1O77A

Crystal structure of the c713s mutant of the tir domain of human tlr2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
146
structure length
141
Chain Sequence
ICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWSKYELDFSHFRLFAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An Extensively Associated Dimer in the Structure of the C713S Mutant of the Tir Domain of Human Tlr2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/membrane protein
molecule keywords TOLL-LIKE RECEPTOR 2
total genus 42
structure length 141
sequence length 146
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2002-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 1o77A00
4LZPA 2M1XA 3OZIA 4C6TA 4LQDA 3UB4A 2JS7A 3H16A 4C6RA 5KU7A 4LQCA 3UB3A 5H3CA 2Z5VA 4OM7A 1FYWA 4C6TB 4FZ5A 1FYXA 3JRNA 4EO7A 4DOMA 1T3GA 4C7MA 4W8HA 4W8GA 3UB2A 1O77A 2J67A 2Y92A 5FORA 1FYVA 4C6SA
chains in the Genus database with same CATH superfamily
3L92A 1WIWA 2PKQO 3LUJA 5LQJA 4AWBA 3WFZA 2Z3WA 3S55A 4QVGA 3LC7O 3V2GA 1T4GA 2E4VA 4EUEA 4AS1A 1FOEB 1EJ6A 3LUKA 1KFJB 5LJLA 2QAGA 1N32B 1KU0A 1GCUA 5LD2C 3N70A 4XB6B 1V5FA 1IAVA 3NHJA 5DBHX 1KWKA 3H3JA 3WBBA 2D1QA 3FWZA 2ONYA 2QNIA 4LNHA 1H2ZA 5CIWA 1IY8A 1EZZA 2ACVA 3DT9A 3UWPA 4WESB 3H83A 1LS1A 3VBEA 1XN1A 1YVEI 2F7SA 2W4IA 2OXIA 5KWJA 5JASA 5L3SA 1SD1A 3HB9A 1TU3A 1QYWA 3EVDA 1LLDA 1B73A 1VECA 3BPSA 1J0EA 1U1GA 2H9YA 3BRWD 3OJXA 4CIWA 1A9YA 1U8XX 1PSZA 4ENUA 4JUCA 4DSTA 3QUTA 3VBCA 5A4KA 3A10A 3GPIA 1AGYA 1SQ5A 2DPLA 3RSGA 1RYNA 2Z9CA 3HYSA 4MWTA 2PLFA 3BIXA 3TOSA 5KVVA 4BGEA 4ACAA 2A6PA 4D80A 1W5SA 5KYWA 1TF2A 2CXRA 5ESXA 3ZY2A 1G66A 1I3KA 1QVZA 3PJFA 4MWEA 4P36A 3GNSA 3VDNB 4B7AA 4IO0A 5CTAA 4X0EA 2RGYA 4P84A 3UJAA 3OTOB 2Z5GA 1HBJA 1W0KA 4MCIA 4PX9A 2GT1A 1AD2A 3HBNA 5CCXA 1QHNA 4IQGA 4KWTA 3HFRA 4MKXA 4EJSC 3CLTD 2ICAA 1YCDA 1RKQA 2I4MA 4XWAA 2PSJA 3C7KA 2GK3A 4P81A 4DMHA 3PDUA 2M6LA 4C2BA 1CUWA 1NRXA 3JVUA 5LA6F 4B6OA 3ZWCA 2IPLA 3MAGA 4B81A 1UODA 4QLBA 1YFZA 5C1BA 1IHOA 3RM3A 2I29A 1T15A 3HBFA 1WF6A 3WBJA 4BVFA 4E2XA 1JJVA 5B36A 3X1KA 3FNIA 2VEOA 5T6BA 4BJ5A 1L9XA 1FYDA 2B92A 4U8HA 2JKVA 3GI1A 1J21A 1GPAA 3IE2A 3PUIA 4G89A 3SQDA 1N6IA 3F97A 4BKMA 4V1CI 2X0JA 1MNAA 1RRCA 1TD9A 1AVTA 5AI5A 3RS2A 2PUCA 3H5AA 1TM4E 2ISCA 1UT8A 4U3JB 4BTLA 1GRNA 3A4MA 1FLDA 2UU9B 5IC4A 4OI0A 5AKLA 4LZZA 4B1FA 4N39A 4V3CA 3CRW1 4GG1A 4B2PA 2JGKA 1VE5A 2XVAA 4KR6A 2QVCA 4LHWA 3U5TA 2FPIB 5DN6A 3JZMA 4ZI7A 1X7GA 2B4QA 4G01B 4MIOA 1QLWA 3SX4A 1EB9A 1NUPA 2ESRA 3NIBA 4KSCA 3MNFA 4TS1A 1NOJA 5LC1A 1DAKA 4EVSA 4BTEA 3ZQ4A 1XZPA 3UT0A 2H1LA 5FUYA 2PEYA 3IPLA 4XE5A 4E88A 4FLEA 3OTHA 5IHPA 1FS4A 1PHRA 4TZ6A 3DVSX 3H0KA 2TS1A 1EYZA 2R7NA 1OXSC 2NSHA 1GGJA 4IDQA 3TLXA 5CDTA 4F04A 1FL9A 2A59A 1CUIA 4JYPA 3VU9B 1TAQA 4QE3A 1KY2A 3R74A 2W48A 3RRYA 1OILA 3T7CA 4LRUA 2G7ZA 1TJ3A 5FPKA 4CV2A 4NYJQ 2R9VA 2FV8A 2PH1A 3N86A 3OTWA 5DNWA 3SS7X 1CE8B 2I4TA 3KBOA 1X1QA 2C58A 2R6ZA 4R83A 2E4UA 4CEJB 1CNFA 3IMEA 3PPWA 2QSJA 4QG3A 1EZ1A 2K7FA 4OLAA 2Q4OA 3EUEA 2AVDA 2YCBA 1E1QA 1R66A 1XTPA 2GAOA 2E18A 5T57A 3WNDA 1E5DA 4EZEA 3ICCA 1O97C 1R0KA 3DDZX 3W6UA 4Q3KA 2ZIXB 4CLHA 2WG1A 3UCXA 3ICVA 5DCUA 5L4SA 1BXRB 4X7BA 1EB8A 1CB7A 3E70C 1NBAA 1OROA 2RE8A 2AI3A 1FZTA 2XECA 2TRSB 1SMKA 3I1YA 1MJGM 4HQ0A 3R7LA 3MGKA 3GLUA 5SY6A 1MA3A 3K9QO 1NYLA 1Q7BA 4FGKA 2DR0A 1EFRD 4C76A 1VZ2A 3OG9A 4AG6A 3KQVA 4F4DA 3KYDB 4MUGA 1QIFA 4EK9A 2EJCA 1QV7A 3O8BA 2G5TA 3LXRA 2UYGA 4FDAA 2E4XA 4YASA 2WJWA 3VKWA 4DTIA 2WA1A 4RVNA 1GZDA 5KTRA 3RIYA 4EQ6A 2A0YA 3UT5B 3HADA 3M1YA 1RXYA 3B7PA 3HDHA 4F5YA 4EKIA 5DBFA 4W1RA 1DAMA 3L0CA 2Q0SA 4EM6A 2IHTA 1GG2A 1KA9H 5AI8A 3SHOA 4EY3A 3GLIA 2Z58A 3KZMA 5EUCA 3N3BC 4YLEA 4ZN6A 2YFQA 3EARA 2PIAA 5FH9A 4I3HA 2ZIEA 1DCFA 4K7JA 5IHXA 5ENZA 3K2EA 3BDAA 4G5XA 1IEXA 1IN6A 4KPUB 4NH0A 1JIUA 2BE7A 2ZKLA 3NG1A 3ORSA 1XEXA 2OAP1 1I0ZA 1WPGA 2YV4A 4WVLA 2C2WA 4OP2A 1YL7A 1NNUA 3IBCA 4JQZA 1DC4A 4G9EA 1NN3A 1TYZA 4RMIA 1J00A 1NN0A 3WB0A 4M8SA 4PGGA 2ZRJA 3UQZA 2OHXA 1KDVA 3F8TA 1UKEA 1U8CB 5MN6A 3H9CA 4Q15A 5IUJC 2FY8A 1Z26A 3EG5A 5KNBD 3BIOA 2WICA 1QK3A 3LOUA 5KC9A 2P1DA 3BBPA 5KEIA 1F38A 1ZWLA 2YS7A 1IUNA 1MVNA 1EVKA 1M8KA 3H2BA 3HA7A 2ZPAA 3M3HA 3MERA 4O2BA 3CNLA 4TVSA 5B6PA 3MUNA 3H8SA 3SMQA 5HM6A 5M2QA 3PIIA 3ZU6A 5E2IA 4B7CA 3G1TA 3ZJ5A 2YNMA 2QMQA 2V6GA 3SNHA 4TTIA 2G1JA 1R16A 2EWVA 4JLNA 2AF4C 4J0EA 4P3PA 2MT9A 5CBPB 1RZRD 1H6BA 4CEHB 2G0TA 1FRFS 5D8DA 5F78A 1R4ZA 2CEAA 3L6RA 3T61A 1NJFA 1T5LA 4JODA 2Q2VA 5D2CA 1TECE 2BFBA 3TTXA 3AJ9A 4IX1A 2JZCA 2GEVA 4UAGA 2JBHA 3IXMA 3O7WA 4DW8A 2ZBFA 3BJMA 4JSYA 2IKQA 3TRFA 3T1OA 4MGIR 2JIOA 3HYNA 4ARZA 4FFBA 2QN1A 3FOWA 3O4GA 1WX1A 2VUSA 4FBLA 4HDNB 4MR8B 3RG8A 2HV9A 3X1ZA 3E7FA 2WYVA 4D6XA 5CDYA 5DT9A 3L4SO 3QTTA 4WCDA 1YTUA 1XAJA 5EJGA 6AT1A 1ZJ4A 5JJCA 4ND7A 1G6Q1 4Z4EA 1MEOA 3F5DA 1K5DA 2ZI3A 4GI3A 4XJSA 3KZXA 1Z4KA 2BL4A 5CM9C 5A2GA 1THMA 2Y1LA 1O94A 4JFRA 3A6EA 5HYVA 4YX9A 1PRYA 1ODFA 5C5DA 3WA7A 1JV2B 2O3QA 3QPBA 3SZUA 3HDGA 4EHKA 4DZTA 2VRCD 1K3FA 1TQ6A 2ZE5A 1II0A 3DBIA 3NTRA 3OJLA 3WDSA 4FB4A 2BHSA 2BF4A 1KORA 5F33A 1SBCA 