1O77A

Crystal structure of the c713s mutant of the tir domain of human tlr2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
146
structure length
141
Chain Sequence
b'ICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWSKYELDFSHFRLFAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TOLL-LIKE RECEPTOR 2
publication title An Extensively Associated Dimer in the Structure of the C713S Mutant of the Tir Domain of Human Tlr2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/membrane protein
total genus 42
structure length 141
sequence length 146
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2002-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 1o77A00
4C6RA 4FZ5A 4OM7A 4LQCA 2M1XA 3UB3A 2J67A 1FYXA 3JRNA 5H3CA 2Y92A 4C6SA 2Z5VA 4EO7A 3UB2A 4C6TB 4W8GA 1FYWA 3OZIA 4LQDA 4C7MA 4W8HA 5FORA 1T3GA 1FYVA 3H16A 3UB4A 1O77A 4DOMA 4C6TA 2JS7A 5KU7A 4LZPA
chains in the Genus database with same CATH superfamily
4RHEA 3ZNPA 2IH4A 3RSQA 1DUIA 3G85A 4LBWA 3O1HB 1WCIA 1DCMA 1MG0A 4Y0AA 2PSFA 2NIPA 1K27A 4HWGA 2O8DA 3KCQA 2JVJA 4JLBA 1IUPA 1UBFA 4UUPA 4CKXA 1AUOA 3MWLA 1QE3A 5L40A 3FYUB 3H2IA 4CMIB 1EDBA 4RQAA 2R96A 3JAKA 2FWAA 3B3GA 2WMYA 3I83A 5AHXA 1ISIA 3SHOA 2JEZA 1E3WA 3G1TA 1N9ZA 3TQSA 3FCUB 1CQXA 1QZTA 2XMGA 5DBEX 1CQJB 1R4MB 2RAVA 3CH5A 2ZIFA 3P5SA 2JK1A 5LCXA 3OT4A 2E4YA 4RHXA 5BXYA 1U2RA 1XZMA 3IQFA 3E9DA 2A4KA 2EAUA 2C94A 2C7VA 3WBFA 1JQLB 3ISJA 1QFMA 3THSA 4D8TA 1ZI6A 2FW7A 2ANCA 3N5CA 1V6AA 1K2VN 4LVUA 2FR0A 4G3XA 1FZQA 2VWHA 1BMFD 5JJ5A 4WH0A 1KI8A 2VF7A 3PSHA 5FUBA 1R9MA 3LT5A 3R0VA 1PVOA 2P5UA 5E8RA 1WXEA 3G1UA 2BZSA 2R1TB 1ZUIA 1AQLA 1J06A 1FMLA 2NVUA 3PFGA 4KH0A 5EE1A 2CLHB 3OZAA 4XJVA 5TGDA 1N34B 1F2TB 1CYEA 1ZIYA 4OKIA 1V1RA 5HIAA 1V5WA 5E3IA 3ZU3A 2DPHA 3RUCA 2ZEJA 1VKJA 4OXXA 4UBKA 4ZI5A 5B1IA 1R18A 1KQGA 3K2BA 2JATA 3BXEA 3CGWA 3GHHA 1E6LA 2L42A 2RHJA 4FDLA 1YJAA 1MC8A 1NYRA 1WUIS 5INTA 1TK3A 1ZOLA 3FWNA 5JZVA 2OKGA 1IBMB 1THZA 4OM8A 3WDKA 4G26A 3PZBA 5JG7A 3FPGA 2G1KA 2H1WA 1I36A 1UBMS 2PBFA 3IP6A 4Y2XA 3PYLA 2XD4A 3DTTA 1Q74A 3EAGA 1X94A 3X1MA 3K73O 1CC1S 1N5IA 2ZUWA 1JFFB 4OVKA 5CLQA 2VDJA 1CF4A 3FWHA 4FK8A 4OATA 5CVDA 3ZDDA 1Y1KE 3PS9A 4J1SA 1F48A 3VX4A 3TUJC 3DM9B 3ROPA 1U2QA 1VJ0A 5KYGA 1RRVA 5HFNA 5AHOA 3T7IA 2RGEA 1EKXA 3AY0A 4QDXA 1JG7A 2CCJA 3IHWA 4H6PA 2HEGA 4HH0A 5K6TA 4TKVB 4KW7A 1RM0A 5AW7A 5LYJF 1FDRA 1XTPA 1Q77A 3SVZA 4OAOA 1NPYA 1T8PA 1NMXA 2Z6VA 2GTHA 4KNVA 4QTZA 4GSKA 1MO3A 2GO7A 2W11A 5LZ9A 1M7HA 2QIPA 4DJ5X 1AKUA 3TTSA 1XDZA 1ZH0A 2HSJA 2VI5A 4FT4A 1JEDA 3QMMA 4D4LA 1JQ5A 4NYIQ 4B2IA 1S3FA 1VC2A 1V5GA 2XMRA 5P8WA 3AVYA 1BHJA 1II8B 4UAGA 5FBKA 1KVRA 3JU3A 4JROA 4BTVA 5SY6A 3TTYA 1UT5A 4BO9A 4EGJA 4NCAA 5C80A 4YRTA 2BGGA 5CNKA 1YOBA 2W00A 3CLUC 3K71B 3IV9A 4KCGA 1KQNA 2IU4A 3JV7A 1D2CA 5SYNA 1TF7A 5CCEA 1NXSA 4YP7A 1WUHS 1XKXA 3KD2A 3KKKA 5HTKA 3F1KA 4L85A 3UEOA 1SPXA 3LMKA 1XA3A 2QSZA 3JZMA 4KI0A 5FOXA 1RJ9B 4XGIA 2AYYA 1SCUA 1Z4LA 3GIDA 2I3DA 3QI2A 2NV6A 1Z6AA 2BI8A 3N5KA 3NHBA 3DOUA 4C7OB 2LCFA 1BO6A 1EAMA 5CB4B 2V3CC 4YP1A 5CVJA 4NICA 1I3LA 5F76A 1QB7A 1EP9A 1NJGA 3C3AA 1RXEA 5ITSA 1H2YA 1N5JA 3KPJA 2NU7B 1JHYA 3GJ5A 2V97A 3RG2A 5T4BA 1X7XA 3KJEA 3EEIA 1Q0HA 1HDRA 1XD9A 3GRRA 2QQ5A 4KFUA 1MB9A 1IZ7A 3I53A 3WK7A 4MJ7A 4PC3A 2J5BA 2YN0A 2JAPA 2R60A 2P67A 2J46A 5M34A 3BCUA 2VF2A 4HDMA 4XD7D 1S2DA 5CM8B 2FZ5A 5FLXA 3UWDA 1F2DA 1GKYA 2XGMA 4BNMA 1V8ZA 1HLDA 2YJZA 4F3KA 1R0LA 4YMIA 1QVRA 5JOQA 2H65A 4IYJA 2H00A 3L92A 2ODNA 1V71A 3P71T 2PKYX 3PD1A 3P9QA 1MT0A 4KYUA 3QVXA 4K7JA 3QXCA 4ISCA 2QSJA 4ZAWA 5IZCC 4L3OA 3U7JA 2AG8A 3PUVA 1J8VA 1E18A 5FUMA 5SICE 4X7PA 2YBDA 3EFEA 2IYSA 4I50B 3KWMA 4TXLA 2YQ4A 5FTJA 4O08A 1P1CA 3Q6MA 1HG0A 3IQEA 3QKWA 4KMRA 3JQGB 4HYEA 2OHOA 1PBTA 5L9AA 2P9BA 3AHEA 4E30A 1T24A 1PQUA 3DDHA 1S3SA 3KLNA 3OZTA 5GPBA 1FLVA 2WTMA 3PXDA 4PZ0A 1AF7A 3JYLA 1J00A 5HS4A 3EGEA 5CM2Z 1A9XA 2JVIA 3HM2A 3OCUA 4IO1A 4J75A 1YZHA 4J4BA 3FMIA 3VZQA 2YVLA 3N76A 4KOAA 3QWAA 4U63A 3ETLA 3NGLA 5CU7A 4Z9FA 5DNAA 1DAIA 5JDCA 4NX2A 5AQ1A 1FBNA 1CZLA 1M10A 1ZISA 3J7AC 1YC5A 3S2SA 2E6UX 2ZYSA 3SKXA 1Y8QB 5CA1F 2G1PA 4EENA 5DHAA 4YMWA 4UBLA 2FPIA 1RCFA 2C5AA 4JXZA 2Z5VA 1LDNA 1LPMA 1QHIA 3DUFA 3TD6A 1ML3A 3TKAA 5M7EA 5CIYA 1ADGA 1D5WA 2XDWA 2OXTA 4KKXB 5FQNA 3LUPA 3NH9A 4XGRA 1JR3E 4RO0A 3N0RA 4CHTA 1HEUA 2Q21A 3OMLA 3DDOA 3P9RA 1LJLA 2V7PA 3G7NA 4WJZA 3PJFA 1J21A 1SCDA 4BVKA 1SAYA 2W6OA 1IMOA 1NP3A 1EFVA 1G5FA 5T67A 3S3TA 4M7PA 5FI5A 1KDZA 3PIIA 1DJNA 2HA0A 3I58A 2TSYB 3CJTA 4QPPA 1S1MA 2RBGA 4Q9JA 1EWKA 2YWBA 4V0NA 4XDYA 5KEIA 1X1AA 2X4DA 1W94A 4E4TA 2PFGA 3GRAA 3JZAA 1S7GA 2G76A 2JCGA 4F72A 4DUZB 1KYZA 4R7GA 1C14A 3W5DA 1QZ3A 4ZHQB 2E4AA 5KVVA 3B8HA 4MUBA 1Z4KA 5LWHA 1ZRSA 1Y1SA 4BPBA 4BN4A 2P41A 4GAEA 5TARA 1RBQA 2LNDA 3VFDA 4Z7NB 1OKKD 3ZOZA 4LQDA 3TLGA 7REQA 1KP3A 1M6NA 2XTZA 3O8DA 3QG5A 5KDOA 5C8YA 1G2OA 2G04A 1K08A 3GLFA 3ZCRA 4FB4A 3WL8A 2XNCA 4UAVA 5DWQA 3QENA 1OXBB 4YQFA 3VJRA 3GZ4A 4YMGA 1Z5WA 5K0NA 4OX9Y 3CRMA 4HWKA 2OAQ1 3DL4A 3PJDA 1KHHA 1J1UA 1USUA 1E2LA 3ZHBA 2OXEA 2XV1A 4FPXA 4L9SA 1HSZA 1KJYA 2AB0A 