1O6UA

The crystal structure of human supernatant protein factor
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
397
structure length
393
Chain Sequence
b'MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEC14-LIKE PROTEIN 2
publication title Crystal Structure of Human Supernatant Protein Factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 121
structure length 393
sequence length 397
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.680 Mainly Beta Sandwich Jelly Rolls GOLD domain 1o6uA02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 1o6uA01
1O6UA 3Q8GA 3P7ZA 5LZ6A 3B74A 4CJ6A 3PG7A 3HX3A 1OLME 3PEGA 4FMMA 4TLGA 1OIZA 1AUAA 4UYBA 4OMKA 4J7QA 1OLMA 2D4QA 3B7ZA 3HY5A 3B7NA 3W67A 1OIPA 4J7PA 3W68A 1R5LA 4CIZA 4OMJA 4M8ZA 2E2XA 3B7QA
chains in the Genus database with same CATH superfamily
1BZWA 4FBFA 3WQ7A 4N43C 2AACA 3MUZ1 1GFF2 3UKVA 1VRH3 4XIKA 1M06G 4Z82A 2XH6A 2YZ4A 2D3SA 3OPWA 4XJZA 2CYFA 3KQRA 1DQ2A 1DFQA 5F3GA 3JD72 1OVSA 3ZSLA 1U5YA 2IXCA 4YGDA 4JHTA 4D7YA 5T55A 4AW7A 2PAMA 2CDOA 4COYA 4ES8A 3AMNA 1C5IA 2DVGA 1SCSA 1AUYA 3E97A 1X8EA 4LEJA 2OQ6A 2A71A 2PFWA 5FZ7A 3TYJA 5I91A 5IK5A 2WZPP 2C6SA 1FMD2 4IV3C 1A8DA 2JX9A 3WINE 5E6HA 1VAMA 5FP7A 5CG8A 4QKBA 3WNNA 4FT8A 1VRH2 1SBFA 2YGLA 5JOZA 2A6XA 1MQTA 4AEMA 1GNZA 1R083 1V6OA 5FY4A 3USUA 2V72A 1H9PA 2H0VA 1EAH3 5GZFA 2ZGLA 4AEDB 3WP6A 5C5TA 1FV3A 5TSWA 1VBA1 2R6QA 1TME1 2W92A 2EF6A 3SH4A 2GNDA 1MZ5A 3DYOA 2BTVC 4DRRA 4EJRA 1ZBE1 3D4KA 2GN7A 5FYBA 4OMJA 4CCKA 1PMIA 4UWDA 4LK7A 3BPZA 2J1EA 4Y5TA 2D93A 5FOJB 2A1XA 4PQ9A 1O3TA 2ZBJA 3SCGA 3PVEA 4E4SA 1GLHA 1PK6A 2RS33 5IVVA 5FUNA 5DN2A 4COWA 1R082 2WNUB 4GMP3 4S2DA 1PIV2 1EAH2 3H1YA 2NZ9A 3BIWE 5I0RA 5JOYA 1U12A 4R9DA 5GM0A 1JYTA 4YW7A 1YQCA 4WM8A 4IV1B 5J96B 4RGAA 2DFCA 2QQWA 1MEC3 4JDOA 2C0ZA 4L0PA 4HKLA 3WDTA 4DEVA 1BK1A 1U5IA 3R4UA 5FMCA 3HMYA 2X8KA 4XQ4A 5FMBA 3TRSB 4H7LA 2GC1A 1CIWA 2HWE1 4CDXB 2P3YA 3D5OA 4R4XA 3IKWA 3OPTA 1CIYA 3P1IA 4FCAA 2ZXQA 1W9FA 5FPBA 5C3OA 2W08A 4KWLA 2WL1A 5BNOA 2ZGMA 1UY4A 4UAPA 2OYZA 1EUTA 4IV1C 1JU4A 4FPJA 4CEYB 2J1RA 1RVF1 2O8OA 1COV1 3OJBA 4PBPA 2JECA 3AMHA 3EYPA 5CB7A 2OA2A 4FP3A 4RA0A 1CQ9A 3OD4A 1PGSA 5LB6A 1W6PB 4P9YA 1MEC2 2UU8A 5CFDA 3VDBA 1XJAA 2PLV3 4LK6A 4DY3A 1MPXA 4PLNA 1TNRA 4RQPA 1AXYA 1S0IA 3APBA 1UYZA 4QM9A 1H4HA 1QJZA 4MO3M 4UFLA 3ZFGA 4G3YC 4TYSA 2A6YA 2DCJA 2YBKA 4AVVA 4DZGA 1QEXA 2W9XA 5LY1A 1UYPA 1VBD3 5L36A 2WUHA 2SLIA 4CEYC 1OOPB 2X05A 4BH9A 1X9TA 2BWCA 1AJOA 1DCSA 2XMLA 2WA3A 4CCCA 2HWD1 2ZX1A 2JXAA 2R043 4XTMA 5L7OC 1WUVA 2HBTA 2W95A 5F3EA 1X82A 4XJ9A 4KMQA 5E16A 5EHDA 4BM8A 3MBWA 4OI0A 2FMYA 1F8VA 3FBYA 4K6BA 1ZREA 1APNA 2J1AA 1GP6A 2V09A 2GP3A 5C8CA 2XXZA 1OLRA 3LCPA 1W2NA 1CZTA 2PLV2 1XU2A 3T2QA 1OOPC 5J36A 2HEYF 1J1LA 2VZQA 4MLOA 2VBDA 3WDUA 4LHSA 4E9KA 5BNQA 2Y6LA 1VBE1 2RJLA 2O8QA 1HQWA 2PAEA 2A6WA 2DYCA 3J8F3 1VBD2 4LBOA 1UU6A 4QB1A 1IZ3A 4BCUA 2ZHKA 3UGFA 5FRAA 1PX3A 3HD8B 3K48A 3N9PA 1I5ZA 2XB6C 2YC2A 1MS8A 3N7MA 3WD5A 3GZTB 3VBUA 3ZN6B 2R042 2FDJA 2R061 3AVSA 3MIHA 5F1RA 3ZYGA 3LSEA 1HRI3 4EN8B 2JWPA 2P3KA 1Y7BA 5A6ZA 2YV8A 3O1MA 2OPKA 3OBZA 1XNCA 1XYOA 2BNNA 3ZYJB 5LA0A 1FNYA 3FHIB 3TWIA 4NHYA 1LHUA 2G9ZA 4KG8A 2VXRA 2FDGA 1QJFA 4UI9L 5FQ0B 1BKZA 1H9WA 3T1MA 4CDWC 2D6KA 2UWCA 3J8F2 4XPVA 2ZGNA 4DPNA 3WP4A 2CHHA 3E1F1 1OXCA 4OQ9A 5JSPA 5LBBA 3VHOA 1MR5A 4CCEA 5LRSA 1GSLA 2WZR3 1TG7A 4W8JA 5FXXA 1OH4A 5AC93 1OPMA 1XB9A 4X8PA 1JS9A 4Y1VA 3MZHA 5FZAA 1W6NB 5DZEA 3CKHA 3WUDA 1HRI2 1OF4A 3ES1A 4AEJA 4BLJA 3ALQA 4URTA 1Z7S3 2CL2A 3I54A 4CCNA 2VPVA 1WCDJ 4LO6B 4AZZA 4B4RA 3GM8A 3GCXA 3D0JA 5DXDA 4XILA 2W52A 2WRAA 3WEZA 4XVHA 3VBOA 1C8M3 4XIOA 5FPXA 1RUE1 2Q4SA 4P5HA 4JCKA 1W9YA 4BHPA 2ZAAA 5KXBA 5FZKA 5CG9A 2WZR2 3PU8A 5AC92 2PHTA 4C90A 5KR7A 2JDNA 3B93A 3R4SA 4CZSA 1PNGA 1ALYA 4MGZE 2MEV1 4OUSA 2JG8C 4RHV1 3S30A 3CIHA 5LEKA 4WZFA 3B7ZA 1K5JA 4IUGA 3DGTA 2OZJA 4DUXA 5DPNA 2XG3A 5I8TA 3T4HB 5A1AA 1Z7S2 3OEAA 4BMBA 3IPVB 3MEPA 1XYNA 3KGLA 3BN6A 4XUNA 1TMF3 2VZ1A 4OUEA 1CAVB 3T09A 3LQCA 1HRV1 5ANNA 1C8M2 1A3KA 4X8NA 3HX3A 5ISLA 4A7YA 5ABJA 4XUQA 3THPA 1QH7A 1O3RA 1W0OA 1H2NA 3OPZA 1Y4WA 3FLPA 3QH6A 2F4PA 1LHWA 3WF3A 4L97A 1OUSA 1OLMA 1Q56A 4YW3A 5LEJA 1GOGA 4A45A 1XNKA 1CJDA 3U78A 4OHZA 1JUHA 3EO6A 4L2NA 1BVP1 3AP7A 3H1WA 4M3CA 1LGBA 4N53A 4XJAA 4Y1ZA 2IC1A 2AREA 2UYBA 2F17A 2YFUA 1DQ6A 3ACHA 4YVSB 4AQTA 4COZA 5BYNA 2W47A 5DZGA 1KD7A 1ULPA 2VMEA 3N9LA 3Q8GA 1QDCA 1TMF2 2WO3A 4PBOA 3JXSA 1F9KA 1PO21 3U1XA 2H6CA 3AZYA 1OT5A 1LODA 1WWYA 1L3JA 1NQJA 1W8NA 2W0XA 3T1LA 3VBUB 1CR7A 1DYPA 1LU2A 1HQLA 4I09A 4F7ZA 1YUDA 4IW3A 2ARAA 3UKTA 4COUA 3CMGA 2JDKA 4PIZA 3CJIA 3IT8A 1RUI3 3R05A 1A34A 1IG0A 1VR3A 1KRIA 1JHJA 4S2HA 2WNEA 1YXWA 2UURA 4WVMA 4YW2A 5GKAC 2FDHA 4AFBA 3C7EA 3ON7A 2FDIA 4QWNA 2XWBB 3VKOA 2Y26A 1FX5A 1BHGA 1HQNA 4JVAA 2LUWA 4OHWA 2O0OA 1VIWB 5G05L 2NLRA 2VBPA 3EBRA 4SLIA 1UPSA 1KDMA 3OGGA 5A32A 1DGRN 1XE0A 3IAPA 3OGVA 5C9AA 4LKFA 3JBG3 2XKOA 3KVAA 1JODA 2A6VA 1V9U1 2VCCA 4I01A 2FHRA 5EP9A 1QJX3 2VNVA 4NVPA 4PLOA 5C3QA 3BU0A 3W67A 1RUI2 1HJFA 2PHDA 4UBGA 4NIHA 5IT6A 2K0GA 5FZFA 1CJPA 3NW4A 4IL7A 1H8VA 4A44A 1JW6A 5FUPA 2BNOA 3DYMA 3CZJA 4ZXEA 2XVLA 4WVVA 4IEPA 2DVFA 1MZ6A 1ULEA 3FLTA 5DAQA 4B1MA 3I2OA 3MV11 1QDOA 2XJPA 4EWAA 5AFBA 1ZYBA 2DU1A 1FPN1 1IGOA 5FBZA 5EZWA 1IQAA 2RG4A 4YM2A 5A70A 2ZOEB 3ZFEC 4E27A 2W5FA 1WA6X 3N35A 2GDFA 3A0KA 3I2JA 3JBG2 4BK4A 3GZAA 3KZ4C 5DDJ1 4CP9B 4Z2WA 1QJX2 5FYVA 3TN91 1DZTA 3WNKA 1H1AA 2IVJA 1CAXB 4QPIC 1I3HA 2VUDA 2EALA 4Q0UA 4RFRB 4QHZA 4HG6B 4CU7A 3O1TA 5LW9A 3T0DA 2HWB3 5L9RA 3H3ZA 1MACA 3IWZA 1VB2A 1AL0G 3I2HA 3Q8FA 3HBZA 4A3ZA 4BXFA 2VE1A 2KXLA 3NNGA 1GP4A 1PM7A 3NV2A 2RDQA 5ABJB 4D94A 2W91A 1ENQA 1AYM3 3PU3A 4BIOA 5JAXA 5LRRA 5JCTA 4KI5M 4UFMA 2Q1ZB 2FMDA 2O1QA 1LULA 2JE9A 4MUVA 3H0OA 3VBHA 3KF3A 1VMFA 4M3CB 4Q4W1 4OYUA 5FPLA 1AR63 2V4AA 4RS5C 3ZYFA 2BRTA 2LW8A 4AXOA 4RD7A 3M3EA 3OGJA 2WN2A 1C3HA 2HWB2 2QBXA 3DKWA 3L2YA 3QD6A 4I0BA 2WINB 5A7PA 4F8AA 4QQPA 1VBB3 2HEVF 5FZBA 5APAA 5FP8A 5CAZA 1RUNA 1IPJA 3PG7A 3GALA 3S0MA 1AYM2 3N7LA 1RUF1 3OYWA 4LBKA 3UETA 5CU1A 1PZ7A 1W2UA 1W6QA 3MW4A 5FWEA 2R0FA 5CKQA 3M3QA 3ZN4A 1BMV1 2YXSA 5FYTA 2JG9A 3O1OA 2EAKA 4XF0A 1AR62 3O1VA 5KWRA 3AZWA 1KITA 3U10A 3H7JA 1SACA 3NV1A 4LBNA 1V6JA 4YW5A 3TNQA 4Q5OA 1KEXA 5A3WA 1OMIA 3B5LB 1NY71 1VBB2 5DUWA 4YGEA 1U0AA 3O12A 1Y3TA 1YI7A 4XE9A 4JGZB 4B8EA 3MDPA 2A70A 2ZTNA 1D4M1 2D5HA 3ORJA 5A32B 2YYOA 1YFUA 3J4UH 1CPMA 4XCBA 3ZMNA 3NNFA 1RUJ3 1V0AA 1ND2A 4AVSA 5H9SA 4LBMA 1PX4A 4YZ4A 3C8XA 4UXAA 4JKLA 5FJHA 3H9AA 1IPSA 5CNAA 5C4WC 1UU4A 1LEDA 2J7MA 5JSRA 2OUJA 2FZ1A 1DYOA 2ZHMA 5FY1A 2JENA 5BY5A 1IQDC 2IXKA 1W8ZA 1Z0HA 2AGSA 3EJKA 3UV9A 4JGZC 1E57A 5F37A 3I8TA 3RSJA 4XDQA 1DP0A 1W9SA 4JRLA 1WW6A 2RM21 4LLFA 5BUVA 2A75A 1SFYA 3VHNA 3HAGA 4XABA 2D43A 3KV6A 1AUAA 1PNFA 1LOAA 1SFPA 4NAMA 4QX7A 2DU0A 1RUJ2 1O8PA 4UF0B 1LOFC 2YU1A 3D3AA 3RJRA 5C6CA 5JMCA 4I2OA 4YM3A 3NWKA 3U07A 2XDVA 1RJ8A 2W94A 2JIGA 2VZRA 1UY2A 4A6OA 4IQPA 3VD3A 4W6WA 1RMU3 3OF1A 4E8DA 1KS5A 4P14A 1OA3A 1YFXA 4WVZA 5H9RA 2AC1A 4RN5A 1KGYA 2D3RA 4CU8A 4ZZ5A 4KBZA 1S0GA 3EHKA 3KV9A 1WMFA 4LMFA 1MVQA 1K5MB 2VL4A 2CNAA 1QU0A 1QJY2 1T2XA 1RL3A 3CDZB 2E26A 3GGLA 4GIQA 1S55A 2ZEXA 4AVBA 1UOJA 5JZGB 3K46A 1LTEA 1WBLA 3RMYA 3ZIWA 3CO2A 3BPSA 1AVBA 1UZYA 3DEMA 4Q4X3 4XW3A 1L7QA 4DXRA 2Y6GA 5FZOA 2RVAA 4IE0A 4QD2A 5FFOC 5F2SA 2VOTA 1OF3A 3T2TA 5LASA 3AFKA 1RMU2 4DXSA 3VD7A 5A80A 1K5MC 3CBNA 2JKBA 3FE5A 3FWEA 1FXZA 2B46X 2E53A 3ACIA 4Y24A 3B7QA 4Q1RA 3NSTA 4HOOA 1CZVA 2C1FA 2PHRA 1NA1A 2R071 1S2EA 1POQA 3UESA 3BTYA 5JZGC 4EV0A 5EWSA 4FTEA 3VBSA 1O7FA 1YJKA 4Y5Z0 4BDVB 4QDRA 2D5FA 3J7NA 3LA3A 2GH2A 2I07B 4OUMA 4JV4A 5HCAA 5DABA 4L8QA 4ZU5A 3ZFFC 3WY6A 4NHMA 4CSWA 2Q1FA 4FTSA 1DQ0A 4YG3A 4B29A 4LTAA 5JUVA 5C3RA 3UJQA 1ND3C 3SC7X 3SH3A 3POJA 2ZEZA 1W03A 4LO8A 4Q4X2 1OH3A 4OZXA 1JH5A 4QQOA 1NKGA 3NNJA 2B4KA 1K45A 2KA3A 3DXUA 5B2GB 5FYIA 3RRDA 2V5YA 1C1LA 5DZFA 2YBPA 2D6MA 2IXLA 1IS3A 4JTOA 4DXTA 1FOD1 2P3IA 1XNTA 4ZY9A 1W8OA 4DS0A 4XUOA 1OKOA 2RMU1 1W6MB 2C9KA 2VZSA 2W68A 1BBT3 1RUH1 2J42A 1AL21 4AE2A 4NHXA 5EJ1B 4DINB 3P6BA 2VOXA 1AYN1 5EJZB 2X5IB 1WLWA 5F3CA 3LEKA 2XQXA 5LA2A 3WW1A 1IG3A 2ZS6B 3PJYA 4J1WA 4AEDA 4P9WA 2R16A 4J6GA 3WG2A 3M4FA 3U11A 2GSYA 2VMFA 2WAAA 4IEUA 3ZXJA 2IWGB 3I2GA 2D98A 3AKPA 3MPPG 4ATFA 4BQ2A 4QGLA 5A33B 4FVVA 2Y6KA 3FC0A 4X6RB 2QQMA 1BCXA 3WDXA 3RPQA 3P3NA 3S5QA 4DEQA 5DAWA 3ZXFA 1UPIA 2X5IC 3A4UA 5T50A 3USSA 