1O77A

Crystal structure of the c713s mutant of the tir domain of human tlr2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
146
structure length
141
Chain Sequence
b'ICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWSKYELDFSHFRLFAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TOLL-LIKE RECEPTOR 2
molecule tags Immune system/membrane protein
source organism Homo sapiens
publication title An Extensively Associated Dimer in the Structure of the C713S Mutant of the Tir Domain of Human Tlr2
pubmed doi rcsb
total genus 42
structure length 141
sequence length 146
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2002-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 1o77A00
4EO7A 4FZ5A 4C6TB 5H3CA 4LZPA 4C7MA 4LQCA 1FYVA 2Y92A 2JS7A 1FYXA 3UB3A 4W8HA 5KU7A 2M1XA 5FORA 1O77A 3UB2A 4C6TA 4C6SA 2J67A 3OZIA 4W8GA 1T3GA 2Z5VA 3UB4A 3JRNA 4DOMA 1FYWA 4OM7A 3H16A 4C6RA 4LQDA
chains in the Genus database with same CATH superfamily
2QZ4A 3EGCA 1A4UA 4WDQA 1RZ3A 5LOVA 2GJKA 1TQHA 3CU5A 3PUVA 2ZSAA 3JPYA 4MV4A 1K7SN 2HY7A 3PX3A 3GJYA 3PJDA 3PQCA 2JKZA 4PZZA 1JHXA 2ZR7A 4IAOA 1TU3A 3MMNA 4HLUC 5DT2A 4HTFB 2MU1A 1GVNB 3Q98A 4R8LA 4KUGA 4KYUA 3TF5A 4RZQA 1YACA 3LHIA 2WWFA 1PUIA 2YYAA 1IQPA 3GZTB 1RXCA 1NVFA 3QUBA 1FDTA 4HO1X 4OHVA 4JCCA 3L0DA 3JZIA 1O6GA 5JC1A 1UOEA 2E6KA 4R8RA 4X1YA 4MINA 3DLCA 1NVBA 1YRYE 2VTEA 1LWOA 4E1BA 1BDBA 1CQZA 4R40A 4C04A 2FWNA 4JLDA 2OFXA 2BPOA 3DBLB 4BMYA 1RYFA 3ZUGA 1G9TA 2MHCA 4MO2A 4HT3B 3MWKA 5L53A 1JDVA 3A2KA 3WKCA 3H1EA 5AXAA 1CV2A 5KQRA 1YZUA 3L1UA 4CQNA 2UYCA 2BEWA 4YRTA 5AFSA 2Z6QA 1ABFA 5JFOA 4IDEA 1YKFA 2BR5A 1O8CA 2NVOA 2Q3BA 4JSTA 2BHLA 2D1YA 4U2KA 4Y30A 3KE9A 4J2HA 3H2HA 1H6AA 1NBME 3OQ6A 1LC3A 1K7FB 1IOWA 5JEDA 3VVCA 2ZU6A 4B4VA 2FN7A 2PZAA 3GCGA 4L0MA 3TRJA 2CF6A 4RZHA 3H5RA 3ZLUA 3WGIA 2J48A 3PDUA 2PYIA 1VMDA 3EWNA 5E9JA 2FXIA 1GUDA 4LHXA 3CS3A 3VJLA 4QHYA 5BN5B 2Z2IA 3Q0IA 3EW9A 1XCMA 3VTKA 5MF6A 4YJ3A 1Y9DA 5KOYA 3HCOA 2Q2VA 3CLUD 2WU1A 1A5AB 3SY8A 2ET6A 5DDIP 4ZOQI 2UDPA 1Q1EA 1E7SA 1PR9A 2YW9A 3II6X 3PIRA 4TSFA 4RORA 4EJSC 621PA 4C0QC 3QWBA 5CW1A 4YAGA 1HZJA 1RD4A 1KF0A 3I45A 2AOTB 1E79D 1U8AA 4AYXA 2C9BA 1XD9A 3KB8A 4P80A 4N6OA 4BCBA 4X8HA 4FU0A 1JTEA 3VR5D 3MS2A 4Z99A 4DDMA 1DVRA 1T9HA 1PRYA 2DPMA 4KFUA 4R2KA 4M2LA 4KREA 3R9KA 4A1OA 3RG8A 4KPUB 3EPPA 3BK7A 2JNWA 4KDFA 3LUFA 1MFZA 2EL7A 3I6ZA 2GDZA 3GGSA 3WA6A 4EJ6A 2IEIA 4M0CA 3I1IA 1WMSA 3IDOA 3OHPA 4AO7A 3FWPA 5JJKA 5IVDA 1YUMA 1DEXA 3EXHC 4UCQA 5L40A 1L4NA 1LB1B 3FKSA 4PNZA 3WV5A 4CIAA 1C7RA 1UFKA 2W2KA 2JLWA 4Q9HA 3IAS6 1NMYA 2Q6OA 2IHYA 3IVGA 3REGA 1XTVA 3I04M 4BUJA 2XDQA 4NOMA 5HIIA 2Q4TA 2D8MA 2A7XA 3BD8A 4A1FA 4HYEA 3LO8A 3B6MA 2JHCA 4B81A 4HQNA 2EARA 1IWBB 3FPHA 1KDVA 2VFAA 1G64A 4NF2A 1ZD4A 1AUQA 3GJSA 4FLFA 1COWD 2XXJA 3O4FA 4LG1A 2H1FA 1LNSA 2BRUA 2IZ6A 2OORA 1EFUA 3W3AA 4A0SA 3C5WP 3BB3A 1KJJA 4C4YA 1PV4A 1NNSA 1NF9A 4EQ6B 4JI1B 1KQOA 2VDWB 2XGMA 4U7JA 4ESEA 1PD0A 2Z1DA 3P4YA 2K87A 1N9GB 2O1XA 4B4KA 1EUDB 5TARA 1W0KD 3W8FA 2QRHA 4QDKA 4X94A 2GCIA 1ADCA 1P73A 4BO9A 2FV8A 1C30A 3GIWA 4NPHA 4FN4A 3JATA 4RK0A 4DSZA 2UXDB 1Y4DE 5FFNA 2O5CA 3DM5A 1R6BX 2OOSA 2YZGA 1N92A 4X3CA 3TR6A 1X19A 3KALA 4BKMA 4DUYB 3O8BA 1E4EA 1QOPB 1WA5A 2IGTA 1CUCA 1H94A 2C4UA 2GRUA 4Y0VA 4PLTA 5ILQA 3D2CA 1S2LA 4UU0A 2B7CA 2AC4A 3PVSA 4YRPA 1DRWA 3G59A 3U9LA 3WFJA 1KZHA 4O6VA 4OJKA 1E0SA 5T4BA 1T0HB 1V8OA 2OV4A 3VFDA 2V96A 2V9CA 4PX5A 3DDNA 1FS5A 4HDMB 3KSBC 1JQ3A 1NVKA 2O2YA 3RHTA 3QSGA 4C6RA 3ZCVA 1GY8A 3B6KA 4MS4A 2OCGA 3NTXA 3UJHA 4QDOA 2IDKA 2WZQA 3EEYA 1RWXA 5FIUA 3A1TA 3LGAA 1ORHA 3OIVA 3F6EX 3IA2A 3LDUA 3OU7A 1PWXA 2VCHA 4LJ5A 4CHGA 1Z4KA 1K2WA 1N1EA 2IUFA 2XSZA 1O5OA 4JP5A 4KP7A 4BGVA 5JXJA 1PZXA 3ZCTA 1O77A 2EXXA 1GFWA 4GZMA 4MS4B 1WQ1R 1Z6ZA 2VF2A 4LXGA 3HB1A 4LNUA 4P7FA 4B82A 4MS3A 1GPH1 4ZAGA 1MC1A 4M8LA 3C7KA 3CLSD 