1ONBA 2VLIA 4LJ6A 5IDVA 5WRFA 1PVVA 3WIOA 4A82A 4YXFA 4XWTA 4ZMRA 1CF2O 1QO7A 2XDQA 2HQRA 1Q91A 4G56A 3D0RA 2ET6A 3FNQA 1J99A 3UJ3X 5DW0A 2HLNA 1E5DA 1DQRA 2K6GA 5G1PA 5KQPA 4CN9A 2C57A 4A15A 3DZBA 4BNDA 3LIPA 4PYMA 4Z1MD 5M29A 3G8YA 2CJFA 1ATZA 1M76A 3EY4A 4FOSA 1K7SN 1NF9A 3LQQA 4G9BA 1P7ZA 4YRFA 4QARA 3GI1A 2CUTA 5KAMA 1NYLA 1JPJA 1TVMA 1U28A 4PAQA 1D6MA 3K05A 5IKPA 3LWDA 1JPNA 3JQAA 4QXPA 3SYNA 2X76A 1SBHA 5JMPA 4CT5A 3GO4A 4JOCA 3NM4A 1EDOA 3QU7A 3FNFA 4RVOA 1JDVA 5JSHA 3CE9A 4BQSA 5U4XA 3DULA 5HNKA 1FFGA 1Q6YA 1TUBB 1Y7PA 2I22A 3AY3A 3IEUA 2UVPA 3MWFA 5KNDH 3SR3A 3RRYA 3EUFA 2O0LA 1EUCA 2DTEA 1SHJA 2Z4SA 5AI4A 4C5AA 1NRXA 3PHJA 1AMNA 1HZJA 1MAUA 4D25A 1U7TA 3HU3A 4M9CA 1GAXA 3SS9X 3Q11A 3NNNA 4F7DA 4JR1A 4POAA 4WJLA 1GIAA 4FYHA 4ND4A 3HLYA 1M6EX 2GAOA 1AD2A 5C7OO 3JQCA 1KDYA 5FPTA 2W8BB 4WASA 3AMVA 2EG9A 4XYGA 2G7MC 3DNFA 3LXMA 3PX3A 3E9QA 2P9TA 2QX6A 4GOJA 4ZTBA 2YW9A 3LC1O 5G3YA 3UIEA 4UE6A 5K8TA 1R9JA 3B2QA 4NLLA 3WJ2A 4MR8A 9GPBA 1XJCA 1YV9A 1NA5A 3LVQE 2ZJZA 1E99A 3IALA 3G5AA 2QI9C 1E6UA 3F97A 4R3WA 1NR7A 2GNPA 4R9RA 4RPKA 3TTVA 1M7BA 4PC2A 4W1QA 3LA6A 3ZIAD 4ND8B 3O4IA 2NAPA 3RCBA 3PVCA 3QBDA 1WDWB 4FWBA 2AK2A 4YECA 2H57A 4GL2A 2Q9BA 4UAJA 4M1OA 3R0IA 4WLOA 4XCQA 4O4LA 4W5RA 1YRWA 1RM4A 4COKA 4RTQA 1KDOA 2FEMA 3RFTA 4ZARA 4AVYA 4LXGA 1PQPA 5C31A 4YMLA 4ZV9A 2O05A 4LBYA 4E6PA 2VNHA 2OHHA 2A9PA 2ZSAA 1Z7YA 2A5YB 4U7HA 3WS7A 3DQQA 1X80A 1OKKA 3F6PA 5EUCA 3LPNA 1PZGA 4IFTA 4QBGB 2QYTA 4NQZA 4UFNA 1TIBA 4FEEA 4MI9A 4C2BA 2F8SA 2YZKA 1RWNA 4QGFA 4G25A 3BFVA 1MQ8B 4KZPA 2XIJA 1A04A 5TMPA 5ENDA 4AYWA 1QWSA 4QNRA 3FPCA 2BGMA 4XPIB 1EX6A 4RJ2A 5DEOA 4GU5A 3ZCXA 4DL9A 7YASA 2P90A 3B1JA 3P9XA 1S8NA 1PX0A 1SIWA 2HV8A 3QVJA 4O2AA 4P82A 2X0EA 3K72B 4G5OA 4WBXC 1D0VA 4IVNA 5ICGA 3RS8A 3D7LA 2R751 4NNPA 4FLMA 5K0CA 4BO3A 3EGWA 3N8IA 1EFDN 3DBIA 1HMYA 4ZEXA 2RDMA 1SR8A 4FJ2A 3NTQA 5FR1A 4P86A 1L8LA 3IDZA 1H4TA 4LECA 2IYAA 5TX7A 3WBKA 2QN3A 3WA7A 3IDAA 4CM7A 4F60A 5I8PA 3SWWA 1WW2A 2J9YB 2LV8A 1YA8A 2AOUB 4WL0A 2I3BA 3ORSA 4FWTA 2YQ5A 1YI1A 4U8GA 3TB6A 4Z1MA 2X5NA 2D6FA 3T52A 3AP1A 3L02A 4WZAA 3RV3A 2C8VA 1VIVA 5T6MA 2H8GA 3KOMA 1PJCA 2EFGA 4RH3A 4H3VA 3EVNA 3FUXA 2J9ZB 1H1DA 1PFKA 3ABIA 3NHPA 3VR2D 2QTAA 2FWIA 2HMAA 1E4OA 1SU4A 2V5UA 1UP7A 2WZCA 1FP6A 2XWSA 2FUG6 2Z57A 3VC7A 3ZTYA 1WQ3A 2P5YA 3OQNA 4P4NA 2G72A 1PGPA 1RKBA 4KI7A 2ZYVX 3RW9A 5K0JA 1A88A 1M72A 1WKVA 5JFOA 1APBA 1UXGA 4BATA 4L27A 1F5SA 1M2OA 2ZS7A 4WXHA 3AB8A 1AT1A 3KR0A 4X00A 3WIDA 4Z4GA 2AX4A 2HK8A 2BMAA 2A5DA 1EPUA 4L8GA 1VYUA 2W58A 2WR8A 3PKIA 5COAA 2FPGA 2GN1A 2ZUTA 5KI6A 3F2IA 1W581 3AINA 1AN9A 1HEYA 2P2LA 1FNDA 3JR3A 4HXYA 3SBOA 1G19A 1UUFA 3CUKA 4CFSA 1IWBB 4EEXA 3K1JA 3JATB 1G98A 1PEDA 2H59A 3OX3A 3WLRA 1ZJ4A 2P4EA 1HZZC 3N7AA 1MHPA 2GUWA 3IVRA 3K5WA 2DR3A 4GPEA 1XLUA 4DR5B 2IHNA 1U2ZA 4G5YA 4YRKA 5IDWA 4EUEA 2FJPA 1CUJA 1F2VA 2ZTVA 3NHFA 1KF0A 1OYYA 2Y1GA 3PQ2A 3O26A 4DR2B 4MWGA 4RD1A 1TQ6A 3ZGZA 4YCSA 4EZBA 1MZVA 2X7HA 1BN7A 1U7OA 1XVVA 3AOEC 4I9UA 2OXCA 2P2YA 3ZIAA 4CKEB 4IY1A 1ICIA 4UDXX 5LOVF 3KQMA 4XVUA 4DLRA 5KX5A 5IJAA 1QGAA 2IYFA 2ECFA 1AGYA 5AXBA 3I6ZA 2MJLA 2ZJ5A 5DXAA 5IKOA 2CXNA 4BQQA 5JI2E 3NPMA 3TQOA 2ZTSA 1NV9A 2Z58A 2VBCA 3CLSD 4Q1BA 3S81A 2V4ZA 5IKEA 1N6RA 5FOVA 1EVYA 2JK0A 5ESWA 5EWJA 4AJPA 2KX7A 2R5NA 5E7MA 4KIJA 1GPLA 4OHCA 1H2FA 3DFZA 4KQEA 2GFQA 4AUKA 3UWSA 1EFRA 3UGJA 1ECBA 1TKRA 4EYSA 4FQ5A 1CU1A 2Y67A 1KY4A 1T8UA 2OAP1 1Q57A 2QP9X 3PFCA 4TM7A 5F3RA 2IYEA 4NEQA 4MRAA 3S2UA 1LW6E 1N8TA 2G6BA 3CJQA 3GUCA 4HUQA 3V8NA 4FSDA 4J4HA 2O7NA 3K8ZA 4WXEA 5CFOA 2BKXA 4DVJA 2Q3LA 2HA3A 4YRPA 2Q8NA 3IUJA 3GVPA 4RJIA 1USWA 5DX0A 2VSNA 2WWXA 2Z8YM 2A0YA 4M60A 4M2LA 4O8CA 4CKWA 1FYWA 4R0MA 1KRHA 2IZ7A 5LQSA 3H1BA 1X74A 2H1LA 3MJVA 1E2KA 1H6AA 3Q9LA 4R0NA 1HE5A 5DTMA 1ZHHA 5TJ9A 4LRQA 1WULS 3INGA 3C2QA 3JQQA 4UCFA 1U8CB 3RKUA 2NP6A 1B14A 1HV8A 4HGNA 2QUJA 5FA8A 4BO1A 2FYTA 3A1NA 1OTXA 3F6BX 5I4IA 1UFKA 1E1KA 3HHEA 1QIJA 2LPMA 4FKBA 3T06B 2COUA 4PRYA 1DT3A 2O23A 3FPJA 1U7HA 2QTTA 3KJQA 1HDOA 3KKOA 2OECA 1YRBA 2UZ1B 2YYAA 2JEYA 3PKZA 4P3NA 3VR2A 5JADA 1JP7A 2FXVA 1QPBA 1E6EA 4BX0A 3CEAA 3P9PA 3FB1A 2BFAA 5K3BA 3PQFA 2WV9A 2BM9A 4TMZA 1DRKA 2HNKA 3PNSA 4A1FA 4JUFA 2VUHB 1FNNA 3QKTA 3K9GA 1VBMA 4OGWA 4ALLA 3OTGA 3LGSA 1BE8A 4M76B 4RJLA 4JSYA 3KZNA 4OQMA 2Q4TA 3BRQA 3JVUA 1OFTA 1QOPB 3G2HA 3RK4A 1U3VA 3GY0A 4IEEA 3CUEF 3PUXA 3R41A 4RA9A 1GR0A 1KMMA 1Z4OA 2R66A 5AIAA 2I87A 3B9PA 5A0TA 3A0RB 2CK3D 1IUKA 3KM0A 2Z43A 4COOA 3ILXA 1U6JA 1GDTA 3MN1A 2XADA 2E55A 4AMZA 2IH2A 1KZ1A 4KWCA 3N2KA 2C2BA 3U44B 3CM0A 4PG4A 5JS8A 1UKCA 1YUMA 2OBFA 2KMLA 3HXTA 4KXQA 5FULA 1ZP6A 1I7PA 1KK1A 2DR0A 2FLVA 3OIYA 2LIVA 4WY2A 1GJRA 2PUCA 5AW3A 5DHSA 3VU8A 3JS5A 4R2IA 4GLJA 3FSGD 3DB2A 3DE3X 2VBGA 1NXVA 2G70A 3PKJA 3PNVA 3H9CA 1CUCA 1T8RA 2KS6A 4WT7A 4YRNA 2AG5A 2NUAA 3TI7A 1P18A 2X41A 1NVEA 1QUFA 1HDYA 2JS7A 4IJ6A 1X7ZB 2OMKA 1SZDA 3HV0A 5KDLA 1TM5E 1ADFA 1WCWA 4OHUA 4BBJA 1KQPA 1B15A 1LBEA 2BE7A 3B2EA 5AXDA 2JI4A 4DIKA 4BP1A 1L5VA 3GUZA 1G8MA 4DMKA 1IN6A 2UVQA 1UBKS 4TROA 3OO1A 4KSCA 4AJJA 2BBTA 1JEJA 2KB0A 