1HX6A 4BYYA 4UW3A 2ZEYA 4LKSA 5T5OA 1BBT2 4HPKA 2XLAA 1RUG1 3MIGA 1UL9A 4N9IA 1OIZA 5JI7A 1QQP3 1NCQB 2WQ8A 2XOMA 3KT1A 4CP0A 1UWWA 4IE4A 1DQ4A 4XJ8A 4LHKA 3ZDSA 1NX9A 1JU3A 5IHRA 3W9AA 3C7OA 3G7DA 5FP9A 3H8OA 2PMWB 2VO5A 2PQQA 3VBRB 3I2IA 1ULDA 2Y6HA 3I4IA 2ZGTA 2XHKA 3ELNA 1W28A 4IV1A 4GAZA 2QVSB 3FJSA 1YEWA 1CZSA 5BXXA 1S1AA 2HWC3 3DPRB 4JGYB 2RDNA 4CP1A 4YZ2A 4V2WA 2EAAA 3ILNA 1NCQC 2R32A 3IB3A 3ZPYA 4CDQC 1GQPA 3JZVA 1SLCA 1H8TB 1W2TA 5K8SA 3KD4A 5F5CA 5EIYB 4LO4B 3QOPA 3PDQA 4CDXA 1IKPA 4NUBA 5CYYA 4Y22B 2LTNA 2EXHA 1O3SA 1VP6A 1QQP2 3HBKA 3UYJA 4AVAA 4YRDA 4N43B 4WVWA 2VOVA 2BGPA 2XJSA 3PMSA 1VAKA 2D4QA 3HNBM 3VL9A 5FLHA 2IZWA 1DF0A 4JC1A 4JGYC 5FYZA 1OLQA 4CEYA 1J58A 1YIFA 3OY8B 3WNMA 1W2OA 3NNLA 2EXIA 1DQ5A 4CA9A 1RUOA 1H8TC 3TEWA 3K2OA 2HWC2 5L7OA 1OA2A 1W6PA 3T4VA 3ZYHA 2RDRA 1JTZX 2PAKA 3RZZA 5A7WB 3ZO0B 3KCYA 3WX5A 4IV3B 4UBHA 1XQNA 4Y20B 3CHXA 1LHVA 1OOPA 4XC9A 3WNXA 2RJ2A 3MW2A 1VE0A 4QU1A 2ZGUA 1QGLA 3CU7A 4CU9A 2VTXJ 3ILFA 1PVC3 3RDIA 3BYWA 2CDPA 2OPWA 3LOIA 1JZ8A 3RZMA 1QJEA 3M8LA 1RJ7A 4LO7A 3E6CC 3ME2A 1EPWA 1B09A 2CWMA 1VRBA 5FPVA 3OCPA 4AFDA 5FZHA 3HNYM 4ZS2A 4R4ZA 5FK8A 1AHSA 4AYUA 5A3LA 3RZGA 1NUKA 3FUOA 5BPXA 1V6KA 4TSVA 1G9DA 4BIFA 3WG3A 2I2SA 3EB7A 5LCWL 1Q8OA 1POV0 2BFUL 4FXGB 4FPFA 2RDSA 3FFQA 2XL7A 3AYAA 1ZNPA 1LB2A 1CX1A 4LORA 1XBFA 1KQRA 4CUCA 4ZU7A 1JOJA 1ZX5A 2QZ2A 1F2NA 4OLLA 1N1YA 1XPWA 5I8SA 4BK5A 4C8DA 2XVKA 3E5XA 4QX1A 4XBLA 4E4ZA 2QQVA 4YZ5A 5AFEA 2VUJA 3ZN6A 1KXGA 2WAOA 4XDPA 1JYWA 3RZLA 1S0JA 2ORXA 3H42B 4UFKA 2QJVA 1SBEA 5GLVA 3VKMA 1CONA 2B45X 3AL5A 3DECA 2UWAA 4NO4A 1D0GA 1ZBA3 4GB33 4D8MA 1AR83 1GKBA 4NMIA 1DGWA 3LDBA 4AK3A 4FAGA 4ZHNA 4LKDA 4HPKB 1OFNA 5IJRA 3HQRA 1AX2A 1L7RA 4IXLA 2WC2A 1YQ2A 5ACA3 1Q8VA 3JQXA 2TEPA 4P02B 5FQ0A 3FL7A 5JWPA 2QQLA 3T30A 1JZ3A 1J59A 3H8UA 1GU3A 4H55A 3WOGA 3ST7A 3OBAA 3N7JA 3THDA 2PA7A 1VBC1 4FPLA 1XNBA 3HPNA 4D6RA 1OVPA 5EV7A 3VZNA 3RZHA 2LROA 1RHI1 5J1XA 2ZZJA 1TQ5A 1W6NA 2HH9A 4B7EA 3LPFA 4PF1A 3CEWA 4NN0A 1F5FA 1UZWA 1ZBA2 2AH2A 2EXKA 4GB32 4ASMB 1RB8G 1PGL1 2JDMA 1AR82 1NZIA 2DCTA 2TNFA 3GXUA 2VECA 1I9RA 4MYEA 2XJTA 2D6LX 3R0RA 4MGQA 2B9UA 3MIBA 1QJU1 1OBNA 1Y9QA 3MO4A 3O1UA 2BPA2 4UOJA 3AYDA 5ACA2 2RS32 1V6IA 2WABA 2WJSA 4CTEA 2A5ZA 3GJBA 2LRPA 2R49A 1HB2A 1ZZ8A 5A3PA 1G9CA 5F2WA 3AZXA 2X29A 4MXWB 3TEYA 4PJYA 4V1PA 1J1TA 2VMGA 4ASKA 4MV2A 4G4FA 2RS13 3AZVA 3RYRA 3UL2A 1ZA4A 4AQ6A 5L9BA 5D8AB 2WZ8A 5FAXA 3WSOA 4EQVA 5HI0A 1NCRB 1O91A 1WCUA 2E51A 5K0UC 4D6SA 5L7OB 5FY9A 2F4LA 1HXS1 4K7JA 2OW4A 3NL1A 3BUCA 3IPVA 1XSQA 4IGOA 4IE5A 4YZ3A 4E2SA 2OXBA 1CAVA 3M7AA 3SMHA 5AVAA 1WMDA 3AJYA 4HANA 4BQXA 3AKRA 2GNMA 4MVTA 1I6XA 5D8AC 1XU1A 4BQ5A 3ABZA 1UY1A 4AHXA 1NCRC 1F4AA 5FDBA 2WLQA 1D2SA 4Y1UA 4NPMA 3RS6A 4Z07A 2RS12 3VKNA 3BTAA 1H4GA 1UOGA 3AFGA 3LAGA 1UYYA 1QHDA 1OIPA 1O4ZA 1QXPA 5FLIA 3WVJA 3SCHA 2QUOA 5HCHA 4KBBA 2QDRA 1ACCA 3ZIXA 3PUSA 3CF6E 4CE8A 4YZ1A 2YHJA 3WQBA 4YVSA 2FCVA 3VZLA 3WXPA 1WW4A 2Q0AA 2NPIA 2BQPA 5GZGA 3FLRA 1AXKA 3IDBB 3MLKA 3KM5A 1MS0A 4IEQA 1JYIA 4DB5A 2ERFA 2GNBA 5KXEA 2VVDA 2KM2A 4CDWB 1VBA3 5FO7B 2UWBA 1S2BA 3BU7A 1TME3 3J7HA 3AP5A 3HY5A 1LECA 1GZWB 5DUXA 3AVRA 1EV11 2BBAA 4Y4RA 2V5DA 2PELA 4YLZA 1CD3G 4HXCA 4XURA 3WUCA 1SLLA 1ZBE3 3K4AA 5CVRA 1LR5A 3SKVA 1UF2C 3FHQA 2RJKA 3JB4C 3WCSA 3I3MA 3LEIA 5JMOA 4BWOA 1W6OB 2VBBA 1SPPB 3NAPC 3RFRA 2GN3A 5F5IA 2VMDA 2XUEA 1ZZCA 3T3YA 4XFIA 1UOBA 4CCLA 2E31A 2Z69A 2PQSA 3A22A 4QX8A 2XJQA 2YBSA 1TEIA 1W8FA 1YLLA 5I0TA 1VBA2 2BZDA 2WSVA 3HQXA 1TME2 3MIDA 4TTGA 3MV01 2W87A 4GULA 3ES4A 2AR6A 2IXHA 1ST8A 4GWNA 4Q8LA 1GOFA 5D1IA 3ZKUA 1R1A1 1ZBE2 2BP6A 2GNTA 2JG8B 1URXA 4UFIA 4MGIE 2PHWA 1UIKA 1VMJA 1S0FA 4XQWA 1ENRA 2HWE3 3RGBA 3ZSEA 3F2ZA 1QJU3 3ZXDA 4AI8A 3MF9A 3J9SA 1BLZA 4I30A 1LCLA 3OTFA 1ODMA 1PM4A 3Q8AA 3V56A 4I02A 2PHFA 4DIQA 4YYOA 4J7QA 2QE3A 2R7EB 1RVF3 4HL0A 5JIUA 1COV3 1ZVFA 2JDZA 3BVCA 4MSVA 4QB2A 1UZVA 5JPNB 2RV9A 5FPZA 4K40A 3DL3A 2XLGA 1ULGA 4CP9A 1AJKA 4DO0A 4HVQA 5FJKA 2H0BA 3MIEA 3HN1A 4N90A 1CAXA 2BV4A 2FQPA 3IDEA 5FKCA 4GXLA 3OEBA 2HWE2 3P7ZA 1GQGA 1SG3A 1E5RA 3J7LA 3LDRA 2JB8A 1QOOA 1W06A 3PMEA 4RGKA 4RS5A 4AFMA 2JJ6A 5LBFA 4QPGB 1SLBA 2YU2A 1LHNA 2Z42A 4FPKA 4Y26A 2P5BA 1W8HA 2OZ6A 2WZEA 2XBO1 3POGA 1RGSA 2HWD3 4FPYA 1MS1A 1RXGA 4J1XA 4LBJA 5FMDA 3PTYA 5JR7B 5A7OA 3WLUA 1RVF2 2PN5A 4Q4Y1 1COV2 3SCFA 3LGRA 4PIYA 2Y34A 5HPOA 2XLFA 4GA9A 4O9GA 4HLTA 4MG2A 2QQJA 3POIA 4L92A 2EIDA 2BFUS 2D6NA 5C7GA 1NE4A 5FTTC 3SITA 3NO8A 5HV4A 5K7PA 4MGTA 2DBIA 1F4HA 1UIJA 1UKRA 1HIXA 2RE9A 2NM1A 3KV5A 4LOSA 4QPGC 4JZRA 3CZUA 3URFA 3INAA 4KWUA 5AVPA 3VBSB 4ZS3A 3VKFC 4S2GA 1VBE3 4OZOA 1QXJA 3ZXAC 2E33A 1CGPA 1MS3A 2WFF1 2C4XA 2YPDA 5EFUA 4FFGA 5CFDC 1NLQA 1GWLA 2FCTA 5F6LB 2B39A 3I3QA 1QKQA 1X8MA 3POSA 1J3RA 2HWD2 3PUQA 4RQPC 1WZXA 2IFRA 2R063 1CVNA 1OFSA 5CA6A 3WW2A 4WM7B 2K46A 1MZFA 4TLFA 5F32A 4FP2A 5FIXA 1YIPA 5A7SA 2QCSB 2VZTA 4Q29A 1G8WA 1DQ1A 3M2MA 1POV1 5LY2A 4CCJA 1GMMA 4O9EA 4U2AA 1W39A 4XMIA 4ATEA 2EIBA 3AP4A 1V6MA 2TUNA 4Q1PA 1UW8A 1VBE2 1WBFA 2N7GA 1OURA 4E8CA 2GMPA 3O7OA 4Y1YA 2XJVA 4Q26A 4WM7C 4AAXA 4HKWA 1GNYA 4JGZA 5KHKA 3SEPA 1ENSA 2CGOA 3ZYPA 5KBFA 3B94A 1JYXA 2R062 4NAOA 4E2QA 2TBVA 1S0EA 1N3PA 4MGSA 3POWA 5CFCB 3ZFEB 2WN3A 4GH4B 5L9VA 2IVIB 3AKQA 1LOFA 4CUBA 2KD7A 4H14A 3M70A 5HXVA 4DUWA 1F15A 4W6XA 4R52A 4AI1A 4Q27A 2QQUA 3I59A 4YG0A 3LSDA 4JDMA 5FZEA 1BEV1 1QOTA 3J26N 4DUVA 4URAA 1AR71 4QPIB 3WF4A 1RUE3 4N7UA 2QZ3A 2DUQA 4W6YA 1AR91 1B35B 1G86A 4XFFA 4XF9A 1SCRA 3AC0A 3KVBA 1LOGA 1QH6A 3R6SA 2VUAA 3IM0A 2LM3A 5CADA 2ES3A 2ADDA 2YB7A 2ZX2A 4GH4C 5HCBA 5CFCC 1ASJ1 4FI9A 4RHV3 2MEV3 4UF0A 1JZ6A 3WHTA 2JE7A 4MXVA 2XGXA 3VZKA 4IDZA 1UD1A 2QQKA 3M3OA 4R9AA 5FZDA 5IVYA 4BU2A 4BXSV 5EPAA 5J09A 2WBKA 4XF3A 1SEFA 2SBAA 4NR1A 2FBEA 2VCAA 2ZGKA 2JEMA 3KV4A 4N9HA 4PDWB 1QXRA 1B35C 3VDAA 3O0VA 5KC5A 4RS5B 5JR2A 1YNAA 1X36A 5FZ6A 1QJY1 1HRV3 1S4CA 5J7MA 3AMMA 1US3A 2PTMA 1RUE2 1K5MA 4YVWC 5FYYA 3RWNA 3SNMA 3NVCA 2Y64A 4HN0A 2J1TA 4Z1VA 5A3MA 3ZMOA 2XWJB 1WLDA 2WS91 4AHWA 2ZGSA 1SBDA 4RHV2 5JZGA 2J22A 2MEV2 1LOCA 1IOAA 3U37A 1XE7A 5IW0A 4OMCA 2ARBA 3PLQA 4PDWC 2YMZA 3LPGA 4LBQA 4XAEA 1LOEA 2Y6JA 4A7ZA 5F7UA 1G9BA 3N9OA 4CIZA 2BGCA 3ENRA 4YM0A 4LR4A 3AXDA 1P8JA 3ZX7A 3KHCA 4QXKA 2AENA 2VM9A 3LFMA 1PO23 1HRV2 3IDAA 3MLLA 3FZ3A 3VDDB 4IETA 1QF3A 4HK8A 1XNAA 4FOQA 1IS5A 3DF0A 3GDBA 3I49A 3KHBA 2RS51 1KFUL 4HVRA 3N9MA 1ULOA 2HEWF 4XHBA 2Z2SB 1J3QA 2CWSA 1KS4A 3QACA 4Q4V1 2OKXA 2ZAHA 2ORZA 1EY2A 1IS4A 3HR9A 4QQHA 2EICA 1QMJA 1W0NA 1PO11 2HWF1 4YFZA 4YW4A 3VD9A 2VGDA 1ZZ7A 1POV3 2ARCA 3VDDC 5C4WB 2V4VA 1RUD1 1AXZA 3NV3A 5FPAA 5GZEA 4ASLA 1YCIA 2ZX4A 5FMOL 4EN7B 3PVOA 1UN1A 1PO22 2O14A 3ILRA 2UYAA 3SEEA 4N53C 2A7AA 1W6MA 4HT1T 1ZZBA 3RMXA 2CU5A 3RJ2X 1J83A 1SDWA 2P6HA 3OG2A 5DAVA 5F5AA 1O5LA 1BVVA 2WNOA 3MFAA 1STMA 2RR11 3NKGA 5F3IA 5F5QA 3GCWA 2X5IA 3LZZA 5JI9A 5M0TA 1V9U3 4B7KA 4RGGA 3WV6A 4CDUB 4UT5A 3EMRA 2VU9A 4HZFA 4RSUA 1UNBA 2XR4A 5IVJA 3W68A 1LRHA 4IGPA 5HCFA 1XC6A 1ZRDA 3PJQA 1RUC1 3A23A 3I59B 4DOUA 4AI2A 1SFNA 3GBWA 4CEWB 5C5UA 5A33A 1W9TA 1Y43B 3B3QE 4GKYA 4LBLA 2HLEA 2Q8CA 4A42A 1QWRA 2X09A 3CJIC 4I0AA 5JXGA 5FP4A 3BODA 1FPN3 3THCA 2GAUA 3GJAA 5IAVA 4JAAA 4CDUC 1CPNA 1L7LA 1ULCA 3NMBA 3OB8A 1NCQA 1W8WA 4GWJA 4D69A 1W2AX 2BUKA 2MHFA 2VOWA 5K9YA 1V9U2 5DDJ3 3VV1A 1O3QA 1K3IA 3TN93 4CXWA 4AVCA 4O61A 5KHHA 4CEWC 3B9CA 4AI9A 4FQZA 3KT7A 2W3JA 1ULFA 3VBRA 5C9AC 4JRAA 4FPCA 1EP0A 3NJXA 5J98B 1DHKB 1S2KA 4FXKB 1QNWA 2BBVA 2OIIA 5DG2A 4AL9A 4LNVA 2ZABA 3DPRA 4JGYA 4KL1A 5F6KA 5FPUA 2EA7A 5A1LA 3VBFB 5IVEA 1RXFA 4K21A 1Q5OA 3ZXGA 5L73A 2FD8A 1WA4A 2D97A 1FPN2 1H8TA 4AOCA 4IEVA 4PQQA 2WT2A 4LIUA 1UMZA 2R1BA 4ORFA 4C1XA 4UFJA 4Y22A 2ADEA 3K75B 3NRUA 3GNEA 4Q4W3 3IMMA 2BGOA 4N43A 4NWWA 3WZ1A 4LBQB 5FO8B 3HEIA 4NIDA 3N36A 3TN92 3ZFFB 3PURA 1PGW1 2QKDA 2Q1MA 1R091 1TVGA 1OUXA 3WG4A 2GZWA 1ND3B 1VALA 2WWSA 1CN1A 2ZGQA 3OY8A 4IE6A 4QMAA 3VBFC 5IAXA 2OUHA 1H2LA 4XCAA 2HBUA 1GWMA 1F31A 3WCRA 2ZCWA 2DVDA 4QT6A 5FZGA 4A41A 2IFWA 4NJ4A 1RUF3 4CUAA 2BOJA 1TNFA 3I3BA 1SQ4A 1M4WA 4QXCA 3WG1A 2RS53 5IK4A 3VB9A 3GHMA 2ZGOA 3JD71 4GJYA 5I0UA 2JDUA 4LITA 5A7WA 5HBAA 1UX7A 1NXMA 4IV3A 3BTXA 4FPGA 4IGQA 1O4YA 4FPOB 4Y20A 2E6VA 4BE3A 3ECQA 3BI3A 4LUMA 3RWKX 1C1FA 2DV9A 2Y0OA 4MH0E 4Q4W2 3ZLIA 1O59A 4AI3A 3BIEA 4R9CA 2DCYA 4OFGA 4XMAA 2CSGA 5IATA 5IYYA 4RFT0 5A3OA 4Z2AA 5C8WA 2NMNA 1WMEA 1FMD1 4MZUA 3NJVA 1Q43A 2I45A 3VBHC 4AQ2A 4UFHA 4XFAA 2VOKA 3I7DA 1VRH1 1ZRFA 