1O6UA

The crystal structure of human supernatant protein factor
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
397
structure length
393
Chain Sequence
MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEC14-LIKE PROTEIN 2
publication title Crystal Structure of Human Supernatant Protein Factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 121
structure length 393
sequence length 397
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.680 Mainly Beta Sandwich Jelly Rolls GOLD domain 1o6uA02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 1o6uA01
3Q8GA 3HX3A 4J7PA 4OMJA 3W67A 1OLMA 4CJ6A 2D4QA 3PG7A 4OMKA 3B7ZA 3P7ZA 3W68A 4M8ZA 1OLME 3B74A 4UYBA 1OIPA 1OIZA 3PEGA 1AUAA 3HY5A 1O6UA 3B7NA 4FMMA 2E2XA 4TLGA 1R5LA 5LZ6A 4J7QA 4CIZA 3B7QA
chains in the Genus database with same CATH superfamily
3R4SA 2VM9A 3D4KA 3VBSA 4BWOA 4RS5B 1W8UA 2XBO2 4EN0A 4QX1A 1AZDA 5C6CA 3GF6A 1QH7A 4PCRA 2XPJA 4WVVA 4KU8A 2BRTA 5FYTA 1W6MB 1O3TA 2RS11 1SQ4A 2WQ4A 1R64A 3B00A 5B4NA 2FCVA 2WA3A 2QJVA 2EICA 2DWRA 2VECA 2XXZA 3DKWA 4I0AA 4NHYA 4PF5A 1ZZCA 3H3ZA 2XJTA 2EAAA 3CJIA 5CNAA 2ZGOA 4HL0A 4M3CB 3T2OA 5J96B 4OMDA 5FUPA 4XDOA 1MS4A 3SNMA 1PNFA 4WM7C 2R063 1GYKA 4E2SA 2JEMA 2CU5A 4COWA 4RFRB 4W6XA 1GU3A 2BW8A 4YZ1A 2VZOA 1VPHA 3LIHA 5CG9A 3ZXKA 2VQAA 1AYM3 3WNKA 1CR7A 2B39A 4QB6A 1R082 1Y9QA 1W8ZA 4DXRA 5JZGB 2DTYA 3WF2A 5DG2A 1KDMA 5FPZA 1J3PA 4CPBA 5E1RA 3OEBA 2GC3A 2E31A 1PO13 4IGQA 2WZR2 4CTEA 4E4SA 4RD7A 4RS5A 5IVEA 1HXS3 2CTVA 2QCSB 2VMCA 4IQPA 1JZ4A 5FZ4A 5FZKA 1KFUL 4HETA 1BEV3 1LGCA 2YB7A 4CZSA 1W6MA 3ACFA 4CSWA 1ZBA3 3N35A 2UYBA 3FUQA 2YY1A 3ZYIB 1H2NA 3WDWA 3LOBA 4DNYA 4LMFA 2X05A 5DUWA 5FZAA 1RITA 1REDA 2ARXA 2QTWB 3ZDVA 2QQVA 4TN7A 3JU9A 3ZR5A 3SCFA 1VB2A 2ET7A 2LM3A 1U5XA 1R091 3NWKA 4U2AA 2AH2A 1DYPA 4UW4A 5DG1A 4M8ZA 3A21A 3INAA 2G19A 1YIFA 4U36A 1KQRA 3P3NA 1OVPA 1QOSA 2VR4A 1YHFA 1GMMA 2EIEA 3MHZA 3PTYA 1RC6A 1NYWA 4FPHA 2WS92 3VV1A 2VUDA 4GIQA 3ILFA 1HB3A 4AF9A 3SCGA 1A6CA 2B46X 4CCMA 1V6LA 2ZX1A 1H4HA 3OPZA 4QPIB 1CIYA 2CAUA 5HXMA 3PHMA 1PO23 2I07B 4XFBA 1AR62 1WKYA 1ZRRA 4CXYA 2O8OA 1ND2B 2JECA 4AVCA 5A6XA 1RJ8A 4CEYB 1FV2A 5F8PA 2E53A 2MEV3 2P4EA 2ZHNA 3HNMA 5GZDA 1UZZA 3WF3A 4NHMA 4BQ2A 3UYJA 2R061 1WGPA 4NO4A 2A3YA 2Z4FA 5FYSA 3I4IA 3WF1A 5L19A 1JYTA 3U10A 2TEPA 2ZZQA 2E33A 5J48A 1JYXA 3RGBA 1ASJ3 2PHDA 3LA2A 4DMIA 4ZZ5A 3AYCA 1AYM1 2QQIA 3S7IA 4B1MA 4QB1A 3PIGA 1JN2P 5CFDB 2P6CA 1SLBA 2PQSA 2JX9A 2WQ8A 1H2KA 2FQPA 2HKXA 3B7QA 1PO11 3NKGA 3LB9A 2ZS6B 4HBNA 4LTAA 1HXS1 1A8DA 4OMKA 5AVPA 4I01A 3KF3A 4CCCA 2WLQA 4NRQA 5ABJC 1BEV1 2VZSA 1CX1A 5ACA1 2JKXA 4QPIA 1YFYA 1ZBA1 5F6LB 1S0BA 1YFWA 3FHAA 3ZVXA 4K7JA 1ND2A 5FXWA 3U75A 4PDWB 4CEYA 4D3WA 1VALA 1XE7A 3ZXLA 4QX2A 4UAPA 2B42B 4NMIA 3U78A 1W9YA 5GZCA 1W8NA 1XRUA 2RDSA 2V72A 3LDKA 4I0BA 3BPSA 1DF0A 2QFEA 5FWEA 1NKGA 4RGKA 5FZBA 3I2GA 5FZ8A 4BM8A 4DO0A 2QQUA 4LE3A 4MGQA 1ZZ8A 1DGWA 4KH9A 2W1UA 1W6QB 1O4ZA 2J42A 4FFIA 5FYUA 3JXSA 4CVUA 2CSGA 1NQDA 2XJQA 1NZCA 2ZGSA 3KQ4B 1H0BA 3MW4A 3PVBB 1ENSA 2I2SA 4MGIE 2YHJA 1PO21 1AR83 3J26N 4NIAA 4DRRA 3GNEA 1NCRA 2IXLA 4HXCA 4MXWA 2BJSA 1S0FA 2ZEWA 1VRH3 4M0NA 4KWKA 1C8NA 1Y7BA 2MEV1 3VBFC 4LT5A 3T2PA 5JIAA 5F1RA 1ULFA 3KT1A 2HEWF 1US2A 3RZMA 5DZGA 1GZCA 3H50A 4JRLA 3M3OA 4EROA 3WG1A 3OB8A 4WBBA 4MGTA 3IT8A 4PDWA 2YPJA 1PVC3 4XJ9A 1ASJ1 4FAHA 4DRVA 1XC6A 5KHKA 1TZOA 3AZVA 3D8CA 3B7ZA 3P7ZA 3PL0A 2XJUA 3ACHA 2HJIA 5AVAA 5LK7B 3HD8B 1AL0G 4HFSA 4IV1A 4K20A 1H8VA 2RS12 4ZHNA 1WMDA 4Y5TA 1FT9A 3H8RA 5EYYA 5FY8A 1IPSA 1ZZ7A 4AFMA 4DEVA 1GNZA 3N9NA 2A73B 1TMF3 4CDUC 2VZPA 2ZEXA 1GNHA 1POV3 2E2XA 2DVAA 1KRIA 3POGA 4UW3A 1R1A3 2QNKA 2HLEA 4KGGA 4LHLA 1IPJA 1H2LA 2BP6A 1H6YA 3F2ZA 4RR3C 3ZXJA 1AF9A 3RZKA 2VQ0A 3APBA 5CA6A 4HKOA 4TXWA 4XETA 4IDZA 4FCAA 1NZIA 1ENRA 2CY6A 4W8JA 3ZSEA 4L11A 3VDDA 1W05A 2X29A 2BGOA 5KXCA 3O1TA 1W03A 3KF5A 3WP5A 4YG6A 2NZ9A 1V70A 1HRV3 3AZXA 2DDUA 1WCUA 1YEWA 2SBAA 2WO7A 5JI7A 4EWDA 1C5HA 1PX4A 2ID4A 3NJVA 3R05A 1QNWA 2QZ2A 3AVRA 2ORXA 4DINB 3UGGA 2Y0OA 2W68A 4DUVA 1CJDA 3TYJA 2J1AA 1RMU3 5JOZA 2VPVA 1PK6B 1UX7A 2CGPA 1AR81 4G4FA 1OMIA 2WYSA 4XTPA 3WR0A 2HWE2 1QEXA 4S2FA 5IWFA 5FP4A 2XR4A 2R30A 2P3IA 1VRH1 1WD3A 4J6GA 4OUMA 4EWAA 1XBFA 1R092 1JZ5A 1YQ6A 1PX3A 1JZ8A 3QH6A 3POJA 2QQJA 3H3LA 1JS9A 2EF6A 4XILA 5JDBA 3QACA 3BTZA 5H9QA 5APAA 4BQWA 4FOVA 4RA0A 4ARYA 2VY0A 4MG2A 4OHYA 2KM2A 1L7RA 1QJX3 2XMLA 4TLFA 4O7XA 4QKNA 3WY6A 2W1SA 1PVC1 4O9EA 4AAXA 4BIOA 4NPLA 1MR5A 1QXRA 3MW2A 4P9YA 3WZ1A 2ZA9A 1EP0A 1LOFC 4XF4A 4XVHA 1RUJ3 3VDCA 2BUKA 3DXTA 3MBWA 5A1FA 2ADDA 1WBFA 1LULA 1FATA 2LW8A 4L8QA 3VB9A 4YARA 3O12A 4M00A 1OSGA 1TMF1 1IGOA 2DUPA 1OLMA 1NY71 1POV1 4P9JA 1A8MA 1IS4A 1VBE1 5KC5A 1H8TB 5FZ3A 1DP0A 3AK0A 2R062 1PK6A 1W3VA 1IPKA 3QD6A 2YG0A 2QUOA 4XAAA 4DPNA 1RUC3 4FPLA 5JIUA 5C3PA 3PEGA 2ORZA 5FPBA 2G9ZA 4UBHA 5EZWA 3PVNA 5FXXA 4XCBA 3VBRB 1JHJA 1AYM2 1ZNPA 5FYBA 2P1BA 2P5BA 4YGCA 2PAMA 3KSCA 2D3SA 3OGGA 1Q3EA 3TAYA 1NG0A 2YGMA 4BB3A 1QJU3 4P9WA 4QQPA 1HRV1 4Y24A 5F5AA 1PO12 4FFHA 1IQDC 4J25A 3SH5A 1HXS2 4JKLA 5J36A 4WZFA 1I5ZA 5EJZB 4OULA 2ARBA 4CP9B 1BEV2 3Q8CA 4CCLA 5ACA2 1RMU1 3BCWA 5LRSA 1ZBA2 3DF0A 5FR3A 2VBPA 1NXMA 2GC0A 2JJ6A 3E6DA 4AGVA 1YFUA 4RL7A 4A42A 2DURA 2JG8B 3D0SA 3I2IA 3O1RA 2DYCA 2PLV3 1X8EA 1H8TA 2P6HA 4P9XA 3VBHB 4MLOA 3MIFA 2Y33A 1VJ2A 3BKZA 4FFGA 1ZYBA 4LHKA 1EYBA 3CZUA 2ZGTA 2NYYA 2EXKA 2WWUA 4AWDA 1I3HA 1QJX1 2CDPA 2UY8A 3A22A 3GHMA 4AEMA 1LECA 2SLIA 4XMAA 2VCAA 5IUQA 3VHPA 2J1RA 3VBRA 3VZJA 4IERA 5B2GB 2QQPA 4BK5A 3U37A 3UGFA 2X10A 4JDMA 1MQTC 4D7SA 4F3JA 5FZEA 2WJSA 1RUJ1 1BJQA 2EA7A 4JGYA 4MOAA 4LBNA 4LK6A 3WV6A 1PO22 4C1WA 4O61A 2X53S 3PVEA 5ERLA 2F6BA 4Q0VA 3UT0A 3WNXA 5FWJA 3KHBA 1VP6A 5A1LA 4Q1PA 4CCNA 3MV01 4CP9A 2R073 4CDQA 1NA1B 4LIUA 4XDQA 4YVSB 3RYPA 3U4XA 1ZRFA 2YFUA 1AR93 1CESA 3AYDA 1RUC1 3B93A 3O7OA 4L99A 4XIKA 3SQOA 3N36A 2E9QA 2IXJA 1GP4A 1CJPA 3V0BB 4E2QA 2KXLA 1ASJ2 3HAGA 1SBFA 5FLHA 5FJHA 3GM8A 3VBHA 3T09A 1PMIA 1N3OA 1NQJA 2W47A 2B9UA 3AMMA 3U14A 3T2TA 1KFXL 2D6PA 4YZ3A 3Q8FA 1GKBA 4S2GA 1QJU1 1LEMA 2XVLA 1M06G 1VMFA 2WA4A 3BOWA 3VBSC 3IIAA 2LS6A 5A7WA 1NLQA 2RV9A 3MUY1 4JKMA 4OUEA 3MUZ1 4BA6A 4D6RA 1FAYA 3GBWA 5IVCA 2VH9A 2ZXQA 3H8OA 4QX5A 4ZZ8A 1GQGA 1JBCA 2AC1A 3J8F3 1C8M3 3DCQA 1KJLA 1YQ2A 3ON7A 5LA9A 1CAXA 1V6OA 3WOGA 4DUXA 1DCSA 1HW5A 2VO5A 2XLGA 4UFIA 5A7PA 3VHNA 4FTBA 1V6JA 1GWKA 5C9AB 4PF1A 2PLV1 2D7FA 2E7QA 2J1UA 2A70A 5ANQA 3KCXA 3MO4A 3ZYGA 5AC92 2CGNA 4HVOA 2F4LA 2JDKA 1LJ7A 3WW1A 3RNSA 3V0BA 3W9AA 3WDTA 3HNBM 1OVSA 1SBEA 5EWSA 1PGW1 4P5HA 1X8MA 5FY7A 4BQ3A 5JXIA 4LORA 4UI9L 4BMEA 5KBFA 1XYNA 1IS3A 1UY3A 3E5XA 1F5FA 1W8WA 3LD8A 1AR82 4XJWA 4RS5C 2PYTA 1F4AA 4GMP0 4FTSA 4DOUA 1ST8A 4QX0A 3POIA 2C26A 4PIZA 3ZYJB 2A1XA 1VRH2 2P2KA 2FDJA 3FBYA 3MDPA 5FY1A 4OI0A 5F7UA 1DQ1A 1U5ZA 2PFWA 5FV3A 1NLRA 2DU0A 3O0VA 2R071 4Q4V3 3WQ7A 3ATGA 3ZFEB 2RE9A 3NNGA 1RUH3 3UJOA 2Y6LA 3VDAA 3ZFFA 1AR91 1HB2A 1AXKA 3OPWA 3AKPA 1CAWA 4GULA 4Z92B 1D2QA 2NLRA 4N43B 5A6ZA 5I91A 1UOJA 2OT7A 4RHV3 1PVC2 3WQ0A 1J3QA 1NE6A 5KHHA 3WUCA 3VKOA 3HY5A 5C9AA 3P3PA 4BXSV 4CEWB 4QPYA 4IL7A 5FY5A 3THDA 2A6YA 1W8TA 4I2OA 2ZAAA 3M4FA 4BQXA 2V4AA 3N7JA 4OUSA 4XXPA 2EXIA 4B4QA 2OUHA 4QQ2A 4UOJA 4YPJA 3OYWB 3N9LA 3AP5A 2RDNA 3H0OA 3I49A 4MGYE 2W0XA 3W59A 3A7QA 1JYVA 1TMF2 1UY0A 3O14A 2Q8CA 3VD4A 1NY72 5JZGC 2Z42A 1E5RA 3D82A 1VBE2 2OVUA 4RQPB 5FZ0A 3J8F1 1VR3A 1PVXA 2Y60A 4QD2A 3BI3A 1C8M1 3RZJA 5BNNA 3SH4A 1J3RA 3GBFA 4HN1A 3S0MA 3V65A 5J3UA 3QBQA 4N90A 3ZPOA 1C4RA 3VLBB 4NUBA 2WO1A 3EHKA 2JKBA 2W08A 1XB9A 5LY1A 2GMEA 5T50A 4E8DA 3HOBA 1K12A 2Y26A 4XEZA 5JR2A 4JX0A 1JZ2A 3ZFEA 4LOSA 5LBEA 5SV5A 1WW5A 1WA4A 2J1SA 1HRV2 2CDOA 5DAVA 4N43A 1N1TA 3OG2A 4PQQA 3FLPA 4CDXC 3TEZA 1CONA 1CGPA 4AVBA 3IDBB 2WINB 4BPZA 4PLMA 2QQNA 5A7NA 3PMEA 2BU9A 4E8CA 1ZRCA 2EALA 3JD73 5IFTA 2NMNA 3NRUA 2NN8A 4FPJA 4YVWB 1RMU2 3OYWA 3N9PA 2D3RA 1JU4A 2DV9A 3HBKA 4W4ZA 4YNIA 4CU9A 5KXBA 5IK8A 4X8NA 2FMYA 2PELA 2PA7A 4FQ4A 1LCLA 2AEYA 5FLIA 1N3QA 1V9U3 1JHNA 5GKAC 2IVIB 1HJFA 4RQPA 1GOGA 4M3CF 4QPIC 4Q4V1 4YM2A 4D6SA 3CHXA 3PUAA 4AQ2A 1O8PA 1VAMA 2R1DA 3AMPA 4HSJA 5T5OA 3IIIA 1ND2C 2QDRA 2JE7A 4YW1A 3DYPA 4CEYC 1QJX2 4RHV1 4Q27A 3VBUA 2ZJCA 2R1BA 3MFCA 4ASLA 1QJY1 2D4QA 1J84A 3NL1A 5EPAA 3W68A 3X29B 5FIXA 2Q4SA 1PGSA 4MSVA 1RUJ2 3BVCA 3I8TA 3PNAA 2HBTA 2IXCA 1UN1A 3MIDA 3GZEA 3QOPA 1QF3A 4FPKA 5I0TA 4AK3A 4YZ2A 5L7OC 1O3QA 3CQOA 1OIZA 3HJRA 4ORFA 4UXAA 2B7YA 2GU9A 3N9MA 