5FBWB 2LIVA 4UDYX 1RT9A 4RD2A 3U17A 1PR2A 1UK7A 1W75A 1ZO8A 4NDZA 1YAHA 1JLMA 2B98A 1I5RA 3K2EA 4DC0A 4DBVO 1VKNA 3CRRA 1DIRA 1BCSA 1UT5A 2LBPA 4L3OA 2WRZA 1DPGA 3EGIA 2VF8A 4DCCA 4A8HA 3JQCA 3ZG6A 1S5PA 3A2LA 1ZEMA 1FQWA 4HQFA 1UXKA 1V45E 5DGCA 4BO5A 4DLKA 1PQUA 2YDYA 1QMPA 3TLMA 1AU9A 3QJYA 1IU9A 3MUEA 2Q3HA 1NVKA 3VH2A 4YUZA 1N32B 2O52A 3LS2A 1VE6A 4CMIA 5E9WA 3FUXA 3KQUA 2JIOA 3K0FB 5C5CA 1RQNA 2DFVA 2W93A 2WWTA 4RSHA 1XNRB 5A3RA 2BKAA 3ND8A 1T2CA 1JQEA 3KOMA 4KOAA 4RA9B 4EF5A 3D81A 4HNRA 4D97A 3HGQA 4MQEA 2AT1A 3C3MA 1HTTA 3CNHA 3VFDA 5FX2A 1P2DA 4ETMA 3TIGA 4UUNA 5D51S 2JAXA 3N87A 4GICA 2QTAA 4EMTA 1R6VA 1D4OA 5LM3A 2VNKA 4IJKA 3AKDA 2Q5CA 5JQWA 5LBUA 3IH5A 4Y9UA 2MOKA 1A9ZA 1PEAA 3B51X 4O02B 4MDHA 4KQIA 4MW1A 3QBDA 3R6GA 4QDKA 3GAFA 1P9OA 2YWDA 1Z26A 5AVZA 3NBMA 2QVYX 4JT4A 4G4IA 4HMPA 1YR1A 1PL0A 1Y33E 4ESVA 1HZJA 1QK3A 2QG4A 3I01A 4ENTA 5JCJD 1JKMA 5LB4A 1C7IA 1BHQ1 4JVSB 2BP7B 5CM2Z 5ESXA 1D2EA 3AVWA 5KPJA 3HZOA 3NGLA 3PUXA 1AKEA 3ISJA 1FNDA 2BGJA 2CVHA 2ZB8A 3B9BA 2VATA 2R9VA 3IVGA 3UT6A 1FS5A 3I5UA 3PXCX 2DKOA 1P77A 1B7GO 3DTTA 4NV0A 1SCUA 1DWUA 4TTPA 4KW7A 1RM4A 2WJZB 1KJIA 3N2ZB 4DPKA 4Q1VA 1XRPA 1JPNA 1Y8QA 1KRHA 3MLAA 2NYAA 3IR5A 1E3EA 4RYDA 4TXNA 3TQCA 5DM70 4L95C 4N0DA 4LY3A 4B6JA 1JHVA 5LLTA 2ODPA 2Z6AA 1U3WA 1H42A 1JQKA 1UBGA 4X95A 4CQNA 4FFOA 1RYEA 1NZFA 4W99A 4E3WA 1PK8A 1S8FA 1Y9JA 3SP1A 5E1MA 3TJZA 4I9UA 3PFIA 4D8VA 5AVJA 3K1JA 3P9KA 2FKNA 1X74A 4J0IA 2A59A 4JWKA 3UQYS 5KKAA 2P9ZA 4UVEA 4DGSA 1CK4A 1QZTA 5A0FA 2GVDC 4Y6PA 4CKEA 1LWOA 3CM0A 3HKDB 1Z34A 4LJAA 3UOAB 3WSTA 4AECA 4LJRA 3DL0A 3U80A 3IEXA 1PJ4A 1BD3A 3PFFA 4BBJA 5JMOA 1KWGA 4NAUA 3W5AA 1C30B 1VCHA 3EXEA 4K9RA 1EPUA 3CZRA 4UVHA 2VPYA 4EHIA 4B7AA 3V8BA 2BTQA 1BA2A 3NORA 2PR2A 3KZ1E 2QI9F 3OVMA 3R77A 1B3BA 2B8EA 4N76A 1I94B 1EP2B 2ZJ1A 4IVNA 4DE5A 1A71A 4MO9A 1IWBB 3M5PA 4K1XA 3OX2A 1TYEB 4REMA 3M4JA 5A62A 3SD7A 1THGA 2CBXA 3ZJTA 1E9VA 2AN4A 4H16A 3N28A 2HUPA 3ONFA 3QXCA 2PXAA 2OPHA 1NJ5A 3OD5A 2Q1WA 4D3DA 3R7AA 1OZFA 1ISHA 4LNHA 2W6PA 3QVTA 5D01A 3DE5X 4LZNA 1C9JA 3WOVA 2PZGA 3JQAD 3BB3A 3AY7A 1N8SA 3A4MA 3B36A 1S4QA 1SCIA 2OB1A 4NAVA 3F1KA 3VX4A 4CEHB 3FTFA 1HMYA 4B09A 3BERA 1GFIA 1QK5A 2EF1A 2OD9A 3OZCA 3EMKA 3PNQA 4PONA 2TSYB 5CT9A 3AB7A 3RNLA 4H3VA 1ISRA 3OKFA 1SIWA 3TQFA 3PQ3A 1NAIA 2GCOA 3MW8A 3ER9A 4UTOA 4XVRA 4EYGA 3T7CA 3A9RA 1UC9A 3SC3A 3WFZA 2GHTA 1GA6A 1IH8A 2AK3A 2VDMB 1Z7EA 3FB1A 1RP1A 4IVQA 4R2IA 5JMPA 1TUIA 1XN4A 3ZE7A 5A3SA 1Q0UA 5KOYA 3OESA 2NTEA 1O0SA 3N86A 6YASA 4E88A 1WLYA 4B6EA 1E1YA 3NIBA 4KLNA 4IX1A 4M8SA 5CXSA 3F90A 4HDCA 2TMDA 3EFEA 3T52A 3TLJA 2VWPA 1MRNA 1JZTA 4LSGA 3S2EA 3ZVLA 4ZZIA 2AC4A 3JQBC 4K26A 1XCGB 2R85A 2YBDA 1F2VA 4PC7A 3LWBA 3NI2A 2OCBA 2P3OA 3Q6MA 5B4TA 3I2IA 2OO5C 5EFOA 4PZAA 3KSAC 2QOEA 5TQJA 3UT5B 1XZMA 2VWHA 1HDIA 2G7MC 4NE9A 3W05A 3KQHA 1JEQB 1US8A 1VB3A 3ZY4A 4HZUB 5DGIA 2GPSA 3EIUA 3QVGA 1AY0A 5AUQA 5LQUA 1DV2A 1R16A 5EJAA 2WVHA 5JSUA 1N6HA 4WDQA 1JJIA 1RCTE 4WXPA 2EW8A 2A0XA 5IKOA 2H7XA 4H2DA 2WVGA 3RIEA 1XZIA 4XLZA 1K7CA 4M99A 4D82A 4O4IB 2QLMA 5A6SB 1KJ9A 3DMHA 4QJ3A 3DBIA 2L17A 2XCRB 4TTQA 4D6PA 4OQFA 1I7LA 4G85A 2C9BA 2DQYA 1G7SA 3T38A 2DG2A 4B6RA 1R3UA 4A15A 2Y3IA 2H1FA 4N12A 2BMDA 4J4BA 1UP6A 1WEKA 3NIGB 1WMSA 4TM7A 1MB2A 3RSHA 4PYMA 4PN7A 3OHSX 2YR0A 5B7GA 4LHZA 1EFHA 1WHTB 1XRQA 1VBKA 1TD9A 3EC1A 1HBJA 4UASA 4XJXA 5AKYA 3I34X 2IEBA 4A1FA 5BWMA 2HMVA 1KZHA 3I76A 2P9CA 1ZD8A 2O2ZA 1ICIA 1K3FA 3R0QA 4JQCA 5B2ZA 3JQRA 1AQYA 1Q1AA 1Y1LA 1A9XA 1QORA 3F5MA 1QCCA 2FSPA 1XVAA 4GZ6A 1PHRA 2GPWA 2G82A 2VJKA 3B7PA 4UD2A 1M6VA 4J4HA 3CISA 1NV8A 4UM9D 5DTIA 4EO9A 1NBWB 5CCXA 2VPQA 1DBIA 2H00A 2P40A 3DV0A 3ZJ4A 3FGOA 2IL1A 2FZLA 2XUAA 3TINA 3WNQA 5CLJA 4KFTA 2ABWA 1NF3A 3RVNA 1TO6A 3KR2A 3Q7IA 5EHQA 1KZ9A 3NTOA 3UT5A 5FL7D 1QQ6A 4EUKA 2D4HA 5JALA 5K4GA 4DSNA 4G0UA 2SHKA 4V1CI 3JYHA 1N7IA 1KK2A 5EZYF 4JI5B 3UBMA 1FUUA 1C9EA 