1D4M3 3PEGA 2OQ7A 1RUF2 3FUQA 3LWCA 1ODNA 1Y9GA 4WZCA 4KGQA 4RR3B 3W20A 1RINA 1ZRRA 1C57A 4A4AA 5I93A 1BMV2 2HKXA 5HV0A 1ZRCA 4H7MA 4AGGA 4YGCA 2VQ0A 1NE6A 3B7NA 5EXOA 1W3XA 3S6PA 1DU3D 4PT6A 4A3XA 4G9SB 4LIVA 2YC0A 1PMJX 5SV5A 3V65A 4D0QA 4YM1A 3PNAA 4QHBA 4CYDA 1A8MA 1NY72 2RM23 4RR3C 2ET7A 5DG1A 3C7HA 3U14A 5CEHA 3G6JB 3HWJA 3AB0A 3WW3A 1D4M2 4TLGA 4YPJA 1YWKA 2DVAA 1R081 2XPJA 2ZPXA 2CY6A 1PIV1 1EAH1 3D82A 4XZPA 4OI2A 4O7XA 4LE3A 2J1UA 4YFWA 4YW1A 1I1EA 2BYVE 4CRQA 2LS6A 1AX0A 3DV8A 5F9TA 1GWKA 2R30A 3PUHA 4DFSA 3C7GA 2E32A 1BK0A 3U4XA 3UJOA 3LEGA 3POBA 1FAYA 2Y6FA 1VLNA 2QQNA 3ZSMA 3LDKA 5JXIA 4BB3A 3I2FA 5HXMA 2JDPA 3M3CA 1TZOA 4K1YA 5DUVA 3SQOA 4XFCA 3NQHA 4OI1A 4KWJA 5KC6A 2NYYA 3B74A 2RM22 3MPBA 4XHXA 2DTYA 3ZYBA 2RS31 4K9SA 1LAJA 3GHNA 2VC9A 4BPZA 1MVEA 3OSDA 5K0UA 3PUAA 3RQ0A 3T0AA 4XUTA 4FFIA 3PVBB 4GMP1 4DNYA 1V00A 1SLAA 2VVEA 3B00A 2DWRA 2PHUA 4ZKTB 2GMMA 4PI0A 5IUQA 3C2UA 1IPKA 1HB1A 4MXWA 1YC61 1Q3EA 5JXJA 4OI4A 1XNDA 5IVCA 2CV6A 3N7KA 2EXJA 1MEC1 2BVBA 1H0BA 2Q5TA 5D8AA 5FZ4A 4QM8A 3SISA 3X29B 1NCRA 1U5XA 2R073 4QXHA 1UY0A 2WQZC 4HSLA 1JYVA 1VPHA 1WKYA 2ZKNA 4PI2A 5GLUA 4B1LA 4XXAA 3AMQA 5FBJA 5FXVA 1N1VA 2GH8A 1JZ4A 3O14A 1NQDA 1W8UA 5H9PA 5CISA 3M3IA 4HKOA 2ZA9A 5FZCA 5FMOS 5A7NA 1GICA 1CAUB 3QLQA 3RNSA 2VCMA 5IFTA 5FYHA 4K3UA 5BNPB 4KU8A 3T2OA 5A7QA 4AHYA 1FOD3 4LT5A 2PLV1 1UU5A 1WCKA 2ZKLA 1N1SA 4OHXA 2RMU3 4XEZA 2R072 2B42B 2YGMA 4XJWA 1RUH3 1VBD1 1AL23 1OLME 1PHMA 2YC4A 4GWIA 2XUMA 3AYEA 3H8XA 2DCZA 4FQ4A 4LQRA 1AYN3 4B4PA 2YDEA 2WDBA 2ILMA 3ZXEA 3OGRA 4M3CE 1CAWB 2W46A 4KWKA 2R041 3KSCA 3RI8A 3RI9A 4W50A 4HN1A 3NAPA 3RVHA 1NA1C 3BOWA 5BNPC 3DYPA 4XF1A 1N47A 1ZA7A 2JDYA 2P17A 3VBSC 1C8NA 1FI2A 1GNHA 2VW0A 5FZLA 4CDWA 1LENA 1GOHA 1PVC2 3JCIA 4QU2A 1VMHA 1GZWA 2WNVB 2V73A 2PXJA 2VW1A 3BOPA 4NOTA 4KH9A 3H8RA 2EIGA 3PL0A 1FOD2 3FMGA 4CU6A 4GWMA 4LXLA 5EYYA 4OCTA 4RYDA 2RMU2 2Y0IA 3B02A 1Q8QA 2YROA 4NWVA 1JYNA 2VTXA 2VCBA 3J8F1 1RUH2 1W6OA 4LKEA 1SPPA 1RUG3 1AL22 5BV6A 1AF9A 2ZZQA 1PIV3 1HV1A 1AYN2 2DCKA 4H3WA 1CESA 2ATFA 3WDWA 3A0NA 3QH7A 2Z5WA 1U5ZA 2WNVC 4XOGA 5CKMA 5G04L 3TOJA 2BEOA 1UKGA 2WLPA 4H2AA 4CPBA 1OPOA 2QDNA 3LIHA 4CDQB 3O1RA 1HRI1 1H1MA 1MS4A 1Z78A 2GC3A 2R1DA 3AP9A 3H50A 3IAQA 3K77A 4Q0SA 1X7NA 4Y5SA 1RC6A 3ZKYA 4BISA 4BOWA 1H1IA 4Q8KA 1WLTA 2VZVA 5DQ0A 2Q8DA 1VJ2A 4JKMA 2Y33A 4AEDC 1GYKA 5FZMA 4D7SA 2JG8A 3HNMA 1SMVA 1UX6A 4C91A 5K0UB 1YRZA 4XFGA 3O0XA 1JYCA 1K12A 4LBQD 4Y3OA 3WDYA 1RUG2 1YO8A 3RG0A 2JB4A 1YFYA 3AM2A 4COVA 2XQRA 4HONA 3DKQA 5LATA 4XETA 5FYMA 1XOYA 2WZR1 2X53S 3O5SA 2G9GA 5AC91 3TEZA 3IMNA 3ZDVA 1RITA 1HLCA 5E88A 2X10A 3LA7A 4HVOA 5LA1A 3K4ZA 5BNNB 4XTPA 1K42A 2NP0A 4XAAA 1FNZA 2VZPA 5LK7B 1OSGA 3PIGA 4UW4A 1Z7S1 4EN0A 2MNGA 1MZEA 4XFHA 3UK9A 4AHZA 2C9AA 1EYBA 2CGPA 3ZM8A 3UKNA 4AVTA 1YQ8A 2WNUC 2L9LA 4TZDA 2VMCA 3GZUC 5A3UA 5A3TA 1C8M1 1RYYA 2W1QA 4CCOA 4P9XA 3ZXLA 4QQ2A 1DBNA 1REDA 4QPWA 1W9WA 5GALA 2ZMLA 5LBCA 4OULA 5JVVA 2VZ3A 5BNNC 3N9QA 4QPGA 3FFZA 3QCWA 3AMPA 5FKBA 2J1SA 3KB5A 1IS6A 2BWAA 3C3VA 3J7MA 4PHZA 2VMHA 4XACA 3W5MA 2ENRA 3FBMA 1HN0A 4NRPA 1GBGA 3UNPA 3KWVA 1A6CA 4CDXC 5FR3A 4C0HA 4BQ4A 2AZ5A 4V2VA 2WR9A 4GZ9A 3ZYRA 4M8ZA 3BKZA 2GC0A 1O6UA 3ZXKA 1TMF1 4CUGA 4D6QA 3NJZA 3ZN5A 2QNKA 2VJXA 2E7AA 4JDNA 5E8AA 2B5HA 1H6XA 1SLTA 4KNCA 4LPLA 3K4DA 4HMZA 3GYDA 3NAPB 1JZ2A 3L2HA 2VZOA 5FZIA 4TXWA 4IEZA 4XDOA 1ENXA 3D8CA 5KHIA 5IFPA 4O65A 5JSOA 1O5UA 2AEYA 1GUIA 1LEMA 4WM7A 1UYXA 1XXNA 2P1BA 4B3NA 3BTZA 3S5AA 3LOBA 3E6BA 4ZU4A 2FZ2A 4LA3A 2CGNA 4BZ4A 1OQDA 1DGLA 5GLWA 1MQTB 4LJHA 3T2PA 1LHOA 3OGSA 1Q8SA 4GALA 4EWDA 1AZDA 2HYXA 3USUB 4L9BA 2D44A 1HB3A 5DUUA 2HYKA 2ZX3A 4D3WA 1C5HA 2W1UA 2VVFA 5DAPA 4QQLA 5FYUA 3VHRA 3GBGA 5L19A 4F83A 3AXEA 1VBC3 3IDCB 2P3JA 2XVGA 5C33A 1R64A 4P00B 1V70A 4KQ7A 4BLIA 1RHI3 1NT0A 2FDKA 3JU9A 1RUI1 5KXDA 3ASIA 3T08A 2WA4A 2DBNA 5T5JA 3PIJA 3WNLA 5JDBA 1MQTC 5JOWA 2VNGA 4HK9A 5CFCA 3ZFEA 4GH4A 1PVXA 1PK6B 4AF9A 4C0BA 2W39A 1W0PA 4PF5A 4QX2A 3VGIA 1D2QA 2A73B 2FDFA 4LHLA 5T52A 2VQTA 3I3EA 5C3SA 5LWBA 1JMUB 4QGMA 4QPIA 4YWAA 1HDKA 3KQ4B 1WW7A 4QDSA 3DUIA 4EN6B 1AX1A 3JQWA 1B35A 2NMOA 4E4DX 1H2KA 4WM8B 3H1MA 3JBG1 1VBC2 2DFBA 1UZ0A 3JB8A 3WT3A 4M3CF 2BU9A 3GBFA 1QJX1 2WO2A 4IEYA 4DRVA 1PK6C 5JOXA 1RHI2 4INDA 4YVWA 1NLRA 2JKXA 2E7TA 1UQXA 2Y38A 2XL9A 2D6PA 1OD3A 3EXUA 5LA9A 1REFA 3RZJA 1PGL2 3WHUA 1HXS3 3WW4A 2VMIA 4A2UA 3K3NA 4Q0QA 1YFWA 5D21A 1DZQA 1YQ6A 5BNOB 4PDWA 1QJU2 3TEXA 4FFHA 1OHFA 1XSRA 1YHFA 2ZX0A 1OQ1A 4WM8C 5FK7A 5FOBB 2XONA 3MHZA 3Q8BA 3U0ZA 4S2FA 1A78A 3LB9A 4LUKA 3TAYA 4EWEA 4GJZA 1ZRIA 3H7YA 5EYXA 4ZZ8A 3DCQA 4XBNA 2ARXA 2VTFA 3W5NA 4QAWA 5CFDB 4YARA 1XE8A 5FZ0A 3AP6A 4SBVA 4Y1XA 4RQPB 3ZFGB 1KDKA 1HKDA 5BNOC 3I97A 3U75A 3U4SA 2VULA 4BJ0A 2HWB1 1HXS2 1R5LA 2AYHA 4GD4A 3WNOA 4P9JA 2VXJA 3ACGA 4BQWA 4CJ6A 3MI8A 5FY7A 4LE4A 4QX5A 1AYM1 1ZM1A 2D6OX 2YY1A 4NIAA 4D7TA 4FMMA 1R1ZA 2B8MA 2I74A 4QB6A 4AI0A 2QQIA 3VDDA 1N3QA 2IXIA 3PTRB 1PMHX 1WD3A 2WWUA 4M01A 3KT4A 3I2KA 3F95A 2DUOA 3LEMA 1SHWB 1FV2A 2EIEA 3ZFGC 5I8YA 4R9BA 4CCDA 1HW5A 1EV13 5C8CB 5A3NA 1AR61 1HV0A 1FMD3 3WF0A 4E4HA 2C5DA 2E9QA 4XYXA 4Y33A 4AG4A 3Q8CA 3WQ1A 3ZYIB 3Q8EA 2D7FA 1V6LA 4JTNA 1LGNA 1X50A 2IUWA 3I3DA 4XFBA 3VD5A 3OUHA 2A6ZA 4NE9A 5FY0A 2OS2A 2AUYA 4EE2A 1VBB1 3TB0A 3WR0A 4MOAA 1KFXL 5FZ8A 5C4WA 4FAHA 1UMIA 2VD7A 1UZZA 2A3WA 5IVBA 1JXNA 5CZKA 4Z92B 2ZMNA 4YGBA 1D7PM 5F39A 4M0NA 5FY8A 5C8CC 1X33A 3ITQA 4UW6A 2QQOA 4X6QB 5JXHA 4YVSC 1WD4A 1S0CA 3PHMA 4ES9A 2ZGRA 1JOPA 4AGVA 3E5UA 3L9JT 2W1SA 2Q8OA 1EV12 4NHKA 4DMIA 5CBLA 3OBTA 5C70A 5DMYA 4CP2A 1IKQA 2NN8A 4BQ1A 1R1A3 4IEXA 3SH5A 4CDUA 1GZCA 3OD0A 1LGCA 1FT9A 4AEKA 3VBUC 3AX4A 4OHVA 4GKXA 2ZHNA 4NIIA 4ARXA 3D0SA 3THTA 1FATA 2K2SA 4GQ7A 4ISQA 1N3OA 3ACFA 1HB4A 2DTWA 1G6NA 1OI6A 2UY9A 3KMHA 4JX0A 5T5LA 4CEWA 1DZRA 1HN1A 3UT0A 5ANQA 4K20A 1US2A 5T54A 4L11A 4I3PA 1S0BA 3FN9A 4I3GA 5LBEA 3DXTA 1RUJ1 5A6YA 2ZMKA 1T6GC 5A1FA 2WWJA 5CIRA 1JUIA 2VAUA 1OKQA 5A6XA 3H3LA 5T3NA 4YVWB 3JUUA 2K9ZA 3LKJA 4EZ4A 4GMP0 3O1SA 2G19A 3A21A 5IK8A 4OHYA 3FHAA 4J7PA 1LU1A 1R1A2 2H6BA 1WCQA 2ZJCA 3R4DB 4WBBA 3WF2A 5J37A 3VBOB 1IHMA 2VQAA 4EZHA 4AQSA 3LE0A 5J48A 3M1HA 5FP3A 3DN7A 4NPLA 2AEZA 3UGGA 4P5YA 1GZTA 2ET1A 1W8TA 1GR3A 3AKTA 2Q8EA 4PIXA 2XBO3 1DGWX 2BJSA 2WT1A 1UCXA 1OA4A 4XQDA 3VBFA 2G9FA 4U36A 3SXWA 4OMKA 1EPZA 1EUUA 1GV9A 1RIRA 3V0BA 1E5HA 4UW5A 4Q4Y3 3VBOC 1J3PA 1MS9A 3S7IA 2BOIA 1CWPA 2P2KA 1S0DA 4TN7A 1RMU1 5GLTA 5IWFA 3TNPB 5GLZA 4AAPA 4M0HA 1PZ9A 2C26A 3GZEA 3VN4A 3ZFFA 1SDDB 5H9QA 2VUCA 3AK0A 3AKSA 1ND3A 4M4PA 1SLIA 4N8MA 3RYPA 1NZCA 5EJ3A 1W04A 4DY5A 3VDCA 1YI9A 2WFF3 1C28A 1XYPA 2QTWB 2HJIA 5I0DA 4BQYA 5IVFA 4QX0A 4MHRA 3ROUA 2XBO2 5GZCA 5T5PA 4EROA 4TWTA 2VQUA 3IIAA 5FREA 1F35A 4Q4X1 4N53B 4NRMA 2ID4A 3ZR5A 4Q4Y2 2A3YA 2GU9A 2Q30A 3AL6A 4FPEA 3I2DA 5ABJC 4OQ8A 3OUIA 3ETPA 1DLCA 2CAVA 4I0WB 4CVUA 1OQEA 2BERA 4QGNA 1UMHA 4KGGA 2JDHA 4CPBD 3VZMA 3BB6A 1LKNA 4OMDA 1G9FA 2BVVA 3ZSJA 2PHLA 1CX4A 4W4ZA 2GP5A 2VG9A 2WFF2 4QXBA 4FOVA 4LO5B 2VNRA 2E7QA 3VLBB 5C3PA 4HSJA 1JZ7A 2E63A 3CJIB 3BCWA 4ZONA 4RR3A 3WQ0A 3E5QA 1WGPA 1NAEA 1UXXX 2VNOA 1NOVA 3NJYA 3SHRA 1X9PA 4WVMB 1H6YA 2WT0A 4QKFA 3NV4A 2ZHLA 4CXXA 4XF4A 3MYXA 4P9LA 2G4IA 3B7MA 3IIIA 1DG6A 2A3XA 4FOWA 2OVUA 1DLLA 1E5SA 5FZ9A 3AZZA 1BEV3 3P3PA 5FXWA 5FWJA 1AR73 3BALA 3HIFA 4NHLA 5KHGA 3W58A 1BBT1 3MW3A 2XKPA 4P08A 5C9AB 1AR93 2JD9A 1UAIA 5LK5A 2P6CA 3HT1A 4IESA 1UY3A 4DXZA 2RHPA 3KS7A 2OT7A 5E1RA 2Y8KA 4LULA 3POFA 1ASJ3 1JHNA 5KHJA 4P9GA 3LIGA 1OC1A 3WP3A 1QNYA 5FCCA 1PZ8A 5FLJA 1REEA 3KCXA 2YG0A 4J25A 4LA2A 3VD4A 4YG6A 3CQOA 4NPRA 4FO9A 1F5JA 2DF7A 2PHXA 3LF7A 2VW2A 4A6SA 1LESA 2CTVA 4META 1GANA 2F6BA 1KJRA 1BEV2 1QJY3 3BGAA 1AR72 1GP5A 1QY4A 4RL7A 3WDVA 5GJ6A 2CAUA 1AR92 4HFSA 1WLCA 2EVXA 4AFCA 3MUY1 2R0HA 1QQP1 3V0BB 2GMEA 4ONUA 1DDLA 2WS93 2WQ4A 3MICA 4F3JA 1ASJ2 4IERA 4MGKE 4ZXKA 5A6QA 1W3VA 3KGZA 3A7QA 5SV8A 3PUIA 5FO9B 4Y4YA 1TE1B 1SZBA 5DDJ2 1JOBA 1N1TA 1UOFA 3B9IA 4YW6A 4QKDA 4FFFA 2Z4FA 1BJQA 4XZUG 2WKKA 3T0BA 1DIWA 1UXZA 2HWC1 2JD4A 4BMEA 3HQUA 2E2XA 5KXCA 3LD8A 3VHPA 1ZZ6A 4QX3A 5FXZA 2GC2A 3CL1A 2DDUA 3NKTA 4ET7A 4BA6A 5JLVA 1LNSA 3VL8A 5J3UA 2Y60A 4P9IA 3VBHB 5I0SA 1BXHA 2JE8A 3KCCA 4XUPA 2MPFA 4FPHA 2WS92 3NNMA 3WNPA 3K51A 4Q4V3 3B01A 3MLJA 4K1ZA 2ETEA 3VZOA 2JICA 2DUPA 3CNAA 4MHUA 1W90A 3TBDA 1PO13 2HWF3 1LOBA 4NRQA 3ZOIA 4XBQA 4JQRA 4DQAA 3CJXA 1CAUA 3P5BA 3ACLA 2WYSA 1RUD3 1Q8PA 2W2IA 3LA2A 4JKKA 5BNPA 1BYHA 3ATGA 