3IAUA 4MGIR 4OJTA 3WK8A 4BVGA 5T8KA 1WETA 4DANA 3V00A 2VT3A 3MC1A 5C5EA 4ZVRA 3I3SR 4KGXA 3R3SA 1HE8B 2FSUA 2VDLB 3Q3GE 3WR5A 1DMSA 3NBZC 2CWDA 3PJRA 2W93A 2JFGA 4M49A 3AEUA 3HEMA 1N2BA 1JA1A 4ZOLA 1S4QA 1N6KA 5K0EA 1ZH2A 1UF9A 3CU5A 1XROA 4NV0A 4QJ5A 3WWEA 5JC1A 4OGFA 5ISMA 3RYIB 3I9NA 1FQOA 2A7QA 2O1XA 2Q2QA 4LHEA 3K2EA 4FNMA 4MV8A 3S5UA 2JBAA 5DOZA 1GGJA 3J7TA 3MIIA 5TSDA 3FCXA 2BFDB 3ZNOA 2ZULA 5J4VA 4R54A 5FEUA 1N5LA 2XITA 2J87A 3N7UA 1NVAA 1CNEA 4K1XA 5L3VA 1EXDA 3DBLA 4MQEA 3R76A 5IVDA 3ZY4A 3GZNB 1GPJA 2A59A 4PNEA 3GPCA 1RWQA 4XOUA 5KNCH 5CGQB 3ANLA 3S1AA 6ADHA 1T9GR 1MVOA 3RFUA 3CUVA 3P2IA 5KYWA 3LK7A 4M0LA 3QVVA 2V7QD 1WXDA 4D4HA 3NGXA 1WXWA 3ZQUA 2B7CA 1U8YA 3CNBA 1TADA 1VMKA 3O3CA 4JOQA 1CVLA 2YC2C 3JQRA 4EYQA 3R0ZA 3AFGA 2M6SA 4PONA 2R8YA 4S1VA 2FDRA 2HSGA 1Y8ZA 2AH5A 2BEUB 2YNMD 1B26A 3D8UA 2DUMA 1XDBA 3ONVA 4NMWA 3TLXA 3JYPA 1SVNA 1IN5A 3GK3A 4F0JA 4RPGA 2AOTA 2I4TA 5EE0A 3EOBI 2Y66A 4UHFA 4ZHSA 1DJLA 5B5SA 4DBLE 1HOXA 1B8OA 3TIFA 1NE2A 1QP0A 4AULA 4HF7A 4RA6B 4YT2A 5K01A 2C00A 4ICIA 1IRXA 2FPRA 3WFZA 2JIOA 1P80A 2GCEA 2A94A 3OIFA 4HS4A 3FLEA 2WFMA 4FP9A 4YJHB 4XSHA 3S1LA 3KCNA 1T4CA 4JELA 2OOSA 1OIWA 3FSGA 4Q37A 5GVRA 3IHLA 3P0RA 4FTWA 4UPVA 4FJ1A 4YNBA 1UBSB 1ZNWA 4XIIA 1ZO8A 3C7DB 3W5CA 4HH1A 2G67A 1EJ6A 1U5BB 3O2JA 3QMPA 4J29A 4MEBA 5EKXA 1E79D 1LRJA 2FFRA 4PQEA 3VH3A 1XP5A 1SOVA 3CKMA 4R1QA 2M6RA 4LSWA 5FLEX 2POQX 5I5EA 4Z4QA 3ZVNA 2DKNA 2QKYA 1BGVA 4PX5A 2D7CA 4X54A 3W5SA 4B4KA 2ZUEA 3A6ZA 3FBGA 3STVA 2FSGA 5KVCA 4ZI7B 3DE0X 3KYBA 3BHJA 3OOEA 3PHGA 2Q1XA 4G1EB 4GDMA 4B71A 4B85A 4UXJA 4ON9A 4N76A 4EWLA 1JEEA 3C7TA 1N2ZA 1LB1B 5BSUA 1VSBA 1H85A 2I3ZA 1WUYA 2HMYB 2IXFA 3AEXA 2VJAA 1G4HA 3GAFA 3KYCA 4RTSA 3KUKA 4ENRA 3H5OA 3UFBA 2P2ZA 3GLGA 2CE2X 3C1OA 1N2HA 3JSXA 3TBFA 2XKKA 1IBRA 4MRVA 5FNVB 2QAJA 4MRMA 1LLUA 3L1JA 1QC5B 1TM2A 1YVPA 3AFIA 1G8GA 2WFZA 3ROTA 1YCHA 4LHWA 3UTDA 1I1QB 4J0KA 4TM8A 3IOBA 4EPTA 3KYDA 2PA3A 3OFVA 3OLXA 1QPGA 5ITWA 5L8VA 1IONA 3CUUA 4DIBA 5EKUA 4JXKA 3A2NA 2VAMA 4P80A 2HNAA 5JR3A 1XTUA 1G6HA 2X7JA 5FPQA 3VA7A 3WLIA 2D1TA 2AMJA 1PLKA 2G7ZA 4CKBA 1GZUA 2FDCA 1W5BA 3IXLA 3R77A 3KALA 2A8YA 5H3LA 5AUPB 1YQXA 2IODA 5H16A 2FW8A 3IR7A 3SZ3A 2C2MA 1T9DA 2OFOA 1K88A 2ZBPA 4JUAA 5JIBA 3QPDA 4L02A 5HR5A 1BD4A 4Z49A 2VO1A 3EGVA 3PA6A 4LY0A 2B7BA 5AI6A 5NULA 3MGKA 4GKBA 4G8JA 3VYVA 2W42A 1RS0A 3M70A 4UHJA 4DNOA 5JAUA 1NZFA 1IQ0A 1I14A 1WB4A 2V1XA 4PLWA 4J4TA 2PGIA 2K7FA 4OGKA 4ZU3A 2Z1MA 2N47A 1JWAB 4TPKA 4RKRA 4MUYA 4HH3C 3RF7A 3AKCA 1DIHA 3PGJA 1YCGA 2C9ZA 2FG7C 3SBXA 2YNMA 3BRSA 1PTJA 4IOJA 2R84A 1K89A 2FTKE 1PW5A 1U3CA 3S2ZA 3CCFA 3WMXA 2WTUA 3ZWQA 1CLEA 3A9RA 3WKCA 5FR2A 2C5EA 4URFA 2GZAA 1M6VB 3NBAA 3C7AA 2OV2A 1F8XA 1YA4A 2WK1A 2HMTA 1E6MA 2XHZA 4RV9A 2MT9A 4TKZA 4WKOA 1TM7E 3R7FA 3UAYA 3ZHUA 1MIHA 4FR2A 4F96A 3INTA 3OMXA 4RBNA 5CNIA 1BS9A 4RZHA 1CF9A 3WL4A 4KL8S 2WV7A 2AC7A 3F7TA 1VE9A 4QWWA 2WT9A 1WW8A 3U7IA 2DB3A 1MVLA 2B35A 1RZ3A 2JKVA 3BG5A 2WFLB 1JLKA 4DR6B 4F7WA 1GITA 4ZJYA 2OOKA 2XIQA 2QYOA 3PXUA 4MNTA 2EFHB 5E4JA 2HFJA 1ZFNA 4D42A 2Y1CA 2BISA 3AVQA 4OI4A 1E79A 1Z7EA 3TQIA 1CTQA 2XUIA 4Q15A 3VHLB 1ETUA 1E3EA 1NUQA 2JAOA 2GD1O 2KJQA 2PKWA 3A6HA 2ZR0A 3KVOA 3NOXA 4JK3A 5DHUA 5BQOA 1ZONA 4JYPA 3SQNA 2ZAMA 3WNZA 1PL8A 4CTMA 2ZVPX 3MT9A 4GYWA 4WOBA 5HFJA 2DJIA 4J1TC 3OEWA 1P77A 1KI4A 2EERA 2WAOA 2BFOA 3NHYA 4BNIA 2BV3A 3SIXA 3H16A 2PZFA 3O75A 3RRZA 3FG9A 1EVKA 2B7LA 2KWIA 4QBFA 3V8MA 3GLFB 1A0OA 1X19A 3KJNA 1M2GA 4L0MA 4Z0TA 3IV6A 4BJ3A 3JAWB 2QXUA 3RC7A 1DIRA 3HFSA 2B83A 3QEAZ 1YDMA 2YZNA 4OYHA 2J48A 2WM8A 2WNSA 4BB0A 4QYTA 1KIMA 2VR1A 1POWA 4HTAA 4IHKA 3S2FA 4D2IA 1C8BA 2Q1UA 3M2PA 3F6SA 2GN4A 4JJAA 1RIFA 4G1UC 4QQKA 4I81A 4LYDA 4ZYZA 4ANFA 5BNZA 3GVXA 4ARCA 4MV5A 1RYBA 2GHTA 5C1OA 4FKMA 4GMFA 2P35A 5CNMA 1CD5A 5NLLA 4CM9A 2DXIA 4DLZA 3MTEA 1G8YA 2A58A 2MIIA 1PGJA 5D01A 2HJ9A 3I3OA 8MHTA 3OWOA 1BFKA 3ZBQA 2XOKD 3F4BA 3PC8A 1ZNZA 2FPMA 3K4HA 4PGHA 1RYHA 5JY6A 4OD0A 1KJNA 2XAAA 5CNJA 1RWMA 1N75A 3I0NA 2QZ9A 4GO1A 5EE5B 4R3NA 1N78A 1SBQA 1VG0B 3EODA 4OHVA 4AD8A 1HI9A 2NTNA 1DQSA 4TQGA 1EFUA 1MQAA 3BL6A 5E9JA 5DM60 2APJA 5HQJA 4DMLA 5ITVA 3QQPA 1KDVA 3RI3A 1VHDA 3O82A 4NAUA 4FDTA 4RF3A 3I61A 4FC6A 3CEPB 3QUSA 3X1WA 1W4ZA 1E61A 2NMVA 4U7JA 1NUAA 1U90A 2FMHA 3GMDA 1A71A 3I6YA 1S2IA 1GP2A 3D7NA 3LQRA 3UG6A 4BYGA 4FC7A 3M6AA 3FDZA 1Q0UA 3RS0A 2TS1A 1CJBA 4A2PA 3ONFA 2AD5A 3DOEA 4FS3A 4ZOBA 4PFKA 2NU9A 3KQTA 5C3UA 3PVZA 4UHKA 5JQGA 1ZOOA 1YZYA 5ADWA 1EDEA 1MJGM 1FNSA 1SQ6A 2DUJA 2DWCA 3M1IA 1UXKA 2NNLD 1VDZA 3DZCA 3UAOA 4C6SA 4ESVA 1F8GA 3ETDA 4AF6A 2R00C 3BWMA 3OT1B 1NQ5A 3FVTA 3R3UA 3IQXA 3TSAA 3V7NA 4C0SA 1OREA 2X1VA 3N0WA 4CM4A 1TD1A 2B1RA 1VCHA 3M6LA 1X39A 4PQGA 3ZCVA 4C03A 2UZIR 5K0LA 5LP6A 5BWMA 5CITA 1C1HA 5ECYA 1LVUA 2X5XA 3WGMA 1GAWA 3DE4X 4X94A 2RCNA 2WINI 4HQNA 4HZUB 1ZINA 1NG9A 4YREA 2QJFA 3SZRA 1G64A 1Z33A 3NIDB 2BFCB 2HYDA 3ZV3A 5JRJA 4OA5A 4RULA 2IQIA 3KSBC 1T0JB 2XB2A 1DAPA 2QN1A 1RXIA 4PSKA 4WN3A 2R65A 1KVQA 4I1PA 1P2BA 6NULA 1I94B 1D2RA 1CYDA 1VKOA 4YWHA 3DEZA 5HUQA 1V7CA 4OHWA 3A2MA 3SDBA 4EJMA 3PFFA 5A4MS 