5BOSA 2VJNA 2I6GA 2Y67A 1ZP6A 3ETDA 3LT0A 4HN2A 4P4TA 1EHCA 3MJDA 4X3PA 2ZSJA 1XLWA 1THGA 2PK3A 4YCSA 3PHHA 1MEEA 1CB7A 1FP1D 3NORA 1I6MA 1TE2A 3F4KA 4IO1A 3K0AB 2F64A 4YJDA 5CDFE 2BFPA 2BDEA 2W2LD 4ZVUA 3IQHX 3E22B 2JRLA 3UK6A 1D9ZA 1KI1A 3P9KA 3R5JA 4P7BA 3OIDA 4RJLA 5DIZA 1CR0A 3GHHA 3SBOA 4BEWA 3THYA 2X8WA 3I58A 4FFMA 2GK6A 4LYEA 1ULBA 3D0QA 2XBMA 1M83A 1G3QA 4HDNA 1OTHA 2PD3A 3HE3A 3T1QA 2E5LB 3I09A 2WPDD 2AVDA 1N4AA 3N2ZB 1QPZA 5IM4A 3IIKA 4WFQA 4CKXA 2XZOA 1BS1A 3E22A 4O5OA 5CP8A 3U7QB 5B7NA 2UXCB 1L1QA 1M0SA 2JFHA 2Z95A 3M5WA 1LS1A 3OIWA 4WLOA 3TPFA 4URYR 4JI2B 5J2TF 4QICA 1GTRA 1QQTA 1YFKA 3K1AA 1FVOA 4KX5A 4Z4CA 2QMEA 1CEQA 4FI3F 4JJZA 5HIJA 4PYQA 1SIWA 2D7DA 1JDTA 3GUVA 1I51A 3JQEA 1ES9A 1PWZA 2H1WA 3OX3A 4AJEA 1J8FA 3A25A 5AVTA 4HJRA 1EUCB 1ARZA 2ODQA 1GTL1 3R74A 3K5PA 5BNIA 4IJ6A 3GU3A 1K7EB 2O2ZA 3KQSA 4N65A 4NNOA 1NT2A 4R1UA 3RHZA 1GADO 4M21A 4AG5A 5C7LO 4JSRA 3HY4A 2Q5HA 1F0KA 1YFJA 2PT9A 5TJHA 1DC8A 3D3EA 3FA2A 5F7JA 1PTKA 3B1YA 1GTSA 3GJ3A 4GMXA 5ALVA 3TNDA 4ETMA 1XWFA 5CFMA 1N6PA 4G85A 2OD9A 4D9IA 3EARA 4MVJD 4CV1A 2OV2A 5K3FB 3LY9A 1M6NA 5AIBA 2R1UA 1V1MB 3L1HA 1J06A 1DKQA 3F5MA 2VF4X 2VHWA 1QVWA 4J3FA 3W6ZA 2I9PA 5L7WA 1F12A 3JQ6A 5JAUA 1QCZA 4PV7A 4BV2A 4AUKA 3W8DA 3K1TA 4K46A 2MJLA 4YJKA 4PY2A 1JHDA 4LE0A 5K8LA 3OQNA 1DTSA 1FIUA 3AONB 2H3HA 4MPJA 3ORQA 4QDJA 1NJ5A 4YJ3B 2C2WA 2C1EA 3QXXA 1LNZA 3CRZA 5B58T 4PR3A 1K5PA 3L5OA 2IXAA 4PWYA 1MDBA 1SKYE 4QYTA 4BNNA 4DCCA 5GQSA 5LQNA 1KERA 4BLWA 3GAZA 4EUNA 8MHTA 3JQ9A 1SRRA 4C0LA 3EC1A 4US0R 1FSPA 4LYJA 1YUNA 3INYA 1PNTA 4FYMA 4L3VA 1C1DA 4P54A 4XUEA 3RU3A 3TIXB 2PCLA 2ZI9A 3SSAA 5ITZB 1GPKA 4ARIA 2EYUA 4J0HA 2AF4C 3GFPA 2QLLA 4XB6B 2F00A 2VT7A 4D80A 1LFAA 1PWHA 3QJGA 3KWMA 4L22A 5CIQA 4G8JA 4LA4A 1C9EA 4YJGA 1CP2A 2COKA 4UNQA 1UJBA 2F7SA 2DB3A 3DDUA 1S89A 5H3HA 4BLTA 4G1FA 1QE5A 4J16C 4GKVA 1C2YA 1KH3A 4EM6A 2X86A 3H6GA 2QBYA 2EU8A 4RETA 4DC0A 2FGJA 2BBTA 2W2KB 4RK1A 3TSZA 2PKCA 4W7IA 2V4UA 1A4RA 5T7BA 4GSLA 4OHPA 2ECOA 1K98A 4GKAA 4H31A 1EB8A 4R71A 2H7CA 4UFNA 4M7RA 3WLSA 4DARA 3HM9A 3AEUA 4GIBA 1R8SA 3IIIA 1ENPA 4IKPA 4JLPA 1VKHA 4NICA 2WVGA 2QRLA 4IXMA 4QL3A 1U1IA 2F1HA 7AT1A 2C1ZA 3K2QA 1ZZEA 4O2AA 3D3NA 1BWPA 5GVRA 4MRRA 5LUAA 3UB3A 2JCBA 2XB2A 1TO1E 1V45E 3EOAI 4I5DA 3IYLW 3B5JA 1VSTA 5TY0A 1TUBB 3C39A 1PO7A 5IJ0A 5KSYA 5HG0A 1TMKA 4WVFA 3D7NA 4C0AC 4CEIB 4N3BA 2QS9A 4QIHA 3ERCA 3KLMX 1PGPA 3DZHA 1Y4ZA 2DH5A 5F35A 1Z83A 5G3YA 1NI4A 1U04A 5D87A 4UHHA 3W3AH 2JIDA 4JBWA 4O1HA 3ETNA 5ISMA 2JAUA 1L8OA 3S8EA 3U7RA 1IOZA 2VTDA 3EVCA 4KK4A 4QYIB 5SYAA 3I0NA 1MZVA 1B8VA 1UXKA 2WTBA 3KT3A 3QKRB 4FGUA 4W7SA 5CGZA 2JIMA 4CFZA 3AJAA 4TM7A 3RIMA 3T4UA 2UVDA 2H29A 2WYUA 4JAVC 2F2TA 4B3CA 3PD1A 2MSLA 2NUAB 1W29A 3D8SA 2IOFA 3JU3A 3HB9A 3JZDA 4RL4A 3TLGB 3NVDA 4BNXA 3IEXA 3BMOA 4F12A 1PZNA 2RKWA 3O7WA 4XDHA 3WMFA 2VNKA 2YQ4A 5EUQB 4EB8A 3DQPA 4AN4A 2HA6A 4J03A 3NX4A 3TOZA 5FXMA 3IAM6 1BWRA 1UKBA 5DN9A 5FA6A 2D2IA 3N0WA 2WHRA 1NVXQ 3TLGA 2CY0A 1GYPA 3L6EA 1RWVA 4L5AA 5FI5A 1OFVA 1JQBA 2UZIR 2PRSA 4E22A 4ALJA 3R0JA 4OEHA 4WLEA 3P7MA 4F2WA 3EDQA 4NPCA 3W9BA 4TTPA 5HP4A 3E5MA 2BUBA 5TQJA 6ABPA 1DFGA 4TWAA 1YIDA 4QARA 3SXJA 3WB2A 4NU8X 2QZ9A 1PNOA 2YCLA 1OYOA 1NXXA 1K27A 2EFJA 3GOQA 4CKCA 3GRYA 3V4FA 4CT5A 1HETA 5BVGB 1KYIA 1SN7A 3MINB 4H4CA 3K9GA 1U8FO 4KUEA 2Q2OA 1TVEA 1HH4A 3G88A 1EUYA 4BX0A 6AT1A 1G8JA 4BOYA 2ISCA 4R1SA 3T7CA 4CDGA 2WPDA 5F5LA 2W00A 2ESRA 2ONJA 4BJ6A 4WY8A 2VHVA 5ER9A 4TQ9A 5HSGA 2PZLA 4V3CA 1AOXA 1F0YA 3FPAA 2QPLA 2ZWMA 3KB6A 2RIPA 3FW1A 4IMJB 1R66A 2XH8A 1I2CA 2X2OA 4G5RA 5DVZA 5E8JA 2Z3WA 3HXQA 2WUEA 4D1YA 3REFA 1LQTA 4OXRA 3RJ5A 1A69A 1ZVKA 3UMYA 2O8CA 1WNTA 3L7KA 3L9WA 4JQYA 1YIOA 1DIHA 1MAWA 2B94A 1QO7A 2FSHA 1EX1A 1B0ZA 3E53A 3ZY6A 4L5IA 1P4SA 5ALKA 1NRIA 4MULA 4PC1A 3VAYA 4C5BA 3D3WA 5GAJA 1T5BA 3R0VA 3AVUA 4QOEA 1BRTA 1XLTA 4KO2S 5HKAA 