3V0AA 3OYWB 3AYCA 3GF6A 3LFIA 4NIGA 4JHZA 3MFCA 3IZOA 3MGUA 3S7EA 3VKLA 5JPMB 3OUJA 1W6QB 2PYTA 2JIJA 4K8RB 2P4EA 2B9VA 1NLSA 4A7KA 2RS52 5FYSA 2RR13 2JG9B 1W99A 5FZ1A 2WFPA 2LALA 4Q4V2 3MF6A 1CAWA 4N7IA 1PVC1 3FX3A 4MX3A 2VY0A 1RTVA 3RZKA 4E2GA 1PO12 2HWF2 4M00A 2D40A 3CLPA 1W05A 1JN2P 1XRUA 1HJGA 1RUC3 2KR2A 2WNVA 1RUD2 3UGHA 1O4TA 3WF1A 5CKNA 3IBMA 1NG0A 2BW8A 2WO7A 1V6NA 4ARYA 1DGRA 1YJLA 2OX0A 1H2MA 2JG9C 1ND2B 3EQEA 4QDQA 5D2AA 3O0WA 3OBRA 4CXYA 1G7YA 1T6BX 3N9NA 2YPJA 4UYBA 5ERLA 3OOXA 1KJLA 2BDRA 4QKNA 5FY5A 3SKJE 4FSJA 1J84A 3KLSA 5GZDA 1C4RA 3HT2A 2RR12 3MIFA 4MADA 2VZUA 1GZ9A 1G9AA 1LJ7A 1QOSA 2G1MA 3HVDA 1BQPA 3ZSKA 3O1PA 4ITCA 3S57A 5JIAA 1ONAA 2WSUA 4XXPA 2JDAA 4AR2A 1H30A 4CCMA 1JBCA 2NQYA 4AWDA 4CDQA 5EQUA 4PCRA 3SLIA 4EN9B 1ZBA1 2Z79A 4GB31 3W59A 2D3PA 3AJZA 4JQTA 1AR81 1ND2C 1NYWA 1RUC2 2C24A 1I5PA 2XJRA 3HN3A 3Q9OA 4C1WA 1QIQA 2QFEA 4KG0A 2B7YA 2FCUA 3C7FA 4Q2FA 4WV8A 5ACA1 1O8SA 1VB4A 4YNIA 2P34A 1JI6A 3POEA 4PLMA 1JZ5A 4IE7A 5K4LA 4B4QA 2WNUA 2XHNA 4L99A 1WCSA 2XJUA 4R8HA 3HJRA 4ZPIA 2UY8A 2VR4A 3E6DA 2WO1A 4FTBA 3B69A 3ZR6A 3KF5A 1R093 3PVNA 4OVEA 4W65A 2YFZA 4AGRA 4NROA 1DYKA 2ZGPA 3ETQA 2DURA 5E89A 3H3UA 3W21A 5BNNA 1YYNA 3ZVXA 3ZPOA 3N3HA 3K3OA 1YQ5A 2QQPA 4K8FA 1OD5A 2VH9A 4IEWA 5B4XA 5LZ6A 1GQHA 4ISRA 3QBQA 5DAXA 5F8PA 3POYA 2W1WA 4LOTA 3WP5A 4YSFA 1D0HA 1MS5A 1FYUA 5FZ3A 2DVBA 5FUIA 3VBRC 3D6EA 1D4VB 3IN9A 3JD73 1ZZ9A 4MGYE 5FZOB 1VAVA 3RYKA 2J1VA 2WYFA 3VZJA 2ZACA 2GALA 4LHNA 5C71A 2IXJA 2BNMA 3HOBA 1Y9MA 1NXD1 3VUOA 4KU7A 4HETA 1E5IA 3DPRC 4QPYA 5FV3A 2RS11 4Z8BA 2ZEWA 4FOYA 5FYCA 4Q0VA 4Q0PA 4EYUA 1PGW2 1WW5A 2P37A 4M4RA 1R092 4IEOA 5IK7A 4LLOA 1WMXA 4XJUA 4AFAA 4HBNA 1NA1B 2WIIB 4BQ3A 5B4NA 3N4MA 3V0AB 1UO9A 3V64A 2YUEA 4QHOA
chains in the Genus database with same CATH topology
1O6UA 3Q8GA 3P7ZA 5LZ6A 3B74A 4CJ6A 3PG7A 3HX3A 1OLME 3PEGA 4FMMA 4TLGA 1OIZA 1AUAA 4UYBA 4OMKA 4J7QA 1OLMA 2D4QA 3B7ZA 3HY5A 3B7NA 3W67A 1OIPA 4J7PA 3W68A 1R5LA 4CIZA 4OMJA 4M8ZA 2E2XA 3B7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O6U A;  3Q8G A;  3P7Z A;  5LZ6 A;  3B74 A;  4CJ6 A;  3PG7 A;  3HX3 A;  1OLM E;  3PEG A;  4FMM A;  4TLG A;  1OIZ A;  1AUA A;  4UYB A;  4OMK A;  4J7Q A;  1OLM A;  2D4Q A;  3B7Z A;  3HY5 A;  3B7N A;  3W67 A;  1OIP A;  4J7P A;  3W68 A;  1R5L A;  4CIZ A;  4OMJ A;  4M8Z A;  2E2X A;  3B7Q A; 
#chains in the Genus database with same CATH topology
 1BZW A;  4FBF A;  3WQ7 A;  4N43 C;  2AAC A;  3MUZ 1;  1GFF 2;  3UKV A;  1VRH 3;  4XIK A;  1M06 G;  4Z82 A;  2XH6 A;  2YZ4 A;  2D3S A;  3OPW A;  4XJZ A;  2CYF A;  3KQR A;  1DQ2 A;  1DFQ A;  5F3G A;  3JD7 2;  1OVS A;  3ZSL A;  1U5Y A;  2IXC A;  4YGD A;  4JHT A;  4D7Y A;  5T55 A;  4AW7 A;  2PAM A;  2CDO A;  4COY A;  4ES8 A;  3AMN A;  1C5I A;  2DVG A;  1SCS A;  1AUY A;  3E97 A;  1X8E A;  4LEJ A;  2OQ6 A;  2A71 A;  2PFW A;  5FZ7 A;  3TYJ A;  5I91 A;  5IK5 A;  2WZP P;  2C6S A;  1FMD 2;  4IV3 C;  1A8D A;  2JX9 A;  3WIN E;  5E6H A;  1VAM A;  5FP7 A;  5CG8 A;  4QKB A;  3WNN A;  4FT8 A;  1VRH 2;  1SBF A;  2YGL A;  5JOZ A;  2A6X A;  1MQT A;  4AEM A;  1GNZ A;  1R08 3;  1V6O A;  5FY4 A;  3USU A;  2V72 A;  1H9P A;  2H0V A;  1EAH 3;  5GZF A;  2ZGL A;  4AED B;  3WP6 A;  5C5T A;  1FV3 A;  5TSW A;  1VBA 1;  2R6Q A;  1TME 1;  2W92 A;  2EF6 A;  3SH4 A;  2GND A;  1MZ5 A;  3DYO A;  2BTV C;  4DRR A;  4EJR A;  1ZBE 1;  3D4K A;  2GN7 A;  5FYB A;  4OMJ A;  4CCK A;  1PMI A;  4UWD A;  4LK7 A;  3BPZ A;  2J1E A;  4Y5T A;  2D93 A;  5FOJ B;  2A1X A;  4PQ9 A;  1O3T A;  2ZBJ A;  3SCG A;  3PVE A;  4E4S A;  1GLH A;  1PK6 A;  2RS3 3;  5IVV A;  5FUN A;  5DN2 A;  4COW A;  1R08 2;  2WNU B;  4GMP 3;  4S2D A;  1PIV 2;  1EAH 2;  3H1Y A;  2NZ9 A;  3BIW E;  5I0R A;  5JOY A;  1U12 A;  4R9D A;  5GM0 A;  1JYT A;  4YW7 A;  1YQC A;  4WM8 A;  4IV1 B;  5J96 B;  4RGA A;  2DFC A;  2QQW A;  1MEC 3;  4JDO A;  2C0Z A;  4L0P A;  4HKL A;  3WDT A;  4DEV A;  1BK1 A;  1U5I A;  3R4U A;  5FMC A;  3HMY A;  2X8K A;  4XQ4 A;  5FMB A;  3TRS B;  4H7L A;  2GC1 A;  1CIW A;  2HWE 1;  4CDX B;  2P3Y A;  3D5O A;  4R4X A;  3IKW A;  3OPT A;  1CIY A;  3P1I A;  4FCA A;  2ZXQ A;  1W9F A;  5FPB A;  5C3O A;  2W08 A;  4KWL A;  2WL1 A;  5BNO A;  2ZGM A;  1UY4 A;  4UAP A;  2OYZ A;  1EUT A;  4IV1 C;  1JU4 A;  4FPJ A;  4CEY B;  2J1R A;  1RVF 1;  2O8O A;  1COV 1;  3OJB A;  4PBP A;  2JEC A;  3AMH A;  3EYP A;  5CB7 A;  2OA2 A;  4FP3 A;  4RA0 A;  1CQ9 A;  3OD4 A;  1PGS A;  5LB6 A;  1W6P B;  4P9Y A;  1MEC 2;  2UU8 A;  5CFD A;  3VDB A;  1XJA A;  2PLV 3;  4LK6 A;  4DY3 A;  1MPX A;  4PLN A;  1TNR A;  4RQP A;  1AXY A;  1S0I A;  3APB A;  1UYZ A;  4QM9 A;  1H4H A;  1QJZ A;  4MO3 M;  4UFL A;  3ZFG A;  4G3Y C;  4TYS A;  2A6Y A;  2DCJ A;  2YBK A;  4AVV A;  4DZG A;  1QEX A;  2W9X A;  5LY1 A;  1UYP A;  1VBD 3;  5L36 A;  2WUH A;  2SLI A;  4CEY C;  1OOP B;  2X05 A;  4BH9 A;  1X9T A;  2BWC A;  1AJO A;  1DCS A;  2XML A;  2WA3 A;  4CCC A;  2HWD 1;  2ZX1 A;  2JXA A;  2R04 3;  4XTM A;  5L7O C;  1WUV A;  2HBT A;  2W95 A;  5F3E A;  1X82 A;  4XJ9 A;  4KMQ A;  5E16 A;  5EHD A;  4BM8 A;  3MBW A;  4OI0 A;  2FMY A;  1F8V A;  3FBY A;  4K6B A;  1ZRE A;  1APN A;  2J1A A;  1GP6 A;  2V09 A;  2GP3 A;  5C8C A;  2XXZ A;  1OLR A;  3LCP A;  1W2N A;  1CZT A;  2PLV 2;  1XU2 A;  3T2Q A;  1OOP C;  5J36 A;  2HEY F;  1J1L A;  2VZQ A;  4MLO A;  2VBD A;  3WDU A;  4LHS A;  4E9K A;  5BNQ A;  2Y6L A;  1VBE 1;  2RJL A;  2O8Q A;  1HQW A;  2PAE A;  2A6W A;  2DYC A;  3J8F 3;  1VBD 2;  4LBO A;  1UU6 A;  4QB1 A;  1IZ3 A;  4BCU A;  2ZHK A;  3UGF A;  5FRA A;  1PX3 A;  3HD8 B;  3K48 A;  3N9P A;  1I5Z A;  2XB6 C;  2YC2 A;  1MS8 A;  3N7M A;  3WD5 A;  3GZT B;  3VBU A;  3ZN6 B;  2R04 2;  2FDJ A;  2R06 1;  3AVS A;  3MIH A;  5F1R A;  3ZYG A;  3LSE A;  1HRI 3;  4EN8 B;  2JWP A;  2P3K A;  1Y7B A;  5A6Z A;  2YV8 A;  3O1M A;  2OPK A;  3OBZ A;  1XNC A;  1XYO A;  2BNN A;  3ZYJ B;  5LA0 A;  1FNY A;  3FHI B;  3TWI A;  4NHY A;  1LHU A;  2G9Z A;  4KG8 A;  2VXR A;  2FDG A;  1QJF A;  4UI9 L;  5FQ0 B;  1BKZ A;  1H9W A;  3T1M A;  4CDW C;  2D6K A;  2UWC A;  3J8F 2;  4XPV A;  2ZGN A;  4DPN A;  3WP4 A;  2CHH A;  3E1F 1;  1OXC A;  4OQ9 A;  5JSP A;  5LBB A;  3VHO A;  1MR5 A;  4CCE A;  5LRS A;  1GSL A;  2WZR 3;  1TG7 A;  4W8J A;  5FXX A;  1OH4 A;  5AC9 3;  1OPM A;  1XB9 A;  4X8P A;  1JS9 A;  4Y1V A;  3MZH A;  5FZA A;  1W6N B;  5DZE A;  3CKH A;  3WUD A;  1HRI 2;  1OF4 A;  3ES1 A;  4AEJ A;  4BLJ A;  3ALQ A;  4URT A;  1Z7S 3;  2CL2 A;  3I54 A;  4CCN A;  2VPV A;  1WCD J;  4LO6 B;  4AZZ A;  4B4R A;  3GM8 A;  3GCX A;  3D0J A;  5DXD A;  4XIL A;  2W52 A;  2WRA A;  3WEZ A;  4XVH A;  3VBO A;  1C8M 3;  4XIO A;  5FPX A;  1RUE 1;  2Q4S A;  4P5H A;  4JCK A;  1W9Y A;  4BHP A;  2ZAA A;  5KXB A;  5FZK A;  5CG9 A;  2WZR 2;  3PU8 A;  5AC9 2;  2PHT A;  4C90 A;  5KR7 A;  2JDN A;  3B93 A;  3R4S A;  4CZS A;  1PNG A;  1ALY A;  4MGZ E;  2MEV 1;  4OUS A;  2JG8 C;  4RHV 1;  3S30 A;  3CIH A;  5LEK A;  4WZF A;  3B7Z A;  1K5J A;  4IUG A;  3DGT A;  2OZJ A;  4DUX A;  5DPN A;  2XG3 A;  5I8T A;  3T4H B;  5A1A A;  1Z7S 2;  3OEA A;  4BMB A;  3IPV B;  3MEP A;  1XYN A;  3KGL A;  3BN6 A;  4XUN A;  1TMF 3;  2VZ1 A;  4OUE A;  1CAV B;  3T09 A;  3LQC A;  1HRV 1;  5ANN A;  1C8M 2;  1A3K A;  4X8N A;  3HX3 A;  5ISL A;  4A7Y A;  5ABJ A;  4XUQ A;  3THP A;  1QH7 A;  1O3R A;  1W0O A;  1H2N A;  3OPZ A;  1Y4W A;  3FLP A;  3QH6 A;  2F4P A;  1LHW A;  3WF3 A;  4L97 A;  1OUS A;  1OLM A;  1Q56 A;  4YW3 A;  5LEJ A;  1GOG A;  4A45 A;  1XNK A;  1CJD A;  3U78 A;  4OHZ A;  1JUH A;  3EO6 A;  4L2N A;  1BVP 1;  3AP7 A;  3H1W A;  4M3C A;  1LGB A;  4N53 A;  4XJA A;  4Y1Z A;  2IC1 A;  2ARE A;  2UYB A;  2F17 A;  2YFU A;  1DQ6 A;  3ACH A;  4YVS B;  4AQT A;  4COZ A;  5BYN A;  2W47 A;  5DZG A;  1KD7 A;  1ULP A;  2VME A;  3N9L A;  3Q8G A;  1QDC A;  1TMF 2;  2WO3 A;  4PBO A;  3JXS A;  1F9K A;  1PO2 1;  3U1X A;  2H6C A;  3AZY A;  1OT5 A;  1LOD A;  1WWY A;  1L3J A;  1NQJ A;  1W8N A;  2W0X A;  3T1L A;  3VBU B;  1CR7 A;  1DYP A;  1LU2 A;  1HQL A;  4I09 A;  4F7Z A;  1YUD A;  4IW3 A;  2ARA A;  3UKT A;  4COU A;  3CMG A;  2JDK A;  4PIZ A;  3CJI A;  3IT8 A;  1RUI 3;  3R05 A;  1A34 A;  1IG0 A;  1VR3 A;  1KRI A;  1JHJ A;  4S2H A;  2WNE A;  1YXW A;  2UUR A;  4WVM A;  4YW2 A;  5GKA C;  2FDH A;  4AFB A;  3C7E A;  3ON7 A;  2FDI A;  4QWN A;  2XWB B;  3VKO A;  2Y26 A;  1FX5 A;  1BHG A;  1HQN A;  4JVA A;  2LUW A;  4OHW A;  2O0O A;  1VIW B;  5G05 L;  2NLR A;  