2N1MA 4D5EA 3I34X 5C3MA 3B48A 4F93B 3FDXA 2QUAA 1Z8DA 3DO6A 1GZ7A 1JVNA 4QU5A 3MUOA 1M2JA 1Z8HA 4Q0MA 2AYXA 1U9JA 4RZIA 4CIBA 4CIAA 2UDPA 3PXBA 2VAWA 2VHZA 5U9CA 1PJQA 4D8YA 1ODTC 2AG6A 2ISSD 2KLHA 3E27A 3O38A 5F7JA 5HZKA 2IS1A 5ALHA 3EZNA 4Y2YA 4Q3LA 1UJMA 1AGXA 1NW7A 1OIXA 1KK2A 1XEAA 3EXHC 5AT1A 4MUFA 1EJ2A 3JQ8A 4QNMA 2CMGA 3QU9A 4BZPA 2WVGA 3RSHA 1RFLA 5E6RB 2C83A 4POOA 3K16A 5LBIA 2XTAA 4G5GA 3QZUA 3OM9A 4GPTA 4K88A 5FOUA 3WLSA 4BNXA 4URXR 3UMRA 4G65A 1T6YA 4RL4A 2WUGA 2HUNA 2IIQA 3NTVA 3LVBA 1ZXXA 4KXXA 1NXPA 3FJOA 1N4DA 3D8HA 4RX1A 3FAKA 4O4JF 4ZO8A 2A84A 5HKOA 5FOWA 3LCCA 1VBFA 4R7TA 5I7EA 5ALQA 2XTJA 3C70A 2QTVB 3GOQA 2POCA 1DEAA 1H1LA 2B92A 2XOKA 3E0QA 3IH5A 3WGZA 1RQRA 2GA8A 2IY9A 1NJ8A 2Y27A 4YJKA 3ZCQA 5JISA 1HPLA 3SX2A 1Q3HA 2PT9A 1UBCA 2P91A 3UMMA 2IZ6A 3DA8A 4DNQA 1OX4B 1W25A 1HSOA 3MLBA 3BWVA 2GI4A 1O77A 4JDPA 4PINA 2X5OA 3KHTA 3HB5X 1I2DA 3T7RA 4BE9A 4LMAA 4X1IA 3SM9A 3HA3A 3T1OA 3LT4A 1HGXA 2W6NA 2ZAOA 4PCUA 4CM8A 5KJ1A 3UMFA 1H4QA 3VQTA 3RFVA 1YR7A 1EG2A 4R1OA 2OM6A 4WLUA 5B6JA 2WF7A 3ED1A 1YU6A 1P0QA 1TU3A 1S8AA 3UGKA 3GH1A 1T29A 3LPLA 2OBLA 5CR9A 4GMDA 3R8CA 3ND5A 3TWOA 5BUCA 7AT1A 5IKMA 2J30A 2VQFB 4B3SB 2QUZA 4DPMA 2L2QA 4E1VA 4CTJA 3W1VA 3K35A 2CB0A 2NZ2A 3OFKA 1WBDA 4C76A 3R0QA 1KO1A 3E61A 3ZVRA 3EWNA 4KIGA 1NUPA 3TSOA 1MJNA 3ZU5A 2N1BA 3WSVA 1ST3A 2V6GA 4X1YB 1M2KA 4K81B 4ZCPA 2NGRA 1W9MA 2PZEA 4A0FA 5KTOA 1JFSA 4C6RA 1SIUA 3UWKA 3DHEA 3GFBA 4H17A 3HGTA 1N9KA 1UEJA 2GLUA 2JCYA 3GFQA 4RPCA 2BBWA 3V7FA 3NDBB 1TMOA 5B12A 3K0FA 2MWMA 4MWEA 4GPZA 3CKLA 4MPJA 4PNPA 2OBNA 1J1ZA 2VHTA 4KQMA 4JY7A 4QDOA 3E9ZA 4Y1EA 3T38A 3TQQA 4ENUA 1L8OA 4CLRB 2R4QA 2PTHA 3JVEA 2YMQA 1CUVA 1YKSA 5BSEA 1E7MA 3LL7A 2C5BA 1TPYA 2HWXA 4RK7A 3ZLVA 3P20A 1D09A 1QQ7A 2LD4A 3H3FA 3IAFA 3O7WA 4G97A 2QW8A 2OB1A 1TLFA 5LSAA 5FTKA 1E7YA 2FQYA 4NPAA 3UJHA 4L6IA 4E51A 5MGNA 5CEFA 5G02A 4YMSA 1TK9A 1Y5NA 1Z3CA 2O5RA 1Z0DA 3DV2A 2EKBA 3NHJA 5AHWA 4YRZA 4B81A 1J07A 1TYCA 3C14C 5FO1A 2OYSA 1M34E 4WWHA 1U1CA 4JBWA 3QHPA 1GUFA 4B7AA 1N92A 4FX2A 1R3DA 4ZOEA 2QNIA 5EIFA 4A0GA 1LC0A 4E5MA 2YDXA 4HZIA 2JFUA 1BWPA 4BX9A 3I4LA 4HGPA 2BMJA 4Y1RB 1P7WA 3IE1A 4P3OA 2C1ZA 5IH3A 3ASZA 4X63A 1USIA 3CXUA 1J9EA 2GAFA 2H8KA 4ESHA 2ZZNA 1FP7A 3UV7A 3ZWKA 4UHEA 4GZ6A 2FPKA 1ZK0A 4NYJQ 3RBXA 3W5VA 3WLTA 1ZM3A 4D96A 1J97A 1JR4A 3ZGNA 3V9PA 1CV2A 1U8EA 3H7IA 3HBNA 4YRMA 4ZXPA 3IQGX 2I6UA 5I6DA 3AVTA 5AI5A 2QJWA 2UYCA 3T7SA 3I09A 1CB0A 1UOQA 2LWIA 2C9YA 3A9TA 4KDRA 5GZ6A 3W2FA 2HCBA 2QP3A 3P4UA 4DG9A 3ORFA 3HYRA 3UJCA 1U3DA 2WJIA 3E1GA 3LY9A 3REQA 1L4FA 5D85A 3VYUB 1KJQA 3CN7A 3H4IA 2YKGA 3AFMA 3KDPA 2FMFA 2OGWA 5B58C 3A8TA 3HS3A 1Z38A 4AMGA 4G5RA 3GEHA 5C52B 4K2AA 1QKKA 5CHEA 1YIAA 1OT5A 3AEKA 3BX1A 4M0FA 1MRNA 3CPSA 3RV4A 3Q6IA 5FL7D 4GP7A 3VNAA 2J09A 1B42A 1NQAO 3EFOB 5E1BA 1MMFB 2ZUUA 3VR4D 2FFAA 4YAGA 4QC2A 1PT6A 4X20A 2B36A 2JGLA 4R1LA 3WL7A 3QXSA 1ZVKA 2ZM5A 1BX1A 3TTUA 2YV1A 5GTDA 5K5EA 2CNBA 2PIAA 1QVWA 3DJYA 3ZH9B 4EFNA 4W9RA 2GBFA 2RI6A 4LHXA 3KVNA 3TLZA 5DP1A 1O95D 2HK6A 3A9VA 1JR6A 4ID3A 2GBGA 2QVBA 1PYGA 4PBRA 4RH0A 1Z4IA 2D0IA 4IX1A 4WNIA 5K3CA 2F8MA 2O2DA 4MV1A 3AUYA 4G23A 1V3UA 2I76A 4ARAA 5HJ5A 3IBTA 1TJ3A 2HF7A 4MVXA 1AE1A 3BD9A 5FQOA 3AP3A 4C0HA 1P3JA 1WCIB 3N87A 5F51A 5A3QA 3GFTA 3DE7X 1VQ1A 2AJLI 1Y9AA 3OJCA 2LKCA 2Q9CA 2TMKA 4OU4A 3AETA 4JC0A 4Q34A 2H29A 4XJXA 1MA3A 3V1TC 4QT0A 3GVHA 4ENSA 3CLRD 4UDNA 1ULSA 2CZCA 5JATA 3BBPA 4OB7A 5E2BA 4KYIB 4TXJA 1KSHA 1G17A 5LP1A 1JYSA 4NENA 1PF7E 1DJOA 1GZ4A 1KFJB 3BHMA 1DLIA 3W8EA 4NHOA 3C15C 3NOQA 3MELA 4NMLA 4P0QB 1UPTA 5ED4A 2NZWA 1K9VF 1Q11A 1T13A 1EA7A 3H2YA 4OSOA 3DPIA 4E2XA 5C34B 1HUQA 1QRAA 1ZKMA 4C88A 3P4YA 1VG1A 3IUEA 5IFKA 5LIPA 3OG9A 4ND2A 3FVVA 3LAWA 5HBRA 3KEGA 1YZQA 1ODKA 3ZWPA 1MP0A 2YHUA 3PI6A 3KKLA 4GKAA 3REFA 4UNSA 3PEYA 3PK0A 4HR7A 2WYHA 4EI9A 1QIKA 4P5PA 3GWGA 5JDIC 3D2CA 2IHUA 3TLCA 3GLQA 2X86A 2Y77A 4BVHA 3UV3A 2O2XA 4ALNA 1KDRA 2P2CA 3E7XA 2NVUB 2P6UA 4ZZ3A 1FMTA 2ILVA 1ODFA 1QMPA 4OSPA 3VPGA 2P5TB 2QW1A 2ECQA 4UEJA 5CMLA 3OQBA 3PPXA 3DAYA 3IRUA 4REOA 2HK7A 1VGRA 1WTCA 4IIDA 4XYLA 2E82A 2W2LD 3VPSA 1HA3A 3B8EA 1RYZA 1UBRS 2GAAA 1WVMA 3E9RA 4ETMA 2I1VB 2OLEA 5AHKA 1C29B 1C9KA 5L3QA 4DMHA 1XZ8A 2BGIA 3G2KA 2JAQA 1ORIA 2G25A 1KYWA 4KJXA 3BCHA 2D5IA 1J22A 1YI0A 4UATA 3A1CA 2O0HA 3DVLA 3I73A 1D9ZA 3PFHA 1UDWA 8ABPA 3C3XA 1MG5A 2OGSA 3O90A 5FL7A 3ZBTA 1XJ0A 3GIWA 2QTCA 4J91A 4I5FA 3VR4A 5FHQA 2AZMA 3ROMA 4A92A 4DRXA 2WZBA 4Z1OA 5BN5A 4M1QA 1LPBB 1Z4PX 3UWPA 3DAOA 1VKHA 4KC0A 4CMHA 3IFSA 2YZMA 4FOTA 4PAWA 1LH0A 1M34B 2IZ0A 4JA0A 2H9IA 5CEJA 3QBTA 4AZSA 2ETXA 3T61A 4E14A 2DE0X 1KWKA 3IILA 1A2OA 1ZMOA 4BFSA 3BXXA 1H1TA 1SKMA 4FLEA 4A10A 2YIJA 4ZT2A 2VQDA 1XVAA 4ZCMA 1MFZA 2DPLA 2ZI3A 4GBGA 4YR9A 3SR4A 4I2NA 4EPVA 3JVVA 4JJKA 1IVNA 2WDPA 2XYRA 3C6YA 1VJ1A 3DEYX 4L9WA 1Z5VA 5F77A 5A9TA 3TLAA 2QRZA 3AHCA 3V1UA 3ERCA 1ISRA 2Z5GA 3MTDA 4XR4A 3NT2A 3C16C 5JH7F 1OPRA 2C92A 5IT0A 3TVYA 4NAHA 4EKDA 5B2FA 3TINA 3IVAA 4H7JA 4JU9A 4NCXA 2IV3A 3ZDFA 4P3PA 4KE7A 2JNWA 2XYGA 3INRA 4HQLA 1R1DA 4W1SA 2A7XA 1SD2A 3M6FA 3UTCA 4GWGA 