1BU8A 3MMXA 2VC2B 2A9JA 3T5GA 1LSJA 3HKEB 3CRMA 3L7DA 1AB5A 3P9CA 2ZKLA 5TEWA 4O4LF 2UYYA 2QX8A 3EEBA 3U3DA 1FTYA 1EP2B 1GT91 4DA7A 5K1ZA 1BZYA 2XMRA 5BR4A 5BSWA 4O2LA 3D6MA 3KQHA 1BGVA 4G5HA 3CVUA 3H19A 3R5XA 2HJRA 1O4WA 4PFSA 4I4TA 4ZT3A 4ETIA 1F2UB 3DTYA 1JALA 1ZJ6A 2JJQA 2VR1A 3U40A 3AW8A 2FR1A 4LTMA 1E2JA 2WV7A 1X1TA 1NOIA 1VB5A 3MTDA 1NUAA 3U37A 4Z1OA 3AG6A 3I28A 3SICE 4A2PA 4YWJA 2HSDA 1TZBA 3SX4A 2IS6A 1X80B 2C92A 3EXEB 1D5CA 3WGKA 2NMVA 1BROA 1M1YA 2YV4A 3WRYC 3AF6A 2OXCA 1LS6A 3GGGA 3PNQA 4QDTA 5AKJA 1YCHA 4QHTA 5DHSA 5IDXA 4BP1A 2VF7A 1ZD1A 1DQSA 3CGWA 1RJDA 2B9VA 1JXOA 1A5BB 3B3FA 1AXGA 3KT0A 4GWLA 4YEDA 3EWIA 1Y81A 1E9AA 5EP2A 4CL3A 2O2EA 3J80A 2ZRJA 1UANA 4F1JA 4L8FA 3ESQA 3ZE1B 3IVAA 2AXEA 4IOKA 3HL4A 3OZXA 4GOMD 3RVOA 1KRHA 3STHA 2P5SA 3D2LA 3EXIA 5G2OA 2P1ZA 5EPEA 4CXMA 4DB4A 1C7ZA 3FPJA 5E6RB 2QSUA 4J1SA 4UEWA 2OM6A 4PLWA 3L4BC 3PFWO 1X8JA 1LPPA 4W99A 5IK2A 1QCYA 4ALIA 5IX8A 2YJGA 1XTPA 2YWJA 3BE6A 3MCAA 3SE0A 5GINE 2KE5A 2ZOSA 1VXOA 3F8SA 4DCOA 5JEEA 1FDRA 2CFTA 4K9DA 1XN1A 4LXUA 5LXTA 4PZDA 3NTQA 4W8GA 4Y9RA 4R1OA 5FAKA 1AT1A 2JW5A 3DZ8A 4DT1B 4YCJA 3D81A 4PRZA 1W9MA 2J0UB 2BLLA 2O7NA 4D97A 1DMSA 3BWDD 4XR9A 2TSYB 3L6DA 1QYXA 3G2OA 3I2HA 4AT1A 4Q01A 1Z74A 2NZ8A 2LR0A 2PH1A 2PU7A 3S0JA 4J0FA 4OU5A 3HP4A 4PSUA 2NZXA 3HGMA 3O2NA 4M37A 4MKHA 1ORWA 2C9MA 5DTMA 3KKNA 3L18A 2ZRAA 4L75A 3ZBUA 3LCRA 3JD4A 1PF7E 3VX4A 2O8DB 3DBLA 4HDAA 3EDMA 2CUZA 1WCIB 1UMBB 1ZWKA 2XCLA 2ZYHA 3LQ1A 4TXNA 3HA3A 4AJKA 2FFBA 3OZIA 4KEAA 1Y3BE 5I7OA 2QN8A 4EYKA 4I8IA 2YH2A 2XYGA 2O7RA 4YHBA 1GEEA 1XU9A 4L6IA 4ALKA 1DO2A 1DG3A 4CLOB 1YDHA 3K8OE 1M75A 2Y0CA 3TKAA 3G3EA 5C8YA 1XDBA 1WCIA 2GAJA 2BZ0A 4QBFA 5C5IA 1U98A 4NV0A 3WLIA 1CU1A 4FHZA 4GP7A 3P9IA 4WD3A 5DCLA 3THXB 3LOPA 3CG0A 1X1BA 2YZ7A 1DJLA 1BOFA 4MGKR 4DHWA 1SKAA 1M1YE 1OHHD 5A7GA 4C4ZA 2G9ZA 3JXEA 4OTZA 4QJIA 3IOMA 4I5EA 3X2EA 3UWMA 3UFBA 3W5UA 4AMZA 3PQ2A 5JSQA 5F9FA 4OHOA 1PQWA 3HHPA 3K4PA 5EJEA 4NBUA 4HVAA 4C4RA 4ZT6A 4B17A 1Q0RA 4BLOA 3JVUA 4PHFA 4ZQGA 1TO2E 3K4HA 2XCQA 4OMUA 3SXPA 4KR6A 2X7XA 4LYDA 3WWEA 1BXZA 1CC1S 1K66A 1XDSA 1NU6A 2OVFA 3CUSA 3LBYA 3PUYA 3UYLA 3KSAC 2HR1A 4EJ2A 2FPXA 3EDRA 1SZDA 2JA1A 2YXNA 3DWFA 3FMFA 4M6WB 3CE6A 5IJWA 3AV0B 2F1JA 2VTVA 3TQTA 1OY1A 1M33A 2C04A 2FVXA 1KK1A 3BORA 3FVQA 3GVIA 3MLAA 3QKSA 4Q47A 2PT7A 3PCXA 1HPLA 2AOVA 2O5VA 3RTDA 3V7WA 1JAZA 1CIVA 3PC2A 4U7TB 3ZE7A 4AF6A 2JFVA 3QELA 4MVWA 3MTQA 4OYHA 4LV5B 5EXTA 2PS9A 2A58A 1DX4A 5AVSA 5J2UA 1N57A 2RJNA 4WVLA 4ABTA 2WDZA 5KC9A 2QD5A 2HEIA 2X19A 4BUZA 3FG9A 2F1KA 4JEHA 3VDXA 1A8UA 1Q21A 2CDBA 3LQ4A 4IS2A 5BVGA 2CK3D 4FIZA 1IZ9A 2AOUB 3DG9A 2AFRA 1IPEA 4XLZA 3ZNOA 4OXNA 3JQDA 4KPYA 1ENZA 1U8XX 1KEVA 1TYDE 3QHQA 4G5YA 3JZMA 4E2ZA 3G9QA 1H0HA 5FPQA 4YT8A 1DWQA 2PJZA 4C22A 4CWAA 4BPBA 5KSPA 1GG8A 5DB4A 5DF1A 1X15A 2GASA 3QVLA 4U7FA 4CKWA 3THWB 2FW1A 4RDCA 5JAMA 5AHOA 5IVPA 4OI0A 3VRHA 2R97A 4LHEA 4Z8YA 3RKSA 2IH5A 1DJMA 2WSLA 3JQ8B 3K92A 2O0LA 2SECE 2VRNA 3P19A 4XQCA 2C31A 1K68A 1JFSA 2GVNA 4JL8A 4CPDA 4I55A 5FI3A 1APBA 3RARA 4QOHA 3FNGA 1P2DA 4OK3A 4L08A 2XVZA 4MWCA 4MRAA 1MAAA 1IL0A 1D0IA 4OH7A 3LHKA 4QEKA 2RB5A 3B20A 1T1JA 3DDZX 5DJ5A 2AZTA 4BVBA 4C4SA 2DETA 2J1LA 4IMPA 3UJPA 2GM5A 1UXHA 2VG8A 5GZ1A 3AM4A 4JXZA 2Q9UA 3SJ7A 2QYHA 2G1JA 3HYCA 3ETHA 3OIFA 4ZEOA 2IOFK 3UKOA 2I3DA 5KVAA 2D5AA 1PT8A 4YWHA 1MX9A 3EZ2A 4FUQA 2QVCA 4LY3A 3UH1A 4ZYZA 4TT3D 1SC3A 2HBQA 4CM4A 5FI0B 3ROXA 1GTJ1 4ER6A 4RY9A 5IJ9A 3N9IA 1S1MA 5AK0A 3LVQE 3T52A 4F71A 1IXKA 3CX3A 3ENWA 1G5HA 4QXPA 4HR7A 4YO7A 4HN9A 1QS0A 2Z6VA 4RTLA 1HQCA 4XGKA 4D9KA 3FZNA 1QIEA 4II3A 4LNUB 1GLGA 4REOA 4ZWNA 4U02A 4EUSA 3MCTA 1I2AA 3LBIA 2P79A 3O03A 4QJ5A 5HQTA 1CQJA 1QORA 2PZJA 3SR3A 1Y1PA 2X0JA 1TIPA 2CZGA 2REOA 2YIJA 3LCUA 4KJZA 1MU0A 3MJFA 1F6WA 1FB5A 2FNAA 4JUAA 2FPRA 5HQJA 1M2NA 1BG6A 5LZ9A 2B6HA 2Y1DA 2A92A 5GONA 3VR5A 5K3BA 