2VBP A;  3EBR A;  4SLI A;  1UPS A;  1KDM A;  3OGG A;  5A32 A;  1DGR N;  1XE0 A;  3IAP A;  3OGV A;  5C9A A;  4LKF A;  3JBG 3;  2XKO A;  3KVA A;  1JOD A;  2A6V A;  1V9U 1;  2VCC A;  4I01 A;  2FHR A;  5EP9 A;  1QJX 3;  2VNV A;  4NVP A;  4PLO A;  5C3Q A;  3BU0 A;  3W67 A;  1RUI 2;  1HJF A;  2PHD A;  4UBG A;  4NIH A;  5IT6 A;  2K0G A;  5FZF A;  1CJP A;  3NW4 A;  4IL7 A;  1H8V A;  4A44 A;  1JW6 A;  5FUP A;  2BNO A;  3DYM A;  3CZJ A;  4ZXE A;  2XVL A;  4WVV A;  4IEP A;  2DVF A;  1MZ6 A;  1ULE A;  3FLT A;  5DAQ A;  4B1M A;  3I2O A;  3MV1 1;  1QDO A;  2XJP A;  4EWA A;  5AFB A;  1ZYB A;  2DU1 A;  1FPN 1;  1IGO A;  5FBZ A;  5EZW A;  1IQA A;  2RG4 A;  4YM2 A;  5A70 A;  2ZOE B;  3ZFE C;  4E27 A;  2W5F A;  1WA6 X;  3N35 A;  2GDF A;  3A0K A;  3I2J A;  3JBG 2;  4BK4 A;  3GZA A;  3KZ4 C;  5DDJ 1;  4CP9 B;  4Z2W A;  1QJX 2;  5FYV A;  3TN9 1;  1DZT A;  3WNK A;  1H1A A;  2IVJ A;  1CAX B;  4QPI C;  1I3H A;  2VUD A;  2EAL A;  4Q0U A;  4RFR B;  4QHZ A;  4HG6 B;  4CU7 A;  3O1T A;  5LW9 A;  3T0D A;  2HWB 3;  5L9R A;  3H3Z A;  1MAC A;  3IWZ A;  1VB2 A;  1AL0 G;  3I2H A;  3Q8F A;  3HBZ A;  4A3Z A;  4BXF A;  2VE1 A;  2KXL A;  3NNG A;  1GP4 A;  1PM7 A;  3NV2 A;  2RDQ A;  5ABJ B;  4D94 A;  2W91 A;  1ENQ A;  1AYM 3;  3PU3 A;  4BIO A;  5JAX A;  5LRR A;  5JCT A;  4KI5 M;  4UFM A;  2Q1Z B;  2FMD A;  2O1Q A;  1LUL A;  2JE9 A;  4MUV A;  3H0O A;  3VBH A;  3KF3 A;  1VMF A;  4M3C B;  4Q4W 1;  4OYU A;  5FPL A;  1AR6 3;  2V4A A;  4RS5 C;  3ZYF A;  2BRT A;  2LW8 A;  4AXO A;  4RD7 A;  3M3E A;  3OGJ A;  2WN2 A;  1C3H A;  2HWB 2;  2QBX A;  3DKW A;  3L2Y A;  3QD6 A;  4I0B A;  2WIN B;  5A7P A;  4F8A A;  4QQP A;  1VBB 3;  2HEV F;  5FZB A;  5APA A;  5FP8 A;  5CAZ A;  1RUN A;  1IPJ A;  3PG7 A;  3GAL A;  3S0M A;  1AYM 2;  3N7L A;  1RUF 1;  3OYW A;  4LBK A;  3UET A;  5CU1 A;  1PZ7 A;  1W2U A;  1W6Q A;  3MW4 A;  5FWE A;  2R0F A;  5CKQ A;  3M3Q A;  3ZN4 A;  1BMV 1;  2YXS A;  5FYT A;  2JG9 A;  3O1O A;  2EAK A;  4XF0 A;  1AR6 2;  3O1V A;  5KWR A;  3AZW A;  1KIT A;  3U10 A;  3H7J A;  1SAC A;  3NV1 A;  4LBN A;  1V6J A;  4YW5 A;  3TNQ A;  4Q5O A;  1KEX A;  5A3W A;  1OMI A;  3B5L B;  1NY7 1;  1VBB 2;  5DUW A;  4YGE A;  1U0A A;  3O12 A;  1Y3T A;  1YI7 A;  4XE9 A;  4JGZ B;  4B8E A;  3MDP A;  2A70 A;  2ZTN A;  1D4M 1;  2D5H A;  3ORJ A;  5A32 B;  2YYO A;  1YFU A;  3J4U H;  1CPM A;  4XCB A;  3ZMN A;  3NNF A;  1RUJ 3;  1V0A A;  1ND2 A;  4AVS A;  5H9S A;  4LBM A;  1PX4 A;  4YZ4 A;  3C8X A;  4UXA A;  4JKL A;  5FJH A;  3H9A A;  1IPS A;  5CNA A;  5C4W C;  1UU4 A;  1LED A;  2J7M A;  5JSR A;  2OUJ A;  2FZ1 A;  1DYO A;  2ZHM A;  5FY1 A;  2JEN A;  5BY5 A;  1IQD C;  2IXK A;  1W8Z A;  1Z0H A;  2AGS A;  3EJK A;  3UV9 A;  4JGZ C;  1E57 A;  5F37 A;  3I8T A;  3RSJ A;  4XDQ A;  1DP0 A;  1W9S A;  4JRL A;  1WW6 A;  2RM2 1;  4LLF A;  5BUV A;  2A75 A;  1SFY A;  3VHN A;  3HAG A;  4XAB A;  2D43 A;  3KV6 A;  1AUA A;  1PNF A;  1LOA A;  1SFP A;  4NAM A;  4QX7 A;  2DU0 A;  1RUJ 2;  1O8P A;  4UF0 B;  1LOF C;  2YU1 A;  3D3A A;  3RJR A;  5C6C A;  5JMC A;  4I2O A;  4YM3 A;  3NWK A;  3U07 A;  2XDV A;  1RJ8 A;  2W94 A;  2JIG A;  2VZR A;  1UY2 A;  4A6O A;  4IQP A;  3VD3 A;  4W6W A;  1RMU 3;  3OF1 A;  4E8D A;  1KS5 A;  4P14 A;  1OA3 A;  1YFX A;  4WVZ A;  5H9R A;  2AC1 A;  4RN5 A;  1KGY A;  2D3R A;  4CU8 A;  4ZZ5 A;  4KBZ A;  1S0G A;  3EHK A;  3KV9 A;  1WMF A;  4LMF A;  1MVQ A;  1K5M B;  2VL4 A;  2CNA A;  1QU0 A;  1QJY 2;  1T2X A;  1RL3 A;  3CDZ B;  2E26 A;  3GGL A;  4GIQ A;  1S55 A;  2ZEX A;  4AVB A;  1UOJ A;  5JZG B;  3K46 A;  1LTE A;  1WBL A;  3RMY A;  3ZIW A;  3CO2 A;  3BPS A;  1AVB A;  1UZY A;  3DEM A;  4Q4X 3;  4XW3 A;  1L7Q A;  4DXR A;  2Y6G A;  5FZO A;  2RVA A;  4IE0 A;  4QD2 A;  5FFO C;  5F2S A;  2VOT A;  1OF3 A;  3T2T A;  5LAS A;  3AFK A;  1RMU 2;  4DXS A;  3VD7 A;  5A80 A;  1K5M C;  3CBN A;  2JKB A;  3FE5 A;  3FWE A;  1FXZ A;  2B46 X;  2E53 A;  3ACI A;  4Y24 A;  3B7Q A;  4Q1R A;  3NST A;  4HOO A;  1CZV A;  2C1F A;  2PHR A;  1NA1 A;  2R07 1;  1S2E A;  1POQ A;  3UES A;  3BTY A;  5JZG C;  4EV0 A;  5EWS A;  4FTE A;  3VBS A;  1O7F A;  1YJK A;  4Y5Z 0;  4BDV B;  4QDR A;  2D5F A;  3J7N A;  3LA3 A;  2GH2 A;  2I07 B;  4OUM A;  4JV4 A;  5HCA A;  5DAB A;  4L8Q A;  4ZU5 A;  3ZFF C;  3WY6 A;  4NHM A;  4CSW A;  2Q1F A;  4FTS A;  1DQ0 A;  4YG3 A;  4B29 A;  4LTA A;  5JUV A;  5C3R A;  3UJQ A;  1ND3 C;  3SC7 X;  3SH3 A;  3POJ A;  2ZEZ A;  1W03 A;  4LO8 A;  4Q4X 2;  1OH3 A;  4OZX A;  1JH5 A;  4QQO A;  1NKG A;  3NNJ A;  2B4K A;  1K45 A;  2KA3 A;  3DXU A;  5B2G B;  5FYI A;  3RRD A;  2V5Y A;  1C1L A;  5DZF A;  2YBP A;  2D6M A;  2IXL A;  1IS3 A;  4JTO A;  4DXT A;  1FOD 1;  2P3I A;  1XNT A;  4ZY9 A;  1W8O A;  4DS0 A;  4XUO A;  1OKO A;  2RMU 1;  1W6M B;  2C9K A;  2VZS A;  2W68 A;  1BBT 3;  1RUH 1;  2J42 A;  1AL2 1;  4AE2 A;  4NHX A;  5EJ1 B;  4DIN B;  3P6B A;  2VOX A;  1AYN 1;  5EJZ B;  2X5I B;  1WLW A;  5F3C A;  3LEK A;  2XQX A;  5LA2 A;  3WW1 A;  1IG3 A;  2ZS6 B;  3PJY A;  4J1W A;  4AED A;  4P9W A;  2R16 A;  4J6G A;  3WG2 A;  3M4F A;  3U11 A;  2GSY A;  2VMF A;  2WAA A;  4IEU A;  3ZXJ A;  2IWG B;  3I2G A;  2D98 A;  3AKP A;  3MPP G;  4ATF A;  4BQ2 A;  4QGL A;  5A33 B;  4FVV A;  2Y6K A;  3FC0 A;  4X6R B;  2QQM A;  1BCX A;  3WDX A;  3RPQ A;  3P3N A;  3S5Q A;  4DEQ A;  5DAW A;  3ZXF A;  1UPI A;  2X5I C;  3A4U A;  5T50 A;  3USS A;  1HX6 A;  4BYY A;  4UW3 A;  2ZEY A;  4LKS A;  5T5O A;  1BBT 2;  4HPK A;  2XLA A;  1RUG 1;  3MIG A;  1UL9 A;  4N9I A;  1OIZ A;  5JI7 A;  1QQP 3;  1NCQ B;  2WQ8 A;  2XOM A;  3KT1 A;  4CP0 A;  1UWW A;  4IE4 A;  1DQ4 A;  4XJ8 A;  4LHK A;  3ZDS A;  1NX9 A;  1JU3 A;  5IHR A;  3W9A A;  3C7O A;  3G7D A;  5FP9 A;  3H8O A;  2PMW B;  2VO5 A;  2PQQ A;  3VBR B;  3I2I A;  1ULD A;  2Y6H A;  3I4I A;  2ZGT A;  2XHK A;  3ELN A;  1W28 A;  4IV1 A;  4GAZ A;  2QVS B;  3FJS A;  1YEW A;  1CZS A;  5BXX A;  1S1A A;  2HWC 3;  3DPR B;  4JGY B;  2RDN A;  4CP1 A;  4YZ2 A;  4V2W A;  2EAA A;  3ILN A;  1NCQ C;  2R32 A;  3IB3 A;  3ZPY A;  4CDQ C;  1GQP A;  3JZV A;  1SLC A;  1H8T B;  1W2T A;  5K8S A;  3KD4 A;  5F5C A;  5EIY B;  4LO4 B;  3QOP A;  3PDQ A;  4CDX A;  1IKP A;  4NUB A;  5CYY A;  4Y22 B;  2LTN A;  2EXH A;  1O3S A;  1VP6 A;  1QQP 2;  3HBK A;  3UYJ A;  4AVA A;  4YRD A;  4N43 B;  4WVW A;  2VOV A;  2BGP A;  2XJS A;  3PMS A;  1VAK A;  2D4Q A;  3HNB M;  3VL9 A;  5FLH A;  2IZW A;  1DF0 A;  4JC1 A;  4JGY C;  5FYZ A;  1OLQ A;  4CEY A;  1J58 A;  1YIF A;  3OY8 B;  3WNM A;  1W2O A;  3NNL A;  2EXI A;  1DQ5 A;  4CA9 A;  1RUO A;  1H8T C;  3TEW A;  3K2O A;  2HWC 2;  5L7O A;  1OA2 A;  1W6P A;  3T4V A;  3ZYH A;  2RDR A;  1JTZ X;  2PAK A;  3RZZ A;  5A7W B;  3ZO0 B;  3KCY A;  3WX5 A;  4IV3 B;  4UBH A;  1XQN A;  4Y20 B;  3CHX A;  1LHV A;  1OOP A;  4XC9 A;  3WNX A;  2RJ2 A;  3MW2 A;  1VE0 A;  4QU1 A;  2ZGU A;  1QGL A;  3CU7 A;  4CU9 A;  2VTX J;  3ILF A;  1PVC 3;  3RDI A;  3BYW A;  2CDP A;  2OPW A;  3LOI A;  1JZ8 A;  3RZM A;  1QJE A;  3M8L A;  1RJ7 A;  4LO7 A;  3E6C C;  3ME2 A;  1EPW A;  1B09 A;  2CWM A;  1VRB A;  5FPV A;  3OCP A;  4AFD A;  5FZH A;  3HNY M;  4ZS2 A;  4R4Z A;  5FK8 A;  1AHS A;  4AYU A;  5A3L A;  3RZG A;  1NUK A;  3FUO A;  5BPX A;  1V6K A;  4TSV A;  1G9D A;  4BIF A;  3WG3 A;  2I2S A;  3EB7 A;  5LCW L;  1Q8O A;  1POV 0;  2BFU L;  4FXG B;  4FPF A;  2RDS A;  3FFQ A;  2XL7 A;  3AYA A;  1ZNP A;  1LB2 A;  1CX1 A;  4LOR A;  1XBF A;  1KQR A;  4CUC A;  4ZU7 A;  1JOJ A;  1ZX5 A;  2QZ2 A;  1F2N A;  4OLL A;  1N1Y A;  1XPW A;  5I8S A;  4BK5 A;  4C8D A;  2XVK A;  3E5X A;  4QX1 A;  4XBL A;  4E4Z A;  2QQV A;  4YZ5 A;  5AFE A;  2VUJ A;  3ZN6 A;  1KXG A;  2WAO A;  4XDP A;  1JYW A;  3RZL A;  1S0J A;  2ORX A;  3H42 B;  4UFK A;  2QJV A;  1SBE A;  5GLV A;  3VKM A;  1CON A;  2B45 X;  3AL5 A;  3DEC A;  2UWA A;  4NO4 A;  1D0G A;  1ZBA 3;  4GB3 3;  4D8M A;  1AR8 3;  1GKB A;  4NMI A;  1DGW A;  3LDB A;  4AK3 A;  4FAG A;  4ZHN A;  4LKD A;  4HPK B;  1OFN A;  5IJR A;  3HQR A;  1AX2 A;  1L7R A;  4IXL A;  2WC2 A;  1YQ2 A;  5ACA 3;  1Q8V A;  3JQX A;  2TEP A;  4P02 B;  5FQ0 A;  3FL7 A;  5JWP A;  2QQL A;  3T30 A;  1JZ3 A;  1J59 A;  3H8U A;  1GU3 A;  4H55 A;  3WOG A;  3ST7 A;  3OBA A;  3N7J A;  3THD A;  2PA7 A;  1VBC 1;  4FPL A;  1XNB A;  3HPN A;  4D6R A;  1OVP A;  5EV7 A;  3VZN A;  3RZH A;  2LRO A;  1RHI 1;  5J1X A;  2ZZJ A;  1TQ5 A;  1W6N A;  2HH9 A;  4B7E A;  3LPF A;  4PF1 A;  3CEW A;  4NN0 A;  1F5F A;  1UZW A;  1ZBA 2;  2AH2 A;  2EXK A;  