5AW0A 2F00A 4QVKA 2ERYA 1NJSA 3O4FA 3STUA 1MW9X 3ZI4A 3ICCA 3PEFA 4F9TA 4U02A 1MJFA 2X77A 1XJWA 1UT8A 1U0EA 3PDJA 3GN1A 1EJBA 3B5IA 2Q5FA 2CNOA 2GWRA 3F9CA 2ZB7A 1ZOIA 4L8YA 2PU7A 4JL6A 2XUPA 5IBPA 2WSSA 1JSXA 2H85A 4WI1A 3Q3HA 1WDTA 4CM6A 3GUVA 3AFOA 3L6CA 1MVNA 1YQEA 2YJ6A 1ZN2A 3CY6A 4RAQA 4BMVA 3EVGA 4MIEA 4BRSA 1RMYA 2P9EA 2CXTA 4K40A 4U2BA 3DLHA 2I8LA 2O2ZA 1U0GA 1J9ZA 4U7PB 4KAJA 2CD7A 1ZIXA 2PRJA 4L75A 2C9OA 1QNLA 1XTVA 1B41A 2CZGA 4N5MA 1JHQA 1RWXA 4JLSA 2C4WA 3RJ5A 1A3CA 2UXBB 4I4LA 2D0PB 1PFVA 3WNBA 3EBLA 2ZXUA 1CUHA 1Z28A 1TMGE 4I4TA 1G5RA 3ESCA 4Y0VA 4FM9A 2ZSKA 4G0UA 2FPWA 4EKEA 1F51E 4H08A 4MQFA 1BDBA 1TM3E 3M5PA 1TQ8A 4HDMB 1KTVA 5CYOA 1FRFS 3QWBA 1CXZA 3LUJA 5F23A 2Q0XA 4LGMA 2YYZA 3T5DA 4C0BA 2YICA 3CSSA 3L7YA 5B3KA 3LPMA 2YWHA 3CX8A 3QKRA 4PLPA 2NXNA 2H4WA 4Q39A 3JQFC 1SC3A 4YAEA 3SXPA 1RLIA 3RAPR 2I2FA 4DWOA 1WXQA 2IPOA 4DM3A 2EQBA 1WJGA 3K4PA 5FBZA 3DOOA 1LBTA 4PEVA 3QE2A 1Z18A 4CVNA 3BQ9A 4PSDA 1I6LA 1C3VA 2CVZA 3DBHA 3L7CA 3HY6A 3QBEA 2PO7A 1PE0A 2NOAA 2GRJA 4LYJA 1OI4A 5GZ3A 4N6NA 1VSTA 4PIVA 1PKEA 3N53A 1AQIA 1XTSA 1YZUA 5EXDA 5BRNA 5FFFA 2W5UA 4TTJA 1XWFA 2WE7A 1NUUA 4MARA 4XUGB 4DILA 1MV8A 2BYTA 5H1YA 2ZG6A 2QVXX 3VHRA 1XF9A 2BFFA 2M32A 3H5VA 2WMOB 1C8KA 1EVQA 5CVCA 5HZMA 1A9XB 2LGJA 4D0LB 1E32A 1R16A 2G80A 3N2ZB 2IUUA 5JSYA 4CE6A 4ESOA 1E9SA 2V0CA 3W9YA 3BH6A 1LFDB 4G0OA 2ATIA 1EWVA 1HXHA 3LSYA 4DCTA 2IPNA 1WDMA 3WBJA 2FPIB 1P81A 2FCAA 4N65A 2NNWB 5FKJA 4EW2A 3O1LA 1S96A 3T4PA 3ENNA 4PWYA 1BA3A 4ENQA 1KP2A 1SVLA 1W46A 5J47A 4IDGA 3FUUA 3KLPX 1ZH6A 1K8YB 2JFOA 1I7SB 2F67A 4CF4A 1HNNA 5DWVA 4BMPB 2BOVA 4MVJI 4Q47A 1VIDA 3FPAA 1F6BA 3EQ6A 1YE5A 1Q1BA 1XIVA 1ZK1A 2AMVA 3ENVA 3SBDA 1AZWA 1K4KA 3O2SB 3TW6A 3OQPA 4LKOA 3T3PB 4WZAE 3RC2A 1EFVB 3F4KA 2Q3BA 2Q5LA 3CF0A 1U0OC 2RJ3A 2YS6A 4AS2A 2WKPA 4MVJM 5H4GA 2P79A 5LLTA 2X15A 3A04A 3I6MA 4JJIA 4LY6A 2QTHA 1P2GA 4N8DA 4OJQA 2B8EA 2OZEA 3HGQA 1YKGA 1Y0BA 1ZM2A 1QLHA 2G6TA 2B25A 3DZGA 4O1IA 5COBA 5CXQA 1W2HA 3EIEA 4K6MA 4OAQA 1JT9A 3LHSA 2Z4RA 3A10A 1EBBA 4ZVNA 3WLAA 4DLBA 3R74A 2MOKA 5CB8A 2BMWA 4RE5A 4KO4S 2AE1A 3KVRA 1ZCJA 3MF4A 3TLGB 4S0ZA 3UK0A 3E3OA 4B6OA 1MZPA 1OPXA 2P4QA 2V6FA 3N07A 5EIWA 4E2FA 4EGAA 3MRVA 5C8YB 3D7RA 2PO5A 2Q1TA 3A1FA 5B37A 2XUJA 2BE9A 5ICSA 2QXYA 4INAA 4YJ3A 5LFAA 3SC2A 4H2DA 1M1UA 4CMGA 3GNTA 3IQDB 4K6GA 4KQWA 5SYAA 2GNAA 3FRHA 2EF1A 4BN0A 1KARA 4TYYA 1G2IA 4TTIA 3T0IA 1REQA 3NC0C 1SY7A 3G2IA 4AXBA 1FA9A 1OX5A 2UUAB 1P3Y1 5JANA 5F21A 3KTDA 1RYYA 2PV7A 5IJ0A 4K0KB 4TZKA 1XV5A 3L4EA 1EVJA 1A5BB 2XDQB 2DKFA 4QHTA 5FRDA 1PK8A 3M6XA 4BO6A 2FFJA 2HDOA 2H06A 4KLNA 5TPZD 2G9ZA 5BSMA 4EGSA 1A8PA 1T2DA 2JRLA 4NVRA 4ZOQI 2RK3A 4UM7A 4LVOA 2D1SA 2WA1A 3DT6A 4UMDA 1BXGA 4AECA 2E85A 2OV1A 4YQYA 4BNDB 1QF6A 2DSNA 1ZDMA 2PHZA 1LUAA 1IAVA 2D5CA 2OE2A 3IUPA 3D7KA 1GTVA 4YLGA 5C7LO 2AUTA 2PWPA 3FNIA 1OA1A 5EOVA 4H1TA 3PXCX 3VJLA 4JH0A 1BX3A 3LQYA 4HDRA 1RFGE 3JQAB 5CDFA 5MDHA 4PO9A 3ZWMA 4Z6KA 1JA0A 3KTAA 3W77A 3IAS6 5G0WA 1FYEA 3SHQA 4NATA 2V59A 3V8VA 1KNXA 2GM5A 4TS9A 3BSYA 4FZ5A 2NACA 5F35A 4YEDA 4BNUA 1VRCA 2OVBA 1LPAB 4J49A 1XK7A 5BYBA 5C1DA 2JG3A 4ZCLA 4IV8A 3RC3A 3ZHVA 1S2LA 4BX3A 2BDUA 3VI3B 3R44A 2CGEA 4GX0A 5EZYA 4JI8B 1YRQA 1OASA 3ZQ6A 2XCOA 1XEWX 1Z6QA 3JQBC 3IOYA 2SKCA 1XAHA 3D1LA 3D4LA 2DT8A 1GGHA 4EA6A 2X6TA 5E38A 1RLMA 5B30A 1N57A 1I01A 1X9HA 5DO9A 4B3RB 5M5BA 4HZGA 3D3EA 1KAMA 4LYHA 4Z53A 4KLRA 1G21E 2FWRA 3HV2A 1ODIA 1PR0A 1II9A 4CR6A 5JDIA 1BVHA 3L6RA 3WGJA 1XSEA 2Y0CA 3E7PA 4MA5A 3VUEA 3F9RA 4EY3A 1R2QA 4LZPA 3ZXIA 2OO3A 5IULC 5BN4A 4V39A 2O57A 4MULA 1QRDA 4MR8B 2OY0A 5I9MA 5AUQA 1K7FB 1ZCZA 3AESA 4KSYA 3KELA 1YR9A 2DWOA 1B3RA 1O94C 1T4MA 4S1NA 4EEZA 5JNWA 5LQRA 1T8SA 1YVDA 2KQUA 4LW8A 4IHQA 4OO3A 1DV2A 2OFPA 4OFXA 4NDAA 1VMIA 1GQSA 3IUSA 2EEPA 1BXZA 2QTZA 1L6IA 1QAMA 3N8DA 3V55A 3GCZA 1U1DA 2FKNA 4CUJA 4F9EA 4B3DA 3TM4A 3EDQA 3BUSA 3JYNA 1PTKA 3E3MA 1TA4A 1FSGA 1UC8A 4GZLA 4O4LB 2A9RA 4ID9A 5CUQA 5JROA 3O1IC 1ONPA 4EJSA 5TT0A 5KJCA 2F90A 3ABRB 3PVSA 3Q8XB 1TZBA 1CERA 1IM2A 1DUVG 1TF2A 3IPRA 1BC5A 4G0PA 5DN6D 1FTGA 5J1SB 3JCZA 3KUCA 1FFHA 3B5JA 1W0JA 4ZVLA 5HJ7A 5JPCA 1V16A 1EYZA 1Y42X 2XGOA 5KHLB 2WF8A 2ZYRA 3EYWA 3AF6A 5ERYA 1ORRA 3LNCA 2VH5R 2HY7A 5T4HA 4Z7OB 3ZGVA 2QRNA 3A0UA 2PUTA 3IPXA 4QASA 4BXOA 3V4FA 3PPVA 5CT8A 4K28A 3CISA 2HRDA 4LZNA 2ERCA 1R10A 1KZ6A 1GA4A 3HPQA 3SFVA 2AW3A 2DFTA 4DQUA 1OUMA 5I4CA 3I2FA 4UZSA 3WMRA 3E22A 2BFPA 2AI2A 2G9VA 4B75A 1LLQA 4ESEA 3PXGA 4HGYA 3BL8A 3L6OO 3QJGA 4YP0A 5TPZA 4BUJA 3Q8KA 3P96A 1F9EA 2ZB4A 5F1PA 1DHRA 1YK1A 4MJ3A 2JZCA 3IR6A 1VZ2A 3TAXA 4J16C 3FW1A 4DYVA 3JQEA 1RXSA 4Q1EA 3DTNA 3ESAA 3EW9A 4X97A 4WZAB 4B4OA 2P9ZA 3JQPA 4LA4A 2BMDA 4IDHA 3TI9A 2HMVA 2Q27A 2XMSA 2BTOA 2OCIA 2ZRPA 4PN7A 1CEEA 2F2TA 3HP4A 3CX7A 3KSAC 1AX9A 3MGBA 4N82A 4A0SA 4KGVA 3L8YA 5L3SA 3HZOA 2ARKA 1NVTA 4M8IA 1QU2A 2BT4A 1KO5A 1DQPA 5BQFA 2CFRA 1JL3A 1WF6A 4M1MA 4KB5A 1C9MA 1M2OB 2IEIA 3G82C 3OPYA 2QN8A 4DCCA 2BVNA 5L45A 4QPDA 3A9SA 4TN1A 4X24A 4CCSA 4GRAA 3REOA 4FSHA 1KE1A 1NC3A 2FPGB 5A4AA 3I0ZA 2D2VA 3A7EA 5P21A 4XTCS 1BAPA 1KZ7B 5THQA 2Y92A 