1Z5OA 2OCAA 2YV5A 2ZVJA 4M1EA 3NHRA 2P3LA 4JA0A 4W1PA 3ZW7A 1JXOA 2VA8A 3IQWA 4HDRA 3I23A 4M6WB 3JATB 2H4JA 4HGPA 2WE8A 2IU0A 1I3LA 3ZTTA 1AQJA 1U1CA 1XJQA 1DI0A 2V58A 3IUEA 1MV8A 5B6JA 1L5FA 3WDKA 2FUEA 4J75A 1TECE 4B85A 1KO1A 3GLFB 1CZOA 3QPAA 3J81k 4JEUA 1PR9A 1N2XA 4I9NA 1I32A 4KRFA 4IX9A 1A5BB 5HIJA 2MINA 4CMKA 1XHFA 1DFIA 1VJTA 3KVYA 4BEJA 2PMFA 3I62A 3OJLA 4KH0A 3I1FA 1PDOA 2PL9A 3GP3A 4EY7A 2PVCA 4OP2A 4TLDA 3LCJA 3LX4A 4GQBA 5H59A 4CV0A 4LK3A 4Q4CA 3FYDA 3KEQA 1F4LA 1WW3A 3LXXA 1SC9A 2HFKA 3FMOB 1NOJA 2JAHA 3B89A 3IOCA 4HR7A 4YO7A 3BB4A 3N59A 1X1BA 1BRMA 1QBGA 3GJ5A 1EX1A 4TUYB 5GONA 4RD4A 4W8GA 3TL2A 1J56A 4BKQA 3JCZA 5AJTA 5K4AA 5JXHA 3DKPA 1AMNA 3HV2A 2VRBA 2F9LA 3BIOA 2E4WA 1PZEA 3W3AH 3S2FA 3IUJA 2FMKA 4D5EA 2QHXA 1TZJA 1DOAA 4LRXA 2PX8A 2HRQA 2JH3A 5ISMA 3EXFB 1XWFA 4DLXA 4WLUA 2OD2A 4JL8A 3THWB 1ZNXA 5LD2B 3LX8A 2GM9A 2R4QA 1A5SB 4I08A 2VTEA 4JMLA 3IDFA 3O4RA 1YJBA 3MS2A 3EFBA 1IY2A 5IVDA 2Z4SA 4M2LA 2W2TA 4QVIA 1KI6A 1PJ2A 2LD4A 3SFTA 4BMYA 1TADA 2BOVA 4LHVA 3V1UA 5B3JC 3CT4A 3DVAA 1NV9A 3CRVA 3L6UA 2Y93A 4EA7A 2XGGA 4IMJB 3U6KA 1KETA 4KB5A 5K0JA 2VYVA 2BP7A 4UXIA 2JFQA 1DEAA 4HN4B 1G3RA 1ZRHA 5AVSA 4R1OA 1PUXA 2VJMB 3W4KA 1NN1A 1ZXXA 1RW4A 2PY6A 4RPGA 4D3FA 2CEKA 2ZT6A 3LT1A 3WGUA 3E3OA 1W25A 3NM5A 2YHUA 2ZIXA 4JLJA 3LDFA 2YVUA 3AJAA 4CKBA 3FZYA 1GTJ1 4IYJA 2DFTA 5LQNA 2PQMA 1QIIA 4G2TA 1W34A 3U6BA 3I8SA 4Q9HA 1GNTA 1SB8A 2QRVA 5K3AA 2HJ9A 2ROQA 1U7ZA 5BVHA 5JYCA 1N3BA 3B2EA 1FFGA 3PK0A 5J59A 5BW6B 5KDDA 1ECPA 1AZSC 1GKUB 5ALQA 3MUNA 1YV9A 4ZO8A 5K6RA 2FK7A 3FRJA 4C0QC 5KSOA 1WXHA 4AB1A 4JH0A 4NJMB 1KI2A 2W9XA 2C3YA 4PYOA 1BEUB 2DWUA 4YA6A 1XD8A 4YMLA 3PU6A 5EIFA 4UHEA 5HTKA 2FWAA 2IW3A 1ENOA 1XU9A 3DJYA 3SLGA 1C4WA 2J4DA 4B47A 3QTLA 3D59A 1F0YA 1SAYA 3PC8A 3QBTA 4YLEA 3HWSA 1EWTA 5KB3A 2JJQA 1APBA 3ZQ4A 3T5TA 2G1KA 1G64A 4M37A 3P4YA 4EARA 4PC2A 1BVRA 3G9UA 1H3NA 4JJEA 5DCLA 2VH2A 4UEJA 4DL9A 3FBTA 2RCNA 3OU6A 5HVNA 1I6LA 1SKQA 3IXQA 5MDHA 4GMHA 2QPTA 2C42A 1PV2A 3IAEA 2Q29A 4ENRA 1Q0RA 1YA4A 2XUGA 1IBCA 5SZKB 2R6AA 2BI4A 4C7VA 4LFAB 1NC3A 1X92A 2EZUA 2YH2A 1PVOA 1UEXC 3L6EA 3Q8WA 1DWOA 5EP1A 4M7RA 1K4YA 3L4EA 2J3DA 221PA 5COAA 4AD8A 1T0IA 1QJ4A 3GFOA 1G66A 2IJGX 2O3QA 2QTVB 3L6DA 5DHPA 5EPUA 3WLSA 2CV2A 3QU4A 1O94A 4DHEA 4FJ2A 5D5QA 3DOHA 1EZZA 4IIEA 1NDQA 4TZKA 4TWIA 3FPLA 2G7ZA 1OGJA 1SKMA 3VZSA 2PKXA 3L82B 1U2GC 2GETA 3W9SA 3NTRA 4J1SA 4OMUA 4MCAA 2CFIA 4O0MA 3Q7SA 2PA3A 1BYIA 3ZNQA 1TA9A 3RSOA 3RG8A 3WYDA 3OZWA 3OCUA 2ZSHA 4R3NA 3CKLA 2AC7A 3I1YA 2D00A 5B3LA 1C50A 1TIBA 2ECKA 4CN8A 1KH2A 4G86A 5JZMA 5A9RA 1K9VF 2C58A 2B1GA 4G9GA 4A0QA 2H29A 3KBOA 2VDWA 4U2EA 3HJGA 4KDFA 4WNAA 4WZAE 4F4IA 4ZAFA 4OQLA 4OGKA 3RS0A 3DEHA 4AURA 3QUAA 1R8YA 4J0QA 1KRWA 4PVDA 5FWXA 4UE3S 4F38A 2WDPA 5KTYA 4BUJA 3RAJA 3BRCA 3HUEA 3JQAA 2BEJA 2GX6A 5BUCA 2E87A 1IOWA 1TLFA 2PANA 2O23A 2ZRMA 4HUJA 1SVOA 4L76A 4NFLA 3L8FA 4JJZA 4V24A 2JIQA 1PJCA 3TDKA 4EATA 4C08A 1WRBA 4OHVA 2HEIA 1CRPA 1CUYA 2AMYA 4MPDA 3RVPA 1LLUA 2OVBA 2VTKA 4XB1A 2X9VA 3MOIA 4FMBB 3REFA 3DD5A 1QPZA 1V35A 4KXVA 5I7SA 1E2NA 3R24A 1L8AA 2VK1A 4BASA 4RD6A 5HM6A 4U7TB 3JD3A 2EQBA 2HSZA 3IMEA 5BURA 3U3MA 1V16B 1WVIA 3RASA 2I65A 4U1RA 1Q1ZA 4D0SA 2FR8C 1SVNA 1R2QA 4C4ZA 3HCDA 2BM0A 3U31A 3N6RA 3O75A 1WDKA 4AVYA 3A1CA 1V8PA 4LYDA 4RHYA 5C8YA 3NDRA 4F3TA 3DWFA 4NAHA 4ZEMA 1A8PA 3PHJA 1VSTA 2H5LA 3H5IA 1FJGB 3UCEA 5ILOA 4B6QA 5B57C 5J58A 1ZOOA 2B25A 1HZZC 5GP1A 1XT6A 4X6YA 4S1OA 3PZRA 1EVKA 1AKMA 1ZZGA 5I7AA 4DCNA 1ZNZA 2ID9A 5HIMA 2WUEA 3LX6A 2A0YA 2ERXA 3D3NA 3CPEA 1O0CA 4Y2HA 4KH1A 1WO8A 5BQOA 3IO3A 2M6LA 1H5NA 4RVSA 5CLGA 3ENNA 3OFSA 2Q50A 2PD4A 1RFLA 1I8TA 1E94E 2C7GA 4MICA 2JFZA 1LV8A 1FTNA 2NV6A 3IESA 3Q12A 4PAOA 1TZBA 1W46A 1GTG1 1UJ6A 2WAYA 2EX4A 5G40A 4TT3A 2CNWA 2DUNA 3T5MA 3KTDA 4EZIA 4S2UA 2I4RA 1TEHA 1L5YA 5F23A 5KKNB 2HLDA 2WU3A 1A2OA 1RLJA 4O4JF 4P92A 4RPJA 3UB2A 3UMJA 4DAOA 