4GB3 2;  4ASM B;  1RB8 G;  1PGL 1;  2JDM A;  1AR8 2;  1NZI A;  2DCT A;  2TNF A;  3GXU A;  2VEC A;  1I9R A;  4MYE A;  2XJT A;  2D6L X;  3R0R A;  4MGQ A;  2B9U A;  3MIB A;  1QJU 1;  1OBN A;  1Y9Q A;  3MO4 A;  3O1U A;  2BPA 2;  4UOJ A;  3AYD A;  5ACA 2;  2RS3 2;  1V6I A;  2WAB A;  2WJS A;  4CTE A;  2A5Z A;  3GJB A;  2LRP A;  2R49 A;  1HB2 A;  1ZZ8 A;  5A3P A;  1G9C A;  5F2W A;  3AZX A;  2X29 A;  4MXW B;  3TEY A;  4PJY A;  4V1P A;  1J1T A;  2VMG A;  4ASK A;  4MV2 A;  4G4F A;  2RS1 3;  3AZV A;  3RYR A;  3UL2 A;  1ZA4 A;  4AQ6 A;  5L9B A;  5D8A B;  2WZ8 A;  5FAX A;  3WSO A;  4EQV A;  5HI0 A;  1NCR B;  1O91 A;  1WCU A;  2E51 A;  5K0U C;  4D6S A;  5L7O B;  5FY9 A;  2F4L A;  1HXS 1;  4K7J A;  2OW4 A;  3NL1 A;  3BUC A;  3IPV A;  1XSQ A;  4IGO A;  4IE5 A;  4YZ3 A;  4E2S A;  2OXB A;  1CAV A;  3M7A A;  3SMH A;  5AVA A;  1WMD A;  3AJY A;  4HAN A;  4BQX A;  3AKR A;  2GNM A;  4MVT A;  1I6X A;  5D8A C;  1XU1 A;  4BQ5 A;  3ABZ A;  1UY1 A;  4AHX A;  1NCR C;  1F4A A;  5FDB A;  2WLQ A;  1D2S A;  4Y1U A;  4NPM A;  3RS6 A;  4Z07 A;  2RS1 2;  3VKN A;  3BTA A;  1H4G A;  1UOG A;  3AFG A;  3LAG A;  1UYY A;  1QHD A;  1OIP A;  1O4Z A;  1QXP A;  5FLI A;  3WVJ A;  3SCH A;  2QUO A;  5HCH A;  4KBB A;  2QDR A;  1ACC A;  3ZIX A;  3PUS A;  3CF6 E;  4CE8 A;  4YZ1 A;  2YHJ A;  3WQB A;  4YVS A;  2FCV A;  3VZL A;  3WXP A;  1WW4 A;  2Q0A A;  2NPI A;  2BQP A;  5GZG A;  3FLR A;  1AXK A;  3IDB B;  3MLK A;  3KM5 A;  1MS0 A;  4IEQ A;  1JYI A;  4DB5 A;  2ERF A;  2GNB A;  5KXE A;  2VVD A;  2KM2 A;  4CDW B;  1VBA 3;  5FO7 B;  2UWB A;  1S2B A;  3BU7 A;  1TME 3;  3J7H A;  3AP5 A;  3HY5 A;  1LEC A;  1GZW B;  5DUX A;  3AVR A;  1EV1 1;  2BBA A;  4Y4R A;  2V5D A;  2PEL A;  4YLZ A;  1CD3 G;  4HXC A;  4XUR A;  3WUC A;  1SLL A;  1ZBE 3;  3K4A A;  5CVR A;  1LR5 A;  3SKV A;  1UF2 C;  3FHQ A;  2RJK A;  3JB4 C;  3WCS A;  3I3M A;  3LEI A;  5JMO A;  4BWO A;  1W6O B;  2VBB A;  1SPP B;  3NAP C;  3RFR A;  2GN3 A;  5F5I A;  2VMD A;  2XUE A;  1ZZC A;  3T3Y A;  4XFI A;  1UOB A;  4CCL A;  2E31 A;  2Z69 A;  2PQS A;  3A22 A;  4QX8 A;  2XJQ A;  2YBS A;  1TEI A;  1W8F A;  1YLL A;  5I0T A;  1VBA 2;  2BZD A;  2WSV A;  3HQX A;  1TME 2;  3MID A;  4TTG A;  3MV0 1;  2W87 A;  4GUL A;  3ES4 A;  2AR6 A;  2IXH A;  1ST8 A;  4GWN A;  4Q8L A;  1GOF A;  5D1I A;  3ZKU A;  1R1A 1;  1ZBE 2;  2BP6 A;  2GNT A;  2JG8 B;  1URX A;  4UFI A;  4MGI E;  2PHW A;  1UIK A;  1VMJ A;  1S0F A;  4XQW A;  1ENR A;  2HWE 3;  3RGB A;  3ZSE A;  3F2Z A;  1QJU 3;  3ZXD A;  4AI8 A;  3MF9 A;  3J9S A;  1BLZ A;  4I30 A;  1LCL A;  3OTF A;  1ODM A;  1PM4 A;  3Q8A A;  3V56 A;  4I02 A;  2PHF A;  4DIQ A;  4YYO A;  4J7Q A;  2QE3 A;  2R7E B;  1RVF 3;  4HL0 A;  5JIU A;  1COV 3;  1ZVF A;  2JDZ A;  3BVC A;  4MSV A;  4QB2 A;  1UZV A;  5JPN B;  2RV9 A;  5FPZ A;  4K40 A;  3DL3 A;  2XLG A;  1ULG A;  4CP9 A;  1AJK A;  4DO0 A;  4HVQ A;  5FJK A;  2H0B A;  3MIE A;  3HN1 A;  4N90 A;  1CAX A;  2BV4 A;  2FQP A;  3IDE A;  5FKC A;  4GXL A;  3OEB A;  2HWE 2;  3P7Z A;  1GQG A;  1SG3 A;  1E5R A;  3J7L A;  3LDR A;  2JB8 A;  1QOO A;  1W06 A;  3PME A;  4RGK A;  4RS5 A;  4AFM A;  2JJ6 A;  5LBF A;  4QPG B;  1SLB A;  2YU2 A;  1LHN A;  2Z42 A;  4FPK A;  4Y26 A;  2P5B A;  1W8H A;  2OZ6 A;  2WZE A;  2XBO 1;  3POG A;  1RGS A;  2HWD 3;  4FPY A;  1MS1 A;  1RXG A;  4J1X A;  4LBJ A;  5FMD A;  3PTY A;  5JR7 B;  5A7O A;  3WLU A;  1RVF 2;  2PN5 A;  4Q4Y 1;  1COV 2;  3SCF A;  3LGR A;  4PIY A;  2Y34 A;  5HPO A;  2XLF A;  4GA9 A;  4O9G A;  4HLT A;  4MG2 A;  2QQJ A;  3POI A;  4L92 A;  2EID A;  2BFU S;  2D6N A;  5C7G A;  1NE4 A;  5FTT C;  3SIT A;  3NO8 A;  5HV4 A;  5K7P A;  4MGT A;  2DBI A;  1F4H A;  1UIJ A;  1UKR A;  1HIX A;  2RE9 A;  2NM1 A;  3KV5 A;  4LOS A;  4QPG C;  4JZR A;  3CZU A;  3URF A;  3INA A;  4KWU A;  5AVP A;  3VBS B;  4ZS3 A;  3VKF C;  4S2G A;  1VBE 3;  4OZO A;  1QXJ A;  3ZXA C;  2E33 A;  1CGP A;  1MS3 A;  2WFF 1;  2C4X A;  2YPD A;  5EFU A;  4FFG A;  5CFD C;  1NLQ A;  1GWL A;  2FCT A;  5F6L B;  2B39 A;  3I3Q A;  1QKQ A;  1X8M A;  3POS A;  1J3R A;  2HWD 2;  3PUQ A;  4RQP C;  1WZX A;  2IFR A;  2R06 3;  1CVN A;  1OFS A;  5CA6 A;  3WW2 A;  4WM7 B;  2K46 A;  1MZF A;  4TLF A;  5F32 A;  4FP2 A;  5FIX A;  1YIP A;  5A7S A;  2QCS B;  2VZT A;  4Q29 A;  1G8W A;  1DQ1 A;  3M2M A;  1POV 1;  5LY2 A;  4CCJ A;  1GMM A;  4O9E A;  4U2A A;  1W39 A;  4XMI A;  4ATE A;  2EIB A;  3AP4 A;  1V6M A;  2TUN A;  4Q1P A;  1UW8 A;  1VBE 2;  1WBF A;  2N7G A;  1OUR A;  4E8C A;  2GMP A;  3O7O A;  4Y1Y A;  2XJV A;  4Q26 A;  4WM7 C;  4AAX A;  4HKW A;  1GNY A;  4JGZ A;  5KHK A;  3SEP A;  1ENS A;  2CGO A;  3ZYP A;  5KBF A;  3B94 A;  1JYX A;  2R06 2;  4NAO A;  4E2Q A;  2TBV A;  1S0E A;  1N3P A;  4MGS A;  3POW A;  5CFC B;  3ZFE B;  2WN3 A;  4GH4 B;  5L9V A;  2IVI B;  3AKQ A;  1LOF A;  4CUB A;  2KD7 A;  4H14 A;  3M70 A;  5HXV A;  4DUW A;  1F15 A;  4W6X A;  4R52 A;  4AI1 A;  4Q27 A;  2QQU A;  3I59 A;  4YG0 A;  3LSD A;  4JDM A;  5FZE A;  1BEV 1;  1QOT A;  3J26 N;  4DUV A;  4URA A;  1AR7 1;  4QPI B;  3WF4 A;  1RUE 3;  4N7U A;  2QZ3 A;  2DUQ A;  4W6Y A;  1AR9 1;  1B35 B;  1G86 A;  4XFF A;  4XF9 A;  1SCR A;  3AC0 A;  3KVB A;  1LOG A;  1QH6 A;  3R6S A;  2VUA A;  3IM0 A;  2LM3 A;  5CAD A;  2ES3 A;  2ADD A;  2YB7 A;  2ZX2 A;  4GH4 C;  5HCB A;  5CFC C;  1ASJ 1;  4FI9 A;  4RHV 3;  2MEV 3;  4UF0 A;  1JZ6 A;  3WHT A;  2JE7 A;  4MXV A;  2XGX A;  3VZK A;  4IDZ A;  1UD1 A;  2QQK A;  3M3O A;  4R9A A;  5FZD A;  5IVY A;  4BU2 A;  4BXS V;  5EPA A;  5J09 A;  2WBK A;  4XF3 A;  1SEF A;  2SBA A;  4NR1 A;  2FBE A;  2VCA A;  2ZGK A;  2JEM A;  3KV4 A;  4N9H A;  4PDW B;  1QXR A;  1B35 C;  3VDA A;  3O0V A;  5KC5 A;  4RS5 B;  5JR2 A;  1YNA A;  1X36 A;  5FZ6 A;  1QJY 1;  1HRV 3;  1S4C A;  5J7M A;  3AMM A;  1US3 A;  2PTM A;  1RUE 2;  1K5M A;  4YVW C;  5FYY A;  3RWN A;  3SNM A;  3NVC A;  2Y64 A;  4HN0 A;  2J1T A;  4Z1V A;  5A3M A;  3ZMO A;  2XWJ B;  1WLD A;  2WS9 1;  4AHW A;  2ZGS A;  1SBD A;  4RHV 2;  5JZG A;  2J22 A;  2MEV 2;  1LOC A;  1IOA A;  3U37 A;  1XE7 A;  5IW0 A;  4OMC A;  2ARB A;  3PLQ A;  4PDW C;  2YMZ A;  3LPG A;  4LBQ A;  4XAE A;  1LOE A;  2Y6J A;  4A7Z A;  5F7U A;  1G9B A;  3N9O A;  4CIZ A;  2BGC A;  3ENR A;  4YM0 A;  4LR4 A;  3AXD A;  1P8J A;  3ZX7 A;  3KHC A;  4QXK A;  2AEN A;  2VM9 A;  3LFM A;  1PO2 3;  1HRV 2;  3IDA A;  3MLL A;  3FZ3 A;  3VDD B;  4IET A;  1QF3 A;  4HK8 A;  1XNA A;  4FOQ A;  1IS5 A;  3DF0 A;  3GDB A;  3I49 A;  3KHB A;  2RS5 1;  1KFU L;  4HVR A;  3N9M A;  1ULO A;  2HEW F;  4XHB A;  2Z2S B;  1J3Q A;  2CWS A;  1KS4 A;  3QAC A;  4Q4V 1;  2OKX A;  2ZAH A;  2ORZ A;  1EY2 A;  1IS4 A;  3HR9 A;  4QQH A;  2EIC A;  1QMJ A;  1W0N A;  1PO1 1;  2HWF 1;  4YFZ A;  4YW4 A;  3VD9 A;  2VGD A;  1ZZ7 A;  1POV 3;  2ARC A;  3VDD C;  5C4W B;  2V4V A;  1RUD 1;  1AXZ A;  3NV3 A;  5FPA A;  5GZE A;  4ASL A;  1YCI A;  2ZX4 A;  5FMO L;  4EN7 B;  3PVO A;  1UN1 A;  1PO2 2;  2O14 A;  3ILR A;  2UYA A;  3SEE A;  4N53 C;  2A7A A;  1W6M A;  4HT1 T;  1ZZB A;  3RMX A;  2CU5 A;  3RJ2 X;  1J83 A;  1SDW A;  2P6H A;  3OG2 A;  5DAV A;  5F5A A;  1O5L A;  1BVV A;  2WNO A;  3MFA A;  1STM A;  2RR1 1;  3NKG A;  5F3I A;  5F5Q A;  3GCW A;  2X5I A;  3LZZ A;  5JI9 A;  5M0T A;  1V9U 3;  4B7K A;  4RGG A;  3WV6 A;  4CDU B;  4UT5 A;  3EMR A;  2VU9 A;  4HZF A;  4RSU A;  1UNB A;  2XR4 A;  5IVJ A;  3W68 A;  1LRH A;  4IGP A;  5HCF A;  1XC6 A;  1ZRD A;  3PJQ A;  1RUC 1;  3A23 A;  3I59 B;  4DOU A;  4AI2 A;  1SFN A;  3GBW A;  4CEW B;  5C5U A;  5A33 A;  1W9T A;  1Y43 B;  3B3Q E;  4GKY A;  4LBL A;  2HLE A;  2Q8C A;  4A42 A;  1QWR A;  2X09 A;  3CJI C;  4I0A A;  5JXG A;  5FP4 A;  3BOD A;  1FPN 3;  3THC A;  2GAU A;  3GJA A;  5IAV A;  4JAA A;  4CDU C;  1CPN A;  1L7L A;  1ULC A;  3NMB A;  3OB8 A;  1NCQ A;  1W8W A;  4GWJ A;  4D69 A;  1W2A X;  2BUK A;  2MHF A;  2VOW A;  5K9Y A;  1V9U 2;  5DDJ 3;  3VV1 A;  1O3Q A;  1K3I A;  3TN9 3;  4CXW A;  4AVC A;  4O61 A;  5KHH A;  4CEW C;  3B9C A;  4AI9 A;  4FQZ A;  3KT7 A;  2W3J A;  1ULF A;  3VBR A;  5C9A C;  4JRA A;  4FPC A;  1EP0 A;  3NJX A;  5J98 B;  1DHK B;  1S2K A;  4FXK B;  1QNW A;  2BBV A;  2OII A;  5DG2 A;  4AL9 A;  4LNV A;  2ZAB A;  3DPR A;  4JGY A;  4KL1 A;  5F6K A;  5FPU A;  2EA7 A;  5A1L A;  3VBF B;  5IVE A;  1RXF A;  4K21 A;  1Q5O A;  3ZXG A;  5L73 A;  2FD8 A;  1WA4 A;  2D97 A;  1FPN 2;  1H8T A;  4AOC A;  4IEV A;  4PQQ A;  2WT2 A;  4LIU A;  1UMZ A;  2R1B A;  4ORF A;  4C1X A;  4UFJ A;  4Y22 