1OQ1A 1T6GC 1ODMA 4ZKTB 3EB7A 3RJ2X 4JHTA 5CFDC 4YVWA 2RR11 3RI9A 2MNGA 3KVAA 4LO4B 2W5FA 4META 4AI0A 4LOTA 4J7QA 1JOBA 4NRMA 1RUC2 5FYIA 1OH3A 2BGCA 2A6WA 2GMPA 3T0DA 4K6BA 2QKDA 3BTAA 2W94A 3HPNA 3AYAA 1IKPA 5FO8B 3E6BA 2A6VA 2E7TA 4O9GA 1QQP3 1QJU2 3AZWA 3IM0A 1FMD3 2D98A 5E6HA 4ATFA 1AR73 5HBAA 3OUHA 2R16A 4KQ7A 2FZ2A 1UPSA 1CZTA 5IVVA 1E5HA 1COV3 1ULGA 4EZ4A 2GNDA 5FZMA 3A23A 4I3GA 4COYA 4LO5B 4TLGA 2JDMA 3B94A 4XZPA 3JD71 5A1AA 1NT0A 2BVBA 2ZHLA 3OGSA 3VL9A 5JSRA 2C4XA 4QWNA 3WDYA 2IVJA 4W6YA 2VCCA 4L9BA 2C1FA 5C8WA 3OD4A 5K0UB 4L2NA 3I2FA 1V9U1 5HCBA 4HVQA 2ZHMA 4AEJA 2PLV2 3MIBA 4JC1A 1ENQA 4P9LA 3USUB 2CL2A 2GSYA 3GGLA 3KLSA 1US3A 5CIRA 1DYOA 3VKNA 4R4ZA 3PJYA 1TEIA 4NAMA 1MS3A 4XHBA 1Y3TA 3ZO0B 1PGW2 3GZAA 3SC7X 5C3OA 4JQTA 3FE5A 3AC0A 5BNOA 3MIGA 1YQ5A 3HN1A 4NWWA 1G9BA 2C9AA 1F31A 3BU0A 4FOWA 1N1YA 2B8MA 2VMHA 2YBPA 3JQXA 2D6KA 5JXHA 4J1WA 1F8VA 4YRDA 3ELNA 2ZGKA 4J7PA 1ND3B 2VNRA 3CJXA 3EBRA 3CJIB 3I7DA 1UMHA 5J98B 5KXDA 1MACA 3L2HA 2R072 1GR3A 1REEA 2D6NA 5L36A 4TYSA 1AR92 5I8YA 5JSPA 4BQ4A 2UWBA 4HONA 5JSOA 1OA2A 2IZWA 5K0UA 2PHUA 4QX8A 4GJZA 4UFMA 1GLHA 5FZLA 3UETA 1WUVA 1W6OA 4UWDA 2BBVA 4KMQA 4PIXA 5FPUA 2D43A 3A0NA 2Q8DA 2Y6GA 3J4UH 4QX3A 4OQ9A 1QQP1 1S0JA 3VBOC 3MLKA 1FMD1 1HIXA 3PVOA 3I59B 1IS5A 4CP1A 5K9YA 3HX3A 1SZBA 3SEPA 1COV1 1DDLA 4JAAA 4XFIA 1IS6A 2VC9A 4LPLA 3ZFGB 4AVAA 4IV3A 2W9XA 4EN7B 2KR2A 2E51A 2WYFA 2VTXJ 4AI3A 3J8F2 4Y22A 2F17A 3CU7A 3C7OA 5C7GA 1C8M2 2PHTA 2R32A 2BQPA 1BMV1 1ODNA 3FZ3A 3VZKA 2WC2A 3RDIA 2G4IA 4YW2A 3ETQA 5JXGA 2VVEA 4Q0QA 2W52A 3PU3A 4BYYA 1ND3A 4CCEA 3HNYM 1XNCA 4XFCA 3PUHA 2WFPA 2CGOA 2FDGA 3B69A 4Y20A 5CU1A 3MICA 4YSFA 5BV6A 3JQWA 3B3QE 4FFFA 3LPGA 4HT1T 3LOIA 3N7MA 4QPGB 4XXAA 2WN2A 3ZXAC 5F37A 5IK5A 1UCXA 1H1AA 1QOOA 2HH9A 2RS53 3PMSA 4A44A 4N53B 4EQVA 2HWF3 2HYXA 3O0XA 1K5MB 1RB8G 3WNLA 2HWB3 1H9PA 2CAVA 5AFEA 1C28A 1XU1A 2WZEA 1F4HA 3I59A 3CO2A 3IWZA 3WG3A 3ZFGA 3H3UA 4LKDA 3U4SA 4GB33 3Q8AA 3ST7A 1E5IA 1ZX5A 4Q4V2 5FYYA 4EE2A 4QQOA 3ZSMA 3DPRB 1BBT3 3LE0A 3QCWA 3BN6A 4RHV2 3BB6A 5EP9A 1QJY2 1H8TC 1KJRA 1OFSA 4C0BA 2JG9A 2CWSA 4UFLA 1VBD1 5IVBA 1TME3 1NE4A 4Q5OA 2Q8OA 3WG2A 1LHNA 3KD4A 4OZOA 4PIYA 5A3LA 1ZREA 1MS5A 3AMQA 5BPXA 4W6WA 1UO9A 4OVEA 4QPGA 5A3PA 1ZRDA 5A3TA 4MGZE 5C8CC 4AEDB 3VBRC 1IZ3A 2W46A 4N53A 1OKQA 3ZSLA 1UD1A 2GZWA 2WFF3 3K75B 2DCTA 3W58A 1K5MA 1B35B 2X8KA 1UNBA 3GZUC 2RR12 4A41A 4CU7A 4BDVB 4O65A 3I3EA 2VJXA 4KWJA 1JZ3A 3O1VA 1DG6A 4LR4A 4Q26A 5I93A 3ZXGA 3FHQA 2DCJA 3WNPA 4JRAA 3CDZB 4CDWB 1OLME 1QIQA 4RSUA 1YRZA 3DPRA 1XNDA 4KI5M 2QZ3A 3RWKX 2DUOA 3CEWA 5GZFA 3SEEA 5C33A 2JG8C 3PUSA 2QVSB 4XBLA 4S2HA 3KGLA 2RS51 3VBHC 3DN7A 4D7TA 2HWF1 3V56A 3PUQA 2XOMA 3JD72 4Y4RA 4CUAA 2HWB1 1UAIA 1K42A 1HLCA 3LAGA 3S57A 2ZAHA 1TE1B 2J22A 4FOQA 4ZXEA 1JUHA 2ZX0A 3GCWA 4AEDA 2JICA 1DQ5A 5FY4A 4Y5Z0 5F39A 2VL4A 3WDXA 1NCRB 1V9U2 2JB4A 1QWRA 2HWD3 4GB31 1B35A 4MXWB 4QXKA 3EYPA 2BNMA 3OGJA 1VMHA 4Y1XA 4A7ZA 4BZ4A 3ZYRA 2OPKA 3I2DA 5L9RA 1BBT1 5HV4A 1LEDA 1AJKA 1L7QA 1NAEA 1YLLA 1YO8A 2VMIA 3IB3A 4QM8A 4R9BA 3VKFC 5DAXA 5EYXA 4DY5A 3N7LA 2R49A 2Q1ZB 3NV4A 4XF9A 3WF4A 1YXWA 3HT1A 4K40A 4LO7A 1F2NA 3ZN6A 1NA1C 4YVSC 5FTTC 5JWPA 4CDWA 1TME1 5CG8A 1GZWB 2YMZA 1S0EA 3E1F1 4NJ4A 3MF6A 4F8AA 3TNPB 2ZGMA 3JBG3 2YV8A 3NJXA 3PU8A 4IV1B 4IW3A 2YZ4A 4LKFA 3W5MA 5ISLA 2VU9A 1LOCA 1W9WA 1ZZBA 3ABZA 3GBGA 5FXZA 1RGSA 4IEXA 4PJYA 4BHPA 3W67A 4JGZA 1UL9A 3B9IA 1S0CA 2XHNA 1SEFA 1W04A 3POWA 2YC2A 3LFMA 1H9WA 1MS1A 3B01A 2TUNA 3C2UA 4CUCA 4TSVA 1HB4A 2DU1A 5E88A 4UF0B 1NCQB 1IOAA 4MHUA 4NWVA 2KA3A 2B4KA 2A6XA 5LBBA 1RUF3 3VDDB 3C7GA 3GDBA 1QQP2 1NLSA 4CRQA 1FMD2 1N1VA 5A3OA 2XGXA 3K51A 2EIDA 2VMDA 1ULOA 4OHVA 3S5AA 4G3YC 1COV2 1U5IA 2QQKA 1GWMA 2WUHA 2FD8A 3E97A 4A3XA 1CD3G 1OKOA 1GV9A 1BXHA 3ZDSA 1GZWA 1VLNA 5JUVA 3VKLA 1QGLA 1BMV2 2EXHA 3HVDA 5A3NA 1UIKA 4BISA 1VE0A 3O1PA 1ZA4A 4Z07A 4B1LA 4D6QA 3RZHA 2VMEA 3M3EA 1VIWB 3AZZA 3QH7A 4GWNA 1LU1A 3VD7A 1VBC3 1Y9MA 1FI2A 2HWD1 5LATA 4FMMA 5FYVA 5FK8A 4JV4A 3CLPA 1QJFA 3LFIA 2VZUA 4ISQA 3DL3A 4K8RB 2RVAA 2VBDA 4NIGA 4AVSA 4LLFA 3PJQA 3ZYFA 3UV9A 3OGRA 2JWPA 1NCQA 2VNGA 4QPWA 4UF0A 5FPXA 4V2WA 4XUOA 1DIWA 4AGGA 1X36A 1ZVFA 1CZVA 1DHKB 1UYYA 2A3XA 3D0JA 1XYOA 3NV2A 3ZR6A 4OFGA 3PIJA 3RG0A 1UWWA 4OI4A 5E16A 3JBG1 4Q4X3 4PI2A 1TNFA 1JTZX 3D5OA 3M7AA 4GA9A 5FY9A 2WNUB 4F7ZA 4CEWC 1I9RA 2O1QA 5A6YA 5CADA 5BY5A 3LSEA 4QB2A 4L97A 5FZIA 5FUIA 4MGSA 4MGKE 2ZHKA 3NW4A 4EN6B 5GZGA 3K3NA 4I02A 2W87A 4FP3A 1LHUA 2ATFA 2Y64A 2VOVA 3RS6A 2IC1A 4QQLA 3OUJA 2YBSA 1X50A 4IXLA 1LRHA 3KT4A 1O91A 4YW6A 4BE3A 3HR9A 2JDHA 1VBD2 4N7IA 3N7KA 1OUSA 5HCAA 5IVJA 1RUF1 1OI6A 4CXXA 4LITA 1J58A 2NMOA 3K2OA 5CFCC 1K5JA 2GNMA 1SMVA 3KWVA 5BUVA 1O8SA 2NP0A 2BBAA 2V5DA 1LOBA 5FZ6A 2ZKNA 2ZABA 4CU8A 2P37A 5BNPA 2GDFA 4H7MA 3U1XA 3K4DA 1WW4A 4IE0A 4XMIA 1PNGA 2XUMA 2VZQA 1FPN3 3IN9A 2P17A 1IKQA 3WVJA 1ACCA 2WNUA 2IXIA 1ZM1A 4A3ZA 4MV2A 4CYDA 5KHIA 4HPKB 1VBC1 3ZKUA 1X9TA 4A4AA 1AX0A 4BJ0A 3EJKA 3POBA 2AZ5A 2BPA2 4Q0UA 1BQPA 2G9FA 3Q9OA 5C4WA 1R1A1 3I3MA 2XWBB 3ZYBA 4R9DA 3EMRA 5K4LA 1OOPA 5LASA 4KWUA 3BIEA 5C3RA 2P3KA 2RS52 3S6PA 2HWF2 1PMHX 2WN3A 3R4UA 5IK7A 4E4HA 4ZY9A 3FC0A 1HN1A 3WF0A 4CUGA 4ZU7A 2HWB2 1HQWA 4HG6B 1YQ8A 3H8UA 4IEOA 4IGPA 2YROA 4JGYB 5H9RA 5ABJA 3ETPA 2AR6A 4Q4X1 4YW5A 2D5FA 2VOKA 5LWBA 3FLTA 1MS0A 2AREA 2DCZA 2JDNA 3VN4A 5C5UA 3H1MA 1UQXA 4GB32 1UY1A 2XL7A 2ENRA 4Y5SA 4DQAA 5LA0A 4SBVA 2BDRA 3EQEA 2CWMA 4GWIA 1R1ZA 4LBMA 3WX5A 2WRAA 4WVWA 4LQRA 1FXZA 4B8EA 4CDQB 1BBT2 2YBKA 4AW7A 4FQZA 1HRI3 1XNTA 1SPPB 2GMMA 1T6BX 1TNRA 4HPKA 5FZFA 3IKWA 4BMBA 3P5BA 1BHGA 1L3JA 1O7FA 3ZX7A 1POV0 1VMJA 1TME2 1CAUB 2WSVA 2Z2SB 3I3DA 4A6OA 4GZ9A 4LO8A 3K48A 3USSA 3JZVA 1ULEA 1KS5A 1QNYA 4RN5A 5JPMB 1AYN3 3MPBA 5KHGA 1JOPA 1WCKA 2I45A 4K3UA 3H1WA 4ASMB 2OZJA 3ME2A 1G9CA 5A7WB 3I3QA 4BH9A 1YUDA 1W8OA 2VVDA 3E6CC 1CPNA 2GN7A 3TEXA 4ASKA 4UFJA 1FPN1 3PLQA 5DUVA 3VZOA 4KL1A 1S0IA 2YYOA 3RVHA 1CAXB 2D44A 2BVVA 5FPAA 2QQWA 3LEKA 5B4XA 4CA9A 1D4M3 4QU2A 4TWTA 5F5QA 2MEV2 2JIJA 4ARXA 1QH6A 4ZU5A 5IAXA 4R9CA 4DEQA 5LZ6A 3S5QA 3VD9A 2Y6FA 4MH0E 3FHIB 1SPPA 2W91A 5D8AC 1F9KA 1AX1A 3LA7A 3NNMA 3POSA 3ACGA 5I0UA 3AJZA 4COZA 2JENA 3NVCA 1CAUA 1WD4A 1QY4A 4H2AA 3RPQA 5DXDA 1Q5OA 4WV8A 5ABJB 1XSRA 5TSWA 2AENA 2FMDA 1BLZA 1HX6A 3AM2A 1DGRN 2OQ6A 4YZ5A 2FDKA 1DQ4A 2TBVA 2RJLA 3C8XA 1W39A 2HWD2 4C1XA 1SBDA 3T2QA 4CUBA 3KB5A 3ZIXA 1XE8A 1JYWA 1YCIA 2W1WA 2W3JA 3PUIA 1C3HA 5LB6A 4DIQA 4AHYA 3ZFFB 1HRI1 3KMHA 3NMBA 2R7EB 1JYCA 1T2XA 3CJIC 1CAWB 3C3VA 4IEPA 1D7PM 1XJAA 3HQXA 4XF3A 4E27A 3RMYA 1IHMA 2GNBA 4QKBA 5T5JA 3WDVA 4PLNA 2BNOA 2HYKA 1EUTA 3JBG2 2WZ8A 4H7LA 4Q8LA 1AYN1 5FK7A 5DN2A 2DFBA 3R4DB 3CNAA 3WP4A 2ZGUA 5FYZA 4ZS2A 1O6UA 4H55A 1WMXA 1CWPA 5FO9B 3WG4A 1MZFA 1C1LA 1J1LA 4ONUA 2BTVC 5IAVA 2NPIA 5E89A 3ES1A 3LQCA 2IFRA 3ALQA 3L2YA 1W6PB 5CKQA 3AMNA 3VL8A 2IFWA 2PXJA 2VOWA 4XIOA 4AFAA 4C91A 3O1MA 2CYFA 2A71A 2XKOA 4Y1UA 1XNAA 4V2VA 4URAA 1OA4A 2W92A 5BNNB 1H2MA 1MZ5A 1UYXA 4I09A 3T4VA 2VOTA 3OOXA 4AG4A 1D4M1 4ATEA 3VDBA 1G9DA 3S30A 3WCRA 1UXZA 3JB4C 5FBJA 1GSLA 2DVFA 4YLZA 2NM1A 3LEIA 4IETA 5DAPA 5FYHA 1RUF2 5A32B 4EN8B 1WBLA 3IZOA 3WLUA 2D93A 3VZLA 1TQ5A 2OS2A 3HIFA 1W28A 4NROA 1BKZA 4P02B 1OBNA 1LGNA 4P00B 3ZSKA 5DQ0A 1MZ6A 1YWKA 2YU2A 3NSTA 4LHSA 4YG0A 3SKVA 5FLJA 3TN93 5JOWA 4XURA 1PGL1 1ULCA 3CF6E 3NJYA 4Y4YA 3TWIA 4BU2A 5FO7B 4N53C 1REFA 3ZYPA 2PHLA 3T08A 3I2HA 1VBC2 3CL1A 1YNAA 3LPFA 1SACA 3F95A 5FKCA 3BALA 1RUE3 5HCFA 3VBFA 2JDAA 3J7LA 2PAKA 1W6PA 5GALA 4AI9A 5FRAA 2YC4A 5I8SA 1R1A2 4D94A 3P1IA 5J1XA 1LR5A 5A7OA 5IW0A 2FCTA 4D0QA 2VTFA 3OTFA 1U5YA 4NPRA 2BYVE 2VMFA 4GKXA 3VBUB 1W9SA 3WD5A 1LHWA 2R043 3MEPA 2N7GA 1UZ0A 3SCHA 4WVMB 3VKMA 4XBQA 4QGMA 3B5LB 4KG0A 4B4PA 5A32A 1NX9A 2GP5A 3IAQA 4I3PA 3VHOA 1RUNA 5BNQA 1D0HA 1RINA 1Y9GA 2WABA 4Q4X2 1Q8PA 4D69A 2JB8A 1A34A 4M4PA 4MXVA 1HN0A 2OIIA 1CZSA 3M2MA 3OPTA 3BUCA 4AQTA 4CDUA 5A33B 4R8HA 5JCTA 4AGRA 1DGWX 1G7YA 3LA3A 4Y1YA 3T0AA 1KGYA 2XG3A 2K2SA 2MPFA 2W2IA 4HVRA 2VXRA 2EIGA 2XWJB 3BPZA 3VZMA 3J7NA 2XJPA 1AR63 3WNMA 1H1IA 5C5TA 2C0ZA 4GWMA 2F4PA 1UU4A 3ACIA 4PBPA 5D1IA 2ERFA 2DF7A 2VW2A 3DEMA 4NIHA 1B09A 2WKKA 1WMEA 3D3AA 4DZGA 4KU7A 4XJAA 3GCXA 3N4MA 4ZU4A 1LOAA 2IXKA 1SHWB 3HN3A 3RZZA 3IPVB 2EAKA 4X6QB 1HQLA 1OPOA 1RUH1 2K9ZA 3THPA 1RUI3 4AFCA 1UMZA 1O5UA 2UURA 3ZN4A 4AHWA 3Q8EA 4AR2A 4EJRA 1XYPA 3PURA 4D7YA 1G8WA 1LNSA 2DFCA 4PT6A 2FHRA 4WVMA 1DZRA 3IBMA 3TN91 2ARCA 2BV4A 5FZHA 1FPN2 