1QKJA 1NQTA 3ZV6A 3R8FA 1UOOA 1E3IA 3ADOA 4RD2A 2QUJA 3AEYA 4DCMA 2G04A 3SQDA 4DDWA 1DKNA 5A3QA 2VJMA 5HM8A 2B92A 1JG2A 3ER6A 4QWWA 5ALZA 4OQYA 1WZ2A 5HZHA 1P75A 4UD6A 3VVMA 4F9TA 4NXNB 1U0NA 2XDYA 2V1XA 1YJAA 3HVIA 4CQMD 1LWNA 4CEJA 4L57A 1SXJC 2PYZA 4WAUA 1LK7A 2ECQA 4BIIA 2XB8A 3UC9A 2MOKA 2WYIA 2MSWA 1I5OA 2VSYA 3GLVA 4FYVA 3CW8X 5LIRA 1E6UA 1VJTA 3S29A 3CVJA 4E2YA 1U9YA 2RC6A 2I22A 2VP4A 4LHWA 2F43B 1ESEA 2HI0A 5D5HA 4AM8A 5KOIA 5CEJA 5DRYA 1TCUA 1VJRA 4F46A 5HIKA 2FW6A 3PF9A 4O4IF 1ODSA 4AS2A 4AWBA 4BNTA 4C0BA 2FPOA 1D2RA 3CC8A 4YJGB 2AD1A 1PR5A 1BRMA 2QXUA 2RGWA 3DBRB 1NXSA 3DKVA 3NHJA 5F3RA 1RRPA 2IU0A 2P65A 3EH1A 4FD3A 2PSHA 2WUFA 5C31A 1VSVA 3A3KA 4MDYA 3TTUA 3HVRA 2JZNA 3WGUA 2GNOA 4XEUA 1A98A 5IT5A 3BHJA 3F2VA 1EEHA 4EUFA 5J5AA 5DN6A 4HEJA 3FFAA 4AX4A 1XE3A 2WD7A 1XCGB 2WYVA 4E5DA 2UYHA 4FHEA 1WBDA 1Z5NA 2LIPA 1WV0A 5JUWA 3TQSA 3IUQA 5AJHA 1UAYA 2R2AA 1PEKE 3AHJA 2RC5A 1J9EA 1QH1A 1CR1A 2OCIA 2Q3DA 1TPYA 4NBWA 3FSJX 4ZPXA 1OI3A 1CY1A 3TAUA 4ALLA 1SD1A 1PFWA 5WRFA 4F45A 2XEDA 4G2TA 3UQYS 4F60A 3H42B 2BWJA 1VRVA 5EJ4A 4XM1A 2ZTSA 5IJAA 5IAKA 3WYGA 2N1BA 3M6AA 5J63A 4JXXA 2NACA 3NT5A 1ZK1A 2O07A 5I7VA 2Y1CA 1CDZA 3UV3A 1H1LA 1W5TA 2J9XB 2JBAA 1KC1A 1HG1A 2JFGA 1NBAA 3MSCA 3OVMA 4TV9B 3RTAA 3RSZA 2DUWA 1CZRA 1NJFA 4XWGA 3QV1A 3ZWYA 2EIHA 3UPDA 3AVXA 2B3TA 1AHPA 3QX7A 2C96A 2VNHA 1IN5A 6GPBA 3FFTA 3KFLA 3K9FC 4RHYA 5AM2A 3EF1A 5BWNA 4H9GA 3ZI0A 1FFCA 1YQQA 2BP7B 4W5HA 2P69A 1SCKA 2JGLA 2I03A 3HCWA 4ZHSA 5BXQC 2G36A 1XPOA 3VPBA 4LJRA 5CT8A 2I6SA 3SZLA 5JASA 1JSRA 3ZN2A 4CR8A 3R7DA 3Q40A 3QF4A 5DGHA 1XKQA 3H05A 2DWOA 4MLPA 3VKVA 1REQA 4B4WA 2PGNA 2J3MA 3FPKA 1XWWA 4OHFA 1A1SA 4ESOA 4HY3A 2I8LA 4LXYA 1G6HA 1PU2A 2ASVA 4ZI7B 4UHFA 1JI3A 2PQ2A 4R1TA 5A3SA 1EGHA 1JFLA 4OREX 4XWKA 1SKUA 2VPQA 5IHPA 2PA3A 1JAIA 3THYB 4CNBA 4E5UA 3QFTA 1T0IA 5B2EA 4ZMBA 2E5FA 1XQ9A 4YMIA 3UK0A 2Y3IA 2UVPB 3KLNA 2XE4A 1O87A 4OUKX 3ZZ0A 1NC1A 3K0CA 3NWPA 5HKKD 3RFTA 4QGHA 4FDTA 2IU6A 3WKDA 3NONA 3BK1A 4LVCA 1YJ5A 3R0XA 3ZVNA 2Z8XA 3TZBA 1CY2A 1DBIA 3ZVMA 1L7DA 2ZYRA 3WYFA 4OGKA 5GZ3A 2HXYA 3CVOA 4MV8A 3P0JA 3D6FA 2DT8A 3RREA 4DPMA 1WABA 5IT9A 3SBXA 1L5SA 4GPEA 4I3FA 4IWNA 4O2AB 4EPWA 4IFIA 3WBKA 2HMTA 2N75A 2A1UA 1G8FA 3RRJA 2ILTA 3TSYA 3BMNA 3O8OA 4RS3A 1QGZA 3PDHA 4GE0A 5JR3A 1P3Y1 2GMWA 4YV1A 1Q1QA 1RAFA 5CLQA 4AIRA 4UE2A 3QFSA 3AR4A 3UUEA 4ILEA 2SNIE 2BCJQ 1IG0A 1NUUA 1SRQA 1T8WA 1IPHA 1GNTA 4PHHA 4URZR 5A0FA 5IJXA 1T0JB 4ZPJA 2PQMA 3DR5A 4CIVA 2E4YA 4PLFA 1YB4A 1ZHFA 4HGOA 4OK5A 4IJKA 4TGLA 3GFVA 4ARBA 4EG4A 3P2MA 4DTCA 3UWSA 4WBNB 2JJ1D 1TD9A 4H3HB 5E4YA 5C8VA 2GESA 3EDYA 4NBTA 1ZITA 1YTLA 3QEAZ 2BEUA 2X7JA 3NVAA 3TTXA 4W1SA 4BYMA 1N4DA 2OSVA 5KYUB 3DZCA 3AVQA 2G0AA 4B34A 5KYVA 1WZCA 5BWBA 1HNZB 5FO0A 3BJRA 2AKYA 4RMJA 5SZKB 3IAAA 1U8YA 3EGEA 3H11B 3OM1A 4GYKA 3SHOA 4IDGA 5EQFA 3UIEA 3W4KA 4KQ2A 4PZUA 4JYMA 3OY2A 1JVSA 2BISA 4JUCA 1JILA 4PQRA 4Q24A 2H4ZA 3I92A 5IDYA 3NHFA 1QE3A 4NBNA 2YBDA 3R20A 1E2LA 4XM0A 5DEIA 2GYVA 3JQBC 5FWYA 2CDAA 3SM9A 3DT9A 3NYWA 4UE3S 5TX7A 1OX4A 3BL6A 1JTFA 5A2GA 5CLFA 3I62A 3NDRA 1UPAA 2SKCA 3O95A 4NCNA 9LDTA 4BE9A 4LF5B 1NI5A 4FMDB 4XGQA 3TNFA 3UEOA 1BFKA 1V8DA 2V98A 3DEHA 5C1BA 3LQKA 2RHDA 4ZVMA 1PNVA 4MAMA 2JI8A 4B44A 5KIAA 2ADFA 3GLHE 3JTEA 4C05A 4N48A 2I2AA 4NMXB 2PUGA 3FLMA 4QAJA 5IJ0B 3CUEF 2GCOA 4QPJC 4CCYA 3L77A 1UBTS 2EQ5A 3AEQB 4L8WB 1NRWA 1T8PA 1QYCA 2FW7A 2WP8J 4EG1A 2CZQA 3CZRA 4FXPA 4CODB 4Y6QA 1U4SA 4UMFA 2J7PD 3UCXA 2ZYIA 3BCRA 2J0EA 3D1JA 1LBSA 3IFSA 4IDAA 4EFKA 4ZHQB 1Z5VA 2Q6IA 1X1QA 4UZSA 1P2GA 1XPUA 1X3LA 5DI3A 4QTXA 4TMYA 3UOWA 3N8DA 2AC7A 3H8SA 4S1OA 3RAEC 1D2MA 1U9IA 1CUEA 1KYTA 2UZ1A 3W2FA 1BXGB 3CM0A 4E5KA 5JZMA 5IRCD 3K09A 1Q7RA 3H8JA 3FPGA 1BE8A 2X4GA 3EEQA 2R8OA 1LK5A 3CWQA 4YAKA 3PNKA 5LKRA 3I5YA 4B7XA 1E7WA 3H8WA 2RI6A 3OMLA 1X7GA 3AVTA 2JJ1A 4M8IA 4AJIA 3FUCA 2BEUB 4UMVA 