5AP9A 3I6YA 4AMBA 2Q5JA 3CNQS 1M6NA 1OTXA 4KMMA 3UK7A 1XP5A 1FP4B 3B7GA 4UTXA 3PC7A 3CEAA 1HNZB 4BAZA 4ODIA 4CLEA 6YASA 4LRYA 1YQGA 5CFPA 1MENA 3EPJA 1JJ7A 3CXRA 2EIHA 2O7SA 2AH5A 1VCIA 2FA9A 5L95A 2B4TO 3ZGLA 3V8EA 4Y2SA 3DQQA 4E03A 4ZVOA 5H1YA 3EYAA 4ZAYA 2PU5A 3EODA 2GUGA 3ET5A 3PGJA 2FWAA 1O5IA 1QH9A 1A4UA 4X1YB 4ARZB 2ASEA 3GEIA 4URZR 1THTA 2CLHB 4S1VA 1D03A 3HV0A 3Q9LA 3ZBUA 1Z18A 1IMJA 1HL7A 1XX6A 3G5MA 4BNMA 2WB2A 4RUKA 3VC3A 2PSEA 4Q93A 4M98A 1KAMA 4YMVA 3HKCA 4DG8A 2JZOA 2UAGA 4C7XA 4QODA 3NTUA 2M9MA 4M38A 3ZHBA 3DAPA 4YAGA 5I6DA 1NFQA 1QNFA 1VE1A 1XF9A 4IFEA 4MO2A 5L3ZA 3GMSA 7REQB 2XIJA 4WCVA 5BW5A 1J06A 2FJ0A 2VPXA 3QOYA 4A2PA 2JJMA 4AUKA 3U4GA 1VMKA 4I9FA 1Z5WA 3TTSA 1IAQA 1JFFB 2FH5B 1K4MA 4P4LA 4K9DA 1XA0A 3WLRA 5CFQA 3FMVA 4EVIA 1GZ3A 4XWWA 3OU7A 1HOTA 1MDBA 4IQ8A 2HA0A 2MSLA 1DADA 4AULA 2A1TR 3DQZA 2OGWA 4PZUA 4U8GA 4YONB 4C5AA 4NABA 1KYIA 1Q50A 2I7DA 4ZT6A 4MS3A 4DUGD 1Q91A 4LOJA 4EP1A 2IBTA 2VTBA 4RQUA 3EEYA 2MINA 3UPTA 1GM5A 2X9VA 1NNI1 4P4SB 4PQFA 4WKPA 4ZQGA 5CT9A 3B3QA 1OJ7A 1PT6A 2AEJA 2QX6A 3AQ4A 4UVDA 4HXGA 4IX9A 4F4HA 4NCAA 1R50A 1VYUA 3THYB 1YQWA 1GOTA 5AIBA 2ES4A 1VOTA 3P0RA 1W9MA 3NM6B 3HP4A 1UBKS 2H2AA 1I5EA 3QKIA 4LHYA 4MV5A 4BZPA 4RTQA 2HR1A 1IONA 3HU3A 1N8KA 2A7QA 1UBEA 1UPUA 4QT4A 1I7DA 1N0WA 2GLXA 4ER6A 3EA5A 1XZLA 3FBWA 3O7MA 2XMSA 1CUBA 1KK3A 4C3UA 3PGA1 1PFVA 2NU6A 3GJYA 4CLOB 1UR5A 1VCHA 5EJAA 1UMDB 4AKTA 5L4NA 2B8TA 3AY6A 1SUBA 3UO8B 4XVUA 4ARUA 4DKJA 2BKLA 3GDFA 4V2IA 5JSHA 2FPPB 5ALUA 5CB8A 2C84A 2EXXA 3SWWA 3GNQA 2EBHX 1C5KA 4MV6A 4NPCA 3EZYA 3ISTA 1RQRA 2W90A 4M4SA 2CUZA 3I9JA 5FBZA 4YR9A 4DDVA 3AW8A 3FCSB 3O38A 2J4CA 2JCBA 3ND8A 4YT5A 4BXOA 3CUWA 4OQPA 4F6CA 1N9GB 4TMTA 1BDJA 2XQGA 3KOYA 4KYTA 1P9NA 2QQFA 3TPCA 1I3CA 3C8UA 1PK7A 4C0QC 1AQJA 1XNRB 1CF9A 1X80A 1S2OA 1M6VA 1DXQA 3C1AA 3OZRA 3NO4A 4OGWA 4DBLE 4ENQA 4ARVA 3UKOA 4BZQA 1EVLA 4Q66C 1GPMA 4QBIA 1MX3A 4X1OA 5JO9A 3NNNA 5ER9A 2BY4A 4DWVA 2D2XA 2OBNA 1Y6ZA 4B83A 3AZOA 1ZONA 4Q1AA 2ZBRA 2Q4RA 4FGWA 3TLBA 4H1WA 4JI7B 4LMPA 4R40A 2AUTA 2ID4A 2WE8A 3GWZA 3RKUA 3A70A 1N57A 5FUXA 2CYCA 5FX2A 3A7DA 4DIMA 2CEKA 1KTVA 3KUKA 2CW5A 2PKWA 5G3ZA 4J1SA 4ZCMA 1HDRA 2LCFA 1X9GA 3OTGA 1VG9B 3QU4A 1FUEA 3FWPA 1IUKA 3GH3A 3OTQA 2Z2YA 4CKBB 3AV3A 3PICA 1PZEA 1P4JA 4LEIA 4Y6QA 5FDFA 1KQOA 5KC8A 3R9KA 1IBMB 5KSPA 2WJJA 4YRSA 3I3SR 2GPBA 2E49A 2ZJ1A 3DM9B 3IE0A 2A5JA 1HQCA 3DV9A 4CMEC 1K7SN 2C2BA 4ZVNA 3HO1A 1F8FA 1LSJA 4WXPA 1N2EA 2WHPB 2O8NA 2ZSJA 3MMSA 4AKHA 4CETA 5EIWA 1RP7A 1KC3A 3B6JA 4RKFA 1K5HA 5B12A 4G5SA 2EF0A 5B1YA 1Y6JA 5FV4A 2XQVA 4RSGA 5LKRA 1IWPB 3PUKA 3UXHA 2Q6KA 5FBQB 1HKHA 1VLLA 2XZLA 4FIDA 1LPPA 1JS1X 4RVOA 1UBJS 2AN9A 2C2ZA 2BEUB 2G5PA 1TEZA 3TL2A 2Q9AA 1FDIA 3JR7A 3QFSA 3B6ZA 4HKTA 4K03A 3WTBA 1H8ED 5FLYA 3O1JC 2CLCX 2QLLA 5IZCC 4JJFA 4EJSA 3O8LA 3RSCA 1R0XA 4FKBA 2GWHA 2YTZA 4YDHB 5GOZA 4IWNA 4EFKA 1ZQ9A 4MICA 4K9QA 4K9SA 5EYPB 4A6PA 5FWAA 1RYBA 1VLQA 3V32A 3CUUA 1SVNA 4PZ9A 2J5RA 5DHUA 1IHYA 3KXDA 4Y6OA 3DLTA 2MHCA 2P7HA 4I4CA 4KQWA 3I2JA 3LMKA 3CQ9A 2HYDA 1CY0A 4NBWA 4EHIA 4DMRA 3NHAA 3IOYA 2D6FA 3E9RA 3GT7A 1K8QA 3INGA 3VO8A 3H5RA 1A88A 4LVNA 5CURA 2X0RA 4AP6A 5TLSA 3AF6A 3JALA 1GPKA 3UM9A 1XZBA 4P93A 1P91A 1E18A 1Y5LA 4D1YA 3ACBA 2P40A 4U0JA 5HIKA 1NBMD 2IYLD 3EGXA 1EKXA 3FJ1A 1MIHA 3AI7A 4R98A 3OKPA 3B3AA 4H59A 1WABA 5KHOC 2BM8A 4UM8B 1MRNA 2JLQA 2GPJA 2CDNA 4AFNA 1W5FA 1AB5A 1WG8A 4R6WA 1XVTA 2VLIA 4BJ3A 1DEKA 1IBRA 1V45E 4MINA 4CM4A 4DARA 2NSLA 1JSLA 3E4CA 4KE9A 4WJKB 1NIJA 3A2KA 3THOA 4CTKA 3N6RA 3AHEA 4RETA 3PNMA 1SWVA 2OYCA 1CZOA 1A5AB 1C1DB 2OP0A 3LO5A 1W0KD 1N1GA 1L5HA 1ZK3A 4RIHA 1B0UA 2ACKA 1LU9A 2JLRA 5GIOE 2VQEB 4X20A 5CB4A 4OXKA 3V7FA 3DOIA 5BQXA 1NW4A 2OLJA 1YDGA 5K3CA 4BGIA 1I2BA 4W63A 3PFGA 4UEQA 3EBOA 4YRKA 5BWMA 4LXQA 5CB4F 3ZJTA 4EY4A 2O19A 4NE2A 3KB6A 4CUZA 5TMEA 3F8WA 3IVCA 3JASA 821PA 1CYDA 3P0FA 4H15A 1YUBA 3UJHA 1E2FA 2X58A 3GOQA 4Q18A 1V8DA 5K3EA 5JAPA 4M60A 3PE3A 3DE2X 1Q7TA 4M0DA 2FUG6 1O96A 1V5GA 2C8KA 4R8MA 4BNGA 2Z83A 2CLKB 2QQGA 2V7BA 2WJAA 1Z0ZA 1PGPA 4R8RA 3ZW8A 3HCDA 5DNUA 2P5UA 4RDXA 2D1SA 1OJLA 4BQOA 5KCZA 4MXDA 4RS3A 2HF2A 3ZE6A 3HVRA 3C3WA 1XEWX 2NPIA 1AIPA 3ME5A 4OBEA 3D8TA 2RHOA 4RW0A 5G4LA 3WADA 2O48X 4KFRA 3OQOA 1W36C 5ITZB 1OI4A 2XBLA 3PGVA 2C7VA 1SU6A 1NW3A 1Q1ZA 4LJ7A 3LL7A 3AYZB 1DVRA 2RAUA 3N9IA 4M0PA 3DC2A 4Y30A 1E9DA 1KP2A 4ZGGA 1RT9A 2DT8A 3QK7A 4BLUA 1DL5A 1YFJA 3FIJA 2IFTA 3NJ8A 4ASUD 2D5BA 2GX6A 1OX4A 1FS6A 1ZH8A 2FK8A 3H84A 4P98A 3IJ5A 4REMA 4GLBA 3N2GB 3RSOA 3VR4A 4MA0A 2XGOA 3AMVA 2YOGA 1C8BA 2ZAGA 3ZV4A 2ORIA 2ZJBA 4LHEA 4P2BA 4DLRA 4CMCA 5FI5A 3VKVA 2EERA 5DM0A 3QMPA 3WMWA 2B5OA 1HE3A 1M76A 3VI3B 1T8PA 1POWA 1NSYA 1ST2A 3QELB 3R9WA 1WMBA 4RMNA 4P92A 5AVUA 4FE7A 3EB9A 1Z5ZA 2IUSA 3WSVA 1FXSA 1V48A 3ORRA 1C14A 2PMKA 2FWRA 4YFVA 1TA4A 3RU7A 1S96A 4AQDA 4CKZA 2CC2A 5LL6P 3EDYA 1B3RA 1Q1GA 2BJVA 2NU9A 1L6RA 2O7QA 3A32A 3CNNA 3K2BA 3UY4A 2IOHA 1EWKA 4A8TA 3B82A 4JMPA 4E6PA 3RC8A 3TXYA 3M81A 1WF3A 3KVRA 3Q85A 2JCVA 3R0IA 1ISPA 5TQ2A 3AL0C 4U9IS 3WC4A 4YXWD 4O63O 2IYPA 5K2OA 4MX8A 1A2OA 1E2NA 4KEAA 2ZETA 