2WNVB 3E5UA 4YWAA 3BOPA 3DECA 2DVDA 1X33A 2Q1MA 4HK9A 5FREA 1HJGA 3LGRA 5EQUA 5A33A 2VE1A 1RUE1 1PHMA 1X82A 3NO8A 3NJZA 5T5LA 2Q8EA 2VXJA 3FL7A 4F83A 1R5LA 1C1FA 2D6OX 5M0TA 1JU3A 4GH4B 2OA2A 5CBLA 4NR1A 4N7UA 4N9IA 3RRDA 1NCRC 1UOBA 4ZONA 1UKRA 4K1YA 4YW3A 3ZM8A 3C7FA 4NE9A 4DXTA 3DYOA 5C3QA 2OQ7A 3WHTA 2R041 1LOFA 5BNOB 3IPVA 2J7MA 4EN9B 1UOFA 1GZTA 4M01A 1PZ7A 5CB7A 4PDWC 5FCCA 1E57A 2WT2A 4JCKA 1S1AA 3NV1A 2TNFA 4MADA 4AYUA 4NOTA 4OCTA 5J37A 4ZS3A 2V4VA 2Z5WA 5GLUA 4E9KA 4IV1C 2B45X 2WNVA 1SLLA 3DGTA 4PQ9A 3RI8A 4FPYA 1XE0A 1NOVA 1HRI2 3G6JB 4GWJA 1W90A 3AJYA 3SMHA 2VOXA 4TTGA 1WZXA 4XFAA 3ILNA 3IDEA 3KV6A 4AVTA 4Q29A 1YQCA 5IVYA 4QM9A 5DMYA 4GQ7A 4GH4A 4HN0A 1U0AA 3OSDA 4PLOA 5SV8A 1W6OB 1XPWA 2XJVA 4IEZA 3H42B 5F2WA 5KHJA 1J59A 4Y26A 1W3XA 1MZEA 1K45A 3BGAA 1RUI1 5JOXA 2RM23 2V5YA 4Q0SA 5DABA 3RYKA 1O5LA 1VRBA 4WM8B 3HQRA 1HB1A 1SFPA 3ZKYA 1UY2A 1KD7A 3VDDC 1KITA 3T0BA 5EV7A 4IV3B 2FDIA 5LY2A 3WQBA 2VNVA 1DLCA 4IE7A 3H9AA 3OCPA 4JZRA 4XCAA 4Y22B 3ZLIA 5C3SA 2ES3A 4UFKA 3MLJA 1LB2A 1MS8A 1SG3A 2E7AA 5F6KA 1A78A 1SLIA 2RG4A 2XL9A 1D4M2 1Q8OA 5LA1A 2YXSA 2VW1A 2WSUA 3N3HA 1GP5A 4AHXA 5FP7A 1OD3A 3AP9A 3AP6A 4Y20B 1RXFA 4K21A 2PHRA 2ZGLA 3LWCA 1CAVB 1GOFA 5GJ6A 1UU5A 5I0DA 3J7HA 4KG8A 5F3GA 3DV8A 1QOTA 3FMGA 2WDBA 5CKNA 3B7NA 1HV1A 1OXCA 3GYDA 4AI2A 1MQTA 3OBAA 4XJUA 4AE2A 3AL6A 2VUAA 4AQ6A 1PGL2 4L0PA 2VQTA 3ZYHA 2NQYA 1L7LA 2B9VA 5DPNA 3RJRA 1YI9A 1AR71 2FDHA 4WM8A 5CKMA 4L92A 5FZ9A 4R4XA 4OMJA 3DYMA 3QLQA 4DY3A 1ULPA 5JOYA 3TOJA 5LRRA 2WZPP 4LIVA 4COUA 5HI0A 5A3WA 2HWE3 4XW3A 1W0NA 3WHUA 4BXFA 4HKLA 2RS33 1C5IA 4XBNA 1YC61 1CPMA 3LDBA 4FOYA 1ZRIA 5F5IA 3KS7A 3FWEA 2JG9B 3NNJA 3EO6A 1PK6C 4YFZA 5A3UA 4PHZA 3ZMOA 1V0AA 3FX3A 4P5YA 4COVA 1CAVA 1SDDB 3T1MA 4K1ZA 2KD7A 3ITQA 2RM21 1M4WA 4AQSA 3U11A 1VAVA 4QXBA 3UL2A 1U12A 4FAGA 4P9GA 5FOBB 2ZEYA 4QGNA 4TZDA 3M1HA 2ZX3A 1WMFA 1Y4WA 2D3PA 4QX7A 3T1LA 1AJOA 1XQNA 3ZXFA 4Z82A 4JHZA 1NXD1 1SFNA 3WDUA 1OIPA 1PZ9A 4RYDA 2J1TA 2GALA 3AP7A 5FP3A 2CNAA 3AKQA 5IT6A 5T3NA 1WCSA 1EY2A 4I0WB 2XB6C 3AFKA 4QU1A 3OJBA 1RUH2 1OLQA 2WR9A 3ES4A 2WWJA 1ZZ9A 3JB8A 4LA3A 3VD3A 1GP6A 2HEVF 1UW8A 1MVQA 5KXEA 4P14A 2D97A 3A0KA 4XUQA 4PI0A 5L9BA 2JDUA 4OLLA 3TN92 3B7MA 3VHRA 5IYYA 3G7DA 3I3BA 4QDRA 1DQ0A 3LKJA 4GALA 1AUAA 4CCJA 4BLIA 4WVZA 1RUE2 1GWLA 3SITA 1RUD3 2XLFA 4KBZA 4XQ4A 5ACA3 1WW6A 5JR7B 4JGYC 4X6RB 5JLVA 2Q1FA 3AFGA 1S2BA 2BWAA 2VMGA 2Y34A 4LKSA 5T5PA 5FPLA 2JD9A 1Q56A 2HWE1 4XUTA 3K4ZA 4M3CA 3MPPG 1EAH3 2RS31 3O0WA 5IHRA 4LULA 3OY8B 1QHDA 5FPVA 2OPWA 2R042 2MHFA 4KNCA 4XACA 3MI8A 3ZN6B 4CDQC 4R9AA 1Q8VA 2ZX4A 2AEZA 3OGVA 2XKPA 4JQRA 1F15A 4KBBA 4QHBA 4XTMA 2VZTA 3AVSA 5GLWA 2DCYA 4JTNA 4RGAA 4XOGA 4IEQA 4GAZA 2ZGQA 4CP0A 1OQDA 1LENA 4ES8A 5JZGA 3T30A 2IXHA 4JGZB 2FDFA 2ADEA 2H6BA 1O4YA 1WW7A 3IMNA 1YJLA 4LK7A 2CHHA 2H0BA 2OUJA 3IMMA 1W2NA 3NAPB 3VGIA 4YM1A 5IVFA 1OD5A 1CN1A 4CCDA 5DZEA 1GOHA 1KEXA 3P6BA 5A6QA 3O1OA 5F5CA 4UW6A 2RJ2A 2Q30A 4R52A 5CEHA 2DBNA 3A4UA 4P9IA 4LUKA 4Q4W3 1W2UA 1AX2A 1LODA 1QXJA 1RUI2 4LNVA 1N3PA 3LIGA 3S7EA 4AL9A 5L7OB 4CDXA 1RHI3 2D6MA 4YGDA 1XNBA 5GLZA 4BCUA 4AI1A 1VBB3 3OY8A 1FNYA 4JVAA 1ZA7A 2D5HA 2YFZA 1GUIA 3SLIA 4B29A 5HPOA 2IUWA 2ZEZA 4FPEA 3HQUA 4INDA 1QXPA 2XH6A 5HCHA 2YU1A 3TRSB 1BK1A 2EXJA 1YI7A 1DGRA 4BOWA 3T3YA 1JW6A 5GLTA 4AXOA 1I6XA 5I0SA 3RFRA 3WP6A 4C0HA 2HBUA 4Y1ZA 1QU0A 1W2TA 1BZWA 1RUD1 2WFF1 1W06A 2YC0A 1K3IA 1Z7S3 1FNZA 4FPFA 2EIBA 3FN9A 3BYWA 5JMCA 1LESA 1DGLA 3SH3A 5DDJ3 1RJ7A 1QDOA 3BTXA 2JDPA 5EIYB 4M0HA 3NAPA 1SFYA 1EAH1 2GH2A 4P08A 4W65A 3POYA 5FP8A 2PMWB 2C9KA 3H7YA 4Y33A 2ZPXA 5AC93 3ACLA 1IG3A 4FI9A 3FLRA 3B02A 1IQAA 4FPOB 4I30A 2FCUA 4XJ8A 3KM5A 3ZFFC 1AVBA 3M70A 5FYCA 1UYZA 1YYNA 5FXVA 3ZXDA 2GN3A 4LLOA 4XF1A 5L7OA 1XNKA 1AR72 2X5IB 1ZBE3 2ZMKA 4QHOA 1A3KA 3WT3A 1HQNA 2DVGA 2VCMA 3OBRA 4IEUA 5C9AC 1LU2A 4OZXA 4LBJA 4A7YA 1X9PA 1QKQA 2ILMA 5K7PA 1FV3A 5CFDA 5DAQA 3OD0A 3RYRA 3AKSA 4S2DA 1O3RA 4IEWA 1Z78A 1AXYA 2JDZA 2WT1A 2XJRA 4LA2A 1ZZ6A 3CIHA 5DUXA 3BIWE 4LBKA 5D21A 2A6ZA 4SLIA 2OXBA 4XZUG 1EPWA 3KHCA 2ZBJA 5FQ0B 2BWCA 4V1PA 2WL1A 4CP2A 1AHSA 4RFT0 2BGPA 2VTXA 3I97A 4KGQA 5BNNC 4OQ8A 3POEA 4Q0PA 3ZPYA 4Q4W1 2QE3A 1PIV3 2DUQA 4UBGA 3UJQA 3VD5A 2RM22 3KGZA 2UU8A 3FFZA 1RHI1 3AP4A 4FO9A 4Y1VA 1PM4A 1VBB1 2W1QA 2XDVA 2WWSA 5A7QA 1DZQA 5JAXA 3D6EA 3U0ZA 4HKWA 3ZFEC 2ZZJA 5BNPB 4OI2A 5EJ1B 2O14A 5HV0A 2XQRA 1OPMA 2VULA 2UWAA 4N43C 1V6MA 2X5IA 5EXOA 3DXUA 2Y6JA 5FZCA 3RSJA 3W21A 2XVGA 5FUNA 1W6QA 4BQ5A 2Y6HA 5E8AA 4UT5A 3UNPA 1LOEA 2YUEA 3LEMA 4XUPA 2A7AA 1LHVA 1TG7A 1VBE3 2E63A 4AAPA 4BIFA 4CXWA 1V6NA 1Z7S1 3RZLA 1O3SA 3OBZA 1S2KA 2C6SA 1LKNA 1QDCA 1EV13 4XE9A 1BYHA 5DDJ1 1WWYA 3VBOB 3WINE 4AOCA 4E2GA 3WW3A 5C4WB 1V6IA 2ARAA 2O0OA 4XHXA 4DB5A 1OOPB 4NVPA 5FQ0A 2PHXA 4Q8KA 2VG9A 3AB0A 4XJZA 3TEYA 1URXA 4RQPC 5IK4A 3Q8BA 3K4AA 4OI1A 5AC91 4NHXA 4DUWA 5F3EA 4Z2WA 4FXKB 1HDKA 4Q2FA 3TB0A 4XFHA 1W9TA 2Z79A 2UY9A 3ROUA 3SKJE 1P8JA 3VBUC 1ZBE1 1JH5A 1BCXA 4QAWA 1GZ9A 5EFUA 1RVF3 4BK4A 1RYYA 1VBA3 4CCKA 1O4TA 4OHZA 3TEWA 3MFAA 3ILRA 4ITCA 5F2SA 2ZACA 5CISA 2BOJA 3V0AB 1N1SA 2VZRA 2BFUS 2A75A 4JTOA 4WM7B 4IE5A 4LEJA 4XC9A 5LA2A 5LEJA 1OQEA 2RS32 4XQWA 5DAWA 1CIWA 4DS0A 5KC6A 3GZTB 3UGHA 3LCPA 4FBFA 2DTWA 5LBCA 4AEKA 4YVWC 4QDSA 2CV6A 5T52A 3VBOA 2BFUL 1PIV1 1XU2A 1LAJA 4YW4A 5GZEA 1UMIA 2RDRA 3ASIA 2UYAA 3ORJA 2LROA 5DUUA 2B5HA 5G05L 4AFDA 5JPNB 4UFHA 1SCRA 2Y6KA 3GJBA 3SXWA 4FPGA 4DXZA 4QXHA 5FMCA 4N9HA 3ECQA 2QDNA 3NQHA 1J83A 2VUCA 2Y0IA 4IE6A 4LJHA 1ENXA 4OYUA 1YFXA 3T4HB 1DBNA 4FT8A 2HWC3 1WLTA 2JE8A 1S0GA 2WT0A 2XQXA 3OBTA 4AHZA 1OF3A 4ET7A 2XVKA 1SLAA 1W9FA 4IESA 3FJSA 2WNVC 4LUMA 3V0AA 4WM7A 2ZCWA 1EV11 2BEOA 1JI6A 3WCSA 3WW4A 1STMA 5C8CB 3MF9A 3ZN5A 3KCYA 4FVVA 4YM0A 4FPCA 4GH4C 5LCWL 1ALYA 2UWCA 1S0DA 2XUEA 4EV0A 5FZ1A 4XF0A 5LBFA 3MZHA 3HBZA 5K8SA 4YW7A 4AZZA 3GJAA 5EHDA 5F3IA 2D6LX 1G9AA 1W2OA 3JCIA 4GMP3 5FYMA 3PTRB 3N9OA 3TBDA 2LRPA 1WLCA 4Y3OA 3I2JA 3HMYA 4D8MA 1WCQA 2WIIB 5BNOC 1RVF1 1HKDA 1RUD2 2WFF2 1VBA1 4XABA 3UK9A 3I54A 1RIRA 3J9SA 1RUG3 1LTEA 3LSDA 4N8MA 3ZMNA 4LXLA 1OF4A 4DFSA 1OUXA 3KV4A 5FMOS 4JDOA 1AL23 3BU7A 4NPMA 2YDEA 3WUDA 2BZDA 5LK5A 4ZPIA 2Y8KA 4YZ4A 1EAH2 3E5QA 3N9QA 1G6NA 4XPVA 4NIDA 2QQMA 1OFNA 4JDNA 2V73A 1QMJA 3VZNA 1FOD3 4MX3A 4HK8A 4QQHA 5FZGA 1WCDJ 1W2AX 2J1EA 2O8QA 5FMOL 4YGBA 2YPDA 3J7MA 3WEZA 1RUOA 5C8CA 5K0UC 2OX0A 4MYEA 4NIIA 3UKTA 3UKNA 2BOIA 1I5PA 2Q5TA 1UOGA 4HLTA 3FUOA 3GXUA 4A2UA 5A70A 5CYYA 4AFBA 3LEGA 2WNOA 4HANA 1RL3A 1APNA 1LOGA 1UF2C 4WM8C 4Q1RA 2PAEA 4LBLA 1DU3D 2RMU3 2LALA 4Q4Y3 5FMBA 2QBXA 1ONAA 2HWC1 2ETEA 4IV3C 3WSOA 4AVVA 3KQRA 5CAZA 3O1UA 4K8FA 1MEC3 5FZ7A 3RQ0A 3WNNA 5LEKA 5FBZA 4DXSA 4Q4W2 3O5SA 4BQYA 4XUNA 1GQPA 2G9GA 3MIHA 3PDQA 1ND3C 1RHI2 2JG8A 3M8LA 4A7KA 2H6CA 3ZXEA 1EPZA 1VBB2 2PHWA 2PQQA 4XYXA 2E26A 5FMDA 1GNYA 2DBIA 4QKDA 4CU6A 3MW3A 4MO3M 3R0RA 3AKRA 2DVBA 4GJYA 3AZYA 4GMP1 2PHFA 1Y43B 5IATA 3ZSJA 3KV5A 1CQ9A 2JXAA 1NUKA 4MVTA 2XBO3 4IEVA 3ZOIA 4QMAA 4ZXKA 4W50A 1W99A 3VBFB 1Z7S2 1JMUB 2ZX2A 5I0RA 1RUG1 4QKFA 1UXXX 1AL21 1C57A 5DDJ2 2G1MA 4QDQA 3BODA 3KVBA 1QJEA 1PMJX 3CBNA 3NNFA 1S4CA 1E5SA 3ZFGC 4X8PA 3H8XA 1G9FA 1NA1A 4YVSA 1YJKA 3KV9A 2E32A 4NHLA 1FOD1 4IUGA 5F9TA 4A6SA 1SLCA 3U07A 3WW2A 4BLJA 2L9LA 2FBEA 2W95A 4CDXB 1ZBE2 5EJ3A 3AXEA 2GH8A 3KCCA 1Z0HA 4NRPA 2JG9C 2VGDA 4CDUB 1R083 2FZ1A 2VCBA 3Q8GA 1CX4A 3OUIA 5C70A 1DQ2A 1OH4A 5KWRA 3THTA 2QQLA 1IG0A 2V09A 4QPGC 2AYHA 2E6VA 2WZR3 1KS4A 2RMU1 4LKEA 2WNEA 3M3CA 4HMZA 4Q4Y1 5A3MA 1JXNA 4LBQD 4RR3B 2HEYF 4JKKA 4HSLA 1K5MC 5CVRA 4C90A 1H1MA 3M3IA 5FJKA 1MEC1 1AXZA 4XFGA 3B74A 1UZVA 4FP2A 4MZUA 2H0VA 4XAEA 5GM0A 3THCA 2OYZA 5D2AA 1PIV2 1UKGA 5FKBA 2WAOA 2DCKA 5G04L 1FX5A 3IAPA 1XOYA 2ET1A 1QJY3 5FP9A 1W0OA 3AMHA 4CE8A 1H4GA 2R6QA 2AUYA 1UIJA 1LHOA 1FYUA 4UW5A 3C7HA 1GBGA 4M4RA 3DPRC 4YFWA 3L9JT 3H1YA 2LTNA 4HOOA 5FZDA 2ZGRA 2ZGNA 1HV0A 2AACA 2C24A 1PZ8A 2WS93 3UESA 3POFA 5J7MA 1KXGA 2XBO1 1UPIA 3NNLA 2VVFA 2RR13 1MPXA 2WO2A 2I74A 4K9SA 1H30A 1F5JA 3MIEA 1X7NA 3URFA 3B9CA 4QXCA 1JZ7A 4GD4A 5F32A 3HEIA 2VQUA 4UYBA 2OKXA 1EV12 1RXGA 2GC1A 4MUVA 4AEDC 2VAUA 3HT2A 5L9VA 1DYKA 3IDAA 5CFCB 1W6NB 3OF1A 4RR3A 3I2OA 3WXPA 3LDRA 4NN0A 1B35C 1DQ6A 2YGLA 4Z8BA 2ZMNA 5KR7A 1I1EA 1WLWA 2PTMA 2VZ3A 1CVNA 5LW9A 1W8HA 2GAUA 3WNOA 4OHWA 1UZWA 1PM7A 3CZJA 1UZYA 3GHNA 2R0FA 2A3WA 1AUYA 4HZFA 4CEWA 4B4RA 2Y38A 1G86A 4GXLA 5BXXA 1N47A 4Z1VA 1RVF2 2LUWA 4B3NA 4EYUA 1VBA2 3MYXA 1R081 4CDWC 2W39A 2D40A 