3C6BA 4TROA 4BVHA 4NX2A 3WQBA 1BXGA 1MG5A 1PZMA 1R5JA 5HGXA 4E4RA 4PO1A 3O38A 2WHYA 1MIOA 3L0CA 1R9MA 3JQQA 2F9MA 1N5DA 1ZRNA 2G6BA 2H2FA 2ISQA 2ZJYA 3MBIA 1JTVA 1GQ2A 1NBMA 5T57A 2QQGA 1QIJA 4XPZA 5A06A 3F6BX 1QCCA 1NW7A 3VR6A 1USKA 5AVKA 1AKEA 2NOAA 4GO1A 4HWSA 4DSUA 3B12A 5HF5A 1SELA 1SVSA 1SZCA 4EA8A 4DB2A 3I5XA 3A6HA 4YECA 3RBXA 1RWMA 2I6XA 2ZG6A 1SKQA 3E5RA 1QGOA 3OFND 1LH0A 1EDZA 1OJ7A 3ZI4A 2V3VA 1D8TA 2IHTA 3B38A 3BMXA 1G17A 2Y1LA 3G68A 4IIBA 4KQWA 4R5MA 4DWWA 3U09A 4OA5A 3GT7A 4B31A 2JHPA 4XIYA 1J97A 1WY5A 2B69A 2DWPA 2VK2A 2AOUA 1VLVA 2B4QA 4Q6BA 121PA 4D4MA 2A7QA 1G291 5DNUA 1D4OA 1PVDA 2VDLB 4RSMA 1E6LA 4HXGA 3WLOA 3FLBA 2XE6A 4RHEA 2NW6A 3JD3A 1CF2O 5ERYA 3TKYA 1Q6ZA 2BSXA 5GJWC 1J0BA 4NMLA 1LI7A 3E3AA 4JCOA 3GNTA 2AQKA 3TFQA 1PJ4A 5A9SA 1RM3A 4WCFB 3RVMA 4CI0B 1P7PA 1NIJA 2HMAA 2HO4A 4BMCA 5FA5A 3UFXB 4R6WA 1UMDB 1KH1A 2I9KA 5E38A 2YYZA 3C3YA 3PGMA 1MJGM 5E3IA 1ZMOA 5SZHB 1M2VA 1T8TA 3OCXA 5L3SA 1ISJA 3QG1A 4L73A 3TQCA 1AB6A 2P91A 1WXWA 4URVR 2R84A 3UKDA 1S3IA 1BJKA 1JVNA 3JATB 3MT8A 2AR0A 3D8NA 1XMOB 4ZN6A 1DJPA 1P3JA 3LUCA 2OZKA 3H9QA 5KTOA 3BGWA 1OI7A 1DT3A 1P29A 2HDNB 1M3SA 2XDWA 3Q5GA 3LCJA 3Q3IA 4I3GA 4UEOA 3SLGA 4EBFA 1W36C 1V2GA 1VKOA 1VHDA 2HC9A 1VI5A 3PR3A 3C3BA 5ENVA 1XKXA 1XJ5A 3CEHA 5CYFA 4DIFA 1R8QA 1H4TA 4CMCA 4XKJA 1KKMA 1W2WB 1NWHA 3GFFA 5DP1A 4JC5A 5FBZA 3GXOA 4W9MC 3TIVA 4ZZ2A 3EPJA 1E2GA 2Q3EA 3OQJA 2AFHB 3WE7A 3TLXA 2EGHA 3LHFA 1LPNA 1RMTA 1SC1A 2IEAA 4XB1A 3RKRA 3ZCXA 5GOZA 3RCBA 1QHXA 1SCUA 1UMCA 3I8XA 4OHXA 5C4MA 1RXWA 5E95A 4JJFA 2F8TA 3VR3D 3R7LA 1VKRA 4P98A 4BO3A 1M34A 1OLSA 4Y2YA 1CE8B 3HBNA 3C8ZA 5DHUA 4A3SA 1Y8QB 4C76A 1CZHA 4ZYWA 1JQ5A 1RYYA 5BNTA 3ELWA 1OA1A 4DQUA 1SNYA 3COYA 4RPGA 4E70A 4EENA 4EITA 2QLNA 1QNFA 4K8RB 5B3AA 1ACMA 3RO7A 3V3KA 5LYJF 5EXDA 5HNKA 2W4IA 2HMVA 4J90A 1MC8A 4CG0A 4CW7A 1MJHA 2L2QA 4FZVA 4D8UA 2GBIA 1XNGA 3LW8A 1N6NA 3DH0A 1GO2A 1NV9A 1R3DA 3WLPA 5KDOA 3E9MA 3FKJA 3KE8A 2GD6A 1ECPA 4JN6B 2VJOA 3CKMA 1I9GA 4MPDA 4BLSA 1K86A 4HDMA 2CUKA 1JDJA 4YMSA 3HY3A 3FCUB 4YP0A 2NADA 4D3ZA 5THXA 3A4TA 1PFGA 1JA0A 4WESA 5T8KC 2G7ZA 3EGIA 4Y2PA 3W6NA 1SXJB 2NTNA 2R6JA 1EUZA 2B8EA 2H9YA 2KW5A 5CA0A 2NM0A 4KH1A 4X85A 5AVZA 2PDAA 2ZIUB 3N87A 2QL9A 1XA3A 2AGVA 2REQA 2B0CA 4B74A 2QAIA 3F46A 1Q6YA 1V7CA 5LD2C 1LLQA 3EHEA 3PI6A 5FOWA 3OJ0A 1VMAA 4DR4B 2HRDA 1FYVA 4XD2A 2VDQB 2PQ0A 1N5JA 4KOAA 2BEJA 4UDOA 4ZALA 3T9EA 4EFMA 2B2CA 1RLIA 2A5JA 6ADHA 1DAOA 5AW1A 5ADVA 2QUZA 3OQPA 1NYRA 5BSUA 5BUSA 2Z04A 1XT6A 1F48A 4G09A 1POXA 2YUIA 5JMPA 1RWWA 1IUNA 4XDYA 4Y18A 5I4BA 1EKXA 5L6MB 3ZHVA 4QJ4A 5J59A 1P5RA 4AJHA 3MS7A 4OAQA 1KO8A 4X90A 1SU6A 4IHAA 1Y1LA 5AOAA 5JSYA 4BKUA 1VI2A 1G5IA 3BWEA 3GJ4A 1QCDA 4QRIA 1L9KA 4QWMA 2K4MA 4X1IB 3ZGNA 1D4FA 2PFGA 3HKEA 4YONB 1M54A 1XA0A 1RI1A 4L8GA 4BKQA 3I5UA 1L3CA 1YL5A 3A4LA 5UKDA 1EMDA 2X5KO 1T34A 1TKRA 2J59A 4RKFA 1Y3FE 2OENG 2VJDA 1X1SA 4Q1DA 5H3LA 1ZQ9A 3E1GA 4C4TA 3SZOA 3AM5A 2A9PA 2JGDB 1XZLA 1CW2B 4H15A 4JVNA 4PAGA 1G9XA 1OBVA 1SHLA 2OCKA 1OGIA 2HF8A 3OSZA 4II7A 1Y4SA 4PO9A 5DWQA 3TI9A 3TVDA 1DDGA 221PA 3QLEA 4KQ9A 3W2EA 4I50F 1UKZA 1Z7WA 3B1VA 3OTWA 4WNAA 3C97A 2HV8A 2BLNA 1Z08A 1AUVA 2GEBA 3KEFA 4UNSA 5E1DA 4EZEA 1JG1A 1T6XA 3V5NA 1GGEA 2A0YA 3DE5X 1NN0A 1CNEA 1NVGA 1RQXA 4R84A 5J2TB 4BXOA 2ZZNA 3UV7A 3HLTA 4M0EA 2VP5A 3IXQA 5E0OA 4OX9Y 5FBWB 2AK2A 3TXAA 2RAPA 3L6UA 4CU2A 1HDEA 3ABSB 3VPCA 1B26A 1BVRA 1P0CA 4J2OA 4BQPA 3HDGA 1W2HA 3BUSA 1WUYA 1HI9A 2GN2A 1Q19A 4U3JB 5IVKA 1J23A 4EKIA 3TLEA 3VZBA 2DE0X 3NHLA 1PT5A 1ZRHA 1U2GC 2J3LA 1IJBA 2JGMA 3B3GA 3REQB 1Q83A 5F4ZA 2FPPA 4LHZA 4YK7A 2BSQA 1E6MA 4LV8B 3COWA 1RIIA 2BFDB 3ETCA 4Y7DA 2VXOA 2F4NA 3TBHA 3L82B 3KIPA 4C4OA 1NM5C 1WZUA 3PYXA 2GK7A 1Z18A 2UZ3A 3WGVA 2PGJA 3GEHA 4ZO4A 1BX1A 4HEA6 3ZKWB 1L8LA 4BE7B 2ZUEA 1C81A 3ZJYA 2GDJA 2VWGA 3BOSA 3FGOA 1P0QA 2X0KA 1UDBA 5DN6D 2GEDA 1WO8A 