3DBRB 2J0UA 1FDVA 4A6XA 1DDOA 3T9AA 3QVTA 4WFKA 2FPGA 5FWYB 4KWEA 4LW8A 1I5RA 2DWQA 1C9JA 1JH9A 3GXBA 3ON5A 3D2CA 4AM8A 5KNDA 2A9VA 4C2UA 3W6PA 1N8NA 1ADBA 5FI3A 2PZBA 5TT0A 4KLRA 5BNZA 3R7NA 4FILA 5KU7A 4QG7A 1ZH4A 2ODWA 3HLTA 1JZSA 1RZVA 4GEGA 4ZOLA 1H1TA 1O94C 1RAGA 4PLWA 2C77A 2PK3A 3BHIA 3ZE7A 3R7WA 3V8BA 1U3WA 3GLVA 4PPGA 1H4QA 4B6QA 2AZMA 3VMMA 4E11A 1SVSA 3WV5A 3KV1A 1R5BA 3TGLA 5C52B 5DEIA 1KJJA 4GE0A 3MT9A 4X61A 3BJEA 1JHRA 1NLMA 3PUVA 3GLFB 4D02A 1Z39A 3LI2A 4KX5A 2WD9A 2O5EA 5D5HA 4DGSA 1ZIOA 3R1IA 4NBUA 4F60A 2IPMA 4CKCB 5LQCA 4JI5B 4M7PA 4KREA 4CM7A 5BN3A 1ISGA 3C3XA 5LM3A 3FJOA 1IPHA 4ZI7F 2JHPA 2OHOA 3QM1A 4N7BA 3WGLA 3EPRA 4HNAB 1B7GO 1UMDA 1YZTA 2V5AA 1EBFA 1EINA 1S2MA 3GFFA 1EJ0A 4QDXA 4GC5A 1NUTA 4BVLA 5BQOA 2FSPA 3C74A 5K0ZA 1PX0A 2GJ4A 2XDWA 2YVKA 3DL4A 3K4PA 3FFBA 4HDSA 1NY5A 3JVEA 4S2UA 3TDNA 2PAFA 4G84A 1ZA2A 1V95A 1QYXA 4Q7KA 3DEHA 2CVQA 3OKAA 4HWSA 3JVVA 1T0JB 1SUWA 2HHJA 4L8FA 1LWNA 3VSEA 5JS7A 1X0XA 1YB7A 5HUQA 2D8AA 4A6EA 1FF9A 5A6SA 1JQKA 2IGBA 1J8DA 4OF4A 1ZBQA 4BX2A 2IHBA 2YN2A 2H5LA 3DD1A 5J59A 1ZLXA 1NQ5A 1MZPA 5EQFA 5I8ZA 1E9AA 1GQOA 3HWSA 3JZDA 2HK7A 3LXXA 3VR5A 4UFPA 3AUJB 4QJ5A 5HX7A 4BU1A 4IDCA 4LF7B 3AIIA 4WLOA 4WESA 3H1EA 4IDDA 4DJDC 2AX4A 4R5MA 2DERA 2ZJ2A 3FBGA 2QROA 2E82A 3PGKA 3DA8A 3JQ8A 4JP3A 1VL6A 4NU8X 1GRCA 1P7WA 2Y68A 3I8XA 3WAJA 1JDBC 4IXTA 5AVOA 4B44A 3ZOKA 1S7CA 2V8BA 4BN4A 2QYOA 3KS9A 1H3EA 4FDMA 3MBOA 2FWMX 4HS4A 1KDRA 1TXGA 4N3BA 3B6MA 5DF1A 5D3KA 4TLEA 3TZKA 5DHSA 5BQ3A 2F8MA 1YA6A 1AY0A 1LW6E 4YAFA 3DLBA 4WT7A 1RQXA 1TTQB 1ZGBA 2GCPA 2V0CA 2XDQA 3JV7A 3AUTA 2BC9A 1IRXA 2FSGA 2GESA 3NDJA 3QVJA 3AHHA 4CL8A 4GDFA 4WFQA 1KSGA 1MC1A 3T3MB 3CR7A 5K05A 2GUWA 2W37A 1UT6A 4Q1FA 4ZA2A 3SZOA 3F6YA 2IU4A 4INPA 3SDBA 1BJKA 1NBEA 4KXYA 4I66A 5CIYA 3WL3A 3WXMA 4W5NA 1JG6A 6ADHA 3D7KA 4JOSA 3E8SA 3D3EA 4INOA 2R5FA 1BG6A 4YMHA 5JMOA 4ZYVA 1LV7A 1T9GS 2OZLA 2V3CC 2CT8A 2C7PA 2PLNA 2EG9A 4FZRA 5K3BA 1DIGA 1PSWA 2NO0A 2QR2A 2R6GA 5C1PA 3OHPA 1QPGA 5B1DA 3TCKA 2IOYA 3B9QA 3N59A 3L0IB 4LYHA 3C1UA 5EESA 3UMGA 2PGAA 3D4IA 1KF0A 2H4YA 1NNEA 2IH4A 2NMVA 1C3EA 2LNDA 3GEGA 2RKBA 5LQDA 3UXMA 1U99A 5GJWC 3NU1A 2H2DA 4LVUA 1CS0B 2HRQA 2BJHA 1M2JA 3BL8A 2Q41A 4MS4A 3TMKA 2DGDA 4JT2A 4L1KA 1LRKA 5DXAA 3RTEA 3SYTA 4P34A 3L04A 2GO7A 5SYAA 1N4AA 1M2NA 3FR7A 3JTEA 4L5IA 3OQMA 2BF7A 3C3YA 3W3AH 2BUAA 4CGYA 1XAHA 1ZVMA 3FZYA 3IUYA 4HWGA 3V1YA 3H1BA 2IE0A 4U3JA 3CX4A 1GNPA 2ZI5A 2JJ8A 3KKOA 1Y5IA 3BE5A 4DG5A 1DAIA 1HE4A 2VBGA 4E1AA 3T6KA 5BNIA 2PH3A 2YR0A 3CWCA 4JELA 2QHXA 4OQNA 3HCOA 1K7EB 2P8JA 2W6IA 2WUFA 4UXHA 5G0UA 3SR3A 3CV3A 3E22A 4OHKA 1UBHS 1W6UA 2E7ZA 4EGAA 3MXOA 2Q2NA 3MYRA 3Q3HA 1BIFA 1VHWA 3D6FA 3NKFA 4FEEA 1XDZA 1AS0A 2P35A 3L8CA 3CVVA 4CMIA 3PQCA 4KU4A 3FOAA 2XA1A 1T10A 3W5JA 2PMWB 2X23A 3H75A 4NKRA 4D3DA 4JLSA 1JILA 1U90A 3KC2A 3HSSA 3G89A 4WNAB 4X7RA 2NYUA 3U4QB 1NTRA 3HGQA 2ROQA 1E9BA 3JAKB 5EJ9A 3OT4A 4HNRA 2GBLA 1N6RA 1M10A 2BTEA 2YOHA 3EMKA 1GCIA 1SBZA 2WYOA 2V6IA 3E3LA 1RRKA 2H29A 2E2WA 3M83A 4QAJA 4GZLA 1JXAA 2I0FA 2XWSA 1UBCA 2A0FA 3GZNB 4R8SA 3QE3A 5IKEA 5J58A 1HTBA 1C7EA 3GU3A 1E2EA 3LHKA 3WAKA 4JI0B 4IEFB 3MD0A 2I62A 721PA 4EY5A 4Z4FA 1AKYA 3N58A 2N9UA 3QFRA 4RTOA 2B34A 4CTMA 4XR4A 4UM9D 1EDOA 2YWDA 3GJ6A 4JUAA 2FMIA 5F1YA 4DNFA 3VKHA 3FDZA 2BKVA 1TPZA 1TTPB 3UWDA 4H1TA 1KQGA 3OEHA 1Z47A 4RULA 1KJQA 1YIOA 2WWVD 4JL8A 1YMUA 3GLRA 3YASA 1HLFA 1HKUA 5KJEA 2C5SA 2QN7A 4TMZA 1C81A 5ALIA 3BJIC 5H70A 1A7UA 2PWYA 3JU3A 1TK2A 5EUQB 3W5SA 1EJ2A 5EC8A 1L5ZA 1LBEA 5E6SB 2PGXA 3NXSA 1ZM2A 2XTJA 5J5CA 1ISMA 1E8MA 2MCFA 4JI6B 3EXIA 1UFQA 2EZTA 3BERA 4CNBA 3BF8A 4LIPD 5BVGA 1NMQA 1U31A 3OKFA 2OYSA 2I22A 4GS5A 2X0EA 3DUFA 4C08A 1NONA 1J97A 1NVGA 1VGQA 2MSDB 4MVJM 3U9TA 5AJUA 1V7CA 5TR9A 1KEZA 1P9LA 2CL7X 4XPIA 1IBKB 2FLKA 1OX4B 1NYQA 2ZAYA 2ZRMA 4PC6A 3K20A 4ZEMA 1ZNYA 5T8KA 2WSMA 4D3SA 1JFTA 3QG1A 1X1CA 1R37A 5D5QA 2VYVA 3K71B 2DPHA 3UG6A 5LLTA 2VHZA 3KZKA 3MJSA 3G8AA 4MW2A 2C1EA 5KDDA 3E5MA 2I2WA 3DFMA 5LMNB 2P2YA 4BQQA 1L1FA 4C6TB 4HP8A 4A2WA 2X8LA 3L6UA 2CZGA 4AN0A 4HVCA 4QJ3A 5JECA 1TFUA 4PLPA 1GILA 2Q2OA 4PN7A 4ZQCB 2VUTA 3SOPA 1E62A 1KI7A 2I5PO 3WYCA 1JG7A 2XWBF 3ETNA 4GX5A 1AO0A 1C80A 3AH8A 2WM9B 3LQ1A 2BUCA 1T9GR 1UC5B 1GQSA 2OAGA 4GYJA 4BFWA 4A36A 2ZYTX 2IHJA 1HF3A 5ESWA 1SG0A 2G1PA 4RJLA 1WQ4A 3ZWXA 1X86B 2WV7A 1CUGA 1DRJA 1UDXA 1V11B 2YYSA 3E82A 1VKJA 3GF4A 1G59A 4MVXA 4US0R 2VDOB 4P3KA 4PXYA 2OV3A 4BMNA 1FDRA 1RABA 3ROZA 5HZHA 5DULA 2XGGA 1BSVA 4JJIA 1USKA 3DDNA 4S04A 3L4KA 4MUIA 1SBIA 4IUBS 2YXPX 1TKAA 4S1OA 3QIAA 1MQ9A 3WHKA 3SC6A 3O31A 2WTAA 4MMYB 2KJQA 5BSRA 5JWOA 4QWWA 2BHNA 3K0FB 1Y1KE 4QQRA 4DNQA 4Y6RA 5EP3A 3SGLA 4C4AA 3T7RA 1V26A 3IL2A 3BZBA 1RXSA 2JK1A 6CHYA 1JG3A 4EVRA 5JCZA 2DQYA 4GX0A 4NZYA 3EZNA 2KE5A 2OHFA 3D3KA 4KQEA 3UUGA 5DM70 3UAOA 4RA9A 1J2YA 3O82A 3F6BX 3QWAA 4WZAE 4AVYA 3KG2A 4PSCA 1Z4PX 2QT0A 3IUSA 3WMRA 3N8NA 2C59A 2RGAA 5A0TA 3N2NA 1RLIA 2QX9A 3UICA 2IEIA 1F3LA 1N1MA 1YBAA 2H2FA 3M1IA 4H6PA 1Z7WA 1XKTA 3CHYA 4AT1A 1E60A 1BYIA 1UDWA 5JFOA 4NIMA 2IRWA 2DH6A 2O8FB 2W6QA 1BW9A 1ZVVA 5EJ4A 