A;  2ADE A;  3K75 B;  3NRU A;  3GNE A;  4Q4W 3;  3IMM A;  2BGO A;  4N43 A;  4NWW A;  3WZ1 A;  4LBQ B;  5FO8 B;  3HEI A;  4NID A;  3N36 A;  3TN9 2;  3ZFF B;  3PUR A;  1PGW 1;  2QKD A;  2Q1M A;  1R09 1;  1TVG A;  1OUX A;  3WG4 A;  2GZW A;  1ND3 B;  1VAL A;  2WWS A;  1CN1 A;  2ZGQ A;  3OY8 A;  4IE6 A;  4QMA A;  3VBF C;  5IAX A;  2OUH A;  1H2L A;  4XCA A;  2HBU A;  1GWM A;  1F31 A;  3WCR A;  2ZCW A;  2DVD A;  4QT6 A;  5FZG A;  4A41 A;  2IFW A;  4NJ4 A;  1RUF 3;  4CUA A;  2BOJ A;  1TNF A;  3I3B A;  1SQ4 A;  1M4W A;  4QXC A;  3WG1 A;  2RS5 3;  5IK4 A;  3VB9 A;  3GHM A;  2ZGO A;  3JD7 1;  4GJY A;  5I0U A;  2JDU A;  4LIT A;  5A7W A;  5HBA A;  1UX7 A;  1NXM A;  4IV3 A;  3BTX A;  4FPG A;  4IGQ A;  1O4Y A;  4FPO B;  4Y20 A;  2E6V A;  4BE3 A;  3ECQ A;  3BI3 A;  4LUM A;  3RWK X;  1C1F A;  2DV9 A;  2Y0O A;  4MH0 E;  4Q4W 2;  3ZLI A;  1O59 A;  4AI3 A;  3BIE A;  4R9C A;  2DCY A;  4OFG A;  4XMA A;  2CSG A;  5IAT A;  5IYY A;  4RFT 0;  5A3O A;  4Z2A A;  5C8W A;  2NMN A;  1WME A;  1FMD 1;  4MZU A;  3NJV A;  1Q43 A;  2I45 A;  3VBH C;  4AQ2 A;  4UFH A;  4XFA A;  2VOK A;  3I7D A;  1VRH 1;  1ZRF A;  1D4M 3;  3PEG A;  2OQ7 A;  1RUF 2;  3FUQ A;  3LWC A;  1ODN A;  1Y9G A;  4WZC A;  4KGQ A;  4RR3 B;  3W20 A;  1RIN A;  1ZRR A;  1C57 A;  4A4A A;  5I93 A;  1BMV 2;  2HKX A;  5HV0 A;  1ZRC A;  4H7M A;  4AGG A;  4YGC A;  2VQ0 A;  1NE6 A;  3B7N A;  5EXO A;  1W3X A;  3S6P A;  1DU3 D;  4PT6 A;  4A3X A;  4G9S B;  4LIV A;  2YC0 A;  1PMJ X;  5SV5 A;  3V65 A;  4D0Q A;  4YM1 A;  3PNA A;  4QHB A;  4CYD A;  1A8M A;  1NY7 2;  2RM2 3;  4RR3 C;  2ET7 A;  5DG1 A;  3C7H A;  3U14 A;  5CEH A;  3G6J B;  3HWJ A;  3AB0 A;  3WW3 A;  1D4M 2;  4TLG A;  4YPJ A;  1YWK A;  2DVA A;  1R08 1;  2XPJ A;  2ZPX A;  2CY6 A;  1PIV 1;  1EAH 1;  3D82 A;  4XZP A;  4OI2 A;  4O7X A;  4LE3 A;  2J1U A;  4YFW A;  4YW1 A;  1I1E A;  2BYV E;  4CRQ A;  2LS6 A;  1AX0 A;  3DV8 A;  5F9T A;  1GWK A;  2R30 A;  3PUH A;  4DFS A;  3C7G A;  2E32 A;  1BK0 A;  3U4X A;  3UJO A;  3LEG A;  3POB A;  1FAY A;  2Y6F A;  1VLN A;  2QQN A;  3ZSM A;  3LDK A;  5JXI A;  4BB3 A;  3I2F A;  5HXM A;  2JDP A;  3M3C A;  1TZO A;  4K1Y A;  5DUV A;  3SQO A;  4XFC A;  3NQH A;  4OI1 A;  4KWJ A;  5KC6 A;  2NYY A;  3B74 A;  2RM2 2;  3MPB A;  4XHX A;  2DTY A;  3ZYB A;  2RS3 1;  4K9S A;  1LAJ A;  3GHN A;  2VC9 A;  4BPZ A;  1MVE A;  3OSD A;  5K0U A;  3PUA A;  3RQ0 A;  3T0A A;  4XUT A;  4FFI A;  3PVB B;  4GMP 1;  4DNY A;  1V00 A;  1SLA A;  2VVE A;  3B00 A;  2DWR A;  2PHU A;  4ZKT B;  2GMM A;  4PI0 A;  5IUQ A;  3C2U A;  1IPK A;  1HB1 A;  4MXW A;  1YC6 1;  1Q3E A;  5JXJ A;  4OI4 A;  1XND A;  5IVC A;  2CV6 A;  3N7K A;  2EXJ A;  1MEC 1;  2BVB A;  1H0B A;  2Q5T A;  5D8A A;  5FZ4 A;  4QM8 A;  3SIS A;  3X29 B;  1NCR A;  1U5X A;  2R07 3;  4QXH A;  1UY0 A;  2WQZ C;  4HSL A;  1JYV A;  1VPH A;  1WKY A;  2ZKN A;  4PI2 A;  5GLU A;  4B1L A;  4XXA A;  3AMQ A;  5FBJ A;  5FXV A;  1N1V A;  2GH8 A;  1JZ4 A;  3O14 A;  1NQD A;  1W8U A;  5H9P A;  5CIS A;  3M3I A;  4HKO A;  2ZA9 A;  5FZC A;  5FMO S;  5A7N A;  1GIC A;  1CAU B;  3QLQ A;  3RNS A;  2VCM A;  5IFT A;  5FYH A;  4K3U A;  5BNP B;  4KU8 A;  3T2O A;  5A7Q A;  4AHY A;  1FOD 3;  4LT5 A;  2PLV 1;  1UU5 A;  1WCK A;  2ZKL A;  1N1S A;  4OHX A;  2RMU 3;  4XEZ A;  2R07 2;  2B42 B;  2YGM A;  4XJW A;  1RUH 3;  1VBD 1;  1AL2 3;  1OLM E;  1PHM A;  2YC4 A;  4GWI A;  2XUM A;  3AYE A;  3H8X A;  2DCZ A;  4FQ4 A;  4LQR A;  1AYN 3;  4B4P A;  2YDE A;  2WDB A;  2ILM A;  3ZXE A;  3OGR A;  4M3C E;  1CAW B;  2W46 A;  4KWK A;  2R04 1;  3KSC A;  3RI8 A;  3RI9 A;  4W50 A;  4HN1 A;  3NAP A;  3RVH A;  1NA1 C;  3BOW A;  5BNP C;  3DYP A;  4XF1 A;  1N47 A;  1ZA7 A;  2JDY A;  2P17 A;  3VBS C;  1C8N A;  1FI2 A;  1GNH A;  2VW0 A;  5FZL A;  4CDW A;  1LEN A;  1GOH A;  1PVC 2;  3JCI A;  4QU2 A;  1VMH A;  1GZW A;  2WNV B;  2V73 A;  2PXJ A;  2VW1 A;  3BOP A;  4NOT A;  4KH9 A;  3H8R A;  2EIG A;  3PL0 A;  1FOD 2;  3FMG A;  4CU6 A;  4GWM A;  4LXL A;  5EYY A;  4OCT A;  4RYD A;  2RMU 2;  2Y0I A;  3B02 A;  1Q8Q A;  2YRO A;  4NWV A;  1JYN A;  2VTX A;  2VCB A;  3J8F 1;  1RUH 2;  1W6O A;  4LKE A;  1SPP A;  1RUG 3;  1AL2 2;  5BV6 A;  1AF9 A;  2ZZQ A;  1PIV 3;  1HV1 A;  1AYN 2;  2DCK A;  4H3W A;  1CES A;  2ATF A;  3WDW A;  3A0N A;  3QH7 A;  2Z5W A;  1U5Z A;  2WNV C;  4XOG A;  5CKM A;  5G04 L;  3TOJ A;  2BEO A;  1UKG A;  2WLP A;  4H2A A;  4CPB A;  1OPO A;  2QDN A;  3LIH A;  4CDQ B;  3O1R A;  1HRI 1;  1H1M A;  1MS4 A;  1Z78 A;  2GC3 A;  2R1D A;  3AP9 A;  3H50 A;  3IAQ A;  3K77 A;  4Q0S A;  1X7N A;  4Y5S A;  1RC6 A;  3ZKY A;  4BIS A;  4BOW A;  1H1I A;  4Q8K A;  1WLT A;  2VZV A;  5DQ0 A;  2Q8D A;  1VJ2 A;  4JKM A;  2Y33 A;  4AED C;  1GYK A;  5FZM A;  4D7S A;  2JG8 A;  3HNM A;  1SMV A;  1UX6 A;  4C91 A;  5K0U B;  1YRZ A;  4XFG A;  3O0X A;  1JYC A;  1K12 A;  4LBQ D;  4Y3O A;  3WDY A;  1RUG 2;  1YO8 A;  3RG0 A;  2JB4 A;  1YFY A;  3AM2 A;  4COV A;  2XQR A;  4HON A;  3DKQ A;  5LAT A;  4XET A;  5FYM A;  1XOY A;  2WZR 1;  2X53 S;  3O5S A;  2G9G A;  5AC9 1;  3TEZ A;  3IMN A;  3ZDV A;  1RIT A;  1HLC A;  5E88 A;  2X10 A;  3LA7 A;  4HVO A;  5LA1 A;  3K4Z A;  5BNN B;  4XTP A;  1K42 A;  2NP0 A;  4XAA A;  1FNZ A;  2VZP A;  5LK7 B;  1OSG A;  3PIG A;  4UW4 A;  1Z7S 1;  4EN0 A;  2MNG A;  1MZE A;  4XFH A;  3UK9 A;  4AHZ A;  2C9A A;  1EYB A;  2CGP A;  3ZM8 A;  3UKN A;  4AVT A;  1YQ8 A;  2WNU C;  2L9L A;  4TZD A;  2VMC A;  3GZU C;  5A3U A;  5A3T A;  1C8M 1;  1RYY A;  2W1Q A;  4CCO A;  4P9X A;  3ZXL A;  4QQ2 A;  1DBN A;  1RED A;  4QPW A;  1W9W A;  5GAL A;  2ZML A;  5LBC A;  4OUL A;  5JVV A;  2VZ3 A;  5BNN C;  3N9Q A;  4QPG A;  3FFZ A;  3QCW A;  3AMP A;  5FKB A;  2J1S A;  3KB5 A;  1IS6 A;  2BWA A;  3C3V A;  3J7M A;  4PHZ A;  2VMH A;  4XAC A;  3W5M A;  2ENR A;  3FBM A;  1HN0 A;  4NRP A;  1GBG A;  3UNP A;  3KWV A;  1A6C A;  4CDX C;  5FR3 A;  4C0H A;  4BQ4 A;  2AZ5 A;  4V2V A;  2WR9 A;  4GZ9 A;  3ZYR A;  4M8Z A;  3BKZ A;  2GC0 A;  1O6U A;  3ZXK A;  1TMF 1;  4CUG A;  4D6Q A;  3NJZ A;  3ZN5 A;  2QNK A;  2VJX A;  2E7A A;  4JDN A;  5E8A A;  2B5H A;  1H6X A;  1SLT A;  4KNC A;  4LPL A;  3K4D A;  4HMZ A;  3GYD A;  3NAP B;  1JZ2 A;  3L2H A;  2VZO A;  5FZI A;  4TXW A;  4IEZ A;  4XDO A;  1ENX A;  3D8C A;  5KHI A;  5IFP A;  4O65 A;  5JSO A;  1O5U A;  2AEY A;  1GUI A;  1LEM A;  4WM7 A;  1UYX A;  1XXN A;  2P1B A;  4B3N A;  3BTZ A;  3S5A A;  3LOB A;  3E6B A;  4ZU4 A;  2FZ2 A;  4LA3 A;  2CGN A;  4BZ4 A;  1OQD A;  1DGL A;  5GLW A;  1MQT B;  4LJH A;  3T2P A;  1LHO A;  3OGS A;  1Q8S A;  4GAL A;  4EWD A;  1AZD A;  2HYX A;  3USU B;  4L9B A;  2D44 A;  1HB3 A;  5DUU A;  2HYK A;  2ZX3 A;  4D3W A;  1C5H A;  2W1U A;  2VVF A;  5DAP A;  4QQL A;  5FYU A;  3VHR A;  3GBG A;  5L19 A;  4F83 A;  3AXE A;  1VBC 3;  3IDC B;  2P3J A;  2XVG A;  5C33 A;  1R64 A;  4P00 B;  1V70 A;  4KQ7 A;  4BLI A;  1RHI 3;  1NT0 A;  2FDK A;  3JU9 A;  1RUI 1;  5KXD A;  3ASI A;  3T08 A;  2WA4 A;  2DBN A;  5T5J A;  3PIJ A;  3WNL A;  5JDB A;  1MQT C;  5JOW A;  2VNG A;  4HK9 A;  5CFC A;  3ZFE A;  4GH4 A;  1PVX A;  1PK6 B;  4AF9 A;  4C0B A;  2W39 A;  1W0P A;  4PF5 A;  4QX2 A;  3VGI A;  1D2Q A;  2A73 B;  2FDF A;  4LHL A;  5T52 A;  2VQT A;  3I3E A;  5C3S A;  5LWB A;  1JMU B;  4QGM A;  4QPI A;  4YWA A;  1HDK A;  3KQ4 B;  1WW7 A;  4QDS A;  3DUI A;  4EN6 B;  1AX1 A;  3JQW A;  1B35 A;  2NMO A;  4E4D X;  1H2K A;  4WM8 B;  3H1M A;  3JBG 1;  1VBC 2;  2DFB A;  1UZ0 A;  3JB8 A;  3WT3 A;  4M3C F;  2BU9 A;  3GBF A;  1QJX 1;  2WO2 A;  4IEY A;  4DRV A;  1PK6 C;  5JOX A;  1RHI 2;  4IND A;  4YVW A;  1NLR A;  2JKX A;  2E7T A;  1UQX A;  2Y38 A;  2XL9 A;  2D6P A;  1OD3 A;  3EXU A;  5LA9 A;  1REF A;  3RZJ A;  1PGL 2;  3WHU A;  1HXS 3;  3WW4 A;  2VMI A;  4A2U A;  3K3N A;  4Q0Q A;  1YFW A;  5D21 A;  1DZQ A;  1YQ6 A;  5BNO B;  4PDW A;  1QJU 2;  3TEX A;  4FFH A;  1OHF A;  1XSR A;  1YHF A;  2ZX0 A;  1OQ1 A;  4WM8 C;  5FK7 A;  5FOB B;  2XON A;  3MHZ A;  3Q8B A;  3U0Z A;  4S2F A;  1A78 A;  3LB9 A;  4LUK A;  3TAY A;  4EWE A;  4GJZ A;  1ZRI A;  3H7Y A;  5EYX A;  4ZZ8 A;  3DCQ A;  4XBN A;  2ARX A;  2VTF A;  3W5N A;  4QAW A;  5CFD B;  4YAR A;  1XE8 A;  5FZ0 A;  3AP6 A;  4SBV A;  4Y1X A;  4RQP B;  3ZFG B;  1KDK A;  1HKD A;  5BNO C;  3I97 A;  3U75 A;  3U4S A;  2VUL A;  4BJ0 A;  2HWB 1;  1HXS 2;  1R5L A;  2AYH A;  4GD4 A;  3WNO A;  4P9J A;  2VXJ A;  3ACG A;  4BQW A;  4CJ6 A;  3MI8 A;  5FY7 A;  4LE4 A;  4QX5 A;  1AYM 1;  1ZM1 A;  2D6O X;  