5K03A 2PX4A 5JSFA 2DTDA 2VZ0A 3RUFA 3VR3D 3A9TA 1PT6A 1K27A 3HN7A 3GLIE 4FLFA 3UWDA 3CA8A 3QEAZ 4GS5A 3C7TA 3E9ZA 3UHAA 4BNDB 2C5HA 2Y1GA 4EA9A 4IIJB 4M21A 1MQ8B 3EQ9A 4MAFA 5B58T 3RYFA 4E46A 2J08A 3BD6A 5E3IA 5AFSA 3VV2A 1SCAA 3H3FA 5IZCC 4HDSA 2C5LA 4WERA 3SVZA 3L7JA 4OYLA 2PU5A 4PYRA 2XF8A 5I7WA 1PYDA 4EG4A 2RG1A 2HJVA 1VJ0A 2NO1A 1HMPA 2OO5A 1GZ5A 1MPTA 1UC4B 3BQ9A 4JL5A 4PTYA 2IUTA 4WEOA 2B3TA 1YL7A 3E9NA 5D8DA 2OD7A 4ZZ1A 4AKGA 4ZCRA 4KWEA 1FYXA 1E5LA 3EIXA 3DGFC 4TS4A 4L15A 5TQ0A 5DM1A 5LDGA 1U3DA 5HZGA 2ZTHA 3ESZA 4C3VA 1KYIA 3W7BA 2O8CB 1IXYA 4DBLE 2IUEA 4G63A 4NBRA 2R8BA 2WFLA 5E7JA 4MYSA 1VCIA 3DBRB 4HXYA 3HRIA 5KC9A 1A2BA 4DV5B 1BXRB 1UK6A 3IKMB 1V8ZA 2LE0A 5E2BA 3LK6A 4Y2JA 1D4ZA 1FPQA 4D4IA 2GYVA 3EUEA 4C4RA 5ETJA 1ZRSA 2CJFA 3HPRA 3VKUA 2FR8A 2XRMA 2QTVA 4UE2A 2HA6A 2I29A 1O0BA 1PT9A 3DL2A 3NGXA 1S6YA 5B3AA 4MUMA 4J4TA 4WOKA 5JY1A 2FMTA 1T15A 2RBKA 5A1TA 2IEGA 2GWRA 3ZKWB 3P0HA 2BCGY 2HJSA 4MWBA 1C3XA 5MHTA 4RTPA 2FY8A 2O1XA 4CWAA 2J3EA 3HKBB 2FYTA 1IYZA 1QCYA 1T8TA 1QUFA 4FFLA 3UYKA 1WVGA 4EKNB 5KQLA 3HLKA 3OZIA 1E9CA 2ECPA 5G0UA 1ECJA 2FPGB 1JG1A 1AURA 3C4VA 3WWPA 3A06A 1PBTA 4LUCA 5AKEA 3N8GA 4E2WA 3OIYA 3UJ7A 2SICE 4FKZA 3H9GA 1NL3A 4IJUA 1E99A 5KYKA 2OSBA 4WGFA 2Y1WA 3PWZA 4IVRA 4L8GA 4BGEA 2FF5A 2XQVA 1G16A 1PWZA 2PKQP 2IX3A 4GBJA 1T3ZA 2QLLA 4Y18A 2BKLA 1TM3E 3PQ4A 4U8GA 1G20E 1ZSNA 2XCSB 4FEEA 4FOPA 4D02A 3EQ7A 2WV7A 4Z0HO 1WF6A 3RIYA 3GJ6A 3NEAA 3FUVA 3UW3A 1Y9DA 3NB0A 3VH3A 5FI5A 2UYOA 3RFVA 2D0OB 1NTOA 4N54A 4EVQA 1Z0JA 3OPVA 3KZKA 1EAYA 2Y27A 5HOEA 1FUYB 4YS6A 4HV4A 3DFIA 3GLUA 2CHGA 2OFFA 1CNEA 2JDID 5T4EA 2QE7A 2KQUA 5DNVA 1PFVA 2QR2A 3MS4A 4A6DA 4NEHB 5ED4A 5ESDA 4L9WA 4Z8YA 3COPA 3T15A 3DE7X 4B5KA 1QIMA 2HA3A 2ZPAA 3QVXA 3W8DA 3FWYA 4PSAA 3B6ZA 4YRNA 2CFSA 2YYZA 3UO8B 3BTOA 2AVDA 2JFBA 3NUQA 2DY0A 1YL6A 1E1QD 3F6YA 3A1NA 3FSJX 4RMIA 3ONDA 3BGWA 3WDLA 1CR1A 1P2GA 2OV4A 3PRJA 5D84A 5ALDA 3HB5X 3ETEA 1GZVA 4Y8VA 3SX0A 4XX0B 5FV7A 5LKRA 2WM9B 4URYR 2IF2A 3FDZB 3M0EA 3PPIA 1QAOA 1FNCA 2GPYA 5ALWA 2K87A 5IU6A 4KWTA 2HJWA 4AO8A 2X0NA 2YHIB 3U40A 3RKSA 1NBMA 2N75A 3KZNA 3GZTB 3H9BA 1WE2A 3A0RB 3P97A 4YGYA 5E4FA 3UJAA 4BCDA 2IEAA 1OI2A 1XD2B 1YVUA 3WQBA 5BSEA 1F6WA 4Z1MA 1G41A 1GT91 2HA5A 3E23A 3PCXA 5KNLA 1RWNA 1HNZB 3HUFA 4JB8A 1SXJD 3JD1A 4QM6A 4EQ6A 1M34B 4FSDA 4UBJA 4KGXA 1QG4A 1QH8A 1GAQA 3ZTYA 1EXVA 2WLSA 2FEKA 1X7ZA 1UQRA 2ZVPX 5I7HA 1XRMA 1VLZA 1DKUA 3GPDG 3L2OB 3S3TA 3ZZTA 1RM3A 5HFNA 4BFUA 3S68A 2VP4A 1ITZA 2E1RA 4QYMA 4XCVA 1Y4DE 2R8ZA 3CX3A 4PIMA 1Y6FA 2EFCB 5L3VA 2JLVA 1I14A 3PUVA 2AK2A 4Z2YA 1VHJA 2QQ5A 2VF2A 3CLRC 3D7KA 4MGKR 3VVBA 1UDWA 4BRSA 1T5SA 4R8KA 3GY0A 2D1SA 3PQFA 2R1VB 2O4UX 4AJJA 3OZGA 3NOOA 1F6DA 1EB8A 1Y7HA 2KMLA 3GRVA 2R2AA 2XB8A 4OI4A 3JPWA 3SIWA 1EFRD 2J0VA 2J7KA 1GN9A 4ECAA 1KPIA 2WVJA 4QUGA 3BGOS 1C7EA 2ZETA 3ROGA 4AUKA 5DNYB 3RDPA 4MQFA 4EG6A 1NQ5A 4QOGA 3Q72A 4FIZA 3CVJA 2IZ5A 1C1DA 3AHGA 1T6YA 4BB9A 4C4YA 2BFEA 3L4KA 1EUDA 4N6OA 4LE0A 4LXHA 2R86A 8ATCA 1Z2AA 3KZMA 2IYNA 3IBCA 1Z0UA 4TKUB 3TR5A 2ZS9A 3HFJA 3KJZA 4D56A 1CLUA 1E6WA 4ZVSA 4YJ2A 2Y1CA 4F04A 4OHWA 1UIMA 2JCBA 3OFVA 5IEBA 2CD7A 5JYBA 2GLUA 2DHCA 1RR6A 4A5OA 4ZQEA 2AE2A 3OEED 3TTWA 4MW5A 5AUPB 3ZNNA 4ZV4A 4BYGA 5HTOA 1DAFA 1UPCA 1SC4A 3BXPA 2PH3A 3F9IA 3ZWNA 1OLXB 5JBQA 3IUPA 5C8YB 3H2YA 3D3KA 3LUAA 3OTQA 3F5FA 1JKJB 4WFKA 1A5AB 4Q12A 2XUFA 1H94A 2REQB 5GVSA 2PS3A 1QE5A 5CTAA 2A9JA 3IAHA 4QO8A 1E9BA 2X2FA 2RCYA 3E5HA 4JKYA 4QXRA 4DLNA 2NLOA 3LZCA 1U8XX 2IEDA 3QIVA 4RK5A 5KX5F 1L5QA 2G70A 5FOXA 1R9NA 4QRHA 4FYKA 5D3MB 3OKCA 1HDRA 4WOBA 1XZAA 5DNWA 1P4AA 1YB5A 1GQ2A 2Z56A 3E7XA 3A1EA 1YZKA 5BN5B 4JYZA 1PG2A 1TRHA 3UB4A 4LF7B 3GJYA 4WZZA 4JP1A 2PX0A 1OH6A 1EFCA 2W37A 5CXUA 4PRZA 4MA0A 3RYCB 2H8GA 1X7HA 1ZK2A 5DBEX 1Z5PA 3AERA 1DTWB 3GEMA 3BL6A 4I36A 3NVDA 3TXXA 5F7OA 5ALVA 5F3WB 2PGXA 2ZRPA 3F6RA 4E4YA 1QOQB 2NUTB 4QAJA 3REOA 1Z25A 1W35A 