4R81A 1Z0KA 3OEHD 4LNUA 2GBFA 2F2TA 4UTOA 4GBGA 3O5AA 1QS0B 3FVWA 4M9RA 1J90A 3D8BA 3SI7A 2IOFK 4Z3DA 3MJ4A 4Q4AA 1F2TB 3WK5A 4ZT5A 3QVGB 3KDAA 1GNQA 5E8JA 1T2FA 1AV6A 1VSUA 2YMLA 4X7PA 2JIMA 5BNWA 2J31A 3N0RA 5C5CA 1YZUA 4Y2VA 5IDQA 1PTJA 4FBMA 1WV1A 2V65A 3TVYA 4IGEA 2GHRA 4GLFA 1CY2A 3BRSA 4GZMA 4TXHA 2O5CA 1R4NB 4LXIA 2YC2C 1OI3A 2EL7A 3FMPB 1YBVA 2A9FA 4KE7A 1IL0A 3CO5A 5FWXB 2VQSA 4ZU3A 2CHFA 1FTQA 4QZVA 3VC2A 1A2BA 1DDGA 1WVIA 2XR1A 2FSSA 3ZCXA 4PHCA 1LI5A 2Q5EA 4KP7A 3NUQA 4DLNA 2W7TA 4IIDA 5LJIA 5SYMA 1GRRA 1YXMA 2OL4A 3MT7A 4H6VA 2RI0A 3NVMB 5CUQA 3T7EA 1BQ4A 3DPIA 4RA9B 4KQ6A 4NJMB 3PBKA 2R6AA 2RBEA 4OJQA 1ZUNB 2QYSA 4MIYA 3DUWA 4D2IA 2A35A 2NU7B 3D4OA 4O1HA 3KDPA 4PLTA 1UWKA 3F6SA 4TVOA 2EC5A 5GPBA 5HG0A 4A15A 3WMGA 3DOFA 2FKNA 4DV3B 4MR7A 4CZ2A 4AQ7A 4LDAA 3WGUA 1JIXA 3SJZA 2PS0A 3ZK9A 2ODBA 4P2GA 4J7CA 1CJBA 4D9FA 2IS2A 2SBTA 3PNLA 4GHWA 4JB0A 1ZGAA 4P08A 4QJBA 2OQVA 3QE2A 3ZX5A 4PAQA 4CV1A 2X2OA 3VH4A 2ZZNA 4R8VA 3BB1A 4IYRA 4JQCA 4BS9A 1YS1X 3R3YA 4B6JA 1IEVA 3GJRA 3TO5A 2LZ0A 1JTEA 5FJIA 4YC7A 5T67A 3E7PA 1XZIA 4BNVA 3OC6A 2RHGB 2XTMA 4IOJA 2JKZA 1TQDA 4CWAA 5KKCA 1QHYA 1XYGA 4OXQA 1WXQA 4DWWA 1H2AS 2W98A 1ABEA 2CNWD 2WQZA 4JEIA 5E6RA 4KXNA 2NPOA 1RAEA 2VHEA 4MQMA 3UPDA 3O94A 3WLHA 5HF9A 1LVUA 4R1MA 5E3JA 2O8CB 1NIPA 1XCPA 3K05A 4MRMB 2OO5A 1XROA 3HY6A 4P0QB 4JL6A 3AX6A 3PGMA 3ZEIA 1P7PA 5HRAA 1E2UA 4OYRA 2QS9A 1VYTA 1ZJYA 3EFHA 4OK6A 4D4HA 3W5AA 4L02A 4MROA 2V3WA 1W87A 2XJ9A 2IYUA 3HACA 3PEVA 1YHNA 4QTXA 1OYOA 4L8VA 3T3OA 1IBCA 3EWSA 3GRRA 1LVGA 1KVSA 1YR6A 1NQAO 2FF7A 4G1FA 2OQ2A 5IYZF 5ALVA 1ID8A 5I7AA 4XEHA 3UTDA 2ZWAA 4QRHA 1P39A 3I9MA 5EE1A 1MHTA 3L1KA 4KSYA 4G0YA 2W93A 1S3FA 5DSXA 3PXBA 2XKAA 5EJIA 3WQBA 5TDHA 1NE2A 1II8A 3K9BA 3CZAA 3ED5A 2JFQA 5JE8A 2WHYA 3FDXA 3OURA 1J2UA 2XQIA 2HLDA 1FQWA 4ND5A 2HLHA 1EFLA 1M3SA 1ZW1A 3THWB 4U7DA 1MX5A 2X7HA 3CZ4A 4NULA 3ER8A 3CLSD 4F3NA 1BFUA 2ZANA 2I7TA 2GM3A 3OZGA 3TLZA 1LQ2A 1BU5A 5D00A 1C9YA 2DMRA 3NVAA 4NCKA 5GZ3A 4JLBA 5A4MS 2EJUA 2XNDD 4I7EA 2VSFA 1P5FA 1NVFA 3F5QA 3FLBA 1C1XA 1T2EA 1PNOA 4QT0A 2PUEA 4GR4A 4TWAA 1JEQB 4UXIA 4MMXB 3RUFA 2QQ5A 1YB2A 1X2BA 3FFAA 2BEJA 1SD5A 4X6YA 2FYTA 1SUIA 3BXZA 3LFTA 4MVCA 5DNAA 4BBZA 2WPDD 1P1IA 1DCTA 2FFAA 4YQFA 2B8EA 1A69A 1ULHA 2H08A 2ISSD 1Z5PA 4HWTA 4P32A 4DCCA 1U2ZA 3FF4A 4ZQEA 5EKUA 3JRWA 4CFZA 1C9NA 1U2PA 1PZMA 1V0JA 1ESNA 1JYSA 3H1TA 3G68A 4MUEA 5KNBA 3IUPA 1EGVB 4YCAA 1SO8A 4BJ6A 5EIHA 1V25A 5LD2B 1GG8A 3AEKB 4U2FA 4BHTA 3FYDA 3AVUA 1IOVA 3FG9A 5FT9A 2CKDA 5DKFA 1PKEA 3SKYA 4D46A 1R6UA 4L0CA 2IXBA 4L2IA 3AUFA 4D26A 4V0ME 4RQTA 4YPVA 3DMFA 1KXJA 2O8VA 3P9KA 4EHFA 5K3OA 5DLEA 3NT4A 1M5TA 4FN4A 3M2PA 3JQAD 2VWQA 5AM2A 2VAWA 3VVCA 2R0QC 5IAOA 4WZBA 2BFFA 5CA1A 5KTNA 3H1GA 2QM3A 4MVYA 1XO1A 4UJ5A 2YL2A 1XJWA 5HFAA 5KQSA 1VSBA 2IP1A 4NBLA 5JZ9A 4NJOA 1VA4A 3ZWNA 3CPHA 4R1PA 3TI9A 1ZZEA 1VI2A 4MJ3A 1GZUA 2OZKA 221PA 3A3NA 4MQEA 5YASA 5AI4A 1AQYA 1GLNA 3GHHA 4WECA 3FCYA 2F3RA 1AE1A 1N6PA 4PZ0A 4RNCA 4UVEA 4GKVA 2REQA 2QB5A 5C8YF 2GZSA 3IP1A 4LDJA 5IUKC 5JZVA 1PTJC 3SQOA 2I7CA 3ZDZB 4TYNA 4LTNA 4YYZA 3VNBA 5KJFA 1DLJA 4JS0A 5BMVF 1OPRA 3J80A 1ZK1A 1SVMA 1RMYA 3KX2A 2IYVA 2KYRA 3RVQA 3ZU2A 5BYKA 2A88A 3PWSA 1IOZA 1T5OA 1YS4A 2ZQZA 3EGXB 4U39A 4ZQHA 4DADA 4F9TA 4DR3B 3EVNA 4YJFA 2O52A 3CH7A 1T1GA 2CXNA 3U3ZA 5KYTA 5I7HA 2ATXA 3I04A 3K2IA 1G2IA 1JXMA 3WIBA 2EKBA 2HJHA 2YZ7A 3KSUA 5K03A 1P4AA 2HPVA 2PGNA 2UUPA 3ZU5A 1EUDA 2O50A 2W2LD 3D0QA 5CK5A 3ZNOA 3CLRD 3DZKA 4J91A 3WWCA 1GEGA 2FR8C 2AOTB 4B6GA 5BP7A 2PWBA 2VRWA 5FULA 2D5LA 4HX5A 4MHOA 1L8XA 3QOFA 2HXGA 5E2AA 4I19A 1NVWQ 1IB0A 2VNIA 3BFVA 3G9UA 4IXWA 3TB6A 3IQWA 4IV0A 2HZBA 3P8ZA 4N0PA 2Z2XA 1KHTA 2JFOA 5B1IA 1ZNWA 1QFYA 3TR0A 3AL3A 4B31A 3KJZA 2DP4E 2V7TA 4XGNA 2HUNA 2P5SA 4KLAA 2WFAA 1RI1A 3C8HA 5HJ7A 4ZVVA 3GPBA 2GNPA 3PITA 1U1CA 4LSMA 4AX8A 2CCGA 5ABPA 2F6RA 4UEWA 4ZP1A 3OY2A 2H85A 5LQAA 1RADA 2GOYA 2PX4A 2BT4A 2R6R1 4M37A 1G1AA 1TZCA 4WD3A 4X93A 4ND8A 1FVFA 4F5WA 3RJ9A 2PXXA 3FUUA 5K45A 3PFHA 3HCAA 1U0JA 4K9KA 5TRTA 2Y1CA 3F78A 3PGXA 1A9XA 1I24A 3RRJA 5KPDA 1RLOA 4WKBA 2DPXA 2J0VA 1FJGB 4D8XA 2H4XA 3HV2A 3IOBA 2JGAA 3ZGZA 2CMGA 4GE3A 1E6WA 1VPTA 1XGKA 1PEDA 3N75A 3UWSA 3P26A 1S3SA 2OWEA 3UWKA 2VNHA 1ONSA 1LRLA 2ENUA 1UBFA 3UMMA 1QK5A 2XUHA 1A3CA 2ZP1A 3DZFA 3P1JA 4M22A 4RSHA 2W2KB 5B58C 2IDJA 2OA0A 3IQGX 5DYTA 3UHOA 2EW1A 3DXXA 3H2SA 3LWDA 2YQ5A 3SG0A 4QVKA 4D92A 1CLEA 2B1QA 3D54D 4UAVA 1L7EA 2RAFA 4AICA 1KI1A 3C4JA 3ZIAD 3QHAA 4BX8A 3Q8WA 2DXIA 2G5CA 3TCXB 2G67A 4QTYA 2IPNA 4TSRA 4B79A 2FOIA 2P4SA 4OBWA 4QU8A 1S2NA 4P6VF 2MJLA 2R48A 2H2WA 1JU4A 3X1YA 4KRFA 3UKJA 4XA8A 2IV2X 2X6TA 3CKLA 5CFOA 3VYUB 1DNPA 3H2GA 3JAKA 3DB2A 1FTNA 2DKFA 1KI6B 4GKAA 1H2YA 2ZAIA 4KODA 2BCGY 4TN1A 1WSDA 4ZDJA 2EP5A 4RM2A 5FWXA 1WB6A 1TFRA 4HDKB 4LISA 2AJBA 5DPMA 5C4MA 4EKEA 4TKVB 5DTMA 3BTVA 5D85A 5JC1A 3QVVA 1UBNA 2OD9A 4LJAA 3SOZA 4C7OB 5EE9A 1QGDA 2HB6A 2WUGA 2YXLA 4PS1A 3SQXA 4C0SA 4R2LA 1VIYA 2E6UX 4Q4JB 1OZ0A 2GD0A 4KGZA 4TN5A 4Y18A 1CETA 1SPBS 1A0OA 3KLNA 1JHVA 1WM1A 2QJRA 2WWGA 3KT3A 4MGZR 4EI8A 1NPYA 4IIJF 1T0HB 