4F3RA 1JQAA 3N0TA 1NN3A 3L0IB 4YN3A 5HIKA 4FGKA 5LPNA 2Q7DA 4LQLA 3P5BA 4N9QA 4KQFA 2XRZA 3INNA 4UM5A 2CNLA 1HLFA 2X58A 4R9SA 1Y33E 1RKQA 3B6EA 4P7GA 1U2GA 4O4HA 1QVAA 2R9VA 4FKZA 3UXHA 4LOHA 4EP1A 3TECE 4M1SA 3NXKA 2W83A 4MRRA 4Q4HA 1RP1A 5D3MA 1H2ZA 4YCBA 2BR3A 4MWZA 4HLCA 3P9CA 1NC1A 1EHYA 4HGQA 5DCLA 3HB7A 1OF1A 2QPAA 4B0PA 4NJMA 2VQ6A 221PA 4OJMX 3QXGA 4Z2YA 1IWOA 3DYVA 1XAIA 1IBCA 5ULLA 3FCEA 4E2YA 4ZOAA 5JWOA 4ALKA 4KIUA 3TSWA 2QYSA 4MYHA 3ADDA 1A5AB 3JQFA 3HDTA 5EWJB 4RY8A 1OCEA 5DN6A 3TQHA 2JGDA 1U2DA 2ZWOA 1E3TA 3IE0A 3O93A 2Y0EA 4Z99A 4EJ0A 3QPUA 2ZIGA 3E5HA 2BBOA 5AK5A 4DS3A 4E46A 1CY2A 4F3NA 1COZA 2GZ2A 2Q49A 4WXRA 2RC5A 1SHKA 4HUQB 4M53A 5ILQA 4AMBA 4BIIA 4QGSA 4CBVA 3NHRA 4PCAA 3SQWA 4I5IA 4KNYA 1V8BA 4GD3Q 1CUAA 3DXFA 3OI7A 5IDXA 5D2CA 2ZWVA 1EZ1A 1Q1GA 1ZA1A 2PPLA 1NBMD 1Z2OX 5LQCA 3MPUA 2GZ1A 2Q45A 3RYFA 1SEPA 3IEKA 4LXUA 5CM9C 2QG9A 4CKWB 2CFCA 2JD0A 1MO6A 2X9LA 1G21B 4OQPA 4OUKX 2PUJA 2VXYA 3I52A 1K9SA 3B20A 1RMQA 4BNYA 3LUBA 1SFRA 2BUBA 1I3KA 1DO2A 1GKKA 2XVAA 2F59A 3GCGA 3C1AA 4FOOA 4R1MA 4WKCA 3VR1A 1YZFA 4BEVA 1SVSA 3ZVMA 4NE2A 1GAQA 4DJTA 2YIDA 1TLLA 2D3WA 1OX6A 2GEDA 2RB5A 3O9VA 4P4LA 3VNBA 1U1FA 4F5WA 1DBIA 4HWTA 2OBYA 3GFOA 1VHWA 1KI6A 2FB9A 2HGZA 2PKXA 2YVAA 1JLSA 5DKFA 3CVOA 1LSSA 3I8OA 1Y4SA 3DDZX 5EKTA 4DCVA 2B82A 2QPLA 3B7PA 1WNTA 4R1UA 1JHAA 5A5DA 1EWRA 3SQMA 4I7EA 4YJDA 1WTAA 1H66A 4J7AA 5DBHX 5CCDA 3RIGA 4EB3A 2XRMA 3FLAA 5GVSA 4M0KA 4GRDA 4L8WB 1T5SA 5TF4A 4F6RA 1UCFA 4YAFA 2WWIA 2HWKA 3FRJA 4Q7EA 3TOCA 3FMGA 2J0VA 1PWYE 2ZRNA 3P2MA 1RTKA 3FBTA 2DWUA 4UU1A 2NG1A 4WFJA 2BEWA 3UENA 4RA9B 3KEQA 1GGMA 4JB8A 3MTIA 1QQ5A 4Q3CA 3OH8A 3E58A 2IEGA 1M6YA 1VMDA 3LLMA 3RSOA 1V7ZA 1KBOA 4LRTB 4BRUA 5CB6A 4BNHA 4ZAVA 3L05A 1AZTA 4Y7DA 1DPGA 2GDZA 3N2KB 3OKAA 4RANA 3AVUA 2BCEA 1JJ7A 3N39C 3QTLA 4EQ6A 2I7TA 3L0OA 4Z9AA 2FU5C 1XWIA 3SAJA 2GT1A 5JRZA 1TZKA 1SUAA 3A1SA 3D6UA 2P9GA 2Y0BA 1Z06A 1Z4MA 3HUTA 4NCHA 1IXSB 2NUAB 3NM6B 4DJFC 2Q5JA 2BUAA 5EUMA 4OXYA 3F78A 2TMYA 1KQFA 2FEAA 3FR7A 3EGIA 2IHVA 3HACA 1MAVA 3JRXA 3KB8A 1QVVA 1XYGA 1IZ9A 2A0FA 2VJYA 2ZYWX 1XQVA 3HMQA 4NZNA 1S7CA 3NUQA 4QQRA 3T9BA 1F12A 4ZC8A 3RVPA 3WQQA 2WYOA 1S2MA 1TKAA 4L0DA 1KGDA 1RI3A 2V7BA 4N5DA 1TA0A 3EIOA 1TIKA 2BGRA 1Z7GA 4OQNA 1LBQA 421PA 2YUTA 2REOA 4QREA 3MTGA 1XKQA 4E7PA 3TM5A 3MMXA 2NYAA 1NW9B 1MB4A 1X70A 4JFAA 2GKSA 4AFNA 3AEUB 1F06A 3C6KA 2QRPA 4MA4A 4ZDIA 3RWBA 1D4ZA 4ZOLB 1HBJA 4LFCB 1LNSA 1YS1X 5LA6F 1P39A 3IVGA 4JGIA 2HL6A 5BXQC 4PTZA 4UNRA 4FHCA 3W2GA 1CS4C 2PD4A 2VHUA 5HXAA 1PV2A 3EIFA 3DBOB 1R0KA 2W6ZA 4KQIA 4DQDA 1EA5A 2FHPA 1Q7GA 3ICVA 3UAWA 2SKEA 3T34A 2HREA 4MTLA 4Q4DA 1UZLA 3E2IA 4Q9DA 5AP9A 1BOOA 3X1ZA 2CXUA 2RHTA 2VSOA 3WWYA 4CG0A 5C35A 4M9ZA 2V45A 4A0HA 1WBBA 1Q7TA 3G9UA 4YDHB 2PMCA 4UBMA 2V1UA 2CJWA 4QU8A 1PQWA 2JGIA 2VKQA 4EB6A 3TZHA 2DYKA 3GBVA 4J43A 4NS4A 3EC7A 3THXA 1UJBA 4MQ6A 1WHTA 1GGNA 3ROZA 3S1AB 1MB0A 2WJYA 3RSGA 4PAMA 4X8MA 3R09A 5KYWB 2PNJA 2QE7A 4ER7A 2JDID 1DQNA 1N2XA 4I1UA 5LZ7A 3NLLA 5JALA 4BCCA 3DVSX 1B0PA 3UN1A 1W0KD 4RYLA 1GCGA 4FFPA 2C7QA 1HDGO 2GS9A 1NIPA 4AYTA 3LFHA 1T35A 2JJMA 2RGNA 1TTPB 2W22A 1EMDA 1AJEA 2ZANA 3HVHA 4F4HA 1G3MA 5CD9A 1H9BA 4FX5A 5DBIA 5BWBA 4NARA 3K0SA 3A4IA 4RLFA 1AHPA 3B9BA 4XH9B 1T4DA 1X7WA 2PRSA 1I1NA 1USKA 4F21A 4EL5A 4YRAA 3UPUA 3U37A 2AOTB 3AB7A 1AH2A 4LJ7A 4E5UA 5TV2A 2FWBA 2QB5A 3FKJA 4H9GA 3SS7X 2QJRA 5KZMB 4MGZR 2HU8A 3FSEA 4XOIA 1BW9A 1BXRB 5EIHA 3LF2A 3PU6A 3NHZA 2JGJA 4BJ1A 1NNLA 2JFXA 5FD8A 5JD5A 1PX2A 1PR5A 2W0SA 1ZRHA 1DTEA 3I5XA 1BYUA 5GINE 1NRWA 2EWVA 1TM1E 2ZVJA 4GF5A 4O6VA 1AUPA 3U7FB 3FLMA 1I4OA 3KJXA 4X6YA 3GRPA 4MEAA 3WLQA 3LUDA 4W9MC 4KVFA 1A50B 4JLNA 1FNMA 3IXQA 1N6LA 1ZG3A 2C58A 4HCJA 4LF6B 1BDJA 2EP8A 2GFIA 3DT9A 2ONJA 1BMQA 1ENYA 1L7PA 3RSLA 4PYOA 5DCYA 4PN3A 5HKKD 2GPBA 5MF6A 4M9QA 4GSLA 5JJBA 1TJNA 2ZRDA 3SC6A 5A0FA 3ACBA 4N0PA 2PUFA 1A4XA 1D04A 1RPJA 4PLZA 1W93A 1X3SA 5CLLA 2PSJA 3DOFA 2ZGVA 2B4AA 1TLTA 4J16A 3LCRA 5D5HA 5AVVA 4B73A 4IZHA 4WOPA 3TMAA 3E9NA 3FTPA 1I2BA 3OZDA 2QR3A 2X9QA 2ZSIA 3OP4A 3TNYA 3ZXUB 3L8HA 4G5XA 1NT2A 2ZE5A 2ORWA 3KYCB 3WO1A 4OLAA 5A5FA 4LX0A 2C2KA 2XNDD 3PSAA 1S0UA 2H54A 1BE0A 1VA4A 2AMLA 121PA 1R6AA 1XU7A 2MSKA 3KZOA 2HLHA 4ML3A 4MRMB 3JWGA 2IKSA 3IOCA 4UHHA 1UPCA 1YR1A 2D2FA 1MO5A 1BVYF 1LK0A 2XB6A 2YWXA 3DKKA 1NSTA 3SHVA 2W6PA 4DWWA 3I64A 1SD1A 3V2IA 3KYDB 3BQMB 3I72A 4JCOA 4R2HA 3UNXA 4C0KA 1MTZA 2P1ZA 3DE2X 5H0IA 4UQLA 1EWYA 3LZ6A 2CVQA 1F1BA 2EBUA 2WJAA 4P81A 4P9NA 3NJ8A 4RORA 1GKLA 4M83A 4X3OA 1MNQA 1VCOA 1BRMA 2PLNA 4IIJA 1DBSA 4CKBB 5JCJD 3WLMA 1XXLA 4J76A 4ZALA 4BUZA 1K3FA 2O0JA 4JX8A 3JD0A 1NASA 3FTDA 2ABWA 3BFJA 3EIXA 1VGVA 2ADMA 2JDIA 5C7YA 3OE5A 1WD5A 1DO0A 2R7AA 5ER6A 2HIGA 3OJXA 3PEEA 1JT2A 2ONYA 3V7UA 1SBYA 4LRXA 3ZQKA 5H8WA 3ZIUA 1B2RA 1M2WA 4LMRA 2WU1A 3RHFA 2X6RA 3WGUA 4LFBB 4Q05A 3GFGA 1XZQA 1DRWA 2OBMA 5H9VA 2XWBF 1UM9A 2V7EA 4Z5XA 1OVMA 3FGPA 1RJGA 1WSAA 3A3KA 3QLTA 2G0NA 5SZJA 2CLMB 3DMFA 3O4RA 2G4VA 3LA8A 1SO8A 3L93A 4WK0B 3IB6A 4RF4A 4E4YA 4CG1A 3I76A 4BQNA 4JBXA 2WP0A 1KY5A 3UFXA 3UOGA 1CE8A 1RJEA 2XJ9A 1Z47A 2H16A 