3LF7A 3I2KA 1LGBA 1GQHA 5GLVA 2WZR1 4CPBD 2JE9A 1DLLA 4FSJA 3OEAA 4JGZC 4LHNA 1O59A 4Z2AA 2QQOA 1UY4A 2JDYA 4G9SB 4IEYA 1XXNA 4NHKA 3VUOA 1MS9A 2C5DA 4XDPA 5H9PA 4AI8A 4FTEA 3NAPC 5CFCA 1W6NA 2ZKLA 4WZCA 1S2EA 1BVP1 2BNNA 3HWJA 1XSQA 3AYEA 4MHRA 3PG7A 4M3CE 4NAOA 1JYNA 5JMOA 2XHKA 1JYIA 3W5NA 3DUIA 3GALA 2VZVA 4B7KA 1VB4A 5DZFA 1F35A 1V6KA 3FFQA 2K46A 3KT7A 3V64A 2VBBA 5A80A 2WS91 3RZGA 2XJSA 1WA6X 2HWC2 2Z69A 3AXDA 2GC2A 2P34A 2VNOA 4LBOA 5BYNA 2VD7A 3K46A 1RTVA 3O1SA 3NKTA 1SCSA 2R0HA 2GNTA 2VZ1A 4H14A 5IFPA 1QJZA 2Q0AA 4B7EA 1AR61 2OZ6A 1BVVA 1Q8SA 3LZZA 1Q43A 1WLDA 4ES9A 4E4DX 3AL5A 1UU6A 5C71A 3K3OA 4CJ6A 1TVGA 5ANNA 1W8FA 3AKTA 5FZOB 2VUJA 5FOJB 2VW0A 1D4VB 4QT6A 4XFFA 4ISRA 1MQTB 3R6SA 2OW4A 2ZTNA 1Q8QA 3KZ4C 3WP3A 1AYN2 4LBQB 1NCQC 3M3QA 4BQ1A 2ZMLA 4C8DA 4IGOA 5A7SA 1OT5A 2J1VA 3SISA 2XLAA 4EWEA 1OLRA 4GKYA 3RWNA 1RUG2 3ZIWA 3BTYA 2RS13 3JUUA 2X5IC 1AL22 1J1TA 3MGUA 2JIGA 5FAXA 3IDCB 4EZHA 3EXUA 5FDBA 4FXGB 3K77A 1GANA 2A5ZA 5D8AB 4YGEA 2IWGB 2ZOEB 2WQZC 4YG3A 1DFQA 3MV11 1BK0A 1D2SA 3ENRA 1FOD2 1POQA 4QHZA 4RGGA 2GP3A 3TNQA 1W0PA 1OC1A 3W20A 1JODA 5FY0A 1UYPA 4YYOA 5FFOC 3MLLA 3WQ1A 5I8TA 1KDKA 4IE4A 2ZGPA 4URTA 1SLTA 3VBSB 5AFBA 4XQDA 1YIPA 3H7JA 1S55A 1SDWA 1V00A 2RDQA 1GICA 4OHXA 5FZOA 4CCOA 4E4ZA 1JUIA 1EUUA 2WLPA 1VAKA 5JVVA 1MVEA 4J1XA 1H6XA 3FBMA 4CIZA 2XONA 4LBQA 4A45A 1D0GA 2RMU2 4PBOA 3CKHA 4Q4Y2 5T55A 1OHFA 3AX4A 5J09A 5H9SA 5HXVA 5IJRA 1OURA 2P3YA 5BNPC 2EVXA 2BERA 1GFF2 2JD4A 2RJKA 4KWLA 3UKVA 5JXJA 4QGLA 1MEC2 2RHPA 2P3JA 2WBKA 3SHRA 2WNUC 3C7EA 5D8AA 2WAAA 3CMGA 1JZ6A 2K0GA 3RMXA 2X09A 4H3WA 2PN5A 4LE4A 4LO6B 1UX6A 4OMCA 1OA3A 4YM3A 1VBD3 1R093 3DKQA 3USUA 5F3CA 5JI9A 5CZKA 5L73A 5C4WC 1DZTA 5T54A 2WO3A 2AGSA 1OOPC 1ULDA 1JOJA 3NV3A
chains in the Genus database with same CATH topology
3Q8GA 3HX3A 4J7PA 4OMJA 3W67A 1OLMA 4CJ6A 2D4QA 3PG7A 4OMKA 3B7ZA 3P7ZA 3W68A 4M8ZA 1OLME 3B74A 4UYBA 1OIPA 1OIZA 3PEGA 1AUAA 3HY5A 1O6UA 3B7NA 4FMMA 2E2XA 4TLGA 1R5LA 5LZ6A 4J7QA 4CIZA 3B7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8G A;  3HX3 A;  4J7P A;  4OMJ A;  3W67 A;  1OLM A;  4CJ6 A;  2D4Q A;  3PG7 A;  4OMK A;  3B7Z A;  3P7Z A;  3W68 A;  4M8Z A;  1OLM E;  3B74 A;  4UYB A;  1OIP A;  1OIZ A;  3PEG A;  1AUA A;  3HY5 A;  1O6U A;  3B7N A;  4FMM A;  2E2X A;  4TLG A;  1R5L A;  5LZ6 A;  4J7Q A;  4CIZ A;  3B7Q A; 
#chains in the Genus database with same CATH topology
 3R4S A;  2VM9 A;  3D4K A;  3VBS A;  4BWO A;  4RS5 B;  1W8U A;  2XBO 2;  4EN0 A;  4QX1 A;  1AZD A;  5C6C A;  3GF6 A;  1QH7 A;  4PCR A;  2XPJ A;  4WVV A;  4KU8 A;  2BRT A;  5FYT A;  1W6M B;  1O3T A;  2RS1 1;  1SQ4 A;  2WQ4 A;  1R64 A;  3B00 A;  5B4N A;  2FCV A;  2WA3 A;  2QJV A;  2EIC A;  2DWR A;  2VEC A;  2XXZ A;  3DKW A;  4I0A A;  4NHY A;  4PF5 A;  1ZZC A;  3H3Z A;  2XJT A;  2EAA A;  3CJI A;  5CNA A;  2ZGO A;  4HL0 A;  4M3C B;  3T2O A;  5J96 B;  4OMD A;  5FUP A;  4XDO A;  1MS4 A;  3SNM A;  1PNF A;  4WM7 C;  2R06 3;  1GYK A;  4E2S A;  2JEM A;  2CU5 A;  4COW A;  4RFR B;  4W6X A;  1GU3 A;  2BW8 A;  4YZ1 A;  2VZO A;  1VPH A;  3LIH A;  5CG9 A;  3ZXK A;  2VQA A;  1AYM 3;  3WNK A;  1CR7 A;  2B39 A;  4QB6 A;  1R08 2;  1Y9Q A;  1W8Z A;  4DXR A;  5JZG B;  2DTY A;  3WF2 A;  5DG2 A;  1KDM A;  5FPZ A;  1J3P A;  4CPB A;  5E1R A;  3OEB A;  2GC3 A;  2E31 A;  1PO1 3;  4IGQ A;  2WZR 2;  4CTE A;  4E4S A;  4RD7 A;  4RS5 A;  5IVE A;  1HXS 3;  2CTV A;  2QCS B;  2VMC A;  4IQP A;  1JZ4 A;  5FZ4 A;  5FZK A;  1KFU L;  4HET A;  1BEV 3;  1LGC A;  2YB7 A;  4CZS A;  1W6M A;  3ACF A;  4CSW A;  1ZBA 3;  3N35 A;  2UYB A;  3FUQ A;  2YY1 A;  3ZYI B;  1H2N A;  3WDW A;  3LOB A;  4DNY A;  4LMF A;  2X05 A;  5DUW A;  5FZA A;  1RIT A;  1RED A;  2ARX A;  2QTW B;  3ZDV A;  2QQV A;  4TN7 A;  3JU9 A;  3ZR5 A;  3SCF A;  1VB2 A;  2ET7 A;  2LM3 A;  1U5X A;  1R09 1;  3NWK A;  4U2A A;  2AH2 A;  1DYP A;  4UW4 A;  5DG1 A;  4M8Z A;  3A21 A;  3INA A;  2G19 A;  1YIF A;  4U36 A;  1KQR A;  3P3N A;  1OVP A;  1QOS A;  2VR4 A;  1YHF A;  1GMM A;  2EIE A;  3MHZ A;  3PTY A;  1RC6 A;  1NYW A;  4FPH A;  2WS9 2;  3VV1 A;  2VUD A;  4GIQ A;  3ILF A;  1HB3 A;  4AF9 A;  3SCG A;  1A6C A;  2B46 X;  4CCM A;  1V6L A;  2ZX1 A;  1H4H A;  3OPZ A;  4QPI B;  1CIY A;  2CAU A;  5HXM A;  3PHM A;  1PO2 3;  2I07 B;  4XFB A;  1AR6 2;  1WKY A;  1ZRR A;  4CXY A;  2O8O A;  1ND2 B;  2JEC A;  4AVC A;  5A6X A;  1RJ8 A;  4CEY B;  1FV2 A;  5F8P A;  2E53 A;  2MEV 3;  2P4E A;  2ZHN A;  3HNM A;  5GZD A;  1UZZ A;  3WF3 A;  4NHM A;  4BQ2 A;  3UYJ A;  2R06 1;  1WGP A;  4NO4 A;  2A3Y A;  2Z4F A;  5FYS A;  3I4I A;  3WF1 A;  5L19 A;  1JYT A;  3U10 A;  2TEP A;  2ZZQ A;  2E33 A;  5J48 A;  1JYX A;  3RGB A;  1ASJ 3;  2PHD A;  3LA2 A;  4DMI A;  4ZZ5 A;  3AYC A;  1AYM 1;  2QQI A;  3S7I A;  4B1M A;  4QB1 A;  3PIG A;  1JN2 P;  5CFD B;  2P6C A;  1SLB A;  2PQS A;  2JX9 A;  2WQ8 A;  1H2K A;  2FQP A;  2HKX A;  3B7Q A;  1PO1 1;  3NKG A;  3LB9 A;  2ZS6 B;  4HBN A;  4LTA A;  1HXS 1;  1A8D A;  4OMK A;  5AVP A;  4I01 A;  3KF3 A;  4CCC A;  2WLQ A;  4NRQ A;  5ABJ C;  1BEV 1;  2VZS A;  1CX1 A;  5ACA 1;  2JKX A;  4QPI A;  1YFY A;  1ZBA 1;  5F6L B;  1S0B A;  1YFW A;  3FHA A;  3ZVX A;  4K7J A;  1ND2 A;  5FXW A;  3U75 A;  4PDW B;  4CEY A;  4D3W A;  1VAL A;  1XE7 A;  3ZXL A;  4QX2 A;  4UAP A;  2B42 B;  4NMI A;  3U78 A;  1W9Y A;  5GZC A;  1W8N A;  1XRU A;  2RDS A;  2V72 A;  3LDK A;  4I0B A;  3BPS A;  1DF0 A;  2QFE A;  5FWE A;  1NKG A;  4RGK A;  5FZB A;  3I2G A;  5FZ8 A;  4BM8 A;  4DO0 A;  2QQU A;  4LE3 A;  4MGQ A;  1ZZ8 A;  1DGW A;  4KH9 A;  2W1U A;  1W6Q B;  1O4Z A;  2J42 A;  4FFI A;  5FYU A;  3JXS A;  4CVU A;  2CSG A;  1NQD A;  2XJQ A;  1NZC A;  2ZGS A;  3KQ4 B;  1H0B A;  3MW4 A;  3PVB B;  1ENS A;  2I2S A;  4MGI E;  2YHJ A;  1PO2 1;  1AR8 3;  3J26 N;  4NIA A;  4DRR A;  3GNE A;  1NCR A;  2IXL A;  4HXC A;  4MXW A;  2BJS A;  1S0F A;  2ZEW A;  1VRH 3;  4M0N A;  4KWK A;  1C8N A;  1Y7B A;  2MEV 1;  3VBF C;  4LT5 A;  3T2P A;  5JIA A;  5F1R A;  1ULF A;  3KT1 A;  2HEW F;  1US2 A;  3RZM A;  5DZG A;  1GZC A;  3H50 A;  4JRL A;  3M3O A;  4ERO A;  3WG1 A;  3OB8 A;  4WBB A;  4MGT A;  3IT8 A;  4PDW A;  2YPJ A;  1PVC 3;  4XJ9 A;  1ASJ 1;  4FAH A;  4DRV A;  1XC6 A;  5KHK A;  1TZO A;  3AZV A;  3D8C A;  3B7Z A;  3P7Z A;  3PL0 A;  2XJU A;  3ACH A;  2HJI A;  5AVA A;  5LK7 B;  3HD8 B;  1AL0 G;  4HFS A;  4IV1 A;  4K20 A;  1H8V A;  2RS1 2;  4ZHN A;  1WMD A;  4Y5T A;  1FT9 A;  3H8R A;  5EYY A;  5FY8 A;  1IPS A;  1ZZ7 A;  4AFM A;  4DEV A;  1GNZ A;  3N9N A;  2A73 B;  1TMF 3;  4CDU C;  2VZP A;  2ZEX A;  1GNH A;  1POV 3;  2E2X A;  2DVA A;  1KRI A;  3POG A;  4UW3 A;  1R1A 3;  2QNK A;  2HLE A;  4KGG A;  4LHL A;  1IPJ A;  1H2L A;  2BP6 A;  1H6Y A;  3F2Z A;  4RR3 C;  3ZXJ A;  1AF9 A;  3RZK A;  2VQ0 A;  3APB A;  5CA6 A;  4HKO A;  4TXW A;  4XET A;  4IDZ A;  4FCA A;  1NZI A;  1ENR A;  2CY6 A;  4W8J A;  3ZSE A;  4L11 A;  3VDD A;  1W05 A;  2X29 A;  2BGO A;  5KXC A;  3O1T A;  1W03 A;  3KF5 A;  3WP5 A;  4YG6 A;  2NZ9 A;  1V70 A;  1HRV 3;  3AZX A;  2DDU A;  1WCU A;  1YEW A;  2SBA A;  2WO7 A;  5JI7 A;  4EWD A;  1C5H A;  1PX4 A;  2ID4 A;  3NJV A;  3R05 A;  1QNW A;  2QZ2 A;  3AVR A;  2ORX A;  4DIN B;  3UGG A;  2Y0O A;  2W68 A;  4DUV A;  1CJD A;  3TYJ A;  2J1A A;  1RMU 3;  5JOZ A;  2VPV A;  1PK6 B;  1UX7 A;  2CGP A;  1AR8 1;  4G4F A;  1OMI A;  2WYS A;  4XTP A;  3WR0 A;  2HWE 2;  1QEX A;  4S2F A;  5IWF A;  5FP4 A;  2XR4 A;  2R30 A;  2P3I A;  1VRH 1;  1WD3 A;  4J6G A;  4OUM A;  4EWA A;  1XBF A;  1R09 2;  1JZ5 A;  1YQ6 A;  1PX3 A;  1JZ8 A;  3QH6 A;  3POJ A;  2QQJ A;  3H3L A;  1JS9 A;  2EF6 A;  4XIL A;  5JDB A;  3QAC A;  3BTZ A;  5H9Q A;  5APA A;  4BQW A;  4FOV A;  4RA0 A;  4ARY A;  2VY0 A;  4MG2 A;  4OHY A;  2KM2 A;  1L7R A;  1QJX 3;  2XML A;  4TLF A;  4O7X A;  4QKN A;  3WY6 A;  2W1S A;  1PVC 1;  4O9E A;  4AAX A;  4BIO A;  4NPL A;  1MR5 A;  1QXR A;  3MW2 A;  4P9Y A;  3WZ1 A;  2ZA9 A;  1EP0 A;  1LOF C;  4XF4 A;  4XVH A;  1RUJ 3;  3VDC A;  2BUK A;  3DXT A;  3MBW A;  5A1F A;  2ADD A;  1WBF A;  1LUL A;  1FAT A;  2LW8 A;  4L8Q A;  3VB9 A;  4YAR A;  3O12 A;  4M00 A;  1OSG A;  1TMF 1;  1IGO A;  2DUP A;  1OLM A;  1NY7 1;  1POV 1;  4P9J A;  1A8M A;  1IS4 A;  1VBE 1;  5KC5 A;  1H8T B;  5FZ3 A;  1DP0 A;  3AK0 A;  2R06 2;  1PK6 A;  1W3V A;  1IPK A;  3QD6 A;  2YG0 A;  2QUO A;  4XAA A;  4DPN A;  1RUC 3;  4FPL A;  5JIU A;  5C3P A;  3PEG A;  2ORZ A;  5FPB A;  2G9Z A;  4UBH A;  5EZW A;  3PVN