2YY1 A;  4NIA A;  4D7T A;  4FMM A;  1R1Z A;  2B8M A;  2I74 A;  4QB6 A;  4AI0 A;  2QQI A;  3VDD A;  1N3Q A;  2IXI A;  3PTR B;  1PMH X;  1WD3 A;  2WWU A;  4M01 A;  3KT4 A;  3I2K A;  3F95 A;  2DUO A;  3LEM A;  1SHW B;  1FV2 A;  2EIE A;  3ZFG C;  5I8Y A;  4R9B A;  4CCD A;  1HW5 A;  1EV1 3;  5C8C B;  5A3N A;  1AR6 1;  1HV0 A;  1FMD 3;  3WF0 A;  4E4H A;  2C5D A;  2E9Q A;  4XYX A;  4Y33 A;  4AG4 A;  3Q8C A;  3WQ1 A;  3ZYI B;  3Q8E A;  2D7F A;  1V6L A;  4JTN A;  1LGN A;  1X50 A;  2IUW A;  3I3D A;  4XFB A;  3VD5 A;  3OUH A;  2A6Z A;  4NE9 A;  5FY0 A;  2OS2 A;  2AUY A;  4EE2 A;  1VBB 1;  3TB0 A;  3WR0 A;  4MOA A;  1KFX L;  5FZ8 A;  5C4W A;  4FAH A;  1UMI A;  2VD7 A;  1UZZ A;  2A3W A;  5IVB A;  1JXN A;  5CZK A;  4Z92 B;  2ZMN A;  4YGB A;  1D7P M;  5F39 A;  4M0N A;  5FY8 A;  5C8C C;  1X33 A;  3ITQ A;  4UW6 A;  2QQO A;  4X6Q B;  5JXH A;  4YVS C;  1WD4 A;  1S0C A;  3PHM A;  4ES9 A;  2ZGR A;  1JOP A;  4AGV A;  3E5U A;  3L9J T;  2W1S A;  2Q8O A;  1EV1 2;  4NHK A;  4DMI A;  5CBL A;  3OBT A;  5C70 A;  5DMY A;  4CP2 A;  1IKQ A;  2NN8 A;  4BQ1 A;  1R1A 3;  4IEX A;  3SH5 A;  4CDU A;  1GZC A;  3OD0 A;  1LGC A;  1FT9 A;  4AEK A;  3VBU C;  3AX4 A;  4OHV A;  4GKX A;  2ZHN A;  4NII A;  4ARX A;  3D0S A;  3THT A;  1FAT A;  2K2S A;  4GQ7 A;  4ISQ A;  1N3O A;  3ACF A;  1HB4 A;  2DTW A;  1G6N A;  1OI6 A;  2UY9 A;  3KMH A;  4JX0 A;  5T5L A;  4CEW A;  1DZR A;  1HN1 A;  3UT0 A;  5ANQ A;  4K20 A;  1US2 A;  5T54 A;  4L11 A;  4I3P A;  1S0B A;  3FN9 A;  4I3G A;  5LBE A;  3DXT A;  1RUJ 1;  5A6Y A;  2ZMK A;  1T6G C;  5A1F A;  2WWJ A;  5CIR A;  1JUI A;  2VAU A;  1OKQ A;  5A6X A;  3H3L A;  5T3N A;  4YVW B;  3JUU A;  2K9Z A;  3LKJ A;  4EZ4 A;  4GMP 0;  3O1S A;  2G19 A;  3A21 A;  5IK8 A;  4OHY A;  3FHA A;  4J7P A;  1LU1 A;  1R1A 2;  2H6B A;  1WCQ A;  2ZJC A;  3R4D B;  4WBB A;  3WF2 A;  5J37 A;  3VBO B;  1IHM A;  2VQA A;  4EZH A;  4AQS A;  3LE0 A;  5J48 A;  3M1H A;  5FP3 A;  3DN7 A;  4NPL A;  2AEZ A;  3UGG A;  4P5Y A;  1GZT A;  2ET1 A;  1W8T A;  1GR3 A;  3AKT A;  2Q8E A;  4PIX A;  2XBO 3;  1DGW X;  2BJS A;  2WT1 A;  1UCX A;  1OA4 A;  4XQD A;  3VBF A;  2G9F A;  4U36 A;  3SXW A;  4OMK A;  1EPZ A;  1EUU A;  1GV9 A;  1RIR A;  3V0B A;  1E5H A;  4UW5 A;  4Q4Y 3;  3VBO C;  1J3P A;  1MS9 A;  3S7I A;  2BOI A;  1CWP A;  2P2K A;  1S0D A;  4TN7 A;  1RMU 1;  5GLT A;  5IWF A;  3TNP B;  5GLZ A;  4AAP A;  4M0H A;  1PZ9 A;  2C26 A;  3GZE A;  3VN4 A;  3ZFF A;  1SDD B;  5H9Q A;  2VUC A;  3AK0 A;  3AKS A;  1ND3 A;  4M4P A;  1SLI A;  4N8M A;  3RYP A;  1NZC A;  5EJ3 A;  1W04 A;  4DY5 A;  3VDC A;  1YI9 A;  2WFF 3;  1C28 A;  1XYP A;  2QTW B;  2HJI A;  5I0D A;  4BQY A;  5IVF A;  4QX0 A;  4MHR A;  3ROU A;  2XBO 2;  5GZC A;  5T5P A;  4ERO A;  4TWT A;  2VQU A;  3IIA A;  5FRE A;  1F35 A;  4Q4X 1;  4N53 B;  4NRM A;  2ID4 A;  3ZR5 A;  4Q4Y 2;  2A3Y A;  2GU9 A;  2Q30 A;  3AL6 A;  4FPE A;  3I2D A;  5ABJ C;  4OQ8 A;  3OUI A;  3ETP A;  1DLC A;  2CAV A;  4I0W B;  4CVU A;  1OQE A;  2BER A;  4QGN A;  1UMH A;  4KGG A;  2JDH A;  4CPB D;  3VZM A;  3BB6 A;  1LKN A;  4OMD A;  1G9F A;  2BVV A;  3ZSJ A;  2PHL A;  1CX4 A;  4W4Z A;  2GP5 A;  2VG9 A;  2WFF 2;  4QXB A;  4FOV A;  4LO5 B;  2VNR A;  2E7Q A;  3VLB B;  5C3P A;  4HSJ A;  1JZ7 A;  2E63 A;  3CJI B;  3BCW A;  4ZON A;  4RR3 A;  3WQ0 A;  3E5Q A;  1WGP A;  1NAE A;  1UXX X;  2VNO A;  1NOV A;  3NJY A;  3SHR A;  1X9P A;  4WVM B;  1H6Y A;  2WT0 A;  4QKF A;  3NV4 A;  2ZHL A;  4CXX A;  4XF4 A;  3MYX A;  4P9L A;  2G4I A;  3B7M A;  3III A;  1DG6 A;  2A3X A;  4FOW A;  2OVU A;  1DLL A;  1E5S A;  5FZ9 A;  3AZZ A;  1BEV 3;  3P3P A;  5FXW A;  5FWJ A;  1AR7 3;  3BAL A;  3HIF A;  4NHL A;  5KHG A;  3W58 A;  1BBT 1;  3MW3 A;  2XKP A;  4P08 A;  5C9A B;  1AR9 3;  2JD9 A;  1UAI A;  5LK5 A;  2P6C A;  3HT1 A;  4IES A;  1UY3 A;  4DXZ A;  2RHP A;  3KS7 A;  2OT7 A;  5E1R A;  2Y8K A;  4LUL A;  3POF A;  1ASJ 3;  1JHN A;  5KHJ A;  4P9G A;  3LIG A;  1OC1 A;  3WP3 A;  1QNY A;  5FCC A;  1PZ8 A;  5FLJ A;  1REE A;  3KCX A;  2YG0 A;  4J25 A;  4LA2 A;  3VD4 A;  4YG6 A;  3CQO A;  4NPR A;  4FO9 A;  1F5J A;  2DF7 A;  2PHX A;  3LF7 A;  2VW2 A;  4A6S A;  1LES A;  2CTV A;  4MET A;  1GAN A;  2F6B A;  1KJR A;  1BEV 2;  1QJY 3;  3BGA A;  1AR7 2;  1GP5 A;  1QY4 A;  4RL7 A;  3WDV A;  5GJ6 A;  2CAU A;  1AR9 2;  4HFS A;  1WLC A;  2EVX A;  4AFC A;  3MUY 1;  2R0H A;  1QQP 1;  3V0B B;  2GME A;  4ONU A;  1DDL A;  2WS9 3;  2WQ4 A;  3MIC A;  4F3J A;  1ASJ 2;  4IER A;  4MGK E;  4ZXK A;  5A6Q A;  1W3V A;  3KGZ A;  3A7Q A;  5SV8 A;  3PUI A;  5FO9 B;  4Y4Y A;  1TE1 B;  1SZB A;  5DDJ 2;  1JOB A;  1N1T A;  1UOF A;  3B9I A;  4YW6 A;  4QKD A;  4FFF A;  2Z4F A;  1BJQ A;  4XZU G;  2WKK A;  3T0B A;  1DIW A;  1UXZ A;  2HWC 1;  2JD4 A;  4BME A;  3HQU A;  2E2X A;  5KXC A;  3LD8 A;  3VHP A;  1ZZ6 A;  4QX3 A;  5FXZ A;  2GC2 A;  3CL1 A;  2DDU A;  3NKT A;  4ET7 A;  4BA6 A;  5JLV A;  1LNS A;  3VL8 A;  5J3U A;  2Y60 A;  4P9I A;  3VBH B;  5I0S A;  1BXH A;  2JE8 A;  3KCC A;  4XUP A;  2MPF A;  4FPH A;  2WS9 2;  3NNM A;  3WNP A;  3K51 A;  4Q4V 3;  3B01 A;  3MLJ A;  4K1Z A;  2ETE A;  3VZO A;  2JIC A;  2DUP A;  3CNA A;  4MHU A;  1W90 A;  3TBD A;  1PO1 3;  2HWF 3;  1LOB A;  4NRQ A;  3ZOI A;  4XBQ A;  4JQR A;  4DQA A;  3CJX A;  1CAU A;  3P5B A;  3ACL A;  2WYS A;  1RUD 3;  1Q8P A;  2W2I A;  3LA2 A;  4JKK A;  5BNP A;  1BYH A;  3ATG A;  3V0A A;  3OYW B;  3AYC A;  3GF6 A;  3LFI A;  4NIG A;  4JHZ A;  3MFC A;  3IZO A;  3MGU A;  3S7E A;  3VKL A;  5JPM B;  3OUJ A;  1W6Q B;  2PYT A;  2JIJ A;  4K8R B;  2P4E A;  2B9V A;  1NLS A;  4A7K A;  2RS5 2;  5FYS A;  2RR1 3;  2JG9 B;  1W99 A;  5FZ1 A;  2WFP A;  2LAL A;  4Q4V 2;  3MF6 A;  1CAW A;  4N7I A;  1PVC 1;  3FX3 A;  4MX3 A;  2VY0 A;  1RTV A;  3RZK A;  4E2G A;  1PO1 2;  2HWF 2;  4M00 A;  2D40 A;  3CLP A;  1W05 A;  1JN2 P;  1XRU A;  1HJG A;  1RUC 3;  2KR2 A;  2WNV A;  1RUD 2;  3UGH A;  1O4T A;  3WF1 A;  5CKN A;  3IBM A;  1NG0 A;  2BW8 A;  2WO7 A;  1V6N A;  4ARY A;  1DGR A;  1YJL A;  2OX0 A;  1H2M A;  2JG9 C;  1ND2 B;  3EQE A;  4QDQ A;  5D2A A;  3O0W A;  3OBR A;  4CXY A;  1G7Y A;  1T6B X;  3N9N A;  2YPJ A;  4UYB A;  5ERL A;  3OOX A;  1KJL A;  2BDR A;  4QKN A;  5FY5 A;  3SKJ E;  4FSJ A;  1J84 A;  3KLS A;  5GZD A;  1C4R A;  3HT2 A;  2RR1 2;  3MIF A;  4MAD A;  2VZU A;  1GZ9 A;  1G9A A;  1LJ7 A;  1QOS A;  2G1M A;  3HVD A;  1BQP A;  3ZSK A;  3O1P A;  4ITC A;  3S57 A;  5JIA A;  1ONA A;  2WSU A;  4XXP A;  2JDA A;  4AR2 A;  1H30 A;  4CCM A;  1JBC A;  2NQY A;  4AWD A;  4CDQ A;  5EQU A;  4PCR A;  3SLI A;  4EN9 B;  1ZBA 1;  2Z79 A;  4GB3 1;  3W59 A;  2D3P A;  3AJZ A;  4JQT A;  1AR8 1;  1ND2 C;  1NYW A;  1RUC 2;  2C24 A;  1I5P A;  2XJR A;  3HN3 A;  3Q9O A;  4C1W A;  1QIQ A;  2QFE A;  4KG0 A;  2B7Y A;  2FCU A;  3C7F A;  4Q2F A;  4WV8 A;  5ACA 1;  1O8S A;  1VB4 A;  4YNI A;  2P34 A;  1JI6 A;  3POE A;  4PLM A;  1JZ5 A;  4IE7 A;  5K4L A;  4B4Q A;  2WNU A;  2XHN A;  4L99 A;  1WCS A;  2XJU A;  4R8H A;  3HJR A;  4ZPI A;  2UY8 A;  2VR4 A;  3E6D A;  2WO1 A;  4FTB A;  3B69 A;  3ZR6 A;  3KF5 A;  1R09 3;  3PVN A;  4OVE A;  4W65 A;  2YFZ A;  4AGR A;  4NRO A;  1DYK A;  2ZGP A;  3ETQ A;  2DUR A;  5E89 A;  3H3U A;  3W21 A;  5BNN A;  1YYN A;  3ZVX A;  3ZPO A;  3N3H A;  3K3O A;  1YQ5 A;  2QQP A;  4K8F A;  1OD5 A;  2VH9 A;  4IEW A;  5B4X A;  5LZ6 A;  1GQH A;  4ISR A;  3QBQ A;  5DAX A;  5F8P A;  3POY A;  2W1W A;  4LOT A;  3WP5 A;  4YSF A;  1D0H A;  1MS5 A;  1FYU A;  5FZ3 A;  2DVB A;  5FUI A;  3VBR C;  3D6E A;  1D4V B;  3IN9 A;  3JD7 3;  1ZZ9 A;  4MGY E;  5FZO B;  1VAV A;  3RYK A;  2J1V A;  2WYF A;  3VZJ A;  2ZAC A;  2GAL A;  4LHN A;  5C71 A;  2IXJ A;  2BNM A;  3HOB A;  1Y9M A;  1NXD 1;  3VUO A;  4KU7 A;  4HET A;  1E5I A;  3DPR C;  4QPY A;  5FV3 A;  2RS1 1;  4Z8B A;  2ZEW A;  4FOY A;  5FYC A;  4Q0V A;  4Q0P A;  4EYU A;  1PGW 2;  1WW5 A;  2P37 A;  4M4R A;  1R09 2;  4IEO A;  5IK7 A;  4LLO A;  1WMX A;  4XJU A;  4AFA A;  4HBN A;  1NA1 B;  2WII B;  4BQ3 A;  5B4N A;  3N4M A;  3V0A B;  1UO9 A;  3V64 A;  2YUE A;  4QHO A; 
#chains in the Genus database with same CATH homology
 1O6U A;  3Q8G A;  3P7Z A;  5LZ6 A;  3B74 A;  4CJ6 A;  3PG7 A;  3HX3 A;  1OLM E;  3PEG A;  4FMM A;  4TLG A;  1OIZ A;  1AUA A;  4UYB A;  4OMK A;  4J7Q A;  1OLM A;  2D4Q A;  3B7Z A;  3HY5 A;  3B7N A;  3W67 A;  1OIP A;  4J7P A;  3W68 A;  1R5L A;  4CIZ A;  4OMJ A;  4M8Z A;  2E2X A;  3B7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...