4M1KA 2VBIA 3K1ZA 1FU8A 3PJGA 5DB4A 1QIFA 5J9FA 4V02A 5T4FA 4KGZA 2I1QA 3WSWA 1LVGA 1YR3A 1LWNA 2B0JA 1IB6A 4NMXB 2Y3IA 2IK8A 2RKBA 4K6CA 3H84A 1LS1A 4KPGA 5GONA 4FYVA 2IEBA 1NX6A 2H2IA 4OJNA 4RUKA 5ESDA 3LO5A 2JRCA 1V4BA 4PYJA 4I2VA 2B2CA 3B1XA 3KXKA 3F5SA 1CEQA 2YOGA 4PYQA 3ZCPA 3PRKE 2HM7A 3A28A 1QGUA 1THTA 3C8ZA 3WNDA 5BMVF 2CDNA 2EGUA 1KA9H 2ZI7A 5KOIA 5ER9A 1PDVA 3MT7A 4MW1A 1GSOA 2XMZA 4YPOA 3COSA 2ZUCA 3EMKA 2CLKB 3BILA 2YY5A 4KRFA 3C7CB 2PX0A 3RE1A 2FSIA 1CPYA 2IP4A 2EVWX 3V48A 3DDCA 3G9QA 1MXHA 3LFTA 3ZUPA 2P3QA 3UO8B 4CQLA 3HWSA 3QVSA 3WBBA 3BK1A 4V1CA 2NO1A 1IPEA 4MO9A 4IQ0A 2X9VA 2O8BA 1IQUA 4UPDA 2XNDA 5DNUA 8AT1A 3THYA 3OESA 1E1NA 3C3BA 3OJOA 3IP1A 4ZKEA 2GBPA 3FJYA 3OEHD 2EIHA 4AXXA 4C1NA 4OQEA 3UM9A 4M7RA 1OTHA 1QWOA 4F2DA 2GK7A 3K53A 3FFAA 2OORC 3AV0B 1W88A 3W4KA 3EXEA 4NBLA 4TWAA 1U8AA 3BMOB 3ADCA 4HN4B 4DMUB 2A30A 2J9RA 5IS2A 4RTOA 1WX1A 2HUPA 1GUZA 2QNRA 3MQ2A 4GI1A 1DLJA 2RG1A 4Q4JA 4R69A 2P7IA 2BKVA 5ALLA 4DTCA 4NXMB 1G42A 2GFHA 4BNKA 5JCJA 2FSHA 4AUNA 2ZJ6A 3SYTA 1STOA 3U3KA 4FGWA 1U9YA 4LDJA 1V3QE 4A2WA 1R8YA 2GZSA 2O0KA 1G18A 1WP9A 3KIPA 3DP7A 3PQCA 3CLVA 3G13A 3WRXC 5C7IO 5HKLA 4RDXA 1P7CA 5LJIA 4X0EA 1PIWA 3VYRB 1R9GA 5DT9A 1R27A 4HGZA 4J7CA 1GZ3A 1JSCA 4DWVA 1GV1A 3T3HA 4GOMD 4WERA 2GVDC 2ZRGA 4ZQBA 3UB3A 1YB6A 4QJ4A 4UU0A 3ZNQA 5C4IA 1N2CA 1VA5A 5AXCA 1GUYA 2WQ7A 2GN9A 3B13B 3ELBA 3EVFA 4HMQA 4N3NA 2QNBA 3PE6A 5EESA 1AGPA 1XFDA 4TLLB 4HEQA 2VYFA 2ZRIA 3DM5A 3RS3A 1XZEA 1PWZA 2SBTA 3A1WA 3FDZB 4K9PA 3HCOA 3HFJA 1BN6A 4KO8A 4F97A 3EF1A 1EXWA 3VZPA 4G0QA 3G5LA 2V96A 1V1MA 4J6FA 4LZZA 2NU9B 3WB0A 4DA9A 4OHOA 2PBLA 5JQGB 1BU5A 1HLGA 2P4HX 3MT0A 2HJRA 2P7HA 2WUEA 1TZCA 3OJ0A 3LOUA 4IFBA 3SBEA 3UHFA 1VIYA 1UKEA 4ERNA 2FZEA 1ODSA 4I99A 4CM4B 3KSRA 1JIQA 1QH9A 2VPYA 4L4ZA 4V0OA 3F6EX 1U3GA 1QORA 4YRJA 3TG2A 2ZS8A 3A58B 1MPXA 3PNQA 5H68A 1SZPA 4YAUA 3W05A 3RQIA 2IBSA 1W4RA 1XOIA 2OHXA 3AILA 1L1FA 2Q46A 5G0VA 5BNWA 4TMYA 1ECFA 3P9KA 3UHAA 1PSDA 2XCIA 3IAM1 4N8SA 5D3ZA 3W5HA 4EKGA 2CLIB 4NK4A 4B8WA 2AGVA 2PGAA 4JWTA 4PU0A 1GTJ1 4LGCA 1RIIA 5F52A 3ZR4B 5LQDA 2JLYA 1WU7A 3GAZA 4ZJZA 2J0SA 3T7KA 4L08A 2BDTA 2IHKA 3PNLA 1Z0IA 2R11A 4OHBA 4AWXA 4HN2A 4BGEA 4BTLA 1MPTA 5IBRA 4O0LA 3I01M 3QVTA 4DC1A 5JAMA 1JW9B 2IOYA 3EZ2A 2BGLA 3RAEC 4S1TA 4BOYA 1O8CA 4XYEA 2KYRA 4FCWA 3OEHA 5D86A 1PG5A 3SC4A 3VYWA 5C37A 3THWB 3WWOA 4F5EA 2D4AA 2WB2A 3C6ZA 2WD9A 3GJXC 3JQ8B 1LI7A 1SM4A 3HNPA 3C39A 3CNLA 2SICE 6CHYA 4RHTA 4W9NA 1F0NA 2H18A 3DT8A 3Q7TA 4PPYA 4UULA 5J2TF 3OFJA 2WU0A 2J07A 2UYQA 4TT8A 1JFLA 1NF2A 1PR3A 3RIXA 1TJYA 4KWIA 4WQMA 4AO8A 1NDHA 4CG2A 2BI4A 3JWPA 3BXGA 1LTHR 1Z0JA 3RIYA 4O4IA 1Z73A 1H1LB 4RKFA 2A2ZA 2ZJ1A 3QYAA 2PS3A 2JCVA 2CXXA 5JAQA 1MOSA 4JI6B 1R12A 3HJFA 4BBPA 4AKGA 3LM8A 4TV9F 3MSCA 5TQVA 5JVDF 1D7AA 3GRVA 3ZW9A 2EZ4A 2BONA 3N70A 4G89A 3O3MB 2J5QA 4F5YA 2EV9A 1FBTA 4IDFA 3WGYA 4RGVA 4DV2B 1DC8A 1OXXK 3E3LA 5C1PA 4NH0A 2QQ0A 4X1IB 5EMHA 4CL2A 2YV5A 4CM8B 1J2JA 5A03A 1XP8A 1OILA 2C77A 4RVHA 1HT3A 1LQTA 1BEEA 2G0AA 1C4KA 1CY1A 2G40A 3ESBA 3K9BA 4PTYA 1BIFA 4DEVA 1MO2A 2LVBA 1MABA 2H1FA 2CUNA 3CRZA 3HO8A 1W2WB 2HDNB 5A3RA 5KQLA 3D1JA 3QBVA 4ARUA 4GMGA 5DBGA 2XVMA 1NVBA 1JALA 3EGDA 5K45A 1YHNA 1PT9A 2CMFA 4JBHA 5HM8A 1XYYA 1NSFA 1QBKC 2YJTD 4X5OA 1E1RD 3LQ2A 4DLKA 2O52A 3WFIA 1S2OA 3MMPA 3TZ6A 1UMBA 1ZEJA 1WLSA 3M5DA 4QU0A 3LYAA 3VU0A 4JV5B 1P33A 4OFBA 3AF1A 2B9VA 5HS6A 3FOWA 3OQOA 2XXAB 2PGOA 3EXG1 3BT7A 2PV0A 4H4EA 4C7KA 2XWPA 3UG7A 4ENPA 5LMNB 1Q21A 3LI2A 4GG1A 4GYKA 3OOHA 3OA0A 3RRNA 4EG1A 2AUMA 2ZWPA 2C9MA 3FTQA 3IEXA 4U5XA 4E3WA 1GN8A 3K0FB 5KCZA 4R8LA 5AVZA 1I9CA 1T43A 3KQVA 4I66A 4LOKA 4UZFA 2J9FA 2RBKA 3TIGA 3EX7C 4F1KA 1IN8A 3IVCA 4O2BB 1I51A 4I55A 2ZJ4A 3WLPA 1U5CA 4HXGA 4HRXA 2IUTA 3RGWS 1PR4A 4EHJA 1X7DA 4Y67A 1JU4A 3CLKA 2G07A 3EYAA 1VHQA 3NIWA 3HJGA 4NG5A 4WBNF 4ZCIA 4L8LA 3SXJA 2JLWA 3W3AD 3IAXA 3QLUC 4H1VA 1P5HA 4HV4A 4QLAA 1VBKA 5J2UA 3IA2A 4UAUA 1UPBA 4M1YA 5F1OA 4C87A 3AF5A 1DTWA 1ZM4A 2AJ8A 1QV6A 4HD8A 4UOEA 3FYUA 2NPIA 3F7OA 3P45A 1ZJWA 5MGBA 2WFAA 2EQ5A 2L17A 4LKRA 5EMKA 4U7WA 3HP1A 1AGRA 2FEOA 2VJKA 4DMMA 5J4KA 2Y1DA 1V5FA 1PFYA 1HYGA 1YI8A 1YS9A 2MYPA 5ARDA 1B2LA 1M0TA 2LCQA 1SOMA 4BX2A 4QDTA 2FOXA 4OIFA 1YBAA 3UT0A 3BOSA 2J6BA 3OCWA 1GCIA 2EFJA 3CPEA 4KAXA 2IYUA 3NYIA 4LEIA 4WZ6A 1JFRA 5I9BA 9ATCA 5IX8A 1EXVA 1OH6A 3KAPA 2NTEA 4PZZA 4YO8A 1ONNA 4G1FA 2AKEA 2QPTA 3WB9A 5J5AA 5AESA 3HYSA 4H7PA 1THMA 1CY8A 1Z7BA 3HR8A 3OHPA 5BN1A 1PJBA 3KEOA 4JLUA 2WEKA 4JP1A 1CR6A 2QPOA 4MVJP 4YFVA 5FA6A 2C5HA 5H02A 3REQB 3U62A 4C04A 3U16A 2ZBEA 4LGVA 2P68A 2HF9A 1HE1C 1LCIA 3IX7A 3K3PA 3AEKB 1FQJA 2DQYA 1NG1A 2JLBA 2HDWA 3LBYA 2GASA 3HRIA 1D2EA 3NPAA 4XB6B 4KO3S 1WY5A 2EGHA 5K51A 5LZ2A 3ANSA 3E9YA 3TFOA 3DXXA 3KQPA 5EFZA 1OWMA 4C0AC 4E5PA 4GXNA 4OEHA 4X20B 2B1JA 3VYSB 3ZDCA 1C2TA 4D0NA 3D3NA 2EKQA 1F0KA 1JRLA 4ZVQA 1ZD2P 1SXGA 2NVWA 2WYUA 5DLQC 2Q2NA 4C2TA 2Y9MB 1SUFA 2CUKA 4D9GA 2CVHA 3ZK7A 4A16A 3B3AA 1VJTA 2YWDA 1P5RA 5MN5A 2DBRA 1T6XA 3Q9SA 1BS1A 1OC2A 3UMBA 1KVTA 1ZGHA 1KK3A 2QLMA 1POXA 3P9IA 1DINA 5EZSA 1KRXA 1ZGGA 4CTOA 