1DHTA 3H04A 3BAZA 2X2OA 4MUIA 4EABA 1D1SA 4IGIA 4LDPA 2CLHB 2P90A 5L4NA 4FFBA 4D6XA 2PZMA 3CIOA 4QFBA 5AVWA 3C7AA 3ERCA 3EQZA 2CJWB 3UAYA 5EE1A 3V1YA 3VHQA 5LOVF 3KQPA 1LWNA 4LXXA 1UDBA 1ZIYA 2GDJA 2NO4A 2ZJAA 2Z5LA 4Q3NA 4JUAA 2ZJFA 1YR8A 3CUEF 3LFHA 2AEMA 3X1WA 3HB4X 5J4VA 1WXGA 4LI0A 1OLXA 5T64A 4UCXA 1PT8A 3FTCA 4PGGA 4GOMD 1ATZA 3AINA 3AW9A 4KSBA 2WFZA 4PYNA 4EW3A 5KPDA 3KR9A 1Z2CA 5JASA 3GYGA 5DBGA 3O9MA 2WMNB 1ZGCA 3AF0A 1M8PA 2LCQA 4W5NA 4ZCMA 1O89A 3MWGA 3TRDA 2I7VA 5EP2A 2O20A 4S1VA 3FPCA 4C0AC 5J1TB 4B7CA 1RXVA 5DLEA 1KAEA 4X1YA 1KP2A 2Y77A 5LMNB 3OFKA 4P0QB 1ABEA 2D4AA 5FB3A 1XMOB 3N2KB 2WZDA 4NDNE 3T35A 4X64B 4XWKA 3AJDA 1E3WB 3TOSA 3GEDA 4LVOA 3QE2A 1HG0A 4EKIA 2PRSA 3ZLTA 1OBVA 3F67A 3TL6A 4F5EA 3C1OA 2ONYA 3N70A 3OWOA 1PR4A 2WSIA 3UBTA 4ZCPA 2BFOA 4ND8A 1I4DD 1ONBA 1BX0A 1I4WA 3F3KA 4C5CA 1GGHA 3DTNA 4ZT7A 1BC5A 1DCKA 2Q4BA 1GKYA 1XLTC 1M2NA 3CEMA 1YQTA 2C5SA 1SVSA 1VI2A 1L4NA 2HMWA 3D6AA 4I1OA 2ATCA 5KTNA 3N8IA 4PO9A 1QTNA 1N5OX 2QYHA 2OBYA 2ZXFA 4YCNA 3G1WA 6PFKA 1YGYA 2G0AA 1NUSA 1G42A 1VM6A 4OJQA 3TNYA 2BFDB 4NJMA 121PA 5LYYA 5LP6F 3MXOA 3FH0A 4HTFB 3RNOA 3JWEA 4A26A 3ITDA 3BE8A 3AHCA 4GLLA 5AYVA 1SIUA 4G0QA 3OOHA 1W36D 3T6KA 3AHHA 1U98A 3JVIA 4KQEA 3VDQA 5IC5A 1V6SA 1B16A 2ZIAA 1QZUA 1XCBA 3L8ZA 1OV4A 3PFWO 2FX5A 4PLTA 3SF8B 3SZRA 2OFXA 1XK6A 1VCOA 5A6VA 2V0CA 4NWIA 2ZTSA 5DN6D 3EC2A 4OI0A 5ITZA 4OBEA 3VR5A 5WRFA 1MFZA 2EYUA 1VGVA 1H0HA 4LWPA 2JNWA 2CV0A 3L5OA 2JBAB 5AQEA 1D3AA 1FRVA 4EGAA 1ZCJA 1KZ4A 2NU6A 5EVJA 1N9ZA 2D0PB 4JUBA 5TSDA 2NU8B 4UJ5A 3FYHA 3GLRA 1YS6A 3F2VA 2Q5QA 3ZHYA 4MW0A 3LBIA 1KGSA 4KIJA 2OZPA 4PY2A 3WWEA 4AJNA 5KNDD 3REQA 3V48A 3LI2A 1J2RA 2QSJA 1H2YA 4DJTA 3EJWA 4PGMA 1BDJA 1TJ5A 4F2GA 4U02A 5IJ0A 1PE0A 1D6SA 1GP2A 4ZHQB 1IAVA 1ECGA 1Z0AA 2GAJA 4I5GA 3WADA 3UKOA 2QD5A 3WVNA 3AVXA 5HNKA 4OI2A 1GXSB 5C0OE 3SR3A 1WP4A 1CETA 3IDZA 1NLUA 1N9GA 2L82A 2VFAA 3EQ6A 3N74A 4FS3A 4KE6A 1W5TA 2ZROA 4EX7A 4JXZA 2BFNA 1FA9A 3FOCA 2AUNA 3QPUA 2QVBA 4OBBA 3ZZMA 3UJDA 2C8LA 3IUYA 2W4QA 2ZFUA 3MCTA 4S0XA 3VOTA 2R6CA 4HNSA 4X7RA 3EZNA 4OUDA 4IBOA 3D4OA 2BGLA 4PEVA 2QRMA 4HNAA 1SCQA 1U1IA 2PTGA 3T99A 2P11A 3NEPX 4TTJA 2VJPA 3PCTA 1BH6A 4U9IS 5BV0A 4ZI7F 2XH8A 1M76A 1NYQA 1UPXA 3QQPA 5AO9A 4J0KA 3UMSA 3NAQA 3KTAA 3DTVD 3SAJA 2NVBA 2IIPA 1RAGA 4RPLA 1VSQA 3MWJA 1K2VN 2OHHA 4U4AA 2QF7A 5JARA 3MAAC 4J7UA 1PKXA 2OPBA 1MH1A 2ZRKA 5K6AC 2ZTUA 3FNIA 4JC0A 3AJEA 3FB4A 2ADMA 3R20A 2NOAA 4M1MA 3INTA 4UNPA 5ULLA 4IICA 3ROTA 1JSZA 2OESA 4U2KA 4DBZA 1U28A 3G0BA 3KM0A 1D6MA 1GTRA 1VMIA 5LZ9A 1GPUA 2AF3C 1KHHA 4KZPA 4Q05A 2FR1A 2H1RA 3H3JA 3JZIA 4TWRA 4XGQA 3U9LA 4EJ6A 4P3PA 2VBFA 5HK8A 1RWVA 1R0XA 2X5JO 3LP6A 2WI8A 1ZMBA 3F6EX 4BVAA 5EY5B 2IZ7A 4IJVA 2AI1A 1CIPA 2OLKA 4R41A 4DQXA 4EM6A 4JMPA 2EJWA 1EVIA 4CF3A 1N0VC 1WY5A 2CFTA 3CLVA 3R9IA 4HVCA 2FAXA 1RQLA 1UJ4A 1MVLA 3SQLA 1UXOA 1X1AA 3VZDA 1G2IA 2IZ6A 3E2PA 1R5OA 3ELYA 5B2FA 2Y1XA 4ZEVA 3PXAA 2VWQA 3BWCA 4YHBA 4MWDA 3DEAA 3B5JA 1T4CA 4KN9S 1YQWA 5AM4A 1PQPA 5LZ5A 3VO9A 4ZTUB 2FRXA 3DLAA 1N5IA 5EVCA 1KR5A 2N47A 3IERA 5EHZA 2QRNA 1FU8A 5IFLA 2IS6A 1C7RA 2FOLA 3EGOA 3T4XA 3FUCA 3RUCA 4QFDA 4NEQA 1L1QA 1TKCA 1JV2B 2WM3A 1U4SA 2Y2UA 4PHFA 4D81A 4IRXA 4D4LA 2NO5A 5CNJA 1ESEA 1MHPA 1P17A 2C4TA 1YL5A 1XELA 3UPDA 3NXKA 2F3SA 1BFUA 3AIMA 3KUUA 2RB5A 2WMDA 3O4FA 1L4LA 5T3UA 5REQB 4X60A 4CUZA 1V3UA 4INPA 2G76A 2PFSA 1VSBA 4PGHA 4JX8A 4YO8A 3B1JA 4K86A 1YHZA 4Q4AA 3LBHA 2XE8A 3E9MA 2IVFA 2HYDA 1O6BA 3FKSA 4MV1A 1OREA 4ND5A 4YJ3B 2AG6A 3VNBA 2J5BA 3LVFO 3H2GA 4DCVA 1AOXA 2X0FA 4IS3A 1YTUA 2FMXA 2VXYA 1ZI6A 3EZ6A 3QV2A 5B3KA 3QFSA 4MRAA 2H5IA 1CJBA 1EJ2A 1MN6A 4UMDA 5JWRA 3P4XA 1Y1TA 4G81A 3VSBA 4XM1A 3H7AA 4GGOA 1BEEA 5CTJA 4TQ9A 1Z6QA 2IYRA 2P9GA 4ZCQA 3RV4A 4DN6A 3FHLA 4I6EA 3GCWA 3HBFA 3ONWA 1Q0TA 4ZVUA 3NWJA 4L6AA 1D5CA 1AB6A 1VHDA 5LQSA 4BGVA 3H9JA 5KTPA 5HJEA 1KK1A 5EGSA 4UHJA 2GZAA 3DAHA 5EXEA 