A;  5FXX A;  4XCB A;  3VBR B;  1JHJ A;  1AYM 2;  1ZNP A;  5FYB A;  2P1B A;  2P5B A;  4YGC A;  2PAM A;  3KSC A;  2D3S A;  3OGG A;  1Q3E A;  3TAY A;  1NG0 A;  2YGM A;  4BB3 A;  1QJU 3;  4P9W A;  4QQP A;  1HRV 1;  4Y24 A;  5F5A A;  1PO1 2;  4FFH A;  1IQD C;  4J25 A;  3SH5 A;  1HXS 2;  4JKL A;  5J36 A;  4WZF A;  1I5Z A;  5EJZ B;  4OUL A;  2ARB A;  4CP9 B;  1BEV 2;  3Q8C A;  4CCL A;  5ACA 2;  1RMU 1;  3BCW A;  5LRS A;  1ZBA 2;  3DF0 A;  5FR3 A;  2VBP A;  1NXM A;  2GC0 A;  2JJ6 A;  3E6D A;  4AGV A;  1YFU A;  4RL7 A;  4A42 A;  2DUR A;  2JG8 B;  3D0S A;  3I2I A;  3O1R A;  2DYC A;  2PLV 3;  1X8E A;  1H8T A;  2P6H A;  4P9X A;  3VBH B;  4MLO A;  3MIF A;  2Y33 A;  1VJ2 A;  3BKZ A;  4FFG A;  1ZYB A;  4LHK A;  1EYB A;  3CZU A;  2ZGT A;  2NYY A;  2EXK A;  2WWU A;  4AWD A;  1I3H A;  1QJX 1;  2CDP A;  2UY8 A;  3A22 A;  3GHM A;  4AEM A;  1LEC A;  2SLI A;  4XMA A;  2VCA A;  5IUQ A;  3VHP A;  2J1R A;  3VBR A;  3VZJ A;  4IER A;  5B2G B;  2QQP A;  4BK5 A;  3U37 A;  3UGF A;  2X10 A;  4JDM A;  1MQT C;  4D7S A;  4F3J A;  5FZE A;  2WJS A;  1RUJ 1;  1BJQ A;  2EA7 A;  4JGY A;  4MOA A;  4LBN A;  4LK6 A;  3WV6 A;  1PO2 2;  4C1W A;  4O61 A;  2X53 S;  3PVE A;  5ERL A;  2F6B A;  4Q0V A;  3UT0 A;  3WNX A;  5FWJ A;  3KHB A;  1VP6 A;  5A1L A;  4Q1P A;  4CCN A;  3MV0 1;  4CP9 A;  2R07 3;  4CDQ A;  1NA1 B;  4LIU A;  4XDQ A;  4YVS B;  3RYP A;  3U4X A;  1ZRF A;  2YFU A;  1AR9 3;  1CES A;  3AYD A;  1RUC 1;  3B93 A;  3O7O A;  4L99 A;  4XIK A;  3SQO A;  3N36 A;  2E9Q A;  2IXJ A;  1GP4 A;  1CJP A;  3V0B B;  4E2Q A;  2KXL A;  1ASJ 2;  3HAG A;  1SBF A;  5FLH A;  5FJH A;  3GM8 A;  3VBH A;  3T09 A;  1PMI A;  1N3O A;  1NQJ A;  2W47 A;  2B9U A;  3AMM A;  3U14 A;  3T2T A;  1KFX L;  2D6P A;  4YZ3 A;  3Q8F A;  1GKB A;  4S2G A;  1QJU 1;  1LEM A;  2XVL A;  1M06 G;  1VMF A;  2WA4 A;  3BOW A;  3VBS C;  3IIA A;  2LS6 A;  5A7W A;  1NLQ A;  2RV9 A;  3MUY 1;  4JKM A;  4OUE A;  3MUZ 1;  4BA6 A;  4D6R A;  1FAY A;  3GBW A;  5IVC A;  2VH9 A;  2ZXQ A;  3H8O A;  4QX5 A;  4ZZ8 A;  1GQG A;  1JBC A;  2AC1 A;  3J8F 3;  1C8M 3;  3DCQ A;  1KJL A;  1YQ2 A;  3ON7 A;  5LA9 A;  1CAX A;  1V6O A;  3WOG A;  4DUX A;  1DCS A;  1HW5 A;  2VO5 A;  2XLG A;  4UFI A;  5A7P A;  3VHN A;  4FTB A;  1V6J A;  1GWK A;  5C9A B;  4PF1 A;  2PLV 1;  2D7F A;  2E7Q A;  2J1U A;  2A70 A;  5ANQ A;  3KCX A;  3MO4 A;  3ZYG A;  5AC9 2;  2CGN A;  4HVO A;  2F4L A;  2JDK A;  1LJ7 A;  3WW1 A;  3RNS A;  3V0B A;  3W9A A;  3WDT A;  3HNB M;  1OVS A;  1SBE A;  5EWS A;  1PGW 1;  4P5H A;  1X8M A;  5FY7 A;  4BQ3 A;  5JXI A;  4LOR A;  4UI9 L;  4BME A;  5KBF A;  1XYN A;  1IS3 A;  1UY3 A;  3E5X A;  1F5F A;  1W8W A;  3LD8 A;  1AR8 2;  4XJW A;  4RS5 C;  2PYT A;  1F4A A;  4GMP 0;  4FTS A;  4DOU A;  1ST8 A;  4QX0 A;  3POI A;  2C26 A;  4PIZ A;  3ZYJ B;  2A1X A;  1VRH 2;  2P2K A;  2FDJ A;  3FBY A;  3MDP A;  5FY1 A;  4OI0 A;  5F7U A;  1DQ1 A;  1U5Z A;  2PFW A;  5FV3 A;  1NLR A;  2DU0 A;  3O0V A;  2R07 1;  4Q4V 3;  3WQ7 A;  3ATG A;  3ZFE B;  2RE9 A;  3NNG A;  1RUH 3;  3UJO A;  2Y6L A;  3VDA A;  3ZFF A;  1AR9 1;  1HB2 A;  1AXK A;  3OPW A;  3AKP A;  1CAW A;  4GUL A;  4Z92 B;  1D2Q A;  2NLR A;  4N43 B;  5A6Z A;  5I91 A;  1UOJ A;  2OT7 A;  4RHV 3;  1PVC 2;  3WQ0 A;  1J3Q A;  1NE6 A;  5KHH A;  3WUC A;  3VKO A;  3HY5 A;  5C9A A;  3P3P A;  4BXS V;  4CEW B;  4QPY A;  4IL7 A;  5FY5 A;  3THD A;  2A6Y A;  1W8T A;  4I2O A;  2ZAA A;  3M4F A;  4BQX A;  2V4A A;  3N7J A;  4OUS A;  4XXP A;  2EXI A;  4B4Q A;  2OUH A;  4QQ2 A;  4UOJ A;  4YPJ A;  3OYW B;  3N9L A;  3AP5 A;  2RDN A;  3H0O A;  3I49 A;  4MGY E;  2W0X A;  3W59 A;  3A7Q A;  1JYV A;  1TMF 2;  1UY0 A;  3O14 A;  2Q8C A;  3VD4 A;  1NY7 2;  5JZG C;  2Z42 A;  1E5R A;  3D82 A;  1VBE 2;  2OVU A;  4RQP B;  5FZ0 A;  3J8F 1;  1VR3 A;  1PVX A;  2Y60 A;  4QD2 A;  3BI3 A;  1C8M 1;  3RZJ A;  5BNN A;  3SH4 A;  1J3R A;  3GBF A;  4HN1 A;  3S0M A;  3V65 A;  5J3U A;  3QBQ A;  4N90 A;  3ZPO A;  1C4R A;  3VLB B;  4NUB A;  2WO1 A;  3EHK A;  2JKB A;  2W08 A;  1XB9 A;  5LY1 A;  2GME A;  5T50 A;  4E8D A;  3HOB A;  1K12 A;  2Y26 A;  4XEZ A;  5JR2 A;  4JX0 A;  1JZ2 A;  3ZFE A;  4LOS A;  5LBE A;  5SV5 A;  1WW5 A;  1WA4 A;  2J1S A;  1HRV 2;  2CDO A;  5DAV A;  4N43 A;  1N1T A;  3OG2 A;  4PQQ A;  3FLP A;  4CDX C;  3TEZ A;  1CON A;  1CGP A;  4AVB A;  3IDB B;  2WIN B;  4BPZ A;  4PLM A;  2QQN A;  5A7N A;  3PME A;  2BU9 A;  4E8C A;  1ZRC A;  2EAL A;  3JD7 3;  5IFT A;  2NMN A;  3NRU A;  2NN8 A;  4FPJ A;  4YVW B;  1RMU 2;  3OYW A;  3N9P A;  2D3R A;  1JU4 A;  2DV9 A;  3HBK A;  4W4Z A;  4YNI A;  4CU9 A;  5KXB A;  5IK8 A;  4X8N A;  2FMY A;  2PEL A;  2PA7 A;  4FQ4 A;  1LCL A;  2AEY A;  5FLI A;  1N3Q A;  1V9U 3;  1JHN A;  5GKA C;  2IVI B;  1HJF A;  4RQP A;  1GOG A;  4M3C F;  4QPI C;  4Q4V 1;  4YM2 A;  4D6S A;  3CHX A;  3PUA A;  4AQ2 A;  1O8P A;  1VAM A;  2R1D A;  3AMP A;  4HSJ A;  5T5O A;  3III A;  1ND2 C;  2QDR A;  2JE7 A;  4YW1 A;  3DYP A;  4CEY C;  1QJX 2;  4RHV 1;  4Q27 A;  3VBU A;  2ZJC A;  2R1B A;  3MFC A;  4ASL A;  1QJY 1;  2D4Q A;  1J84 A;  3NL1 A;  5EPA A;  3W68 A;  3X29 B;  5FIX A;  2Q4S A;  1PGS A;  4MSV A;  1RUJ 2;  3BVC A;  3I8T A;  3PNA A;  2HBT A;  2IXC A;  1UN1 A;  3MID A;  3GZE A;  3QOP A;  1QF3 A;  4FPK A;  5I0T A;  4AK3 A;  4YZ2 A;  5L7O C;  1O3Q A;  3CQO A;  1OIZ A;  3HJR A;  4ORF A;  4UXA A;  2B7Y A;  2GU9 A;  3N9M A;  1OQ1 A;  1T6G C;  1ODM A;  4ZKT B;  3EB7 A;  3RJ2 X;  4JHT A;  5CFD C;  4YVW A;  2RR1 1;  3RI9 A;  2MNG A;  3KVA A;  4LO4 B;  2W5F A;  4MET A;  4AI0 A;  4LOT A;  4J7Q A;  1JOB A;  4NRM A;  1RUC 2;  5FYI A;  1OH3 A;  2BGC A;  2A6W A;  2GMP A;  3T0D A;  4K6B A;  2QKD A;  3BTA A;  2W94 A;  3HPN A;  3AYA A;  1IKP A;  5FO8 B;  3E6B A;  2A6V A;  2E7T A;  4O9G A;  1QQP 3;  1QJU 2;  3AZW A;  3IM0 A;  1FMD 3;  2D98 A;  5E6H A;  4ATF A;  1AR7 3;  5HBA A;  3OUH A;  2R16 A;  4KQ7 A;  2FZ2 A;  1UPS A;  1CZT A;  5IVV A;  1E5H A;  1COV 3;  1ULG A;  4EZ4 A;  2GND A;  5FZM A;  3A23 A;  4I3G A;  4COY A;  4LO5 B;  4TLG A;  2JDM A;  3B94 A;  4XZP A;  3JD7 1;  5A1A A;  1NT0 A;  2BVB A;  2ZHL A;  3OGS A;  3VL9 A;  5JSR A;  2C4X A;  4QWN A;  3WDY A;  2IVJ A;  4W6Y A;  2VCC A;  4L9B A;  2C1F A;  5C8W A;  3OD4 A;  5K0U B;  4L2N A;  3I2F A;  1V9U 1;  5HCB A;  4HVQ A;  2ZHM A;  4AEJ A;  2PLV 2;  3MIB A;  4JC1 A;  1ENQ A;  4P9L A;  3USU B;  2CL2 A;  2GSY A;  3GGL A;  3KLS A;  1US3 A;  5CIR A;  1DYO A;  3VKN A;  4R4Z A;  3PJY A;  1TEI A;  4NAM A;  1MS3 A;  4XHB A;  1Y3T A;  3ZO0 B;  1PGW 2;  3GZA A;  3SC7 X;  5C3O A;  4JQT A;  3FE5 A;  3AC0 A;  5BNO A;  3MIG A;  1YQ5 A;  3HN1 A;  4NWW A;  1G9B A;  2C9A A;  1F31 A;  3BU0 A;  4FOW A;  1N1Y A;  2B8M A;  2VMH A;  2YBP A;  3JQX A;  2D6K A;  5JXH A;  4J1W A;  1F8V A;  4YRD A;  3ELN A;  2ZGK A;  4J7P A;  1ND3 B;  2VNR A;  3CJX A;  3EBR A;  3CJI B;  3I7D A;  1UMH A;  5J98 B;  5KXD A;  1MAC A;  3L2H A;  2R07 2;  1GR3 A;  1REE A;  2D6N A;  5L36 A;  4TYS A;  1AR9 2;  5I8Y A;  5JSP A;  4BQ4 A;  2UWB A;  4HON A;  5JSO A;  1OA2 A;  2IZW A;  5K0U A;  2PHU A;  4QX8 A;  4GJZ A;  4UFM A;  1GLH A;  5FZL A;  3UET A;  1WUV A;  1W6O A;  4UWD A;  2BBV A;  4KMQ A;  4PIX A;  5FPU A;  2D43 A;  3A0N A;  2Q8D A;  2Y6G A;  3J4U H;  4QX3 A;  4OQ9 A;  1QQP 1;  1S0J A;  3VBO C;  3MLK A;  1FMD 1;  1HIX A;  3PVO A;  3I59 B;  1IS5 A;  4CP1 A;  5K9Y A;  3HX3 A;  1SZB A;  3SEP A;  1COV 1;  1DDL A;  4JAA A;  4XFI A;  1IS6 A;  2VC9 A;  4LPL A;  3ZFG B;  4AVA A;  4IV3 A;  2W9X A;  4EN7 B;  2KR2 A;  2E51 A;  2WYF A;  2VTX J;  4AI3 A;  3J8F 2;  4Y22 A;  2F17 A;  3CU7 A;  3C7O A;  5C7G A;  1C8M 2;  2PHT A;  2R32 A;  2BQP A;  1BMV 1;  1ODN A;  3FZ3 A;  3VZK A;  2WC2 A;  3RDI A;  2G4I A;  4YW2 A;  3ETQ A;  5JXG A;  2VVE A;  4Q0Q A;  2W52 A;  3PU3 A;  4BYY A;  1ND3 A;  4CCE A;  3HNY M;  1XNC A;  4XFC A;  3PUH A;  2WFP A;  2CGO A;  2FDG A;  3B69 A;  4Y20 A;  5CU1 A;  3MIC A;  4YSF A;  5BV6 A;  3JQW A;  3B3Q E;  4FFF A;  3LPG A;  4HT1 T;  3LOI A;  3N7M A;  4QPG B;  4XXA A;  2WN2 A;  3ZXA C;  5F37 A;  5IK5 A;  1UCX A;  1H1A A;  1QOO A;  2HH9 A;  2RS5 3;  3PMS A;  4A44 A;  4N53 B;  4EQV A;  2HWF 3;  2HYX A;  3O0X A;  1K5M B;  1RB8 G;  3WNL A;  2HWB 3;  1H9P A;  2CAV A;  5AFE A;  1C28 A;  1XU1 A;  2WZE A;  1F4H A;  3I59 A;  3CO2 A;  3IWZ A;  3WG3 A;  3ZFG A;  3H3U A;  4LKD A;  3U4S A;  4GB3 3;  3Q8A A;  3ST7 A;  1E5I A;  1ZX5 A;  4Q4V 2;  5FYY A;  4EE2 A;  4QQO A;  3ZSM A;  3DPR B;  1BBT 3;  3LE0 A;  