4HNVA 4II7A 3PD1A 1JB9A 4TYMA 5CLQA 1BOOA 5THXA 2HF7A 1C2YA 2YJ6A 3GUZA 4NG5A 5JG7A 3PR2B 5B5SA 4N18A 1KVRA 1DUSA 4D57A 2QJFA 2QTHA 2Y8EA 3GPLA 1W5TA 2QP3A 1DKNA 2VS1A 3NB0A 4KNVA 4YDSA 5HIMA 3TNYA 3E05A 1EFKA 2XB8A 1BEEA 3KYCB 4O1MA 1L5NA 4BEVA 4D9MA 3QEKA 2P9BA 1NVKA 3GUHA 5D86A 6Q21A 4TYWA 3UYLA 3FJYA 5FYDA 3SLRA 4B17A 4FJ1A 1OB2A 1XQYA 4RZSA 2ZBPA 1K6JA 4XAQA 2OMKA 4C6SA 4XRGA 5TX7A 1OC4A 1YQ9A 3CRNA 4DLTA 4JP8A 1U9IC 1HWYA 3EXG1 3LKZA 2VR1A 4X9XA 3VTKA 3A9UA 5AVZA 4IKPA 1CZUA 2CFRA 1JEJA 2OK8A 1BE0A 1G20E 1SA0B 2QUKA 1UQRA 1H0HA 1X7WB 3G23A 3TLYA 2FF5A 1YSCA 1NVAA 1ZDMA 3D5EA 2ZG6A 2VXCA 4HTAA 4BQRA 3ESDA 5ED4A 3P2OA 3R3VA 2DY0A 1V8ZA 4I4IA 4FYVA 2O8EA 4N3GA 1DQSA 2DSTA 2QK4A 4ROTA 5F2EA 2R7MA 2OC4A 1LFDB 1FMFA 2HZ7A 5EMHA 1JI0A 5JQGF 3G17A 2H59A 2G04A 3KQOA 4MAFA 1GGKA 2UV8A 1QMPA 5FTMA 1XDGA 2WNSA 1MO4A 2H3HA 4DXHA 4FNGA 2BGTA 1AOXA 1WNFA 2IXAA 2EFCB 1EP3B 3QEMA 3PC3A 1QQ7A 3KUCA 3NGMA 2HQRA 4NX2A 3E7WA 3HH8A 4OP1A 2BMAA 3OCXA 3R4CA 2ZM5A 4MHTA 2OV6A 4CEJA 4LE1A 4LC1A 3OZFA 4QXRA 1R5OA 3VJKA 1DAHA 1OHHA 1Z8FA 5I48A 2GARA 2FJUA 3KLOA 3STYA 3RLIA 1KYZA 4I9GA 4LGVA 2RGCA 4OFXA 1T1EA 2WSIA 4QXMA 2E4ZA 2O2JA 1W49A 2EWWA 3F7TA 3H2YA 1Z7GA 3KB2A 5FTJA 3IAM1 3VJMA 4GRAA 2H2HA 5I9IA 1TF5A 1V1RB 4OFZA 4OSEA 1NJ5A 3MM4A 2ZSIA 4KQKA 1HTWA 4BFLA 1CQIA 1QTIA 4BUJA 1XZDA 4EY8A 1OH5A 4MW9A 4EQZA 1RM0A 1ZCJA 1ZIDA 2C96A 1N2CE 1WLYA 4I3FA 3USZA 1V3UA 1ADJA 3NDRA 3B5EA 4N6OA 5KTTA 1W29A 3EA0A 2YOFA 2GDZA 4TV8A 2A14A 3THWA 2PUFA 4AG3A 4DSAA 1PD0A 2BCJQ 2DFKB 4N9QA 4CT4B 3ZGYA 3EPLA 3P2MA 4JI2B 3PEEA 2VYNA 2QX7A 1P80A 2PYZA 4YTEA 4HO1X 3EGWA 1MG5A 1Z5VA 1JGTA 1USVA 2YYAA 5J63A 4O08A 4FFMA 4MPTA 3BXFA 1D6MA 5HXAA 1C7IA 4K87A 3KKNA 3TIGA 1ZGZA 3LH5A 4S35A 1ZC3A 4RAOA 1F51E 2IOFA 3KHTA 4F1KA 2HMWA 3A1TA 3OFVA 2M2IA 4RLFA 3EFOB 2H11A 3EZ6A 4ZYWA 3GB9A 3GN2A 4DQXA 4F5EA 5GONB 4ALIA 1IXSB 3SKVA 1UJ4A 2KM1A 4QEZA 4NEGA 2QRLA 3DBOB 1ISHA 4Z86A 4DA9A 5J5VA 2IQIA 3GJ3A 4LS3A 3UMFA 1Z07A 1XEAA 3ZPXA 3E58A 1NHWA 4Y9RA 1ODKA 5TJHA 1FXWA 2WD7B 4L8GA 2ZT5A 1PLKA 5CLHA 4WOKA 4BGUA 4AF8A 4BP9A 1V5EA 3AQIA 3C85A 4P86A 2JFFA 3I4CA 3MWKA 5DHTA 3UK0A 3ZQKA 4EENA 2O59A 3QGMA 4GWLA 2P30A 2D1TA 3E1GA 4CE6A 1QRTA 4ERNA 1LPOA 2X0IA 2XUQA 1EQUA 4TLLB 2R1TB 4NATA 1TW3A 1M34B 2F1JA 2P9FA 3ECAA 3OIYA 5IT4A 2HFJA 2JH3A 4XQCA 2KI5A 3W5UA 4BY9E 1J7KA 2PT7A 3T3EA 4HEJA 4D4IA 4N0EA 5F1OA 3TZEA 3FTNA 3O8QA 3QYAA 3ZHOA 4PE5B 3TAUA 5I8PA 2RK6A 4BVJA 1L5HB 4MKRA 3MLBA 1N2XA 3ROTA 3JYNA 4HRVA 5BOVA 3LQKA 3TLEA 3KZVA 1X1SA 3OQJA 3TJZA 2HWKA 1SZDA 2SNIE 4E7PA 1JQ5A 1VDMA 1VG0B 2HD4A 3L8EA 2H16A 2O2SA 1BE8A 2CNKA 2HAEA 2XT0A 5IAKA 1Y9JA 1RMTA 3EISA 3JQCA 1WOYA 3WGNA 5K8IA 4NE7A 3FLEA 4MITA 1YIDA 1EPUA 2FGKA 2R7LA 2JLCA 2VUIB 5DSTA 4OQQA 3RBXA 1YB6A 3IPCA 5I4IA 4C89A 1X38A 2OHJA 2PX0A 5CTJA 5GV7A 4HS9A 3VNRA 3QU2A 5GMOA 3ASVA 3OPYI 1JR4A 3LY9A 1B2RA 1Z3CA 4G5RA 5G3YA 3MJRA 3V42A 1F4VA 2C2KA 2UZ3A 3I58A 2O9JA 4PC1A 2WRZA 3UUWA 1GL3A 1WCYA 2Y4NA 1HNWB 1S2IA 2W2MA 4OIFA 3WWOA 4S1WA 5SV2A 4TRRA 1UWCA 1X1EA 4HDSB 5JV5A 1NWHA 3F67A 1M0EA 1SPXA 4NBSA 1QLHA 3NIDB 2GN1A 4XFJA 1SQ6A 3N07A 2C97A 1TKCA 5AM3A 3JD3A 3STTA 4C78A 1TQHA 2EFHB 2B7CA 3MGBA 4H7JA 1KOFA 4BNZA 1EWTA 2QMUA 2O6LA 1V5IA 1EVZA 2PS1A 3WJAA 3KSDO 3OLZA 4BASA 4YJ2F 1YBFA 3D2AA 1BJTA 3EUWA 3TQOA 5CYOA 3PFWO 3T1VA 5DYWA 5AKGA 1IN7A 1A76A 1G5IA 1XI2A 4IYJA 1KAEA 2EATA 2ZB8A 4GMGA 5CX1B 3HZHA 5IFLA 3OPQA 3T1YB 4OMDA 5CVJA 1KARA 1B23P 3AF0A 3A05A 1OIVA 4WOCA 1WAMA 4CN8A 3KQNA 3HKDB 1N3LA 3Q7RA 4TTVA 5LWQA 2WG2A 3BJZA 1XFDA 4ON9A 4PPFA 2ZS9A 1G8MA 4GMFA 3TLCA 1NXWA 4XSHA 4BB0A 2YW2A 1LTHR 1HT3A 2A5LA 1CJCA 3T9CA 3OQIA 3EVBA 3WIVA 2CNWA 4FHZA 2R47A 2WT8A 3PQ6A 5EWMA 4BYMA 4P8RA 3FZGA 1NOIA 5F21A 3M1AA 1AUOA 2LE0A 3KLMX 3N5KA 1VJ5A 2XADA 1E3JA 3VAAA 4HYTA 2JGNA 3NHYA 4LZLA 1AZLA 1YDHA 4O02B 1P2BA 1JVBA 1G8FA 4K6MA 1L5GB 3Q2KA 5EJ7A 4CKWB 1FNNA 3A2NA 4QFCA 5C9ZA 4E5KA 3VNVA 4FQ5A 2XYRA 5E38A 3KVOA 3CLUD 2D8MA 1HE1C 4JX8A 4N0MA 4U6SA 3NP7A 3QU9A 4ZI5A 2GEDA 1W1UA 2HTEA 3KSAC 3DUFB 2PUWA 1OR8A 1JU9A 2FR0A 1ODLA 2IELA 2QG4A 2Z2IA 5ALXA 1QZZA 3ANMA 3DDUA 1JUDA 1O5OA 3EZ2A 2HT1A 1SG9A 1E32A 3OOJA 4EDFA 2C00A 3KXLA 4LVOA 1N9KA 1Z0SA 4EJ6A 2LIVA 4JITA 1GL9B 4REQA 1RHKA 2VT7A 5SZJA 3ICEA 4H27A 4CFSA 2HA4A 3D6TB 4MRPA 1F2UB 1WL8A 1OYYA 1VSQA 2C9MA 2ZWMA 3RASA 2DRIA 1N1DA 2JIZA 4IP0A 3K6SA 2GFIA 2WU4A 1GYQA 2OXRA 1KQNA 2H52A 5J2UF 5LIPA 4GXQA 2ADMA 2NN3C 3AZQA 3Q5EA 1DB3A 2XUJA 4TXMA 4GQIA 5CB4B 2C5BA 3P9PA 4G63A 4CG3A 4DILA 3WVNA 1Q57A 1R4AA 2R6FA 1VMEA 4TXJA 3DTVB 3GZ4A 3JZIA 1JI3A 5DGTA 5FEUA 1LDNA 1RJEA 3AUSA 3HDVA 3JYOA 2F8TA 4CLOA 1DBIA 4QDJA 1X7DA 1XOIA 4WZAA 4Q7LA 1H3FA 3BX1A 4LZAA 2JFXA 2WNHA 4PZAA 2PUBA 3T5GA 3GCZA 4BUCA 5J4KA 5AH0A 3NP9A 1XTKA 1XZEA 2VP4A 3AO0B 3RNOA 3HZOA 4RYDA 1K8XB 2FZCA 1A98A 2WMNB 3JQGB 3WDKA 5HCNA 3U3XA 2IYWA 1F8UA 1QIKA 3PPYA 1ECGA 1XZ8A 4HGZA 2QSUA 4I1RA 1YB1A 3RCBA 3WXBA 1RJ9A 4NOKA 3H5IA 1EFHA 3HB5X 1AMNA 3LUAA 3ND5A 3SHFA 4J94A 1PJZA 5DZSA 3DGEC 4CMIB 1XTIA 1H2WA 4YIKA 1M1NB 4YMIA 3T99A 4RSMA 3FSGA 3OO0A 5JANA 4OSOA 1N8TA 1Y7IA 2QTMA 