4BV8A 2WDZA 1VHTA 2ZVDA 3WP0A 3ZW9A 5JS6A 3TGLA 3H8JA 1DQNA 1CY1A 1FYWA 1ONNA 1T5IA 3R7DA 1ISMA 1R64A 4CCWA 4Q82A 4EHDA 1M67A 3U2QA 4RY0A 2XAUA 2DHEA 1TF2A 2OGWA 4RORA 3OJWA 2NN3C 3UGQA 1UOPA 3I92A 4LHSA 1ADFA 3QVOA 4OBWA 4Y9TA 6LDHA 1PEKE 2WUGA 3L7MA 4C3UA 5BN4B 4N48A 1IY1A 3TEJA 4V03A 2WQZA 2EKLA 2WU1A 2F7SA 1N7GA 3R44A 3BFKA 1U0GA 4WADA 2TMGA 4I1YA 5JIBA 3TM5A 3RTEA 1OT5A 4B71A 3CPHA 1XROA 1U0FA 2QQ0A 2DJIA 2R7NA 3OX1A 1VL1A 3NBAA 1NI4A 4D42A 3E27A 3DPUA 4YRPA 5LA6B 2GKOA 1FQKA 5F12A 1THMA 4TSKA 3KFVA 3M4ZA 1OFTA 3D6MA 4UXJA 5H81A 2CMHA 3TLGB 1G9SA 3E9QA 1F3LA 3G5LA 5IBCA 3QWBA 3QI7A 1BE0A 3GGCA 2H2IA 4FNOA 1NT2A 2HH9A 3L77A 4ZPJA 1DAHA 1DIAA 4LSWA 1X7ZB 4FR5A 4M0UA 4RFSB 5CVVA 3RIXA 1KNXA 4HRAA 4INJA 2JI8A 5I8ZA 4JEIA 5J4YA 1UQTA 1QF7A 3SZ3A 5K45A 2DBZA 1F06A 2B78A 2C1ZA 2QL5A 5T6MA 5I9IA 2XNCA 4MW7A 4JI4B 3UXHA 3F4LA 1RJGA 2CKMA 3CSUA 4IVPA 2W2OA 5H4HA 4HEQA 3WBJA 4B7ZA 1WUJS 4QGAA 4YIHA 5IMSA 2XE4A 4IWXA 3KV1A 2RK3A 3R3SA 2I2CA 2XGOA 2QRHA 4EEKA 3FGZA 3W4IA 3MRSA 1DEKA 3AI2A 3W2EA 1C7QA 2FQWA 3DSRA 4CIAA 1FTQA 1SO8A 1BWPA 1Q95A 3T61A 2GVZC 4FINA 3QLVC 4QU5A 3V32A 4H77A 4BNTA 2QPAA 2GRUA 4QUIA 4YUVA 5TS2A 3VI3B 1JKXA 1ZP6A 2D0IA 4GMDA 1MAAA 4RBNA 2XOKA 3I8XA 1AC5A 3OTHA 5BWNA 4D4GA 1X8JA 3ASVA 4OHYA 4FOOA 1ST2A 1U4OA 2MTBA 1OTHA 3ACDA 3SR0A 4PU0A 3TSOA 2UXDB 2P9JA 3R7WB 1QJCA 4CQMB 1MO5A 3WC4A 3PBKA 4OJTA 4EO4A 2ZXUA 3O8DA 4DCUA 1T3HA 3ET5A 4WNIA 3BMCB 5BNWA 5EZQA 1N78A 4RVDA 3A2NA 4E2ZA 3VZPA 2AJBA 2BUCA 1C5KA 1VL6A 2HCFA 2Z57A 5B5SA 5IYZB 2WQ7A 2D59A 2PVPA 3GLHE 1JQLB 2ZBFA 4GLJA 2VQ3A 1A98A 2VYFA 2G09A 3LBYA 3OLWA 1ZW1A 1F38A 4HS4A 3M1LA 3O0DA 1L3CA 1JHZA 5F1OA 3VC2A 2TMKA 1LPOA 1NVFA 1ZKMA 1NKTA 4E5VA 4EBBA 3KL4A 3UYLA 5CAEA 3ICCA 1Y5MA 4TWAA 1DC3A 4UEWA 4HI0E 5J4HA 3S4YA 1CZLA 4BV2A 1GFSA 1JJAA 2BKXA 4TKMA 4D0NA 4KUHA 2FEXA 2R44A 4MMZB 4YRBA 1R4NB 3OPYI 1GR1A 3CW2A 4Y1EA 3HP1A 1EFPB 4HYYA 4WFJA 2SKDA 3VHXB 4DR5B 5J2TA 2ONJA 3N0VA 4AKIA 5C3UA 1UP7A 4P22A 1PD1A 4NS4A 3U3ZA 5JDCC 4DDMA 4GQAA 2ERCA 2GZDA 5DMHA 4I50F 1Q91A 2IIVA 1A8UA 5JS2A 3UB3A 3WFJA 4BP9A 3U1BA 3FNGA 4IEIA 2Z98A 1XU7A 1ZD1A 3G1TA 4ND7A 4PF1A 5TXGA 2C2BA 4CZ2A 3K8YA 2RKOA 1PGQA 2ECOA 2V7VA 3I37X 1QH8B 3ECSA 2XT9A 3EUFA 4EJ2A 1RI1A 3PVCA 5IJ0B 3R9XA 1VLHA 2VH1A 4NZPA 2NU9A 3STTA 2BMWA 1LDMA 2GOYA 5DCUA 3V2GA 1S2OA 1PP4A 3VKWA 5I7UA 5JI3E 2AEJA 3IUMA 4Y9RA 1AKNA 1DRWA 1G5FA 3I9LA 1KJ8A 3JATA 1N8NA 2I6GA 4Y6SA 1T36B 3OF3A 5BSHA 3FA2A 1M2VA 2N3ZA 1D1QA 3P8ZA 4IQ4A 4QBFA 1NWHA 2LUOA 2AS0A 1L5LA 3RBAA 3RT7A 2Q5LA 2C2GA 3HJNA 4TZ6A 2DBVO 3G2LA 4JSYA 4RSMA 4TSRA 1P4JA 5FOUA 1KL7A 4BHTA 5KYUB 1QHSA 1XFAA 2FPSA 2YXLA 4XYBA 1WUIS 1X39A 1U0JA 2OOKA 3RLIA 2BUAA 1BKDR 4IJMA 4BFLA 5HSGA 4I14A 2BJVA 3QNMA 1VC2A 1DAMA 3BCHA 3C1UA 4KE9A 5BRJA 1ZK4A 2HRCA 4LDQA 1C41A 4J1QA 1AMOA 1E66A 4KQXA 1KVTA 1I2MA 1WXWA 1Z8HA 2GLXA 2RGUA 3H3XA 4RFVA 5B6IA 5KVVA 1SCUB 1HDCA 1NMSA 3ZGVA 3EXFA 4KR2A 1QQ5A 4IXDA 2C0CA 4JEMA 1XC7A 2FGJA 2ZRCA 3KWJA 4U0JA 4B3BA 5EQJB 5E7QA 4BX9A 3BIWA 5BSUA 5TPZA 1QCDA 3V6MA 3MERA 3VRHA 2RONA 3BGSA 4EW6A 4CMAA 1RRKA 4ZVOA 5KQSA 1KI3A 3KT8A 2AJCA 3FFAA 4IDDA 4EWLA 2W2XA 1J8MF 5JOQA 2WSSA 4CDRA 3C0KA 4OP3A 5MF6A 1XTQA 2P67A 4JCOA 5EG5A 1QH0A 3IOEA 3EDQA 3N39C 2NU9B 3LPNA 3N3BC 4QOHA 3DDWA 3D4NA 3UXMA 3T7JA 3CNEA 2QMHA 2X5NA 4LF4B 3QU5A 4KQCA 1IONA 3F97A 3GLKA 2SNIE 1E58A 1NBEA 3L7CA 4TOIA 1BFDA 2JFOA 2Q5IA 2ATIA 2WF8A 1OIXA 2NPIA 2GGSA 1J7KA 3CNLA 1G5IA 1PFWA 2HC9A 4NU8X 5EMLA 1QYDA 4ALKA 2DPLA 4BLTA 1WQ4A 4D9FA 1EGMB 7AT1A 3EMVA 5KNBA 4GVLA 4MEJA 3K09A 2P35A 4ZDJA 5DOVA 2RIPA 4F5DA 4QGSA 5BUZA 3Q6NA 2IUSA 3AFNA 2H3EA 1XZQA 2P65A 1J0BA 3FJ1A 3FLBA 3HY6A 1FFSA 3DXYA 2JPDA 1VJRA 1SQ5A 4HLUC 1HR0B 2O1SA 3G79A 5D6OA 1MT0A 1SD1A 1HL3A 4K3UA 2V7TA 4LC0A 1RE0A 2Q21A 1OX4B 2EV9A 2IHTA 2Q2VA 2RHMA 3LHSA 4EL5A 5JW6A 3DO8A 3EWNA 4EEZA 1Z47A 3THOA 1FU7A 2G08A 3UXYA 2COUA 2HMAA 2FW9A 5BPFA 