3QCW A;  3BN6 A;  4RHV 2;  3BB6 A;  5EP9 A;  1QJY 2;  1H8T C;  1KJR A;  1OFS A;  4C0B A;  2JG9 A;  2CWS A;  4UFL A;  1VBD 1;  5IVB A;  1TME 3;  1NE4 A;  4Q5O A;  2Q8O A;  3WG2 A;  1LHN A;  3KD4 A;  4OZO A;  4PIY A;  5A3L A;  1ZRE A;  1MS5 A;  3AMQ A;  5BPX A;  4W6W A;  1UO9 A;  4OVE A;  4QPG A;  5A3P A;  1ZRD A;  5A3T A;  4MGZ E;  5C8C C;  4AED B;  3VBR C;  1IZ3 A;  2W46 A;  4N53 A;  1OKQ A;  3ZSL A;  1UD1 A;  2GZW A;  2WFF 3;  3K75 B;  2DCT A;  3W58 A;  1K5M A;  1B35 B;  2X8K A;  1UNB A;  3GZU C;  2RR1 2;  4A41 A;  4CU7 A;  4BDV B;  4O65 A;  3I3E A;  2VJX A;  4KWJ A;  1JZ3 A;  3O1V A;  1DG6 A;  4LR4 A;  4Q26 A;  5I93 A;  3ZXG A;  3FHQ A;  2DCJ A;  3WNP A;  4JRA A;  3CDZ B;  4CDW B;  1OLM E;  1QIQ A;  4RSU A;  1YRZ A;  3DPR A;  1XND A;  4KI5 M;  2QZ3 A;  3RWK X;  2DUO A;  3CEW A;  5GZF A;  3SEE A;  5C33 A;  2JG8 C;  3PUS A;  2QVS B;  4XBL A;  4S2H A;  3KGL A;  2RS5 1;  3VBH C;  3DN7 A;  4D7T A;  2HWF 1;  3V56 A;  3PUQ A;  2XOM A;  3JD7 2;  4Y4R A;  4CUA A;  2HWB 1;  1UAI A;  1K42 A;  1HLC A;  3LAG A;  3S57 A;  2ZAH A;  1TE1 B;  2J22 A;  4FOQ A;  4ZXE A;  1JUH A;  2ZX0 A;  3GCW A;  4AED A;  2JIC A;  1DQ5 A;  5FY4 A;  4Y5Z 0;  5F39 A;  2VL4 A;  3WDX A;  1NCR B;  1V9U 2;  2JB4 A;  1QWR A;  2HWD 3;  4GB3 1;  1B35 A;  4MXW B;  4QXK A;  3EYP A;  2BNM A;  3OGJ A;  1VMH A;  4Y1X A;  4A7Z A;  4BZ4 A;  3ZYR A;  2OPK A;  3I2D A;  5L9R A;  1BBT 1;  5HV4 A;  1LED A;  1AJK A;  1L7Q A;  1NAE A;  1YLL A;  1YO8 A;  2VMI A;  3IB3 A;  4QM8 A;  4R9B A;  3VKF C;  5DAX A;  5EYX A;  4DY5 A;  3N7L A;  2R49 A;  2Q1Z B;  3NV4 A;  4XF9 A;  3WF4 A;  1YXW A;  3HT1 A;  4K40 A;  4LO7 A;  1F2N A;  3ZN6 A;  1NA1 C;  4YVS C;  5FTT C;  5JWP A;  4CDW A;  1TME 1;  5CG8 A;  1GZW B;  2YMZ A;  1S0E A;  3E1F 1;  4NJ4 A;  3MF6 A;  4F8A A;  3TNP B;  2ZGM A;  3JBG 3;  2YV8 A;  3NJX A;  3PU8 A;  4IV1 B;  4IW3 A;  2YZ4 A;  4LKF A;  3W5M A;  5ISL A;  2VU9 A;  1LOC A;  1W9W A;  1ZZB A;  3ABZ A;  3GBG A;  5FXZ A;  1RGS A;  4IEX A;  4PJY A;  4BHP A;  3W67 A;  4JGZ A;  1UL9 A;  3B9I A;  1S0C A;  2XHN A;  1SEF A;  1W04 A;  3POW A;  2YC2 A;  3LFM A;  1H9W A;  1MS1 A;  3B01 A;  2TUN A;  3C2U A;  4CUC A;  4TSV A;  1HB4 A;  2DU1 A;  5E88 A;  4UF0 B;  1NCQ B;  1IOA A;  4MHU A;  4NWV A;  2KA3 A;  2B4K A;  2A6X A;  5LBB A;  1RUF 3;  3VDD B;  3C7G A;  3GDB A;  1QQP 2;  1NLS A;  4CRQ A;  1FMD 2;  1N1V A;  5A3O A;  2XGX A;  3K51 A;  2EID A;  2VMD A;  1ULO A;  4OHV A;  3S5A A;  4G3Y C;  1COV 2;  1U5I A;  2QQK A;  1GWM A;  2WUH A;  2FD8 A;  3E97 A;  4A3X A;  1CD3 G;  1OKO A;  1GV9 A;  1BXH A;  3ZDS A;  1GZW A;  1VLN A;  5JUV A;  3VKL A;  1QGL A;  1BMV 2;  2EXH A;  3HVD A;  5A3N A;  1UIK A;  4BIS A;  1VE0 A;  3O1P A;  1ZA4 A;  4Z07 A;  4B1L A;  4D6Q A;  3RZH A;  2VME A;  3M3E A;  1VIW B;  3AZZ A;  3QH7 A;  4GWN A;  1LU1 A;  3VD7 A;  1VBC 3;  1Y9M A;  1FI2 A;  2HWD 1;  5LAT A;  4FMM A;  5FYV A;  5FK8 A;  4JV4 A;  3CLP A;  1QJF A;  3LFI A;  2VZU A;  4ISQ A;  3DL3 A;  4K8R B;  2RVA A;  2VBD A;  4NIG A;  4AVS A;  4LLF A;  3PJQ A;  3ZYF A;  3UV9 A;  3OGR A;  2JWP A;  1NCQ A;  2VNG A;  4QPW A;  4UF0 A;  5FPX A;  4V2W A;  4XUO A;  1DIW A;  4AGG A;  1X36 A;  1ZVF A;  1CZV A;  1DHK B;  1UYY A;  2A3X A;  3D0J A;  1XYO A;  3NV2 A;  3ZR6 A;  4OFG A;  3PIJ A;  3RG0 A;  1UWW A;  4OI4 A;  5E16 A;  3JBG 1;  4Q4X 3;  4PI2 A;  1TNF A;  1JTZ X;  3D5O A;  3M7A A;  4GA9 A;  5FY9 A;  2WNU B;  4F7Z A;  4CEW C;  1I9R A;  2O1Q A;  5A6Y A;  5CAD A;  5BY5 A;  3LSE A;  4QB2 A;  4L97 A;  5FZI A;  5FUI A;  4MGS A;  4MGK E;  2ZHK A;  3NW4 A;  4EN6 B;  5GZG A;  3K3N A;  4I02 A;  2W87 A;  4FP3 A;  1LHU A;  2ATF A;  2Y64 A;  2VOV A;  3RS6 A;  2IC1 A;  4QQL A;  3OUJ A;  2YBS A;  1X50 A;  4IXL A;  1LRH A;  3KT4 A;  1O91 A;  4YW6 A;  4BE3 A;  3HR9 A;  2JDH A;  1VBD 2;  4N7I A;  3N7K A;  1OUS A;  5HCA A;  5IVJ A;  1RUF 1;  1OI6 A;  4CXX A;  4LIT A;  1J58 A;  2NMO A;  3K2O A;  5CFC C;  1K5J A;  2GNM A;  1SMV A;  3KWV A;  5BUV A;  1O8S A;  2NP0 A;  2BBA A;  2V5D A;  1LOB A;  5FZ6 A;  2ZKN A;  2ZAB A;  4CU8 A;  2P37 A;  5BNP A;  2GDF A;  4H7M A;  3U1X A;  3K4D A;  1WW4 A;  4IE0 A;  4XMI A;  1PNG A;  2XUM A;  2VZQ A;  1FPN 3;  3IN9 A;  2P17 A;  1IKQ A;  3WVJ A;  1ACC A;  2WNU A;  2IXI A;  1ZM1 A;  4A3Z A;  4MV2 A;  4CYD A;  5KHI A;  4HPK B;  1VBC 1;  3ZKU A;  1X9T A;  4A4A A;  1AX0 A;  4BJ0 A;  3EJK A;  3POB A;  2AZ5 A;  2BPA 2;  4Q0U A;  1BQP A;  2G9F A;  3Q9O A;  5C4W A;  1R1A 1;  3I3M A;  2XWB B;  3ZYB A;  4R9D A;  3EMR A;  5K4L A;  1OOP A;  5LAS A;  4KWU A;  3BIE A;  5C3R A;  2P3K A;  2RS5 2;  3S6P A;  2HWF 2;  1PMH X;  2WN3 A;  3R4U A;  5IK7 A;  4E4H A;  4ZY9 A;  3FC0 A;  1HN1 A;  3WF0 A;  4CUG A;  4ZU7 A;  2HWB 2;  1HQW A;  4HG6 B;  1YQ8 A;  3H8U A;  4IEO A;  4IGP A;  2YRO A;  4JGY B;  5H9R A;  5ABJ A;  3ETP A;  2AR6 A;  4Q4X 1;  4YW5 A;  2D5F A;  2VOK A;  5LWB A;  3FLT A;  1MS0 A;  2ARE A;  2DCZ A;  2JDN A;  3VN4 A;  5C5U A;  3H1M A;  1UQX A;  4GB3 2;  1UY1 A;  2XL7 A;  2ENR A;  4Y5S A;  4DQA A;  5LA0 A;  4SBV A;  2BDR A;  3EQE A;  2CWM A;  4GWI A;  1R1Z A;  4LBM A;  3WX5 A;  2WRA A;  4WVW A;  4LQR A;  1FXZ A;  4B8E A;  4CDQ B;  1BBT 2;  2YBK A;  4AW7 A;  4FQZ A;  1HRI 3;  1XNT A;  1SPP B;  2GMM A;  1T6B X;  1TNR A;  4HPK A;  5FZF A;  3IKW A;  4BMB A;  3P5B A;  1BHG A;  1L3J A;  1O7F A;  3ZX7 A;  1POV 0;  1VMJ A;  1TME 2;  1CAU B;  2WSV A;  2Z2S B;  3I3D A;  4A6O A;  4GZ9 A;  4LO8 A;  3K48 A;  3USS A;  3JZV A;  1ULE A;  1KS5 A;  1QNY A;  4RN5 A;  5JPM B;  1AYN 3;  3MPB A;  5KHG A;  1JOP A;  1WCK A;  2I45 A;  4K3U A;  3H1W A;  4ASM B;  2OZJ A;  3ME2 A;  1G9C A;  5A7W B;  3I3Q A;  4BH9 A;  1YUD A;  1W8O A;  2VVD A;  3E6C C;  1CPN A;  2GN7 A;  3TEX A;  4ASK A;  4UFJ A;  1FPN 1;  3PLQ A;  5DUV A;  3VZO A;  4KL1 A;  1S0I A;  2YYO A;  3RVH A;  1CAX B;  2D44 A;  2BVV A;  5FPA A;  2QQW A;  3LEK A;  5B4X A;  4CA9 A;  1D4M 3;  4QU2 A;  4TWT A;  5F5Q A;  2MEV 2;  2JIJ A;  4ARX A;  1QH6 A;  4ZU5 A;  5IAX A;  4R9C A;  4DEQ A;  5LZ6 A;  3S5Q A;  3VD9 A;  2Y6F A;  4MH0 E;  3FHI B;  1SPP A;  2W91 A;  5D8A C;  1F9K A;  1AX1 A;  3LA7 A;  3NNM A;  3POS A;  3ACG A;  5I0U A;  3AJZ A;  4COZ A;  2JEN A;  3NVC A;  1CAU A;  1WD4 A;  1QY4 A;  4H2A A;  3RPQ A;  5DXD A;  1Q5O A;  4WV8 A;  5ABJ B;  1XSR A;  5TSW A;  2AEN A;  2FMD A;  1BLZ A;  1HX6 A;  3AM2 A;  1DGR N;  2OQ6 A;  4YZ5 A;  2FDK A;  1DQ4 A;  2TBV A;  2RJL A;  3C8X A;  1W39 A;  2HWD 2;  4C1X A;  1SBD A;  3T2Q A;  4CUB A;  3KB5 A;  3ZIX A;  1XE8 A;  1JYW A;  1YCI A;  2W1W A;  2W3J A;  3PUI A;  1C3H A;  5LB6 A;  4DIQ A;  4AHY A;  3ZFF B;  1HRI 1;  3KMH A;  3NMB A;  2R7E B;  1JYC A;  1T2X A;  3CJI C;  1CAW B;  3C3V A;  4IEP A;  1D7P M;  1XJA A;  3HQX A;  4XF3 A;  4E27 A;  3RMY A;  1IHM A;  2GNB A;  4QKB A;  5T5J A;  3WDV A;  4PLN A;  2BNO A;  2HYK A;  1EUT A;  3JBG 2;  2WZ8 A;  4H7L A;  4Q8L A;  1AYN 1;  5FK7 A;  5DN2 A;  2DFB A;  3R4D B;  3CNA A;  3WP4 A;  2ZGU A;  5FYZ A;  4ZS2 A;  1O6U A;  4H55 A;  1WMX A;  1CWP A;  5FO9 B;  3WG4 A;  1MZF A;  1C1L A;  1J1L A;  4ONU A;  2BTV C;  5IAV A;  2NPI A;  5E89 A;  3ES1 A;  3LQC A;  2IFR A;  3ALQ A;  3L2Y A;  1W6P B;  5CKQ A;  3AMN A;  3VL8 A;  2IFW A;  2PXJ A;  2VOW A;  4XIO A;  4AFA A;  4C91 A;  3O1M A;  2CYF A;  2A71 A;  2XKO A;  4Y1U A;  1XNA A;  4V2V A;  4URA A;  1OA4 A;  2W92 A;  5BNN B;  1H2M A;  1MZ5 A;  1UYX A;  4I09 A;  3T4V A;  2VOT A;  3OOX A;  4AG4 A;  1D4M 1;  4ATE A;  3VDB A;  1G9D A;  3S30 A;  3WCR A;  1UXZ A;  3JB4 C;  5FBJ A;  1GSL A;  2DVF A;  4YLZ A;  2NM1 A;  3LEI A;  4IET A;  5DAP A;  5FYH A;  1RUF 2;  5A32 B;  4EN8 B;  1WBL A;  3IZO A;  3WLU A;  2D93 A;  3VZL A;  1TQ5 A;  2OS2 A;  3HIF A;  1W28 A;  4NRO A;  1BKZ A;  4P02 B;  1OBN A;  1LGN A;  4P00 B;  3ZSK A;  5DQ0 A;  1MZ6 A;  1YWK A;  2YU2 A;  3NST A;  4LHS A;  4YG0 A;  3SKV A;  5FLJ A;  3TN9 3;  5JOW A;  4XUR A;  1PGL 1;  1ULC A;  3CF6 E;  3NJY A;  4Y4Y A;  3TWI A;  4BU2 A;  5FO7 B;  4N53 C;  1REF A;  3ZYP A;  2PHL A;  3T08 A;  3I2H A;  1VBC 2;  3CL1 A;  1YNA A;  3LPF A;  1SAC A;  3F95 A;  5FKC A;  3BAL A;  1RUE 3;  5HCF A;  3VBF A;  2JDA A;  3J7L A;  2PAK A;  1W6P A;  5GAL A;  4AI9 A;  5FRA A;  2YC4 A;  5I8S A;  1R1A 2;  4D94 A;  3P1I A;  5J1X A;  1LR5 A;  5A7O A;  5IW0 A;  2FCT A;  4D0Q A;  2VTF A;  3OTF A;  1U5Y A;  4NPR A;  2BYV E;  2VMF A;  4GKX A;  3VBU B;  1W9S A;  3WD5 A;  1LHW A;  2R04 3;  3MEP A;  2N7G A;  1UZ0 A;  3SCH