1P61B 4YJFA 3E1SA 3P0HA 1SBIA 3OX2A 1P1BA 3H5WA 3OTOB 1P2DA 3G0OA 4WMLA 3NTUA 5EJEA 4DKXA 4J0FA 3L9WA 2AA3A 3AETB 4UVDA 4MS3A 3JWHA 3SYRA 2E7ZA 4B4VA 1PFQA 4UTPA 1WO8A 4FCVA 4TV8A 2OORA 2H0QA 5EYPB 3WIEA 4CF5A 4CR8A 4BNFA 4N5HX 2OG1A 4JQZA 1E4EA 1O8BA 3IEPA 5EE3A 3ILYA 4TKVA 3IEIA 1AQ6A 4DHEA 1E1CB 4Q9KA 3U1TA 1I32A 1MC1A 2F3TA 2I4NA 1P5FA 3MK31 1L8XA 4NENB 5DASA 3A26A 3RANA 2V9CA 3LK6A 1R66A 3O1JC 3UUWA 1L1QA 1Q17A 2VQEB 1KBQA 5BWOA 5K3EA 4BGDA 4IYRA 4ZPJA 1NVWQ 4K86A 4E3ZA 2JASA 3GT7A 2I62A 2AJDA 3COWA 3GEGA 4WFKA 1WSDA 1R8JA 3UW3A 3D6TB 4QM7A 5A62A 1SVMA 4B32A 3Q40A 5DMHA 1GKUB 1II8A 3SR0A 1PNQA 3OVMA 4QUAA 3NWJA 4CMBA 1W36C 2R7NA 5FYDA 4DM7A 3HCPA 1K7YA 4EZIA 3EVZA 1SVKA 4PZPA 3V5NA 5E7QA 5KTTA 5JTTA 2Q5IA 1FS6A 3TTTA 2XZPA 3OTIA 2F8LA 1BE1A 4PZYA 5EMMA 3LVFO 3BL5A 2WTEA 3G7SA 1MC5A 1YB7A 1E8DA 1K0FA 1FFWA 1BWRA 2DUWA 3JPYA 4GGPA 4I8XA 1YJXA 4W1RA 3R7NA 1RJ9A 2GXUA 2NZYA 4A6PA 3BC1A 2QDXA 1EGQA 2VPIA 2WAMA 4MVJF 4WZBE 4YRLA 4HWSA 1G2QA 3OOJA 2FW0A 2VCHA 1JQ3A 1Y8AA 3IXMA 5E4FA 1HDXA 2O5VA 4GZ5A 2D0OB 4IHJA 2G09A 1MLDA 4L73A 5L7YA 3WG9A 3MWGA 2YWJA 4D4GA 3IPLA 5L3QB 1IEXA 1IZ8A 4A9AA 2GPNA 3S8MA 4QECA 3H1EA 3U81A 2ZSFA 1D6NA 5AUNB 3DXYA 2B8JA 4E2WA 2YVUA 4GGOA 4Q3NA 3DYBA 4FHEA 5GGXA 1DWQA 2VTBB 1MHTA 1CUUA 1DO8A 3LX4A 2JI6A 2NLOA 4YFYA 2W2OA 4HYTA 3Q8WA 4BO2A 3PV0A 2WZQA 3DMTA 3TPFA 2OC4A 4XTRA 1NQUA 3DVAA 3AKYA 3ONDA 1HDZA 3KVVA 3FOCA 4DRXB 3DAGA 3HU5A 2P5SA 4LS3A 2BTQA 1KC1A 5CDYA 3CEMA 1RKUA 2P1RA 2Q3CA 1UZAA 2DTXA 3KTOA 1ZAKA 1QFJA 4P3KA 5LMZA 2YXPX 1NW5A 1YD7A 2P2NA 3JXEA 5I7SA 4WRRA 4MZXA 1NYQA 2FN8A 3DUWA 2ZRAA 3QVOA 4UNNA 2WJPA 2QRMA 4EDHA 3OLVA 4AIIA 2P75A 1TVCA 5AFSA 1DWPA 1T3ZA 4I4NA 3KQLA 5HQTA 2ZDHA 1M1ZA 4O33A 4RZUA 3X2FA 4ETNA 1RYDA 1ILWA 5EHXA 4DARA 3OPQA 2Q8QA 5ARCA 2D1FA 5EUBA 3BMNA 3I1YA 3RQSA 4D9CA 5AM1A 3R7AA 1PAUA 4OX9B 1PWEA 4JKYA 1FTQA 4EVIA 5UKDA 4E5YA 5FEMA 4P7FA 3T5BA 4G0NA 4CCWA 2I66A 4GI2A 4WLFA 2C82A 4QEKA 5KYUA 4US2R 5IAAA 4E1BA 3REGA 4CV0A 2V9ZA 3ICPA 2GN8A 2BW0A 1NJ5A 3QSGA 1W73A 1QMGA 1DOAA 2G8NA 1M2FA 1KYIA 2JGAA 4RH1A 3VOBA 4K9NA 2PMBA 4PYKA 3DSRA 3EQ7A 4MUEA 2VHCA 5BN3A 5CDSA 3HBMA 3O94A 5CDFE 3RADC 1ZR2A 1XMPA 1W44A 2HHJA 2QD2A 3H8VA 1MX3A 1EFKA 1J0XO 4FE7A 2C2HA 1WXIA 4RKWA 4W6ZA 1ZBDA 2E48A 1J0BA 4M86A 5D5PA 5KMGA 1XCBA 3PE4A 1XMJA 4AK9A 3KOOA 1RRCA 3HABA 4I1VA 1XB2A 3VISA 1ENZA 2WVAA 4LWPA 1K86A 2Q2VA 3BSWA 1B7GO 5HP4A 2ZXFA 2Y1EA 4EHIA 3FM9A 1YHZA 3D7SA 1EK0A 1PEYA 1Z4JA 2G3YA 3H04A 1OGJA 4C43A 4O1HA 3RNLA 3I6IA 5CG1A 4OBBA 2JBHA 5EPEA 3IMFA 3R5HA 3QG1A 1MEEA 3NBUA 3IDQA 4ZJPA 2PH1A 3EISA 2RGAA 2QMYA 3CA8A 5GV7A 4BMSA 2C5FA 3VPDA 3MRXA 4I4TB 2HBRA 3WICA 3N2NA 4V2IA 1VL5A 3C24A 4Y3UA 1OFIA 2NV0A 3HNRA 2HJHA 1CUEA 5IP5A 4G4SP 2G1AA 4C6HA 4EPWA 4HNTA 4P4TA 1R3UA 5GJCA 1OB5A 4FFNA 4A6EA 4JLAA 2EZTA 3RC9A 5CLGA 4P34A 1CUBA 3QXHA 4Q01A 2WWGA 1L4BA 3VHXA 3QKRB 4D4JA 3KB2A 4M6WA 5A5GA 5I48A 2B5OA 3HSSA 1YTUA 2KE5A 5K8VA 5TQJA 3EDMA 4PXYA 1IPFA 3HCAA 4QOHA 1W6UA 1XMVA 3DBHB 1XDSA 4UUOA 1E2EA 1UJ4A 1RKVA 4IBOA 1N3BA 1Z0ZA 2CCGA 1YJQA 2B6HA 3CUYA 4DA0A 1R0YA 2VZ9A 2XZLA 4CU2A 3GN2A 3UAZA 3IAM6 1FDTA 3GEDA 1JR3D 1Z2DA 1JHMA 4KKVA 2BFFB 2CB9A 3QE9Y 3FTCA 2F4NA 2C2WA 3GDOA 1P1IA 1EP1B 1KC3A 1KU6A 2A1UA 2IPAB 1RLJA 1V8FA 3KWLA 4BLPA 4HVCA 4YCCA 5KNBD 1QM5A 1L7BA 1CBUA 2CF6A 1A7KA 1RHKA 2BD0A 2WKRA 5ALJA 4CF6A 1DAFA 1I0ZA 2O50A 4D1YA 3D8RA 1NVXQ 2ECOA 2GMWA 2GEVA 4JXJA 1DXYA 3D5QA 3FOZA 1YRAA 5A5EA 1FCJA 1E9EA 1EM8A 2XMCA 3D1VA 4JVNA 4RJKA 3T15A 2A9OA 3TB4A 2IUEA 2OG2A 3RM3A 2E5LB 2H4YA 4K9LA 3CZ4A 2ZUVA 2BFEA 1TUBA 1M8GA 2RMKA 3O3NB 1Y80A 4CL8A 2JEOA 2J7KA 3IVXA 1J2YA 3RAJA 1WPRA 3QHAA 4C06A 1CJKC 1DELA 1I5EA 2HBZA 3NR2A 1MUUA 2VYVD 5HZGA 2RSLA 2PKQO 2YDYA 1CZOA 3R1IA 5MFZA 2FOIA 1O6ZA 5T5QA 1OGIA 3K30A 2XUGA 4QOIA 1Y81A 4XRRA 1DCKA 1OXVA 1TJPB 4BO0A 1HFEL 1XJ5A 4X41A 2ID4A 1QOZA 1TU0A 4BAGA 3TMYA 1KAEA 1NMQA 1WXGA 1DIGA 2V55B 3CX3A 4FMDB 2JPDA 4M7WA 3OC0A 1I80A 1ZD9A 3PQ5A 3EEYA 4BMXA 2E5FA 3HKBA 3P2KA 4ND8A 3X1DA 3C3YA 4RSMA 4X71A 2UUBB 2FZKA 3JZIA 5HCIA 4L76A 1VFNA 1X13A 3QUAA 3WNVA 2ZXEA 1LZLA 4YJ3B 4E5DA 2GVZC 4TYMA 3SC2B 1JPUA 5B7PA 5JXWA 1YQQA 1YFZA 2H2WA 2PUWA 2WIFA 3I1IA 4CEJA 1BH2A 4PLHA 1RACA 5F5XA 2GD0A 3MEQA 4DC9A 1P3DA 2QX4A 2WHYA 1ZQ9A 1REQB 3HQ4O 3K0BA 2O2GA 4IH1A 4LPSA 3A1VA 4BNLA 4MKGA 4ZYVA 4PBTA 4LTNA 4B2LA 5IJ0B 4X66B 4DR4B 2YTZA 4MV3A 1NFRA 5ESRA 3W1WA 3C43A 3GLHA 4HVAA 4PTLA 5AYVA 4LYGA 1UBHS 4IV0A 5A1TA 1E98A 3ER8A 2ZIEA 5KYVA 4RADA 3TTWA 4D4IA 1U7UA 2BSAA 3ZWCA 4UW9A 3KZVA 4XPIA 5A06A 4L4XA 3EH2A 4NBNA 3DZFA 1CR4A 1O57A 721PA 1BXGB 3J81k 3KXLA 1SHLA 4KTTE 2EARA 2B94A 3L8ZA 4IMPA 5JHHB 2MSNA 2FR1A 4PX3A 5DM4A 3PICA 2QN9A 4UTOA 5T3YA 1MGOA 1G63A 3ZWYA 3ANNA 4M3NA 2ZYTX 1O9GA 5JMWA 1GA1A 3B1YA 1SURA 1ZH4A 3IL2A 4WGFA 16PKA 5IM4A 2BZ0A 2PLFA 3AHDA 2C3YA 3ZCSA 2PH3A 4FIDA 4ALJA 4DCOA 5JZOA 3L8MA 3W7VA 2G88A 3RBVA 3EAFA 2Q5QA 3B6JA 3L1HA 3PA8A 1KZ9A 3RJTA 3WSTA 1P6QA 3OQVA 3T5CA 4IF4A 3VMFA 4H7DA 2DWPA 2X5KO 4DMFA 3NWPA 4QBKA 5EZYB 2WI8A 3PGMA 3W90A 4BV3A 2FLWA 5IM5A 2X3FA 5CB4F 1UL1X 2FGKA 3G8BA 4YWJA 5KNBA