1EWRA 2VNHA 3CW8X 2ZQ5A 2Q2QA 1E9AA 1GZHB 2HJRA 4Y2RA 1GSAA 4CBVA 3Q7RA 1MGOA 1DBWA 5CEJA 1WXXA 3ZWXA 4R9VA 1KOLA 4KQKA 3Q9NA 5TVGA 2HXYA 3VU9A 2G4VA 3TFQA 3M4XA 1DCFA 3F98A 3KSDO 3OFJA 4IDFA 3I09A 4K88A 1Z16A 3H8WA 1OBHA 2W4MA 1IN5A 4L02A 3U7QB 5IBRA 1C3VA 2FPIA 2I34A 2BEUB 1KY3A 2TECE 3H5RA 4O4JA 2Q3BA 4QREA 1WZIA 2CVZA 3FDFA 1IEVA 1YHNA 1R0WA 1B23P 4Q1CA 1FL9A 1CDOA 4K40A 2QX4A 3GD7A 4Y7CA 3SQOA 2E4UA 5G53C 4U7DA 1PO7A 3NFYA 2NTYC 3QM1A 3IAM1 2LTAA 2YIDA 3S8YA 4R7TA 2YASA 2HRBA 1IQRA 4RS4A 2UUCB 4EAQA 3ZLJA 1Y6ZA 3GG2A 5IVPA 2Q3CA 2YZ2A 3AG5A 3I2KA 3IHTA 3FWZA 1U11A 1JQDA 2X2PA 1E18A 3FMPB 4NBVA 3D6VA 1DIHA 2C4MA 2RHJA 3I9JA 3IR7A 4PC1A 1WTCA 2O2GA 3HYCA 3AY6A 3R3WA 4KR9A 4C5BA 3EYWA 5CG1A 3BMXA 3NIFB 3MLBA 1HYEA 1II0A 3GVPA 4QOJA 5BY2A 4QNMA 4WIAA 4HX9A 1V1MB 5ILGA 3TLEA 3H1EA 3H2BA 3W5BA 3GA7A 4IIXA 4ZYZA 4YRSA 5AJVB 4HNHA 4GMFA 4W5OA 4NYJR 3QELB 3DUFB 4XTRA 4C88A 1GCIA 2ONZA 2J0EA 4KXNA 1ISIA 4OMCA 1Z28A 4X7PA 1U2PA 1DRJA 2FWRA 4KJZA 5DLDA 4M87A 1PJAA 1NBHA 2QJWA 3K1TA 4KR0A 4F85A 3VNUA 4X92A 1CY2A 4PWYA 2EWVA 1WOMA 5MN6A 2C82A 2N9UA 3R5JA 2PS1A 3HZHA 1XNHA 5AKGA 2W2KB 3AHEA 1XCPA 1XEWX 4FW8A 4AMBA 3KL2A 2I6TA 3D0RA 5KSWB 1NVEA 2C04A 4MVWA 2EZ8A 2ZLBA 4K6FA 5EMJA 1O6FA 1V96A 2NT3A 5JD6A 2PL1A 5EKUA 1YS2X 2YW2A 4JLNA 5JEDA 1EQUA 2PLWA 1NASA 3G8BA 4I5EA 4K9DA 4FB5A 2XEXA 4FFWA 1OV6A 1OJLA 1ENZA 2WT8A 1SVUA 3BTUA 1IQUA 2XBUA 3DKVA 4F4FA 2E6UX 1ZWKA 5JWHA 4A16A 4QICA 4UJ3A 5F51A 4ED9A 4HVLA 1QTQA 3H05A 1BX3A 2Z4TA 2GJAA 2DY1A 2JBAA 2FLKA 3VISA 1RVDA 3ETCA 4G07A 1J2TA 2F2TA 1ELOA 1ZA2A 3ES9A 4I5IA 4IIGA 1XYVA 3DEZA 1P5RA 3FHCB 3FCYA 3BL8A 1SEVA 4IS2A 2PNFA 3NWPA 1CX9B 2F4NA 3D6TB 4UUBA 4MVJG 2WHPA 3KS9A 5A0VA 2YWRA 2GN8A 5AIAA 2WKWA 4DR4B 3DW1X 3F71A 5K8UA 4H6VA 2CV1A 5TX7A 3ZHQA 4XB2A 1VLQA 1ZRNA 1I3CA 4B82A 2FPMA 1HOTA 3GL9A 5E1OA 4HNAB 2MSCB 2F1KA 4KDRA 3A4LA 5DHFA 4DF3A 2VHYA 1NA5A 1PRYA 1VKRA 2BM1A 3MTDA 2H0RA 4NQZA 1LQUA 3LHIA 2UZIR 4MXDA 4WBNF 3FPJA 4R1QA 1G5RA 2CXOA 1W4BA 1YXMA 1P1FA 2FDRA 3CZPA 4N1AA 1EINA 4C0KA 3S7ZA 4BIIA 1VRVA 2X1HA 3FE2A 3L0YA 5BXYA 2YN2A 3II6X 1YJ5A 4IIUA 4ESHA 4JI7B 4OU4A 4X1IA 3GLGA 4AIRA 3OTOB 3FYUB 1CE8B 1FVOA 3I8OA 3JWPA 5A7HA 5BORA 5JVDB 3AQIA 3PQEA 3C8ZA 2O7NA 4JVOA 4EY5A 2NNWB 1V95A 3HMKA 3NP9A 3NC1C 1F2TA 4ZOBA 2PUCA 1SG6A 1KEVA 3PF8A 1RXYA 1GN8A 3IPRA 1I1HA 2GA9A 2R97A 2RGEA 3EZFA 3H11A 4NZMA 4ZMBA 1KTIA 3AR9A 2H1OA 3OJ0A 2ZI9A 4XB6B 3ZDQA 1QYCA 3V1LA 2O19A 5I48A 3NHFA 2WJ6A 1OYWA 1XA4A 4GRIA 3HXPA 4J29A 5BYJA 3WYEA 5K8IA 4BBZA 3OTGA 5CFLA 2OZLB 4D3XA 1C2TA 2KS6A 4LN1A 3BIJA 1BO6A 4CUJA 4ZCIA 1HDXA 1YGPA 3GR6A 4RHTA 3MIIA 3ZX4A 4EYKA 4WBNA 4XX1A 5ICEA 2Y0EA 1JDVA 1VYTA 2ZYVX 2BSXA 3CF6R 4GW3A 2QM0A 3LUKA 4J91A 4M3NA 2D5IA 3AETB 3G7SA 5KWJA 5SV2A 5E6SB 2IUYA 5E7MA 3JXEA 3UOGA 2ADOA 5E4TA 3IPXA 3A8TA 4TZTA 2PX6A 5DWQA 3G6WA 3JASA 4GL4A 3UWSA 1S4MA 1FTWA 2WTAA 3P9IA 2J3JA 4IO0A 1C8VB 2G9QA 2RI1A 4EQZA 1HDOA 4UU7A 4BPBA 2H1VA 4XASA 2PUJA 3S1LA 3QSYA 3GHHA 3ICWA 2XNKA 3TLYA 2GSWA 1WCIA 2AMVA 2ZU0C 3EAQA 1XTBA 3PNSA 3K73O 1L7MA 4BLQA 2TRSB 5K7SA 5AQ1A 5C35A 3PKIA 1Q12A 4G8JA 1E0AA 1TVKB 4NEGA 1CE8A 2ACWA 2D54A 3AM5A 4J7AA 2XADA 2EL7A 1QR2A 5B1HA 2F48A 1FUEA 3FYTA 1F8FA 4UM7A 3SLRA 2R1VA 3GHYA 4U6QA 4LRQA 3BORA 2HHAA 3L79A 1ULTA 4OHMA 4UMFA 2X5XA 2HHCA 2Q6OA 5L6MB 3GUYA 721PA 3JAKB 2PDAA 1E3IA 1LI7A 2AHOA 3FNFA 2VF7A 2HDHA 4AW9A 1OHHA 4KR7A 1RRVA 3DULA 3TSZA 5EJ7A 1OWPA 2VDUE 3AP1A 1DXOA 3FRHA 4RDCA 3PX2A 2PMDA 4DA4A 1PR0A 2X8LA 4FD3A 3U7IA 2F43B 1A9SA 1KYVA 1BA3A 4OMFG 3FMVA 4D57A 1QHNA 4TRNA 5DGHA 3KKMA 5CP8A 2C7VA 1X7DA 3KDSE 4R1MA 5KNBH 1XTVA 2OXRA 2QRPA 5CDTA 4WKBA 3JRNA 2IH5A 1GPAA 4LMAA 4R3UC 2YRFA 4UBKA 5CA0F 4WMLA 3NRBA 5KHLB 3WFIA 4O2RA 2PO7A 5E1DA 1C9YA 2QD3A 3LKZA 3MMXA 4RD0A 5GQSA 2Y1OA 3HH8A 4EY4A 2BGUA 5I8WA 2ZS7A 3ROZA 1PWEA 4QUAA 3PC2A 2XR1A 5JNUA 1JXAA 3COWA 5LNK6 2UUAB 1QWOA 1SURA 2D5LA 2GJ9A 