1UM9B 2RBGA 3BH7A 3UMBA 1MJNA 3O92A 2PZEA 1EP1B 2G25A 2ZI7A 3K5IA 4JLKA 4Q4JA 1ZC4A 3C48A 2FETA 4E7OA 3RV4A 1C1DB 1PR2A 2A9VA 1Z3IX 2IYXA 1Q7BA 4ZQHA 4DWVA 4FLEA 1UFOA 2AZMA 4F56A 3B9RA 5FBQB 4F6CA 1Q17A 3KEGA 2GYWA 3LOQA 3A3PA 1TGYA 1NSFA 1Y9AA 3Q3HA 3AR3A 2FPGB 4H7FA 1T9KA 1YR7A 3EAQA 5COQA 2XR1A 5TGZA 2BH9A 4X3OA 3S3TA 4PCAA 3LIPA 4EECA 2HWWA 3DUFB 4J7AA 4CLHA 4KHZA 4Q7QA 2CWWA 1QH0A 2AMJA 1B0UA 2YWDA 1Q3HA 3KBBA 1HE4A 1LPOA 4WSOA 5DX1A 2WWYA 4OHRA 2GB4A 1V16A 1X8LA 2H1SA 2ZUWA 4LRUA 1AD2A 4UM5A 4Q9LA 3VDNB 1JZTA 2PBRA 4HN4B 2KX7A 3AHGA 2W70A 3MGAA 2OYRA 3C87A 4PLVA 1CY4A 3FRHA 5AHXA 3GFTA 3DO6A 3UUFA 4N49A 4BB0A 4EY5A 4AP9A 3KKEA 1X7XB 3VJMA 4YRGA 4ZVOA 3K0FA 1W581 2ZWVA 3DBHA 3E2MA 4QUHA 4RO0A 3HFGA 1YZKA 1TQ6A 4W6QA 3H2ZA 1N9KA 2G88A 3JW8A 2BFAA 1L5VA 4QC2A 4I66A 2BFMA 4YRNA 2XRFA 4ASUD 4BVKA 1IJKA 1TZ2A 4MUXA 1B43A 3WJ2A 5HUQA 1PW7A 3NRCA 1HTBA 5CXSA 3SZUA 2XW6A 4ZK6A 5K7SA 2JAOA 3CUTA 5AJTA 3JAWB 2FLVA 4NS1A 2YXEA 1TU4A 4D81A 1PR0A 5F51A 3EVNA 3F67A 1KMIY 2IBMA 4PHGA 4PYJA 3DFMA 3CKYA 1RYBA 5I01A 3J81k 2MYPA 3ZIAD 4AULA 3KK0A 3OEEA 1CUXA 4MRVA 4Z2AA 5IYZA 2AQHA 3HXPA 1UWVA 2IOHA 3AY3A 4RFSB 2ZIAA 4YA6A 3MMPA 3NBQA 1SC6A 3R6TA 1GZ5A 4OG2A 4TWRA 4JB2A 1GKYA 1N3IA 1S3GA 4IVRA 3HR4A 3HXTA 3E7FA 2F59A 3HRKA 4EUHA 4EPRA 4G4SO 2YWHA 3VNQA 4D02A 2DTXA 4LDPA 4IKOA 4H7HA 5AUQA 1K7YA 2PT6A 4XD7A 2HHHB 3QXHA 4HVCA 4HDNB 1J5XA 1OCEA 3QUCA 1G8AA 3UA3A 2XOEA 1IXZA 1E77A 1V5WA 3JCZA 4ZJYA 3EA5A 1G98A 3VV2A 1DAGA 1NAHA 1NX6A 1TMGE 4RM2A 1KMHB 2V7WA 1KK2A 3EBOA 5CT5A 3ZD6A 2Z2JA 3GLGE 1V5EA 2EATA 3IKVA 3LY7A 3ZJTA 2BZ1A 2DLCX 2VPIA 3B85A 1QQ7A 3DP7A 4MH0R 2M6LA 2WM9B 1GZSA 4X91A 5JDCC 1T10A 2FMXA 4TXLA 3WQSB 4P92A 3OBBA 3TOCA 3HB4X 1GUFA 3PZRA 1WSBA 3SKVA 4DZRA 1JU9A 3DYIA 3PGA1 1CEEA 1J8DA 4V0LA 5JLJA 3ON5A 1WMEA 3OOWA 5G1PA 2C61A 1YT5A 3OLYA 2GZRA 3GEIA 3L1JA 3O7MA 1NJ6A 2OUIA 5BV1A 4Z4FA 1GA4A 3C5CA 4X45A 4G5SA 1C1YA 3ODGA 3VPFA 2RGEA 3JAKB 1V3QE 3TW6A 4KNYA 5IARA 4MQFB 3F4BA 5K8VA 2XWQA 1HBJA 1JPNA 1Q0UA 2R8BA 5CPFA 2B4AA 4BGDA 3L05A 3B1KA 2NUPB 3NB0A 3FGPA 4BQEA 4CTOA 3TAHA 3U44B 2O8FA 1OXVA 3WP0A 2XNCA 1SJ9A 1Z4JA 1B4DA 1A0OA 2HWXA 3DWIA 1ODCA 3KFXA 3PR1A 1FF9A 1U3WA 3DO5A 4PG4A 4DA6A 5INTA 4DSTA 4U2CA 4MP6A 3Q7PA 2X6RA 3SC6A 1C7EA 4UNPA 4X60A 3UN1A 1Z4MA 4DREA 1XTKA 5B6PA 3EXFB 1QAOA 3U4HA 3WYCA 2QUKA 3AR8A 1AF4A 1CY8A 3A7EA 1LX7A 3G5AA 1YJ8A 4J9VA 3I2FA 5BSMA 3ICEA 5I47A 2P9FA 3BHIA 2Q2WA 3ENZA 4J7CA 3INRA 3DB1A 2R4TA 3BWXA 1R6VA 4D43A 3FBWA 5CVUA 3B8HA 3ZK7A 2DQKA 2H4FA 3RROA 1Z8HA 5K0NA 2SBTA 3EGXA 2IW1A 1F3OA 1LNQA 5JDIA 4QEZA 2H92A 5JQGF 5EHIA 1CJSA 1NZDA 3TLZA 2O1WA 4XGNA 5H68A 5FUVA 4A27A 1QB7A 1R4MA 5IKXA 1YS2X 2PTHA 2AN3A 4X65B 2IYPA 4Q1AA 3HCBA 4V2UA 3EGXB 3G9UA 1GUAA 4YRAA 1F7VA 1TECE 4YAWA 2C4HA 2YOHA 3S6JA 5I45A 1VHJA 3FVWA 3TRKA 1UJCA 1L5FA 1ULTA 4L0CA 2O6LA 4XYLA 3MRVA 3WWOA 2ICAA 3EUAA 3LXUX 2GJSA 3PCTA 3VKGA 4J3NA 1CUHA 1Q0QA 1F9AA 3DZGA 3JASA 1NATA 4I5IA 4MQEA 4AW9A 2Y0EA 4D3YA 1DADA 5KINB 1NUHA 2F8SA 4IW3B 1W5SA 3WK8A 4PF1A 3EXG1 2PQ6A 5FNZA 3PUXA 2CLLB 2C0CA 2F9FA 4DLKA 1EGMB 4PRYA 3ZE2B 3D1LA 2YVLA 1OROA 1U63A 4CUJA 2VPZA 3DMYA 2JHGA 3ETEA 1F2VA 1JYSA 2V4ZA 3RK4A 3S2EA 4A26A 3ZWBA 5B7GA 5IZCA 2VH2A 5GIPE 1MBZA 4W7HA 4MB6A 2C2YA 3ZHXA 4M88A 4KVAA 5SY4A 3I9KA 5HKKA 3NYQA 4OP1A 4FGWA 4E94A 3D3KA 4F4IA 5MGBA 2CW5A 1UQTA 1FMLA 1JPUA 2J6HA 2GF9A 2R2GA 2WIKA 4LSZA 3RYHB 4D9JA 1P9OA 8ABPA 4DV1B 2RGGA 1HMYA 3H18A 4QELA 5FTJA 1AXEA 1QH8B 1RCFA 3RWMB 2H4JA 4M1QA 3VXKA 4KHPB 3MTAA 3HDJA 4AVYA 2H1HA 2DHEA 1ZINA 3KETA 2GEUA 3N58A 2CYBA 2GPYA 3T5TA 5CIYA 2QSZA 1C30B 2X40A 3NYIA 3V2UA 1VGRA 4HOYA 5GGXA 4KRGA 4KC0A 1SU7A 2CD9A 3C4VA 1IAQA 1SOWA 3HWRA 3OLQA 3PPYA 1M9NA 4H1VA 4YAOA 4F4CA 5HQ3A 5KX5B 3SVTA 2X6QA 2J3IA 4QU5A 4GLOA 4OHCA 4Z3DA 4F0JA 4FONA 1AQYA 1IU9A 2EKPA 4Z7NB 2C4NA 2ZIXB 3EZGA 4EX6A 3QEOA 4XLLA 4BVJA 5HILA 