A;  4WVM B;  3VKM A;  4XBQ A;  4QGM A;  3B5L B;  4KG0 A;  4B4P A;  5A32 A;  1NX9 A;  2GP5 A;  3IAQ A;  4I3P A;  3VHO A;  1RUN A;  5BNQ A;  1D0H A;  1RIN A;  1Y9G A;  2WAB A;  4Q4X 2;  1Q8P A;  4D69 A;  2JB8 A;  1A34 A;  4M4P A;  4MXV A;  1HN0 A;  2OII A;  1CZS A;  3M2M A;  3OPT A;  3BUC A;  4AQT A;  4CDU A;  5A33 B;  4R8H A;  5JCT A;  4AGR A;  1DGW X;  1G7Y A;  3LA3 A;  4Y1Y A;  3T0A A;  1KGY A;  2XG3 A;  2K2S A;  2MPF A;  2W2I A;  4HVR A;  2VXR A;  2EIG A;  2XWJ B;  3BPZ A;  3VZM A;  3J7N A;  2XJP A;  1AR6 3;  3WNM A;  1H1I A;  5C5T A;  2C0Z A;  4GWM A;  2F4P A;  1UU4 A;  3ACI A;  4PBP A;  5D1I A;  2ERF A;  2DF7 A;  2VW2 A;  3DEM A;  4NIH A;  1B09 A;  2WKK A;  1WME A;  3D3A A;  4DZG A;  4KU7 A;  4XJA A;  3GCX A;  3N4M A;  4ZU4 A;  1LOA A;  2IXK A;  1SHW B;  3HN3 A;  3RZZ A;  3IPV B;  2EAK A;  4X6Q B;  1HQL A;  1OPO A;  1RUH 1;  2K9Z A;  3THP A;  1RUI 3;  4AFC A;  1UMZ A;  1O5U A;  2UUR A;  3ZN4 A;  4AHW A;  3Q8E A;  4AR2 A;  4EJR A;  1XYP A;  3PUR A;  4D7Y A;  1G8W A;  1LNS A;  2DFC A;  4PT6 A;  2FHR A;  4WVM A;  1DZR A;  3IBM A;  3TN9 1;  2ARC A;  2BV4 A;  5FZH A;  1FPN 2;  2WNV B;  3E5U A;  4YWA A;  3BOP A;  3DEC A;  2DVD A;  1X33 A;  2Q1M A;  4HK9 A;  5FRE A;  1HJG A;  3LGR A;  5EQU A;  5A33 A;  2VE1 A;  1RUE 1;  1PHM A;  1X82 A;  3NO8 A;  3NJZ A;  5T5L A;  2Q8E A;  2VXJ A;  3FL7 A;  4F83 A;  1R5L A;  1C1F A;  2D6O X;  5M0T A;  1JU3 A;  4GH4 B;  2OA2 A;  5CBL A;  4NR1 A;  4N7U A;  4N9I A;  3RRD A;  1NCR C;  1UOB A;  4ZON A;  1UKR A;  4K1Y A;  4YW3 A;  3ZM8 A;  3C7F A;  4NE9 A;  4DXT A;  3DYO A;  5C3Q A;  2OQ7 A;  3WHT A;  2R04 1;  1LOF A;  5BNO B;  3IPV A;  2J7M A;  4EN9 B;  1UOF A;  1GZT A;  4M01 A;  1PZ7 A;  5CB7 A;  4PDW C;  5FCC A;  1E57 A;  2WT2 A;  4JCK A;  1S1A A;  3NV1 A;  2TNF A;  4MAD A;  4AYU A;  4NOT A;  4OCT A;  5J37 A;  4ZS3 A;  2V4V A;  2Z5W A;  5GLU A;  4E9K A;  4IV1 C;  2B45 X;  2WNV A;  1SLL A;  3DGT A;  4PQ9 A;  3RI8 A;  4FPY A;  1XE0 A;  1NOV A;  1HRI 2;  3G6J B;  4GWJ A;  1W90 A;  3AJY A;  3SMH A;  2VOX A;  4TTG A;  1WZX A;  4XFA A;  3ILN A;  3IDE A;  3KV6 A;  4AVT A;  4Q29 A;  1YQC A;  5IVY A;  4QM9 A;  5DMY A;  4GQ7 A;  4GH4 A;  4HN0 A;  1U0A A;  3OSD A;  4PLO A;  5SV8 A;  1W6O B;  1XPW A;  2XJV A;  4IEZ A;  3H42 B;  5F2W A;  5KHJ A;  1J59 A;  4Y26 A;  1W3X A;  1MZE A;  1K45 A;  3BGA A;  1RUI 1;  5JOX A;  2RM2 3;  2V5Y A;  4Q0S A;  5DAB A;  3RYK A;  1O5L A;  1VRB A;  4WM8 B;  3HQR A;  1HB1 A;  1SFP A;  3ZKY A;  1UY2 A;  1KD7 A;  3VDD C;  1KIT A;  3T0B A;  5EV7 A;  4IV3 B;  2FDI A;  5LY2 A;  3WQB A;  2VNV A;  1DLC A;  4IE7 A;  3H9A A;  3OCP A;  4JZR A;  4XCA A;  4Y22 B;  3ZLI A;  5C3S A;  2ES3 A;  4UFK A;  3MLJ A;  1LB2 A;  1MS8 A;  1SG3 A;  2E7A A;  5F6K A;  1A78 A;  1SLI A;  2RG4 A;  2XL9 A;  1D4M 2;  1Q8O A;  5LA1 A;  2YXS A;  2VW1 A;  2WSU A;  3N3H A;  1GP5 A;  4AHX A;  5FP7 A;  1OD3 A;  3AP9 A;  3AP6 A;  4Y20 B;  1RXF A;  4K21 A;  2PHR A;  2ZGL A;  3LWC A;  1CAV B;  1GOF A;  5GJ6 A;  1UU5 A;  5I0D A;  3J7H A;  4KG8 A;  5F3G A;  3DV8 A;  1QOT A;  3FMG A;  2WDB A;  5CKN A;  3B7N A;  1HV1 A;  1OXC A;  3GYD A;  4AI2 A;  1MQT A;  3OBA A;  4XJU A;  4AE2 A;  3AL6 A;  2VUA A;  4AQ6 A;  1PGL 2;  4L0P A;  2VQT A;  3ZYH A;  2NQY A;  1L7L A;  2B9V A;  5DPN A;  3RJR A;  1YI9 A;  1AR7 1;  2FDH A;  4WM8 A;  5CKM A;  4L92 A;  5FZ9 A;  4R4X A;  4OMJ A;  3DYM A;  3QLQ A;  4DY3 A;  1ULP A;  5JOY A;  3TOJ A;  5LRR A;  2WZP P;  4LIV A;  4COU A;  5HI0 A;  5A3W A;  2HWE 3;  4XW3 A;  1W0N A;  3WHU A;  4BXF A;  4HKL A;  2RS3 3;  1C5I A;  4XBN A;  1YC6 1;  1CPM A;  3LDB A;  4FOY A;  1ZRI A;  5F5I A;  3KS7 A;  3FWE A;  2JG9 B;  3NNJ A;  3EO6 A;  1PK6 C;  4YFZ A;  5A3U A;  4PHZ A;  3ZMO A;  1V0A A;  3FX3 A;  4P5Y A;  4COV A;  1CAV A;  1SDD B;  3T1M A;  4K1Z A;  2KD7 A;  3ITQ A;  2RM2 1;  1M4W A;  4AQS A;  3U11 A;  1VAV A;  4QXB A;  3UL2 A;  1U12 A;  4FAG A;  4P9G A;  5FOB B;  2ZEY A;  4QGN A;  4TZD A;  3M1H A;  2ZX3 A;  1WMF A;  1Y4W A;  2D3P A;  4QX7 A;  3T1L A;  1AJO A;  1XQN A;  3ZXF A;  4Z82 A;  4JHZ A;  1NXD 1;  1SFN A;  3WDU A;  1OIP A;  1PZ9 A;  4RYD A;  2J1T A;  2GAL A;  3AP7 A;  5FP3 A;  2CNA A;  3AKQ A;  5IT6 A;  5T3N A;  1WCS A;  1EY2 A;  4I0W B;  2XB6 C;  3AFK A;  4QU1 A;  3OJB A;  1RUH 2;  1OLQ A;  2WR9 A;  3ES4 A;  2WWJ A;  1ZZ9 A;  3JB8 A;  4LA3 A;  3VD3 A;  1GP6 A;  2HEV F;  1UW8 A;  1MVQ A;  5KXE A;  4P14 A;  2D97 A;  3A0K A;  4XUQ A;  4PI0 A;  5L9B A;  2JDU A;  4OLL A;  3TN9 2;  3B7M A;  3VHR A;  5IYY A;  3G7D A;  3I3B A;  4QDR A;  1DQ0 A;  3LKJ A;  4GAL A;  1AUA A;  4CCJ A;  4BLI A;  4WVZ A;  1RUE 2;  1GWL A;  3SIT A;  1RUD 3;  2XLF A;  4KBZ A;  4XQ4 A;  5ACA 3;  1WW6 A;  5JR7 B;  4JGY C;  4X6R B;  5JLV A;  2Q1F A;  3AFG A;  1S2B A;  2BWA A;  2VMG A;  2Y34 A;  4LKS A;  5T5P A;  5FPL A;  2JD9 A;  1Q56 A;  2HWE 1;  4XUT A;  3K4Z A;  4M3C A;  3MPP G;  1EAH 3;  2RS3 1;  3O0W A;  5IHR A;  4LUL A;  3OY8 B;  1QHD A;  5FPV A;  2OPW A;  2R04 2;  2MHF A;  4KNC A;  4XAC A;  3MI8 A;  3ZN6 B;  4CDQ C;  4R9A A;  1Q8V A;  2ZX4 A;  2AEZ A;  3OGV A;  2XKP A;  4JQR A;  1F15 A;  4KBB A;  4QHB A;  4XTM A;  2VZT A;  3AVS A;  5GLW A;  2DCY A;  4JTN A;  4RGA A;  4XOG A;  4IEQ A;  4GAZ A;  2ZGQ A;  4CP0 A;  1OQD A;  1LEN A;  4ES8 A;  5JZG A;  3T30 A;  2IXH A;  4JGZ B;  2FDF A;  2ADE A;  2H6B A;  1O4Y A;  1WW7 A;  3IMN A;  1YJL A;  4LK7 A;  2CHH A;  2H0B A;  2OUJ A;  3IMM A;  1W2N A;  3NAP B;  3VGI A;  4YM1 A;  5IVF A;  1OD5 A;  1CN1 A;  4CCD A;  5DZE A;  1GOH A;  1KEX A;  3P6B A;  5A6Q A;  3O1O A;  5F5C A;  4UW6 A;  2RJ2 A;  2Q30 A;  4R52 A;  5CEH A;  2DBN A;  3A4U A;  4P9I A;  4LUK A;  4Q4W 3;  1W2U A;  1AX2 A;  1LOD A;  1QXJ A;  1RUI 2;  4LNV A;  1N3P A;  3LIG A;  3S7E A;  4AL9 A;  5L7O B;  4CDX A;  1RHI 3;  2D6M A;  4YGD A;  1XNB A;  5GLZ A;  4BCU A;  4AI1 A;  1VBB 3;  3OY8 A;  1FNY A;  4JVA A;  1ZA7 A;  2D5H A;  2YFZ A;  1GUI A;  3SLI A;  4B29 A;  5HPO A;  2IUW A;  2ZEZ A;  4FPE A;  3HQU A;  4IND A;  1QXP A;  2XH6 A;  5HCH A;  2YU1 A;  3TRS B;  1BK1 A;  2EXJ A;  1YI7 A;  1DGR A;  4BOW A;  3T3Y A;  1JW6 A;  5GLT A;  4AXO A;  1I6X A;  5I0S A;  3RFR A;  3WP6 A;  4C0H A;  2HBU A;  4Y1Z A;  1QU0 A;  1W2T A;  1BZW A;  1RUD 1;  2WFF 1;  1W06 A;  2YC0 A;  1K3I A;  1Z7S 3;  1FNZ A;  4FPF A;  2EIB A;  3FN9 A;  3BYW A;  5JMC A;  1LES A;  1DGL A;  3SH3 A;  5DDJ 3;  1RJ7 A;  1QDO A;  3BTX A;  2JDP A;  5EIY B;  4M0H A;  3NAP A;  1SFY A;  1EAH 1;  2GH2 A;  4P08 A;  4W65 A;  3POY A;  5FP8 A;  2PMW B;  2C9K A;  3H7Y A;  4Y33 A;  2ZPX A;  5AC9 3;  3ACL A;  1IG3 A;  4FI9 A;  3FLR A;  3B02 A;  1IQA A;  4FPO B;  4I30 A;  2FCU A;  4XJ8 A;  3KM5 A;  3ZFF C;  1AVB A;  3M70 A;  5FYC A;  1UYZ A;  1YYN A;  5FXV A;  3ZXD A;  2GN3 A;  4LLO A;  4XF1 A;  5L7O A;  1XNK A;  1AR7 2;  2X5I B;  1ZBE 3;  2ZMK A;  4QHO A;  1A3K A;  3WT3 A;  1HQN A;  2DVG A;  2VCM A;  3OBR A;  4IEU A;  5C9A C;  1LU2 A;  4OZX A;  4LBJ A;  4A7Y A;  1X9P A;  1QKQ A;  2ILM A;  5K7P A;  1FV3 A;  5CFD A;  5DAQ A;  3OD0 A;  3RYR A;  3AKS A;  4S2D A;  1O3R A;  4IEW A;  1Z78 A;  1AXY A;  2JDZ A;  2WT1 A;  2XJR A;  4LA2 A;  1ZZ6 A;  3CIH A;  5DUX A;  3BIW E;  4LBK A;  5D21 A;  2A6Z A;  4SLI A;  2OXB A;  4XZU G;  1EPW A;  3KHC A;  2ZBJ A;  5FQ0 B;  2BWC A;  4V1P A;  2WL1 A;  4CP2 A;  1AHS A;  4RFT 0;  2BGP A;  2VTX A;  3I97 A;  4KGQ A;  5BNN C;  4OQ8 A;  3POE A;  4Q0P A;  3ZPY A;  4Q4W 1;  2QE3 A;  1PIV 3;  2DUQ A;  4UBG A;  3UJQ A;  3VD5 A;  2RM2 2;  3KGZ A;  2UU8 A;  3FFZ A;  1RHI 1;  3AP4 A;  4FO9 A;  4Y1V A;  1PM4 A;  1VBB 1;  2W1Q A;  2XDV A;  2WWS A;  5A7Q A;  1DZQ A;  5JAX A;  3D6E A;  3U0Z A;  4HKW A;  3ZFE C;  2ZZJ A;  5BNP B;  4OI2 A;  5EJ1 B;  2O14 A;  5HV0 A;  2XQR A;  1OPM A;  2VUL A;  2UWA A;  4N43 C;  1V6M A;  2X5I A;  5EXO A;  3DXU A;  2Y6J A;  5FZC A;  3RSJ A;  3W21 A;  2XVG A;  5FUN A;  1W6Q A;  4BQ5 A;  2Y6H A;  5E8A A;  4UT5 A;  3UNP A;  1LOE A;  2YUE A;  3LEM A;  4XUP A;  2A7A A;  1LHV A;  1TG7 A;  1VBE 3;  2E63 A;  4AAP A;  4BIF A;  4CXW A;  1V6N A;  1Z7S 1;  3RZL A;  1O3S A;  3OBZ A;  1S2K A;  2C6S A;  1LKN A;  1QDC A;  1EV1 3;  4XE9 A;  1BYH A;  5DDJ 1;  1WWY A;  3VBO B;  3WIN E;  4AOC A;  4E2G A;  3WW3 A;  5C4W B;  1V6I A;  2ARA A;  2O0O A;  4XHX A;  4DB5 A;  1OOP B;  4NVP A;  5FQ0 A;  2PHX A;  4Q8K A;  2VG9 A;  3AB0 A;  4XJZ A;  3TEY A;  1URX A;  4RQP C;  5IK4 A;  3Q8B A;  3K4A A;  4OI1 A;  5AC9 1;  4NHX A;  4DUW A;  