4NDZA 4RZ2A 5DX8A 2ZYUX 1P5JA 4N3NA 5I01A 4HMQA 2WWRA 4OY3A 4NYIQ 1QHSA 1ULUA 4Y6PA 1PG2A 2AK3A 3GRVA 3KU4A 4WOBA 2QTVB 4YMSA 3W6ZA 2G4LA 1OT3A 4ZCQA 2QUZA 2AMYA 4CHTA 2QNRA 2HK6A 1U2EA 1L2TA 2P6MA 2PO7A 3KYIB 2QD3A 2F64A 2O0HA 1T8YA 1LK0A 4J03A 3V2HA 3Q10A 3D31A 2IX9A 3Q12A 4GNRA 3TNLA 2OB2A 5H81A 3EDCA 5F73A 2ZBUA 4DCUA 1IG3A 2PZAA 2FMTA 1EK6A 1Z8NA 2YXDA 3GFRA 4GP7A 2QLNA 4LBVA 4A03A 4A6DA 5JVDA 4KFTA 2ONKA 1N5JA 2JGIA 1PJQA 1QLJA 2VT2A 4ERXA 4J0CA 3WS7A 4GF5A 4O4HA 3UTCA 2WIGA 3BGIA 4CGZA 1DO2A 2XKJE 4JLAA 4OP3A 2FRVA 3R3WA 3WA6A 1Z6XA 4J49A 4ZI7B 5T4EA 3KPVA 3DBRA 3DO6A 3GGPA 3ZHUA 3AUUA 3WZLA 1VB3A 1RXCA 2FG5A 5BVGB 5KVSA 1EM8A 5D84A 3KT8A 3PUWA 4ED9A 2PVSA 3WLTA 3NAQA 3NHUA 4RXMA 2AW3A 4AK9A 4OQXA 3RC2A 4S1PA 1UKVY 4HGYA 3E1KA 4G8CA 2PY6A 4YDQA 3LBFA 1Z7BA 5EP4A 3QE4A 3U3JA 5IJZA 5IKPA 2QN3A 2NYRA 1XMPA 2N0SA 2FNAA 1J5XA 1JBKA 1WXIA 2HCBA 2L18A 2O0JA 3O6VA 3REFA 4ZHSA 3FCUB 3T9DA 4X54A 2AOWA 2W11A 3ZVMA 5DGDA 1PWEA 1RYEA 3IEKA 4Z51A 1B41A 1SCIA 1UEJA 2IA5A 3T54A 1PCXA 1WWKA 3SZRA 4C6TA 3RC9A 5AOBA 3CX6A 3L0YA 2QD1A 2QU7A 4IZHA 3GJZA 2C1ZA 4JBNA 3F7MA 4ZVLA 3TLGA 3WK4A 2PG3A 3R5JA 5JTUA 4KR2A 2J3QA 5KNCA 2FWJA 3IQFA 1ACLA 3QV1A 3ESYA 3GLGA 1SEPA 2BM9A 1OGJA 3PD0A 4O1IA 3B1FA 4HATA 2YV2A 2O3SA 2QSYA 1KAGA 2P3QA 3AK4A 3ESZA 3MCZA 4CQNA 2GNAA 3ICPA 3A4YA 3WWZA 4H7DA 2D2IA 2JZNA 3OH8A 4KNYA 1GNLA 1JEEA 1UZAA 3E3OA 1KFKB 2PMBA 3G7NA 4Q9JA 3ROPA 1XPRA 4HQFA 1YFKA 3OLWA 4L9AA 4HDQB 3IO3A 3T34A 1U9ZA 4E30A 3FPGA 4RACA 4GW3A 5CFZA 1AM4D 3GQBB 3L7DA 4L57A 2Q21A 5FB3A 1U1DA 3IAXA 5AK5A 5TF4A 2ZBDA 3CM0A 4FLMA 1Q3KA 4ZQFA 3TSYA 4Y0AA 2R2GA 2V4MA 4IVQA 4G0ZA 1QQTA 3V8MA 1TMGE 1H66A 4FEGA 4R2IA 3KUXA 4LC9A 2AFRA 5CT5A 3RH0A 4X20B 3PT9A 4XYGA 4EYGA 2QF7A 3K9LA 3TE7A 3RPEA 3NHSA 5FPPA 2P11A 4EFMA 1G2QA 2VSOA 1I30A 4P4NA 5K8UA 1C2TA 1W30A 2ZUTA 4DLUA 3DMDA 2C2HA 2XNSA 3I2YX 3QPCA 2WIBA 4NAHA 1P2TA 2WY2D 4BN5A 4FE4A 3VO2A 4F93B 2Z4TA 1LH0A 4UBKA 2PZFA 3JQPA 4HWOA 5JXJA 3GVIA 1KEKA 2YZKA 5AK6A 2A1UA 2ZT6A 4QAQA 8AT1A 4OOFA 3J81A 3KAPA 4RD3A 4NHOA 2HF8A 4D7AA 1GN9A 1Q0SA 1SZPA 2FZWA 5DYIA 3T9EA 3WKEA 4FFSA 1IN8A 1WB9A 3LPLA 3JQ9C 3ZCPA 1LS6A 1T4CB 3ZJ4A 1P0MA 2QPLA 1YRYE 4DMMA 4LNUB 3DEIA 4UC0A 5CCBA 3CZMA 2IYXA 4HH0A 2VZ9A 1QG6A 1U2TA 4WX2B 1JR3D 1DARA 3E3NA 2YMQA 1DS6A 3CGGA 3OBBA 4DIEA 2X5NA 1H1LA 4K6FA 4MUAA 5IKOA 1TZ2A 5IJ9A 3GEPA 1ID1A 2KSQA 2WTXA 3NAGA 4PWZA 1N5IA 4UTPA 2CGEA 2P78A 1A9SA 1GGFA 1WPQA 2QKYA 1R27A 2PYDA 3AKDA 1T26A 3W2IA 2WJHA 2JGFA 1G8AA 2DWPA 2VYCA 3NQ41 4WA7A 4XD7D 3EX7C 1JWLA 1TL7C 4V02A 3K1TA 4ESEA 1J0DA 2Y3IA 2QPAA 2YS6A 2Z4SA 3CUKA 4QFBA 1JTFA 2XYQA 1K8RA 1UZNA 2CXXA 1BN6A 4LWPA 4MLCA 5CGZA 4FD3A 4DZRA 2YN0A 1RVDA 4BV3A 2BZSA 2I1LA 3D3NA 3PTZA 2C3UA 3C5EA 5K8LA 5E1BA 1YQEA 5BYBA 1VPEA 3NBZC 5EKSA 4PONA 3HXMA 1WSAA 1JHOA 1HL3A 1R8SA 2KLHA 2Q4DA 1E3SA 4MEJA 4N47A 4YT8A 1Z73A 2CWDA 4P22A 5EVJA 4BO6A 1UAAA 5BO5A 1RAAA 4IKEA 2CKMA 1BHQ1 5DVZA 1NPDA 3GAAA 1YZYA 1PDWA 2HPHA 5CFNA 1HDZA 1VKNA 2NXNA 1IFXA 1BZYA 3OJEA 1EVYA 4GXRA 4MWZA 3RS8A 3TSAA 4D82A 3ZD7A 1EX1A 4NOJA 3IKLA 1COWD 1MRSA 5DLDA 4J0FA 3ZX4A 2I6XA 4YP9A 5ALJA 1FXUA 1V3QE 3AUAA 3HKEA 4N54A 4ZYZA 1NF9A 1RYZA 1S02A 3W5CA 3OWOA 5JXHA 5KQMA 1FMJA 4EHJA 1QDUA 2BUBA 3GL9A 4EKYA 1FP1D 1FTYA 3G7UA 3I04M 5E0OA 4AMUA 4BGVA 3KYDA 4Q03A 1U0SY 2ID7A 3OMLA 3S1LA 3OZWA 3AERA 5LP1A 1MVLA 4Z3OA 4KVFA 2O7NA 2W2NA 3E48A 2BMWA 2WSYB 1XA3A 4WOJA 4ZREA 3Q3GE 4QQ8A 1KH2A 5A2QA 1P17A 2FRDA 3JR3A 3L7IA 4CIYA 1APBA 3ZCRA 1HYGA 1JSRA 1KZ4A 4FHEA 3R0ZA 4G4GA 4WINA 1YZGA 4EG7A 4M49A 4KKXB 1L4GA 4AWXA 1FP7A 1OVGA 3DBVO 4KZPA 4LRSB 5JYEA 1ACJA 2NO4A 1VRWA 1Z75A 2FQQA 2V8OA 1GZ6A 2YYZA 4KRGA 4UASA 5DP1A 4CLRA 4C2AA 4KXLA 2O2EA 2PLAA 2MSNA 3PPVA 4MGKR 2ZSKA 1E6CA 2WZBA 3PNPA 4FMPA 5F7ZA 3MWEB 3B1WA 1BMDA 1VHDA 4JENA 2G07A 3LYHA 4A0HA 2HDOA 4WERA 3TGWA 5HCUA 1QKKA 2Q6VA 1M8FA 2J7PA 1GAJA 4RV9A 3IEMA 4NXNB 2IUTA 3TQRA 2WVHA 4AKIA 5MDHA 1MV5A 1WCV1 4I5EA 1G21A 3RVRA 5D5PA 2QOEA 1H9CA 2FSUA 5K3DA 1ORRA 5T4HA 1UC4B 4DIDA 3HYTA 5HIAA 1CHDA 1QXSA 2GF2A 2QUAA 3Q9SA 3Q88A 3WOHA 3FYHA 1QS0A 4HI0E 3A3YA 3OE7D 3C6ZA 3RUDA 1JIQA 2AFIE 5EIEA 3EYWA 3M49A 5ANRB 3KXKA 4NFYA 5FO1A 3SBOA 3VZPA 2EV9A 4BLRA 3UJCA 3WK6A 4EO7A 4F4CA 1YJXA 3MAAC 4UTZA 3TINA 3KYBA 5D51S 4LTDA 3AF2A 4B3HA 5DGIA 3ZR4B 2GEKA 2VPWA 3GT4A 3VGJA 1TKRA 1HM5A 1XRQA 2PXHA 2GA8A 2R00C 3AF3A 2XDYA 3CRMA 1THZA 4EPXA 3PVZA 4RD1A 3K1ZA 4RU1A 1EX7A 2ONCA 1G98A 1Q20A 2Y1FA 3LZ6A 4L85A 4HGRA 4MGYR 4K05A 3WFJA 5DLPA 3R5XA 4IS3A 4D79A 1C7ZA 1R8QA 2J1LA 2QTAA 5JJIA 1SBHA 1KPIA 1H2BA 3WIUA 5CG2A 4ZC8A 4MQBA 4YRPA 1Y3IA 1ZJ6A 1NXQA 5ADVA 3NYRA 4KBGA 3GLTA 2RGGA 5LVAA 4DBVO 1NC1A 2P6PA 3MLEA 4A8JB 4BNUA 3VDMA 1Z6AA 2V58A 1XK6A 4I4NA 2D06A 2NU7A 3FOEC 1NW5A 3GJ5A 2C9YA 1J9GA 3NR2A 2ZE6A 5K51A 1KSHA 3RDPA 5JNTA 2GM5A 4YY3B 1L7PA 5K20A 3R5KA 1MX9A 3HO6A 1V2GA 2ZRCA 4GOKA 2ILVA 1S0UA 2VHQA 4ZI3A 2RHDA 1OXBB 2EJWA 3L4BC 4C0XA 5KPJA 4RTMA 4RD4A 2OORA 3GRZA 5KREA 5FPTA 2HDWA 5IWCA 1TVKA 2MTBA 2OXCA 3SBEA 3I2KA 1D5CA 1Q0RA 4L28A 1N92A 3DEKA 4P54A 5H59A 3EY4A 3BF7A 3A9RA 2GCOA 3K35A 4CM4B 4KYVA 