1UXJA 1AV7A 4Q1VA 3SR0A 3H0CA 1AU9A 2ZCJA 2FPWA 1NNEA 5DLDA 2NV0A 2AN9A 4GI1A 2YOGA 2H16A 1Y1QA 1FLVA 5KX5A 4W5NA 1PK7A 1L1EA 3O8LA 4FFBA 3DOHA 3ZDZB 3KOWA 2F1OA 2FPIB 1T2EA 3T7SA 1FS4A 1ZCAA 2FCRA 4D8VA 1RZRA 4H18A 2H5LA 4M53A 4R8KA 3PXEA 4LE2A 1NW4A 5ELXA 4FGSA 4MYRA 3SJCA 4PHCA 2GD0A 4M9CA 4YRIA 2XWJI 4Q4AA 1GR0A 4JP8A 2IIVA 4PINA 4GX1A 4BZZA 1DAPA 4L2IA 4QG7A 3U4CA 3IULA 4JUDX 2ZPUA 1L7MA 3OPVA 1GKIA 1DNPA 2JARA 1QGAA 4OQEA 3FIJA 1RPNA 3PWKA 3I83A 2OZPA 3QKUA 3VKWA 5LMCA 2LDBA 5IBPA 2WTEA 2OBMA 3T95A 2P5YA 4M86A 2BKXA 4PZAA 1UZLA 4RXTA 4PVCA 2AOXA 4PN7A 2JIRA 4MEBA 1X7WB 1ZXXA 3K2BA 1T9BA 4WFJA 3EY9A 5LNK6 3T0GA 2P75A 2VCEA 5DX0A 2M6RA 4HDKB 4ZVNA 3KDAA 3WMEA 4ENQA 3F6RA 4Z4HA 1M67A 3R7WA 1US8A 3ITNA 1AKNA 3HZOA 5HJEA 2FK8A 1AX9A 1HE5A 3L49A 1L3BA 4BQRA 1U7XA 2Z43A 3Q7IA 1E92A 5E1OA 2ZQZA 3W34A 3CNBA 3BD6A 3KWLA 4A0FA 5CJ2A 4K9LA 4UTVA 5L4LA 1DBSA 1Y3IA 1NW3A 2FSIA 1Q0TA 3FAKA 3MGBA 1E69A 5D51S 2WHPA 4X9XA 3ONFA 16PKA 3ONWA 1PSZA 1ULUA 3DPUA 3THOA 3UAOA 1IOVA 1AMOA 5HRUA 2HQ1A 3GLFE 4ZRDA 1NBHA 1XEWY 2ATIA 3EUEA 3U80A 4KRFA 3ZDFA 1YIAA 4XCVA 3ZS9A 3QTBA 4FHGA 5ICFA 1TVMA 3L4BA 2V6BA 3PFNA 3GZJA 1YR9A 2P3QA 3BCHA 4OQMA 5BQ5A 1GZ4A 1ZAKA 2GFQA 4FYHA 5J4VA 3I9V1 5LIPA 5B2ZA 1RC1A 2CZCA 4DLVA 1M1YB 3NDPA 4G37A 4MP3A 3SU8A 3GLKA 1JHQA 1KY4A 3FOWA 1DV1A 3JR7A 4JVSB 3WGQA 3UCFA 3TXYA 1EK6A 3FYUC 1DBQA 3FDJA 3HMQA 3N75A 4MWDA 3KELA 1QF9A 2HZ7A 4OHKA 3GFGA 3NANA 1R6AA 2YZMA 3BH0A 1MUUA 4N7RA 3BE8A 3T41A 4DCPA 1RKXA 3CB2A 1KORA 4GPTA 4Q05A 4D8TA 2J9GA 5E9WA 2C7QA 3OURA 3U62A 3OOEA 4GMKA 3PUJA 2WNSA 4R9SA 3ZD9A 4BB5A 5L4SA 4XXHA 2HJWA 3DTTA 4LOAA 3SR4A 3EUFA 5IEJA 5AVXA 1E5DA 4G89A 2HWUA 3LXXA 2X4DA 3DVAA 3OZ7A 4DCJA 3LGXA 2CHFA 5LXTB 1V8BA 2YFYA 2M9MA 4DCUA 5JBQA 1CRWG 2DQYA 4EF5A 2XRZA 1H5NA 4Q03A 3PUHA 1LSUA 2PLRA 5IKOA 3RW9A 2DMRA 5AXBA 1K9VF 2VHEA 3F73A 4P81A 1OFIA 1SG6A 5KKCA 2PGIA 1YC5A 3ZZUA 2FOLA 3DTVA 5EG5A 2ZAMA 4B8WA 2ZWOA 2W6ZA 3HXMA 3DAOA 1ORTA 1R5OA 3S81A 4I08A 4NMMA 2O5RA 2P3LA 2EKLA 1I7SB 3HXOA 1T4CB 1AK1A 2KBFA 2ZI5A 5D7NA 3ZZNA 4LF4B 1ZOLA 3H1TA 2O57A 4E5PA 2XADA 2HMUA 2UAGA 5E4TA 2XWPA 4DLAA 2POCA 2PWAA 1UBRS 3GLGB 3ZYZA 1LPAB 3T35A 2CLHB 1I7PA 5JY1A 4JGGA 3SF8B 3QLVA 3WGGA 5JTUA 1PZHA 2C54A 2J3JA 1EGQA 4B83A 4WX2B 2XCSB 3DMGA 2Q28A 4UOQA 1MXFA 1XRRA 3A0RB 3LHSA 4G1MB 4ENWA 1I94B 2CB9A 3LQQA 1OLXB 3OECA 3T5DA 1LBIA 3I5MA 2Q3LA 3JWIA 4PX9A 1MX3A 2E4UA 2KQUA 3EC2A 5EWMA 5DCUA 3OI7A 3WZMA 3TN7A 2JFBA 4NYMQ 4F4HA 421PA 4RA9B 4M89A 1LVGA 4JI4B 4NFLA 1ZD9A 4FFWA 3SHQA 4BVGA 2C3PA 4E0BA 4DRZA 2IBTA 3CNEA 1ISHA 1SMKA 2XBUA 5G0WA 3TOVA 3WDKA 4BNGA 1JH9A 4MDEA 5K0LA 4NFSA 2IHNA 4N40A 4HFRA 1LLDA 1Y9ZA 4IRUB 3SM3A 4IPTA 2ZRGA 3VR6D 3DVAB 1N8SA 1W4LA 3SHFA 1IMJA 1J2UA 2QAGB 4RQAA 1EUCA 1RCUA 5LLTA 1N0HA 2ZIZA 2CV0A 4MZDA 1CWUA 4I4TF 1SEVA 4I9NA 3WWPA 1Z2OX 3NWEA 3HV0A 3MUEA 3IVXA 4CMIA 5KTSA 1B74A 3KJIA 1PZGA 2AI3A 4MEJA 2H4XA 3ZXYA 4PNEA 3BQNB 4XASA 2CL6X 3H2SA 4ZOLA 2ZU0C 3NNDA 4ROSA 4N8SA 5K0EA 3ICWA 1G6KA 2QB5A 3ANMA 2EG9A 1E66A 3GLRA 2FZEA 4FGKA 5FX2A 1TLTA 2Q4EA 1CRZA 4O63O 3HJUA 3T1HB 3QUQA 2BE9A 1JAYA 2PD6A 2WMNB 1U2EA 5BWMA 3MRTA 2HQBA 5BWLA 3LYAA 2AZXA 5KKNB 2GPTA 4G4JA 4MQMA 1N6RA 3ETJA 4PYKA 1OWMA 1CUFA 5JVDF 1M6HA 2IEZA 1UK7A 4YN3A 5B57C 3EQ7A 1CUYA 4JJ8A 1X1EA 4S1PA 1SPXA 2KS6A 3A4MA 4DCTA 3DCNA 4YY3B 2ZE8A 3LUDA 4O25A 4IIEA 3O9VA 3Q9SA 1FRZA 4RJTA 4YCMA 4HDSA 4G0VA 5AI8A 2GPNA 3HSSA 4GD3Q 4IGAA 2DHRA 2BHTA 3ACBA 3ZD8A 4PWZA 4DWJA 1I14A 1H4QA 4QUGA 2R4QA 4B3FX 3CMCO 5AW4A 1JT2A 3LLVA 5GJCA 3RJ9A 2JLUA 4WADA 2WU8A 2OD2A 1CUIA 3V7NA 4CMJA 4MI6A 1OWNA 4KAJA 4TLMB 3HYRA 1E0JA 1KVRA 2PD4A 1TF2A 2J0UA 4FYIA 2I3GA 4LI0A 4M49A 1U3VA 2H4HA 1B3RA 3PVZA 4US1R 5F2KA 2YXLA 3TNLA 4MCIA 1NQXA 1XQYA 4GMHA 2QJTA 4KB5A 4ZI5A 5TNXA 1GL7A 3NDJA 4D3SA 1PJCA 4LISA 1NXTA 2ZTLA 1IZ7A 1GV1A 1Y1TA 4RVDA 4HQ0A 1A50B 1AGRA 2ZJ3A 