3KDAA 1F14A 2BKEA 3HM2A 5HIIA 1UDCA 2YN0A 5D5HA 4GNKA 4HX2A 4IH4A 4UZSA 3KOOA 4CV1A 4J0FA 3DFZA 2IYWA 4NQRA 2PD6A 1NR5A 3BX1A 3KKPA 2OV1A 2QVXX 1Z8DA 1J97A 3FRIA 5K09A 3OLQA 3WWCA 1CDDA 3BMOA 5LQRA 2EATA 4S24A 5HR5A 2Z1MA 4R7ZA 4DRXA 3DVSX 2Z2IA 1R7RA 3ACBA 2P30A 4FSHA 2AKAB 2QS9A 1WVMA 2ZI5A 1DBRA 5BT9A 2C2HA 2EKZA 3DB1A 3VTFA 3W9BA 5EEGA 2DWOA 1DKRA 4RENA 2JS7A 3K1YA 5HILA 4E4RA 1NJ8A 1D2AA 1P45A 1XPJA 4PC3A 1WU8A 2ERYA 1CQIA 1LNQA 1SRRA 2B2CA 3HC7A 3IHLA 3IIEA 3ANNA 5CT5A 5A3JA 1NVXQ 3QU7A 3LH5A 3PIDA 5ALUA 3I61A 1ODKA 2DPGA 3AONB 4OXKA 2B61A 4LOHA 2JD0A 4R0MA 2ATXA 4QPZA 3WL3A 3I5XA 3CZMA 1OF1A 4DW8A 1H6AA 1CR6A 3CYFA 1OPRA 4FYHA 4QEZA 3CZAA 1F2UB 3EF0A 1VGQA 2QV7A 1HFWA 4RTQA 2WSBA 1QH9A 3G6KA 1UJCA 1YS1X 4HLUA 4GI3A 4P7KA 4C2BA 1Y34E 1T9AA 1ZKDA 2RK6A 2YVKA 3JARA 3I4CA 4FB4A 4RCZA 1KBQA 1C30A 2FWIA 2Y0PA 3EXEB 1YMUA 3F5SA 3OIUA 4JCCA 2P2ZA 2RH9B 1VMAA 2A33A 3E1GA 4ZRMA 4I55F 4BNLA 2VYCA 2WJJA 2ZIVB 3OMLA 3VHRA 3ZHCA 5KMGB 5EEHA 4AS3A 1X7WA 3JD4A 1EDBA 1UMDB 2NTJA 2PQ0A 2WA2A 2AFHA 2ID4A 4FKMA 4Y6LA 2DKNA 2FPGA 3Q87B 4GPZA 5FBLB 3VYSB 2YJ6A 1CY0A 1G8SA 1DARA 1SXJE 1T10A 2I6SA 1YBHA 2QRZA 3BJRA 4UBNA 3G2QA 4YFYA 1JDBB 3WIVA 2GAOA 3C6YA 2PKQO 2J5KA 4H15A 4HBZA 4UDOA 4E70A 4E14A 2NU8A 2VUSA 1WMDA 4YEDA 5AKZA 2CK3D 2PGAA 4BNKA 4UBMA 4UXHA 3DZIA 3ESCA 3UAXA 3DOOA 1WETA 4MDFA 1P73A 1KY5A 2IUFA 1KARA 2JLCA 3R41A 2ZSEA 3Q0IA 4P82A 3QLTA 4J90A 4B45A 5B7PA 3HADA 5CW2A 3ND9A 3GJRA 3WGYA 4BGUA 4WPGA 4H1UA 4ER6A 3DWGA 4FMDF 4OLAA 1X2EA 4D9KA 2C99A 3B6KA 5E2IA 5F9MA 3VNRA 3R9WA 2WZQA 1GZ6A 1DJOA 4W5JA 2IYZA 3CNQS 1PW5A 2WC1A 4AUEA 3GRZA 3ZD8A 2C5AA 2J8ZA 4TKLA 4JK3A 5E2AA 3TB4A 5F4BA 5BXQC 3SHWA 1ISJA 2DQSA 5HKKA 3QJGA 4ARZB 4EPRA 3ZC3A 2WD7A 4X3CA 3OE7D 5FKJA 2Q27A 3EARA 2NVWA 1N9KA 2H9YA 4P7FA 2ZYWX 5K6TA 4BBPA 3T5PA 5IT0A 4EYQA 3HB9A 1NVBA 2FZKA 2OXFA 5DSXA 1H0RA 3BGIA 1DAOA 4G0MA 1TJPB 2X8BA 1CJSA 3LBFA 3ZDYB 2FXIA 1GGVA 5DHUA 1Z6YA 4MUFA 1OIVA 4L3WA 4NIMA 5U4XA 4Q4HB 4DIEA 2JAWA 3QITA 2JLQA 1VPEA 1SNYA 1CY8A 2ASEA 1GLVA 1II8B 3ZGZA 5AOVA 2A86A 3WBKA 1WF3A 1MX9A 1XZLA 3V2HA 3X2EA 2IPMA 2CCJA 2CLIB 1ZUNB 2FSIA 1FMTA 3BXFA 4N8SA 4FX5A 2JFFA 1PUIA 3PGXA 3PJEA 1WJGA 1MG0A 2YIVX 4OSEA 4PIVA 1F3OA 2FWPA 4DLZA 3C48A 5GIPE 3IP8A 5BWBA 3IMFA 1G5PA 2JJ2D 3AV3A 1W88B 3WHLA 1TT7A 4GGMX 1P4RA 4F93B 3AEQB 3EIWA 4JI1B 4EJSC 3PWSA 4MB2A 5AM0A 3PIIA 4WNAB 4M1TA 1DG1G 3LUPA 1EGHA 3OP4A 4P8RA 4CTMA 1DUIA 2B37A 3SYNA 1GUAA 1RBMA 1BD4A 2XMQA 3CUTA 4HEA6 5KOJA 5FWAA 2XLCA 5LUAA 1EP1B 4LHXA 1T0BA 1K6EA 2Q9BA 4L5CA 3RYFB 4OCZA 4TV8B 3EF1A 3VR1A 5KX5A 4P6VF 2HHJA 4WZBE 3QF4A 521PA 1YZNA 5F3DA 3A05A 1M5UA 4BU0A 1ZNQO 3FHOA 2WIAA 3FPGA 3FPSA 4XSGA 4Y9DA 4Z4HA 2A9VA 3FI0A 2ZUCA 3E5MA 3GUUA 1M6EX 4DXAA 5JD5A 1UBRS 2B82A 4XQ0A 2JLRA 4PZZA 3W4JA 2CLFB 2AKEA 2HSDA 5FDFA 2B7CA 3FCSB 3GRRA 2FW8A 4MIYA 1Y82A 1Q7RA 2GCGA 5LP6C 2E37A 2VYVD 5IJWA 5JR3A 2IHUA 3ZCVA 4PLPA 3ORYA 1HX7A 5J3JA 2BFBB 1ZOIA 2XZOA 3OE5A 4DUGA 2R7LA 1PGPA 3B20A 4DSAA 5EIBD 3VJMA 4RJJA 4NNJA 4BDTA 4UQOA 5TS3A 1RWOA 1NW4A 3O4IA 4L16A 3E84A 4C0LA 3I9V6 1EHCA 1E79A 1HFJA 5EI5A 4D74A 5HF5A 4IOJA 2YCLA 4FJ1A 4ABTA 4LBZA 1XDDA 3OX4A 3IPCA 1E7YA 1G38A 3VC7A 2FV8A 4FHFA 2QRUA 3CRZA 2E4XA 4X41A 1U6JA 2IEYA 1TW3A 3BEOA 1MTOA 3GB9A 1VG1A 5AJUA 3FM9A 2P2NA 3H2HA 2P7IA 3OA0A 4CIYA 4RV5A 1BU5A 1INLA 4CG0A 3BMQA 1YO6A 1VLLA 4BLVA 3LTNC 1FCJA 5A0TA 4RX1A 3NATA 2GK7A 2ZUDA 1Q14A 2W8BA 3LBNA 4IO1A 4HJXA 4N82A 1H9BA 1IDOA 1YJ8A 3N2GB 3UV6A 9ATCA 4HP8A 3G2HA 3LOUA 3HZZA 2HWKA 2EIXA 2W2PA 2CCKA 1MMFB 1P5HA 1JEJA 3OIGA 4QGHA 4WK6A 1RYZA 4HK4A 4YYZA 4H3KB 2OZVA 2F3UA 2A2ZA 4EMUA 5BQ3A 3Q3CA 1CUZA 4MKGA 4AI6A 4JKIA 1K9SA 4LZAA 3PP8A 3HCFA 1M6VB 1SUDA 5JQGF 4Q7LA 4E5SA 1SM4A 3H0EA 4C3OB 3NDJA 1C0PA 3K6RA 1WKBA 1JPVA 4P4SA 2VZEA 1X38A 2I3ZA 9LDTA 5KO2A 3HA5A 3ZJUA 5CNIA 2JRCA 5IK2D 3ILHA 1CF2O 1MQSA 1VKJA 2GEVA 4PO1A 2O0JA 4UHHA 3THYB 1Z2PX 1QUEA 