1Z06A 1T36B 2MYNA 1E7QA 5FOWA 2BFDB 2X4LA 4FDVA 3AR6A 5G0TA 2ZULA 4DNOA 5JZSA 1AHPA 1C1HA 3IRVA 4HGQA 1DEAA 5TXGA 4B2IA 1MU0A 1U8AA 3AIKA 3CB4A 1EGAA 2K7ZA 4JSRA 1GSAA 1N0IA 4MZXA 1GVHA 3M9LA 3O1HB 5ALOA 1VPVA 3PE6A 5CVUA 1PWXA 1PR3A 1WW2A 4MV9A 3WZMA 4M6WA 3DZDA 1RSZA 1Q74A 2QTRA 1IWBB 2H1IA 2VP3A 5DNVA 4E6EA 2P91A 1ZI6A 3QVOA 4Y8VA 3A1UA 4XD2A 3EAFA 4FYMA 1AKWA 3AYXB 3TMYA 3M3DA 1A72A 5JO0A 2ADOA 2VSYA 2YWCA 2BM0A 1O95C 1O4WA 1MO5A 1QTRA 2XTZA 5BRNA 3VRHA 2AN4A 4JLWA 4LV8B 3UBTA 2GM4A 3ANXA 4V0SA 3C8MA 4LOHA 4FK8A 2O4UX 4LCEA 1ML4A 4D81A 1ATIA 2BJWA 4RELA 1J1ZA 3IV6A 2OCIA 4GVXA 5T4BA 3RNLA 3THSA 1QU3A 3O0DA 3EIQA 1JECA 2E4YA 4B3BA 3ML1A 3IAAA 1N2GA 4LDRA 1XVVA 4B76A 4Z1MD 3I2FA 1QU2A 3OSZA 2O1EA 5FFNA 3E7XA 2Q8PA 2R8EA 3D1LA 5IT0A 4TZTA 2JAUA 2LW7A 5C4IA 2ZDHA 3GLGB 2R79A 3DDWA 1Z56C 3NIGB 4LI0A 4EEKA 4JI3B 4G5FA 4XVCA 2Y0CA 4J2OA 5DU2A 1NSTA 3ID6C 3KQYA 4P3XA 3VSDA 4Q3CA 4BQPA 1KK1A 1ZK4A 5FTLA 1B14A 4G5QA 5CXXA 2CDAA 4WASA 3QF7A 4HHEA 5JSFA 1GUDA 3IULA 1UZUA 1TYBE 5CH8A 3WHLA 3X3HA 3EIHA 3WB1A 1QJCA 1J8VA 3EDOA 4YNBA 1F2TA 4RTRA 3M6XA 3MIIA 4H35A 5H0IA 1L4YA 4QOHA 3VJLA 5IYZB 2VC2B 3KEFA 2H0QA 3RSZA 5JH7A 1H0KA 4ETIA 3M5PA 4U9HS 1WCIB 4MGHA 3T15A 5AHKA 1K06A 1QZUA 5CA0F 1WUJS 1W4CA 4F8EA 5IARA 2AG8A 4JOBA 3VU3A 1RWOA 2BFBB 3QA3E 5IVPA 1BCSB 4NNOA 1Y0BA 1G18A 2FHSA 2WNIA 5JARA 3O1IC 1Y89A 1IOLA 1FTWA 2R68A 4I1PA 1E9FA 3VTAA 4B7ZA 4Y0VA 4IQ4A 1E2LA 4OK3A 1AXRA 1OXVA 2CJFA 3NWBA 1SVOA 1E9RA 3CUYA 3EFBA 2ZE7A 1JVNA 4PQRA 2D4HA 1B1CA 1LEHA 4RPGA 3TQIA 1C0KA 2A9KA 1T3SA 3NAZA 3SJUA 4YRBA 1UXOA 2C94A 4COOA 4R7GA 2V4ZA 3ESAA 3EGDB 1Y80A 4MIEA 1QG2A 4QOSA 4CW7A 3NGLA 4UE2A 3FI9A 3PXEA 4X00A 3RSFA 3S7TA 4GPAA 3RBAA 5CAEB 5K0BA 1FEZA 1MUUA 3DVQX 3UHJA 3P4UA 2UYCA 4O4LA 3WNQA 1RHUA 4BMSA 3QH4A 2CUNA 3JQFA 3LDGA 3LYAA 1MF7A 1M2EA 1VCOA 1WCIA 4ESOA 1ISRA 1ZMOA 2AJDA 1WZ2A 2X7XA 3TM4A 1J6UA 4Z4IA 2I91A 1T35A 2XB4A 2ARKA 3IIIA 4R3UC 2GZMA 3HXQA 4UPEA 4RDIA 4RGQA 3MTBA 4AUEA 4KQMA 2G0AA 4RF5A 2JB9A 3SF8A 1G1MA 1TCBA 5FNZA 3U3MA 3HCPA 2XUZA 3GW8A 3QEAZ 1HMPA 2JGRA 2CLIB 2VJAA 3JWIA 2R7AA 4JROA 2O5VA 1WXDA 3SYKA 2DYKA 4P82A 1VC2A 3G5LA 4I99A 3ZHSA 3D7RA 3EFOA 3ZS9A 1QYVA 3NEJA 1A8UA 2GWRA 1JLHA 3R41A 4FW9A 4WMLA 2I6TA 1OXUA 5CK4A 2YV1A 8ATCA 1QVVA 2JAPA 4RPJA 3OUTA 4DC0A 1KY4A 2OV8A 4WDRA 5DWDA 4DSOA 1E3LA 1K89A 2RGNC 4NCJA 4UEOA 2J0QA 1NQWA 2XGMA 4CKEB 2F3PA 4MW0A 4TRNA 5CLIA 2QTNA 5IAAA 2OGTA 2P77A 3AESB 3IR7A 4WE3A 2UVPA 3OF2A 1EK1A 1XZQA 3V55A 1YKSA 1SXJC 2VH2A 4WXMA 4BB9A 3EG9B 1PV4A 2BR5A 3I6QA 1TJYA 3F96A 1XFAA 3KZOA 1VP9A 3SLGA 2Q45A 1AZSC 3EMDA 2HM7A 5IK2A 5JPDA 3S8YA 1JR2A 1QVRA 1VM6A 2PX8A 2WF9A 4MKIA 2WB4A 3ILVA 2K2WA 1FBNA 1KJYA 1KO1A 1TT7A 1XPJA 1YOVB 3DNPA 4A0RA 4ZT3A 2IQ5A 2NUPA 5SZKB 3VMFA 5FBHA 4AAYA 5AD1A 1JEYB 4MDFA 4Z1MA 1Y1QA 4KK4A 4B3XA 5I5GA 1G4UR 2JFHA 4FEYA 2QE7D 1FC0A 4YV7A 4MVJE 2ECFA 3OLXA 5EKTA 4OV6B 4URFA 5IMBA 4D98A 4CJXA 3H18A 4I1SA 3PXAA 3FB4A 5HFJA 4BNHA 2GJSA 1KZYC 2X4DA 1ZESA 4U2GA 5GAJA 3QKRA 4AMGA 3IO5A 3DONA 5LZ4A 3L1VA 1Z3IX 4CR8A 1P4RA 3B3JA 2QI9F 4BB5A 2WW8A 3KJXA 2SKCA 3O84A 4RJ2A 4F2PA 2ID8A 1C7JA 1G2OA 3TZQA 3ZQ6A 3G2OA 2JJ2D 3GAFA 4M0CA 4UE6A 1HPLA 4WLEA 3H8WA 4GI2A 5BUSA 5H5JA 1RU3A 4WXYB 1FFWA 2GJAA 2HJRA 4MVJH 1JR6A 3PU6A 3AESA 3CH6A 3DYVA 1U7PA 3V7NA 2FX5A 3OQPA 1GCOA 1GV0A 1DEOA 1QH8A 4D56A 3SJBA 3F73A 1CQXA 2EEPA 2YNMC 4HDCA 2BGJA 1M2VB 3NDPA 4WLVA 1ACMA 1FLAA 2DBQA 4YAEA 1CNEA 4NG4A 5SICE 4PCAA 3F3KA 1SU7A 1F9AA 1B0PA 4HAIA 1I13A 3D3WB 1PR1A 2PSFA 4CEHA 3HGTA 1MIOA 3D0KA 3HKDA 1BFDA 3PDCA 4N0DA 5M3BA 4JJKA 4EG0A 1XWFA 2VP2A 4CN9A 3LT4A 4YMGA 1E2GA 1QPZA 3ZE9A 2XCUA 1R3UA 1OZGA 4RKWA 3IUBA 5CX1A 3ZJYA 1BO6A 2PKEA 5E4TA 5INTA 3ENQA 2Y1WA 1ECJA 3N7UA 4KW7A 4RZIA 3THRA 1TUGA 4E2ZA 4J7AA 3MWLA 3KQWA 3S1SA 4IHAA 1ZNQO 2O7VA 1GT6A 1Y9AA 3LPCA 3SSNA 4FKMA 5L45A 4KIFA 5CLLA 3MCVA 3A6PC 3MTGA 2WWXA 3M6FA 2B30A 2IHVA 3FCEA 4DJ5X 2IEAA 2AKEA 2GBLC 4UFNA 1SU8A 4L7QA 1NYTA 1YRHA 2WJVA 4G0QA 4DF3A 2YMPA 2AV6A 3QFFA 1KIFA 4GUAA 1TLFA 3N39C 4IFBA 3W79A 3G0IA 1JKMA 2XUFA 2COEA 2TMGA 2XVMA 1LVHA 3S2FA 4H3KB 2BWJA 1Y6FA 3DDSA 3B5IA 3F5MA 1D1SA 1J42A 5DTQA 2R751 3TFWA 2SKDA 3PB3A 4L4SA 1VYHA 5EIBC 1KTIA 1XXHB 4WBXC 5ILOA 3MWFA 1U7WA 2O06A 2PPVA 3ITNA 5DSZA 3MXTA 5AHXA 1SKQA 3P9YA 4M1QA 2G1AA 4UDOA 1P19A 4UDYX 5I7EA 3Q40A 4R1NA 3LQ2A 4HLUC 4ZVTA 2Y77A 3P45A 3OM0A 3PWZA 1QRDA 5G1NA 3VOTA 5B6IA 1RI5A 4BJ1A 1XJ0A 1ZN9A 3UXEA 2CV1A 2DLNA 1I7SB 1QBKC 4YV1A 2PBLA 1UZLA 4R8LA 5D6NA 4Z7JA 4LRXA 1Y9ZA 1D7AA 5DRYA 4P4TA 2ZYSA 2PUVA 4YQEA 4O2AB 1EIWA 3U4MA 2V7XA 4EHBA 1FFAA 3PK0A 4NZNA 4YACA 3EIXA 2VEDA 1M2KA 2LR0A 3A0UA 1SFRA 2PSDA 3FNGA 4JUIA 3TEFA 4CG1A 1YJCA 3SMVA 4IIFA 2QDXA 3FX2A 1A97A 1SOUA 3NNSA 1W94A 5KTSA 3S2UA 5L3QB 5LP6B 1CIPA 2P3OA 4GMHA 3DEFA 4QPDA 2QZJA 2GO1A 3K8ZA 1TYAE 1CIJA 1W5EA 4LN1A 3ZKWB 5AJTA 3LUBA 3GGDA 4K6HA 3I64A 1EWYA 1CVRA 3LVBA 3Q11A 4MK4A 4XIFA 5JS2A 3GIDA 2Q1UA 1ZNXA 4MB6A 2QT1A 4CTJA 4EYQA 1CJSA 5FL3A 5JZOA 3P2YA 2VXYA 4IUDS 1ZXXA 2WUEA 4U7HA 2ZOSA 4RLSA 4C0LA 3EMBA 3I92A 5CXQA 3DVLA 4IJ6A 4KV7A 3KUDA 2X1MA 4DQKA 