5F3E A;  4Z2W A;  4FXK B;  1HDK A;  4Q2F A;  3TB0 A;  4XFH A;  1W9T A;  2Z79 A;  2UY9 A;  3ROU A;  3SKJ E;  1P8J A;  3VBU C;  1ZBE 1;  1JH5 A;  1BCX A;  4QAW A;  1GZ9 A;  5EFU A;  1RVF 3;  4BK4 A;  1RYY A;  1VBA 3;  4CCK A;  1O4T A;  4OHZ A;  3TEW A;  3MFA A;  3ILR A;  4ITC A;  5F2S A;  2ZAC A;  5CIS A;  2BOJ A;  3V0A B;  1N1S A;  2VZR A;  2BFU S;  2A75 A;  4JTO A;  4WM7 B;  4IE5 A;  4LEJ A;  4XC9 A;  5LA2 A;  5LEJ A;  1OQE A;  2RS3 2;  4XQW A;  5DAW A;  1CIW A;  4DS0 A;  5KC6 A;  3GZT B;  3UGH A;  3LCP A;  4FBF A;  2DTW A;  5LBC A;  4AEK A;  4YVW C;  4QDS A;  2CV6 A;  5T52 A;  3VBO A;  2BFU L;  1PIV 1;  1XU2 A;  1LAJ A;  4YW4 A;  5GZE A;  1UMI A;  2RDR A;  3ASI A;  2UYA A;  3ORJ A;  2LRO A;  5DUU A;  2B5H A;  5G05 L;  4AFD A;  5JPN B;  4UFH A;  1SCR A;  2Y6K A;  3GJB A;  3SXW A;  4FPG A;  4DXZ A;  4QXH A;  5FMC A;  4N9H A;  3ECQ A;  2QDN A;  3NQH A;  1J83 A;  2VUC A;  2Y0I A;  4IE6 A;  4LJH A;  1ENX A;  4OYU A;  1YFX A;  3T4H B;  1DBN A;  4FT8 A;  2HWC 3;  1WLT A;  2JE8 A;  1S0G A;  2WT0 A;  2XQX A;  3OBT A;  4AHZ A;  1OF3 A;  4ET7 A;  2XVK A;  1SLA A;  1W9F A;  4IES A;  3FJS A;  2WNV C;  4LUM A;  3V0A A;  4WM7 A;  2ZCW A;  1EV1 1;  2BEO A;  1JI6 A;  3WCS A;  3WW4 A;  1STM A;  5C8C B;  3MF9 A;  3ZN5 A;  3KCY A;  4FVV A;  4YM0 A;  4FPC A;  4GH4 C;  5LCW L;  1ALY A;  2UWC A;  1S0D A;  2XUE A;  4EV0 A;  5FZ1 A;  4XF0 A;  5LBF A;  3MZH A;  3HBZ A;  5K8S A;  4YW7 A;  4AZZ A;  3GJA A;  5EHD A;  5F3I A;  2D6L X;  1G9A A;  1W2O A;  3JCI A;  4GMP 3;  5FYM A;  3PTR B;  3N9O A;  3TBD A;  2LRP A;  1WLC A;  4Y3O A;  3I2J A;  3HMY A;  4D8M A;  1WCQ A;  2WII B;  5BNO C;  1RVF 1;  1HKD A;  1RUD 2;  2WFF 2;  1VBA 1;  4XAB A;  3UK9 A;  3I54 A;  1RIR A;  3J9S A;  1RUG 3;  1LTE A;  3LSD A;  4N8M A;  3ZMN A;  4LXL A;  1OF4 A;  4DFS A;  1OUX A;  3KV4 A;  5FMO S;  4JDO A;  1AL2 3;  3BU7 A;  4NPM A;  2YDE A;  3WUD A;  2BZD A;  5LK5 A;  4ZPI A;  2Y8K A;  4YZ4 A;  1EAH 2;  3E5Q A;  3N9Q A;  1G6N A;  4XPV A;  4NID A;  2QQM A;  1OFN A;  4JDN A;  2V73 A;  1QMJ A;  3VZN A;  1FOD 3;  4MX3 A;  4HK8 A;  4QQH A;  5FZG A;  1WCD J;  1W2A X;  2J1E A;  2O8Q A;  5FMO L;  4YGB A;  2YPD A;  3J7M A;  3WEZ A;  1RUO A;  5C8C A;  5K0U C;  2OX0 A;  4MYE A;  4NII A;  3UKT A;  3UKN A;  2BOI A;  1I5P A;  2Q5T A;  1UOG A;  4HLT A;  3FUO A;  3GXU A;  4A2U A;  5A70 A;  5CYY A;  4AFB A;  3LEG A;  2WNO A;  4HAN A;  1RL3 A;  1APN A;  1LOG A;  1UF2 C;  4WM8 C;  4Q1R A;  2PAE A;  4LBL A;  1DU3 D;  2RMU 3;  2LAL A;  4Q4Y 3;  5FMB A;  2QBX A;  1ONA A;  2HWC 1;  2ETE A;  4IV3 C;  3WSO A;  4AVV A;  3KQR A;  5CAZ A;  3O1U A;  4K8F A;  1MEC 3;  5FZ7 A;  3RQ0 A;  3WNN A;  5LEK A;  5FBZ A;  4DXS A;  4Q4W 2;  3O5S A;  4BQY A;  4XUN A;  1GQP A;  2G9G A;  3MIH A;  3PDQ A;  1ND3 C;  1RHI 2;  2JG8 A;  3M8L A;  4A7K A;  2H6C A;  3ZXE A;  1EPZ A;  1VBB 2;  2PHW A;  2PQQ A;  4XYX A;  2E26 A;  5FMD A;  1GNY A;  2DBI A;  4QKD A;  4CU6 A;  3MW3 A;  4MO3 M;  3R0R A;  3AKR A;  2DVB A;  4GJY A;  3AZY A;  4GMP 1;  2PHF A;  1Y43 B;  5IAT A;  3ZSJ A;  3KV5 A;  1CQ9 A;  2JXA A;  1NUK A;  4MVT A;  2XBO 3;  4IEV A;  3ZOI A;  4QMA A;  4ZXK A;  4W50 A;  1W99 A;  3VBF B;  1Z7S 2;  1JMU B;  2ZX2 A;  5I0R A;  1RUG 1;  4QKF A;  1UXX X;  1AL2 1;  1C57 A;  5DDJ 2;  2G1M A;  4QDQ A;  3BOD A;  3KVB A;  1QJE A;  1PMJ X;  3CBN A;  3NNF A;  1S4C A;  1E5S A;  3ZFG C;  4X8P A;  3H8X A;  1G9F A;  1NA1 A;  4YVS A;  1YJK A;  3KV9 A;  2E32 A;  4NHL A;  1FOD 1;  4IUG A;  5F9T A;  4A6S A;  1SLC A;  3U07 A;  3WW2 A;  4BLJ A;  2L9L A;  2FBE A;  2W95 A;  4CDX B;  1ZBE 2;  5EJ3 A;  3AXE A;  2GH8 A;  3KCC A;  1Z0H A;  4NRP A;  2JG9 C;  2VGD A;  4CDU B;  1R08 3;  2FZ1 A;  2VCB A;  3Q8G A;  1CX4 A;  3OUI A;  5C70 A;  1DQ2 A;  1OH4 A;  5KWR A;  3THT A;  2QQL A;  1IG0 A;  2V09 A;  4QPG C;  2AYH A;  2E6V A;  2WZR 3;  1KS4 A;  2RMU 1;  4LKE A;  2WNE A;  3M3C A;  4HMZ A;  4Q4Y 1;  5A3M A;  1JXN A;  4LBQ D;  4RR3 B;  2HEY F;  4JKK A;  4HSL A;  1K5M C;  5CVR A;  4C90 A;  1H1M A;  3M3I A;  5FJK A;  1MEC 1;  1AXZ A;  4XFG A;  3B74 A;  1UZV A;  4FP2 A;  4MZU A;  2H0V A;  4XAE A;  5GM0 A;  3THC A;  2OYZ A;  5D2A A;  1PIV 2;  1UKG A;  5FKB A;  2WAO A;  2DCK A;  5G04 L;  1FX5 A;  3IAP A;  1XOY A;  2ET1 A;  1QJY 3;  5FP9 A;  1W0O A;  3AMH A;  4CE8 A;  1H4G A;  2R6Q A;  2AUY A;  1UIJ A;  1LHO A;  1FYU A;  4UW5 A;  3C7H A;  1GBG A;  4M4R A;  3DPR C;  4YFW A;  3L9J T;  3H1Y A;  2LTN A;  4HOO A;  5FZD A;  2ZGR A;  2ZGN A;  1HV0 A;  2AAC A;  2C24 A;  1PZ8 A;  2WS9 3;  3UES A;  3POF A;  5J7M A;  1KXG A;  2XBO 1;  1UPI A;  3NNL A;  2VVF A;  2RR1 3;  1MPX A;  2WO2 A;  2I74 A;  4K9S A;  1H30 A;  1F5J A;  3MIE A;  1X7N A;  3URF A;  3B9C A;  4QXC A;  1JZ7 A;  4GD4 A;  5F32 A;  3HEI A;  2VQU A;  4UYB A;  2OKX A;  1EV1 2;  1RXG A;  2GC1 A;  4MUV A;  4AED C;  2VAU A;  3HT2 A;  5L9V A;  1DYK A;  3IDA A;  5CFC B;  1W6N B;  3OF1 A;  4RR3 A;  3I2O A;  3WXP A;  3LDR A;  4NN0 A;  1B35 C;  1DQ6 A;  2YGL A;  4Z8B A;  2ZMN A;  5KR7 A;  1I1E A;  1WLW A;  2PTM A;  2VZ3 A;  1CVN A;  5LW9 A;  1W8H A;  2GAU A;  3WNO A;  4OHW A;  1UZW A;  1PM7 A;  3CZJ A;  1UZY A;  3GHN A;  2R0F A;  2A3W A;  1AUY A;  4HZF A;  4CEW A;  4B4R A;  2Y38 A;  1G86 A;  4GXL A;  5BXX A;  1N47 A;  4Z1V A;  1RVF 2;  2LUW A;  4B3N A;  4EYU A;  1VBA 2;  3MYX A;  1R08 1;  4CDW C;  2W39 A;  2D40 A;  3LF7 A;  3I2K A;  1LGB A;  1GQH A;  5GLV A;  2WZR 1;  4CPB D;  2JE9 A;  1DLL A;  4FSJ A;  3OEA A;  4JGZ C;  4LHN A;  1O59 A;  4Z2A A;  2QQO A;  1UY4 A;  2JDY A;  4G9S B;  4IEY A;  1XXN A;  4NHK A;  3VUO A;  1MS9 A;  2C5D A;  4XDP A;  5H9P A;  4AI8 A;  4FTE A;  3NAP C;  5CFC A;  1W6N A;  2ZKL A;  4WZC A;  1S2E A;  1BVP 1;  2BNN A;  3HWJ A;  1XSQ A;  3AYE A;  4MHR A;  3PG7 A;  4M3C E;  4NAO A;  1JYN A;  5JMO A;  2XHK A;  1JYI A;  3W5N A;  3DUI A;  3GAL A;  2VZV A;  4B7K A;  1VB4 A;  5DZF A;  1F35 A;  1V6K A;  3FFQ A;  2K46 A;  3KT7 A;  3V64 A;  2VBB A;  5A80 A;  2WS9 1;  3RZG A;  2XJS A;  1WA6 X;  2HWC 2;  2Z69 A;  3AXD A;  2GC2 A;  2P34 A;  2VNO A;  4LBO A;  5BYN A;  2VD7 A;  3K46 A;  1RTV A;  3O1S A;  3NKT A;  1SCS A;  2R0H A;  2GNT A;  2VZ1 A;  4H14 A;  5IFP A;  1QJZ A;  2Q0A A;  4B7E A;  1AR6 1;  2OZ6 A;  1BVV A;  1Q8S A;  3LZZ A;  1Q43 A;  1WLD A;  4ES9 A;  4E4D X;  3AL5 A;  1UU6 A;  5C71 A;  3K3O A;  4CJ6 A;  1TVG A;  5ANN A;  1W8F A;  3AKT A;  5FZO B;  2VUJ A;  5FOJ B;  2VW0 A;  1D4V B;  4QT6 A;  4XFF A;  4ISR A;  1MQT B;  3R6S A;  2OW4 A;  2ZTN A;  1Q8Q A;  3KZ4 C;  3WP3 A;  1AYN 2;  4LBQ B;  1NCQ C;  3M3Q A;  4BQ1 A;  2ZML A;  4C8D A;  4IGO A;  5A7S A;  1OT5 A;  2J1V A;  3SIS A;  2XLA A;  4EWE A;  1OLR A;  4GKY A;  3RWN A;  1RUG 2;  3ZIW A;  3BTY A;  2RS1 3;  3JUU A;  2X5I C;  1AL2 2;  1J1T A;  3MGU A;  2JIG A;  5FAX A;  3IDC B;  4EZH A;  3EXU A;  5FDB A;  4FXG B;  3K77 A;  1GAN A;  2A5Z A;  5D8A B;  4YGE A;  2IWG B;  2ZOE B;  2WQZ C;  4YG3 A;  1DFQ A;  3MV1 1;  1BK0 A;  1D2S A;  3ENR A;  1FOD 2;  1POQ A;  4QHZ A;  4RGG A;  2GP3 A;  3TNQ A;  1W0P A;  1OC1 A;  3W20 A;  1JOD A;  5FY0 A;  1UYP A;  4YYO A;  5FFO C;  3MLL A;  3WQ1 A;  5I8T A;  1KDK A;  4IE4 A;  2ZGP A;  4URT A;  1SLT A;  3VBS B;  5AFB A;  4XQD A;  1YIP A;  3H7J A;  1S55 A;  1SDW A;  1V00 A;  2RDQ A;  1GIC A;  4OHX A;  5FZO A;  4CCO A;  4E4Z A;  1JUI A;  1EUU A;  2WLP A;  1VAK A;  5JVV A;  1MVE A;  4J1X A;  1H6X A;  3FBM A;  4CIZ A;  2XON A;  4LBQ A;  4A45 A;  1D0G A;  2RMU 2;  4PBO A;  3CKH A;  4Q4Y 2;  5T55 A;  1OHF A;  3AX4 A;  5J09 A;  5H9S A;  5HXV A;  5IJR A;  1OUR A;  2P3Y A;  5BNP C;  2EVX A;  2BER A;  1GFF 2;  2JD4 A;  2RJK A;  4KWL A;  3UKV A;  5JXJ A;  4QGL A;  1MEC 2;  2RHP A;  2P3J A;  2WBK A;  3SHR A;  2WNU C;  3C7E A;  5D8A A;  2WAA A;  3CMG A;  1JZ6 A;  2K0G A;  3RMX A;  2X09 A;  4H3W A;  2PN5 A;  4LE4 A;  4LO6 B;  1UX6 A;  4OMC A;  1OA3 A;  4YM3 A;  1VBD 3;  1R09 3;  3DKQ A;  3USU A;  5F3C A;  5JI9 A;  5CZK A;  5L73 A;  5C4W C;  1DZT A;  5T54 A;  2WO3 A;  2AGS A;  1OOP C;  1ULD A;  1JOJ A;  3NV3 A; 
#chains in the Genus database with same CATH homology
 3Q8G A;  3HX3 A;  4J7P A;  4OMJ A;  3W67 A;  1OLM A;  4CJ6 A;  2D4Q A;  3PG7 A;  4OMK A;  3B7Z A;  3P7Z A;  3W68 A;  4M8Z A;  1OLM E;  3B74 A;  4UYB A;  1OIP A;  1OIZ A;  3PEG A;  1AUA A;  3HY5 A;  1O6U A;  3B7N A;  4FMM A;  2E2X A;  4TLG A;  1R5L A;  5LZ6 A;  4J7Q A;  4CIZ A;  3B7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...