1YFZA 5IHXA 3R3YA 2DU8A 3U4QA 5JFGA 2HBQA 4K3VA 3RABA 1S8NA 1XN1A 1KI6B 3WMWA 4CT5A 4I5DA 5JCOA 1JNYA 2VWGA 3LUHA 3RF6A 1KSFX 2HPZA 2YXPX 2IYUA 3WL8A 2PZ8A 3KVOA 1ETUA 5AW4A 1P1CA 4P4UA 4PFQA 4GE3A 5FUBA 3H4TA 3MTAA 2FW6A 1WW8A 3ZIUA 1PG5A 5LVAA 3ESQA 1T5BA 2DLDA 3P7MA 5D00A 1XZEA 1ORIA 1K86A 5CXQA 1KEWA 1VBNA 2HHLA 4O4HB 4ZOLA 3AL3A 3UJ8A 1HQKA 3HDJA 3FVRA 1KO5A 3LKDA 3D5TA 5HRUA 1MOPA 1W44A 2WHEA 4CQMD 1CU1A 2E4ZA 2H4WA 1QGUB 2F3TA 3RROA 3N0WA 3FR8A 4EF4A 4KHPB 2PGIA 3MJ4A 1K8RA 4UBLA 2EG9A 3TI9A 1RC8A 3DQQA 5ERGB 3UJPA 2AWNA 4TWJA 2XWSA 4E1AA 4HKTA 4WX2B 2QBYB 5PNTA 3TECE 3AEUB 4JBHA 4CM5A 3TRHA 1QB7A 4ZCLA 4LF9B 5JZSA 2OLJA 4L08A 4RZUA 1SQ0A 4FBLA 4L4XA 5TY0A 2FPWA 4V0SA 1ISFA 3GT7A 3QRWA 4WGGA 2WU4A 4YAGA 3GH3A 2XE7A 1GYPA 2EAUA 2CLLB 3UH0A 3CTPA 2C9DA 4PHTA 3WK5A 2OK7A 3S40A 2G1PA 1GUFA 2IHYA 2J9RA 2K7ZA 3C98A 4IHJF 3IP3A 3PJDA 1BWSA 4H35A 3N2YA 1ZXBA 1JMVA 3P96A 5JSKA 1J06A 3CF2A 3TZBA 3T1HB 3CN9A 2GM4A 2FF7A 4TROA 5C5EA 2B5OA 5EZ6B 2WP0A 2YY7A 4RAOA 1DV1A 4YX9A 2AXNA 3JQGB 4MQ4A 3ZHUA 2O8BB 1CUEA 3BMCA 3RSLA 3BD7A 1AJEA 3FAZA 5K0SA 3EVAA 2QTHA 5A9SA 2L18A 5LD2C 5AKIA 1E4OA 4URFA 3QPDA 5LIPA 9LDBA 4AS1A 3OM0A 1X9GA 2ZR0A 3HDHA 4WFIA 2RE8A 2QUKA 2OZEA 1T5OA 2VP6A 3OJCA 4YQEA 3VMMA 3H5NA 3KSMA 3TOXA 4R2JA 4JP8A 1IOLA 1CJMA 3V8VA 1JS1X 3V1TC 1TTTA 3N8DA 1YB1A 1JAYA 5HCNA 3LWZA 1SBYA 5KMGA 2Z43A 1UZMA 3IQEA 3ASUA 5D6NA 1G59A 3LLCA 3M6LA 2BEVB 2B5VA 3RREA 1JU4A 2ZSAA 1FTSA 1PTKA 2XUPA 1L3BA 3FF4A 4W9MC 2PH5A 3ENQA 1XTTA 10MHA 3OLYA 4B1FA 3TI7A 2JIPA 3TMKA 3UWOA 1EFVA 4ML3A 4YRDA 2BD0A 3SXPA 4L22A 5HBRA 1RIIA 1L4YA 3B7WA 3IOMA 4F4UA 4RXUA 3KHSA 1NVTA 1I33A 2OR3A 3AT1A 4RHFA 1U0BB 2PXXA 3PHBE 5I7OA 2IOFA 4G4JA 4C20A 1CFZA 1FRFS 2O6LA 3R74A 4A8TA 1H1LA 3VR5D 2YJ4A 2IZZA 2ZR9A 1BGVA 4FD2A 1C3LA 1U0NA 3OC0A 4WN3A 4JHXA 4YQZA 2WKRA 3AZQA 2ETXA 1A9TA 1FXWF 5EA2A 3TLBA 4QUEA 1CQJB 3IP6A 1Z63A 4K6OA 1ZITA 3KB2A 3SY8A 5ITWA 1F12A 3K5IA 3BWXA 4H4DA 2HMYB 1IY8A 1SN7A 3DMNA 2H65A 3HWX1 4RM2A 3J7AC 3HM9A 3DC7A 1LSSA 1USKA 2PKYX 4TTTS 3ZCXA 1FFHA 3FFWA 3SEZA 4P4GA 5HZMA 3ZKAA 5HP4A 4NCXA 4C07A 4DY4A 2W71A 4LGMA 1JA9A 4IGEA 1YR6A 2VH5R 3UEOA 2V0NA 1IK4A 4PNHA 1Z4KA 3STXA 1Z56C 3TD9A 4C0BA 5CEEA 5I3CA 3ZV6A 1NVDA 2G1UA 3VPDA 5JSYA 3C3AA 1YKFA 4FFDA 4EX6A 4EI9A 1AN0A 5T41A 2YY6A 1PGOA 1YCGA 2E85A 2Y1LA 3NDIA 1CRQA 2GS9A 1CLEA 2JL1A 2O14A 2Q3JA 1T9CA 2YHBA 3TNJA 1E9SA 1P75A 4ZEOA 4HDNA 2OGTA 1DBSA 2GASA 2WHYA 3PE3A 5JAUA 1QFSA 2WJWA 5ALKA 2BEWB 1TQ6A 3U3JA 1DAKA 3DQPA 3WZ2A 2F8LA 3P2KA 3F3MA 2JFPA 4I4TB 6Q21A 2BZSA 3AW8A 1QGED 4HAIA 3ICPA 3RYTC 2XVAA 4IRUB 4DA7A 4H31A 4ZQIA 4WFQA 3X1YA 3TKAA 3GEGA 4KXMA 4ATNA 2PV7A 3OFND 5EWJA 4CI0B 2XQGA 1IB0A 2XRYA 3KQTA 5KAPA 3VR6H 3E8XA 4AL4A 5JROA 4CM1A 1FYFA 1FP4A 1EG7A 4YMTA 2ZI3A 2VYND 2B30A 1ZR4A 1IPEA 3ELBA 4RGBA 4YI5A 5JO9A 1FE8A 2M1ZA 1VHLA 3N9IA 2GRJA 2VCEA 4JYPA 2Y05A 4BNDA 3RQSA 4EG0A 4Q19A 4EGSA 2D74A 1EUQA 1OBFO 4X6LA 3L7DA 2F62A 4Q4DA 3EW7A 3ADKA 5I9LA 2AWOA 1N0HA 3IIMA 2JGMA 1GGJA 1P2UA 4LZPA 1I7DA 1KU0A 4Y9SA 3KB6A 3TX2A 5LXTB 1XXHB 4K8OA 4XUEA 5C1IA 4CLOB 3KLOA 5CH5A 1XO1A 4JJKA 5JFTA 2I6FA 5AW3A 2UVDA 1BIFA 3JWIA 2E4AA 4HFRA 4Y7DA 3CVXA 1GNLA 3EAFA 4QWWA 4JR0A 1DX6A 1QO0A 2AXQA 4ZN6A 3ZZUA 5HKAA 4CM4B 1BYUA 1JKJA 2JH8A 1W8IA 2DYKA 4NNOA 2ZIXB 4MMYB 4EJMA 1EK6A 2A9QA 5K01A 4JAVC 1E4YA 1NP3A 3ELUA 4IUDS 5LP6A 1KFBB 4NZNA 5SY6A 5BR8B 5AXCA 4MX8A 4HDRB 1RPZA 3HU1A 2HCRA 4PBRA 1ZCAA 4MJ3A 4V0QA 4DG5A 3I9NA 4NZ9A 4D3YA 1H66A 1G8KA 3E58A 1UFKA 2H7CA 4TVKA 5DWDA 4K7JA 2J3MA 3NHAA 1KVRA 4OIFA 1R5NA 4Q9AA 3UOWA 3ZBTA 1WDWB 3COSA 1RYNA 4UAGA 1EKXA 3LYHA 1R6AA 3EGVA 1KGDA 3GWGA 4URWR 4Z9YA 2PNJA 4FZVA 4KPYA 5F1YA 3ZGOA 5HM8A 2JCGA 4IFTA 1SPBS 2CFCA 3T7TA 3RARA 4MV6A 2DUWA 4EUEA 3Q11A 2DETA 1J1IA 1JG2A 1EX7A 2LCFA 4YWHA 4CIXA 1BROA 2Q7XA 1QV6A 2X86A 3A6HA 2B4AA 3PWTA 4U9HS 1WUYA 1U0OC 2C5BA 3ZOKA 1DQYA 2I22A 2ZJOA 1VYHA