4TTJA 1LDBA 3NRBA 2RAVA 2J3MA 5TGZA 4MUMA 2QYHA 3NORA 4UU8A 3RFCA 4KTVE 2AEEA 3WRWA 1UKCA 4M7WA 5CBPA 1JX6A 1UIMA 4UPDA 1OAAA 2LKDA 3FYTA 1Q95A 2PQ0A 5A4FS 1KVTA 6PFKA 1P75A 5ESDA 2R8XA 1YA4A 1TK9A 4RHTA 1BMQA 1T4BA 1ISJA 3FPHA 5AHWA 4OXRA 2WHEA 4QO7A 2GZAA 1SKAA 2UVQA 2ZBQA 1RNLA 3AXTA 3RUHA 5I45A 3THYA 1R0SA 4KGDA 1H6DA 2AXNA 5B2EA 3RE1A 4K40A 3PXGA 5K3FA 3ISVA 3QYFA 3ZLTA 4EAAA 1YE3A 4WJZA 1PGQA 3ZU4A 3JAWA 3VXKA 4JDPA 2XUPA 5P8WA 4TWJA 2FCRA 4Z1OA 4YK7A 1XDWA 1PEYA 1UBMS 1L5KA 1PK8A 1QP8A 1HYQA 2GJ8A 2NGRA 3EVAA 4KG7A 4W8GA 5EZQA 1GTJ1 4V38A 4DCPA 5FP0A 2UXBB 1L5SA 2VDRB 3ZE0B 4GRIA 4EI2A 1WMEA 3AWDA 3M6IA 3K5HA 1AN0A 2PJZA 4LY3A 2HGZA 3DG9A 3AHDA 4Q7JB 1EVJA 2EF1A 3VR3A 4Y2XA 1NJ8A 4MEAA 4C05A 4UNIA 2Q3FA 3ICOA 1E9EA 2HRDA 3D2BA 3RU9A 1C7QA 4C4XA 3PTAA 2G4CA 5HE9A 2XVXA 3CW9A 4UNNA 3GFGA 1FX0B 4D5EA 2G82A 3ZWBA 4F4UA 8LDHA 2IBMA 4PX5A 2BFFB 4QDUA 3A1DA 3GMDA 4EMTA 4KR0A 1KJZA 3DMNA 3Q4GA 4EHHA 3HB0A 1DC6A 2FUKA 3D0RA 1JHDA 3DKRA 3AG5A 3DHVA 3FBTA 4R51A 1MW8X 4F8YA 2XCLA 2ANCA 1P0CA 3GAMA 3OIDA 1JJIA 1A9TA 4Q9IA 3JQ7A 3MS2A 4GEKA 4Z9BA 2HMVA 3FIUA 3ZYCA 5A1TA 3OZXA 3U4QA 4FYWA 2IF0A 4DR7B 2Q0XA 3A8TA 1PL0A 4ALMA 1K97A 3B1JA 4N3AA 2FSIA 1DTSA 5EN4A 2QUIA 2XWPA 4E2WA 3VSAA 2ZI7A 4B46A 4EDHA 2XD4A 2GJ9A 3DTVA 4QDZA 5E1OA 3R9XB 3Q87B 4TZKA 5MF6A 1BXZA 1I6LA 1H4TA 3LKDA 2NO1A 1EWRA 1LDMA 4WNIA 3FDZB 4KPUA 4CKXA 5HJEA 1ZIYA 2QUHA 4LZOA 1YRQA 1B42A 3HEMA 1CR4A 3NHRA 4CMBA 1L5MA 4O4IF 2Q99A 3K5IA 1NRIA 3QBEA 1XB2A 2AYZA 3SBXA 3P2IA 4W6ZA 3TRDA 2R8BA 3AM3A 3L8YA 4Y6LA 5JLAA 5E9WA 4RENA 2C07A 5IG2A 3ZN2A 4PO8A 1X7YA 2AQKA 3IJRA 3COJA 5SZIA 3HY3A 4Q48A 1DRKA 4IRXA 4O6VA 1FSZA 2C7BA 5GVSA 4EGJA 1VIVA 5JNUA 1BDMA 4DLWA 5KIAA 1M2HA 3K8QA 1V6AA 2FLWA 2WD8A 1TO1E 1O6GA 3BFPA 4UDNA 3WGOA 4BECA 5IZ4A 3E53A 2G6TA 4E21A 4WY8A 3O0TA 2C9CA 2QXYA 4JBGA 3KCNA 3ZCVA 2CDBA 5LBUA 4ITUA 3I37X 4OL9A 2QX8A 3H11A 3ASZA 4GI1A 4Q3OA 5IXYA 4M46A 3TKAA 4G0UA 1E0JA 1UDCA 2X1LA 1GR0A 5DISB 1ZM7A 4RY9A 4WOPA 4GDMA 2CK3A 1HFWA 3BSWA 4PTLA 5CJ2A 4WLFA 5FBRB 3REOA 3RWOA 1WBBA 4B3GA 4TV9F 4BNXA 2J7KA 4LI3X 2RSLA 5HRUA 2QV7A 1IVSA 3MRSA 4EA7A 3QOXA 1E92A 1XTQA 1A95A 1XZHA 2CXTA 3B2NA 4RQBA 5FLKA 5LCXA 3WYFA 2PMFA 4ETMA 4HRXA 2HYIC 2O8BA 1UBLS 3FPEA 3DOJA 1ZVKA 1U8UA 1G38A 3C5VA 1G20A 5LA6A 4OKSA 4YJGA 5G1OA 5GOTA 4JT9A 2FWIA 1JMKC 1OKKD 2FFHA 3V34A 1SXIA 3WLOA 1B0ZA 1E7YA 1U0LA 2IF2A 2HLNA 5T3UA 1Z33A 2X9GA 4IHJF 5E4FA 2HQBA 3LL4A 1V11A 3HJAA 2VNJA 1EXWA 3NOXA 3IT3A 3K15A 4L8LA 3G8BA 4WGFA 2VOEA 1AQLA 3H6GA 2JFUA 2LCIA 3WQHA 1C30B 4ZXPA 3CPSA 3EASA 3P0JA 4JEUA 1P5HA 3RG2A 4WCFB 3U3OA 1HLGA 1X1RA 1P6UA 1YZQA 2OUKA 3R09A 1SC3A 1C9DB 2QZZA 5IBQA 4YGYA 3IPAA 3VZRA 1I4LD 4AO8A 2P1ZA 2WQ7A 1UP4A 1UBRS 1E79D 1R0YA 3JQFC 4MKZA 1N6HA 1VL2A 2JGDA 2J5XA 3GGGA 1QZXA 1XQ6A 2CJWB 4NCNA 4MRVA 1NZFA 3CLVA 1HURA 4YRTA 5EZ6B 3V2UA 1T1RA 3ELYA 3GFBA 3R24A 4FXOA 2R6JA 3R8CA 4AD8A 4ME6A 4RC9A 2AR0A 2G9UA 3FNEA 3SY8A 2PWPA 2AC4A 3H17A 1HZZC 3CW8X 4TT3A 5JS1A 2C88A 3WLAA 4IZIA 2W2TA 3L8MA 3TMAA 2WWTA 4B8YA 4D74A 3OCVA 1RAFA 1Z5OA 1JQLB 1MTZA 1O0CA 5C8YA 1V39A 5IN4A 1M5RA 1UOPA 2NG1A 3CB2A 4ENTA 2A7XA 3C3PA 1DTWA 3RIEA 2AWOA 2V6FA 1P61B 1EEHA 3A4IA 2EP7A 3I2GA 2GYWA 1UIRA 4G81A 3OFSA 4Y9UA 1I32A 1K9SA 3HN7A 3KLBA 4UCXA 4ND6A 4JP5A 4AJPA 1FU8A 3AOEC 1IVYA 3ZLBA 4DSNA 4L9SA 4QOJA 4MQ5A 1W4BA 4MJLA 5DK4A 3BRWA 4DR2B 1FCJA 2PJUA 3QFTA 3WKAA 1T2UA 4WADA 4BZXA 2BZGA 3EQZA 3AVPA 1XD9A 2F3SA 2VH5R 3ZKAA 1LV8A 1L1QA 2D7JA 4X95A 5FQOA 3OM8A 4Z0TA 3VR3D 5JD4A 4BFTA 4UD6A 5LBIA 3BZUA 3ZBQA 5U9CA 2OCPA 4YMUA 1O6CA 1E9CA 1Y7PA 2QIOA 4CI9A 3RYHB 5AW9A 2B4RO 2BMEA 5AW7A 1CQJA 1N2CA 3NFYA 4RD2A 3VC7A 1QYCA 5L40A 3TS1A 1I1OA 4QJIA 5F7JA 5DBIA 1OLXB 2FPKA 1EU1A 1PJCA 1UJ5A 1KH1A 3G2JA 1A27A 3IKJA 1P3JA 1SCBA 3K96A 2RMKA 5HS6A 2NAPA 4IGFA 2A86A 1E1RA 1TC2A 2EP8A 1L4LA 1O95A 3AINA 3IHKA 4Z54A 1PBTA 3DJYA 5JAZA 1QH0A 2FEXA 3EZGA 2C8JA 1KIMA 1PQUA 4KGXA 4RA6A 4EAQA 3S44A 2XUGA 3H05A 4L2IB 1W25A 4M1OA 3WLPA 2FN4A 4NV0A 4H17A 5F52A 5BQFA 3ZKWA 4CL2A 1BXRA 3OOEA 2OV1A 3BAZA 4IICA 1LF5A 2J6HA 3MGGA 4RFLA 3B52X 2IEBA 2FUNB 3UFBA 2V7QD 3C41J 4FGZA 1KNXA 4ZO7A 3JS5A 1DC8A 1BXGB 1DZ3A 1JEDA 3JARA 4MLPA 1M6HA 4G4SO 3ESRA 3Q3IA 2HPAA 2QW8A 3QLTA 5EJEA 5HR5A 4OJKA 5E8RA 4TS4A 1MFZA 3GIWA 4CMEA 3T3PB 2QVLA 4G56A 4UDXX 1N5DA 5BVHB 1JEYA 2PEZA 1U80A 1AKRA 2BGMA 4B3FX 4KPYA 2CZCA 1X80B 4C22A 1RHJA 2B25A 4EB6B 3I2IA 1TB4A 3QWBA 4ALJA 2REQB 2F48A 1PNRA 4ZV7A 3UG7A 3LT5A 1TPYA 3OFKA 3T7JA 2C9ZA 1HORA 5FO0A 4LBWA 2JHGA 1EAMA 5IVHA 1HQDA 2Y9MB 3RS5A 4FD2A 3VH1A 2IP4A 4BV8A 3HRKA 3S2SA 3ZGNA 1NBWB 3E0XA 4CKBA 2BI7A 3B2QA 4RA6B 2BOVA 1QFZA 3TX6A 1LK7A 3UGJA 4YIHA 3HJCA 4D5GA 3IKMB 3EPHA 2OG1A 1PT9A 3H7AA 3UV3A 4NOLA 4CQLA 4R71A 4RKEA 5BPFA 2PFGA 2EJVA 2C4NA 5DNDA 1N2IA 2UUAB 2FUG1 4G0OA 5FNVF 3T35A 5B1EA 2W6JD 3Q0TA 2C3PA 5JWHA 3LT1A 3EULA 3REQA 3DMPA 2SICE 3HYCA 3QXGA 5CPFA 1H93A 3NV7A 4FS3A 4YJFB 4O2BB 4ACBA 4TV9B 3BT7A 2F3UA 4GX2A 2Z8YA 5JDCC 4DAEA 1M7GA 1ZIXA 3K16A 4OHBA 1SHJA 4W9NA 5AICA 4LYYA 1W4AA 1J2EA 1F8GA 3V4VB 2XYGA 1IE3A 4Z3KA 4XX1A 1WQ1R 1ZGHA 2Y2UA