3HH8A 3T9BA 2JLAA 3D8RA 5L3SB 4IGIA 1E2EA 1V95A 3BWBA 4EG0A 3IEMA 1Z73A 3PICA 3QV2A 4TZTA 4B8YA 1XSEA 2IYRA 4B6SA 1YRHA 4BP8A 1RFGE 3I30X 4R1MA 3O83A 3PWZA 4GLJA 2WU0A 2ZRHA 5CT6A 5F77A 5LR6A 2H1RA 5DP2A 3QUAA 3HYNA 1WQ3A 5CHYA 3F8WA 3V3TA 13PKA 2B98A 3R76A 1UKEA 1ODFA 3FDZB 2BKUA 3C1AA 2VOEA 3MD9A 3T3NA 3TMAA 3IEVA 2CV1A 2PM8A 3TB4A 1H2XA 1XNJA 3P5SA 4RK7A 4KFSA 1ZHOA 1XAIA 2I91A 1RZVA 2R9VA 4R9VA 2NSJA 4ZO6A 2ZBRA 4Y1GA 5FOXA 3MWYW 4KQIA 2N3ZA 3LPDA 3LY8A 4JHXA 1PVVA 3V9PA 3BWYA 5B36A 2A2ZA 2V3WA 4QUKA 4ZAYA 1UT8A 4LHYA 2OFWA 5E7IA 4RAOA 4I1OA 5I9LA 1OUMA 2X4IA 1ULHA 3QLUC 4HTAA 3SYRA 1L4MA 1T2FA 3FLAA 4XOIA 1PJZA 2IUSA 4DR7B 4FYPA 3EMKA 3WSTA 2QTWB 4HRVA 4H08A 1N75A 5JCOA 1UPCA 1NJ1A 2GBFA 3SDZA 4JIGA 3TM4A 3NHZA 3DZDA 2OQVA 2ZVQX 1PIWA 2NO5A 5J3JA 4G0UA 1HLDA 4YI5A 1YBVA 3Q8MA 721PA 1SCJA 2I0FA 5DHQA 2Y77A 3WA7A 4IDOA 1JBKA 2RG1A 1V41E 3E35A 4BHTA 3AUSA 1HZZC 2VSNA 3NZEA 3L0ZA 2FQYA 1XF9A 1KYWA 2CDRA 3PSAA 5AM1A 3VR2D 1KI8A 2HMSA 2Z2XA 4LQDA 4EHBA 1WAMA 4DDUA 3Q0TA 3V6LA 1JEAA 1M0TA 1TCVA 1XKLA 2DLDA 2YXDA 2WVHA 3FI0A 3MPOA 1QG0A 3KO8A 4JSYA 4I4CA 4KI0A 3AFGA 4N0DA 1JVBA 2YL2A 2VEDA 3RRXA 3IQDB 3HR7A 3O8DA 2EJBA 2BCGY 3V9AA 5A1JA 4OXKA 4L6AA 2I33A 1V3TA 2HGZA 1VLZA 3OKAA 4RH1A 3P8ZA 5TPWA 4Z4QA 2I7TA 4DVJA 3QW4B 4M1EA 2FEAA 2DPHA 4K9PA 1ZVVA 2HL6A 5D7BA 4WLUA 4Q48A 3UMMA 4WPGA 2PE5A 2ZAGA 2BFFA 4EB6B 4XQEA 1DQRA 3FTFA 2VYVD 5D2CA 1FFXB 1TUBA 3NT4A 5KQMA 1XXHE 5K0BA 1GPUA 4N0MA 4P4SA 4Z8XA 5TQ2B 4MITA 3GH1A 3RPEA 4RF2A 4NQRA 2EP5A 3SBEA 3K6SB 1CR2A 3HMKA 1TU0A 3QU9A 4N7BA 2B8JA 2P9CA 2UYGA 1R0KA 3E0QA 3M6WA 4WXMA 4EOGA 4TRRA 1Z6AA 1M6WA 1RXEA 4PQGA 1YDMA 3O9MA 3PJFA 4UBLA 4G07A 4M1KA 3FOCA 1HDIA 3JVEA 4JU9A 4DRXA 1P45A 3TEMA 4IHJB 2QL7A 2AW5A 4WNIA 3T9AA 3H7AA 2ACEA 4Q9DA 4KQFA 1IONA 4Q16A 3V42A 5TMPA 3EXG2 3QU7A 3AP1A 4E12A 1PKEA 2Z09A 2EWWA 3SQWA 4QUAA 2GFHA 2X6TA 4RACA 5CCDA 3ER9A 3NGXA 4Q6WA 4GGPA 3BRSA 1K06A 2OHOA 5DTIA 4CM3A 2QQFA 2BIFA 3Q15C 4IIVA 4J1NA 5FPPA 3KPWA 3UAVA 3EIFA 2XGGA 1DP4A 5TF0A 5B5SA 2Q3FA 2B1IA 4MUAA 2FSVA 4TLCA 3GPBA 4P0QB 2XVYA 2C00A 4YRSA 3HRIA 2PX4A 1EK1A 3B6IA 1KYZA 2OAQ1 1J2RA 4EJSA 3SOPA 2WBLC 2GWHA 3RFVA 3U3RA 2FPKA 3O4GA 2PSFA 4G4GA 4LC1A 1UFVA 5IABA 3N0VA 1CZKA 1L5GB 4M0LA 1DKRA 4FKMA 4LQ4A 3QEMA 3PVCA 2IYNA 3K0EA 5GADl 3VDRA 4E2WA 4HNTA 4ZGGA 4V1CA 4KGDA 2WWHA 1A9TA 1ANKA 2J6BA 3DT8A 4NBSA 1HE1C 3GJXC 4UHCA 2E2WA 1YBMA 1JIXA 1YQGA 2P6NA 1XTTA 3NHPA 1J90A 1YOBA 3KOUA 4WK6A 2QNRA 1POWA 1IY1A 1SGWA 2PJRA 3IT0A 4W8OA 4IHKA 4C7OA 2VUUA 2QIOA 3DCYA 1X9IA 4LZZA 1BCSB 5J5VA 1XDUA 3A11A 2W2OA 3G82C 3GA7A 4Q5IA 3IOYA 5TMDA 4GM4A 2PIDA 5EOVA 1DWUA 4C4XA 4U7GA 4GGOA 4AWXA 1KRWA 3IL2A 1ODIA 2MSKA 5MN6A 3IELA 2QOEA 4JX8A 5E7JA 1SOVA 3MA0A 1UL1X 3N76A 3MILA 3P2IA 3PWSA 4IRMA 1LVUA 5D3MA 5BN4B 2YC2C 4ND6A 2HFJA 2CN1A 2PV7A 4OYYA 4CIWA 3V4RA 1ZGJA 3ZE6A 2ADOA 2FJPA 3OG9A 1GITA 5FYQA 4F8YA 3HPQA 1DAMA 3VYSB 2XBLA 4W5WA 2Z56A 4DMFA 1JJFA 5BN3A 3DNFA 1P4JA 2GRAA 2ZITA 5LA6B 1R16A 3EUWA 1YZQA 1HNWB 3DBRA 4NJOA 5B2FA 3NV7A 4CM5A 1P9LA 4PAOA 1JH8A 5DGXA 1E63A 3ONNA 3M9LA 1NVWQ 4QOFA 2O20A 5EQTA 3DOCA 2A9QA 4E32A 2Z4SA 3ZLTA 1XTQA 1YGPA 3PNLA 2P90A 1GZ7A 5K8UA 1NUSA 3ZZMA 4IWXA 5BMVA 3EVBA 4CTKA 2PEYA 1Z13A 3DOIA 3HJGA 3IBGA 4DMCA 3TQIA 4JDUA 3DLTA 1U7UA 2BCEA 3F3SA 1R0SA 3SNHA 2IOQA 3L8MA 1M5UA 2QU8A 1WXEA 3CG4A 4FFNA 4MW5A 5H3CA 1UT5A 3IGFA 2CVQA 2V7UA 4NCBA 1VCOA 1B1AA 3EULA 3G49A 1AQIA 4ZQEA 2V54A 2XB9A 4BFVA 4YLEA 4RIEA 3A70A 4DCSA 2J5RA 4YPFA 3E4CA 2EEZA 2B25A 3NIGB 1P1IA 3PFKA 1XZCA 4F9GA 5B12A 1GPBA 1T2VA 3COPA 1XEWX 2FF7A 2W6ID 5D00A 1FPQA 2FWIA 2FOIA 3NH9A 1KWKA 4OAPA 4OGFA 4FUTA 2G5PA 4OQFA 2Q21A 4E09A 8ADHA 4IXDA 4EW3A 3H2BA 5FD8A 2WIJA 1EXWA 1IUOA 1II8B 1YOVA 2J7KA 3A27A 4KTVE 3OWHA 1XWIA 1YK1A 1TNDA 3OM9A 4IICA 5E4JA 3O9ZA 4IIXA 1DKMA 4BQFA 3FRJA 4XFKA 2WSYB 4A8JC 1OREA 4J6EA 4J7UA 4MMXB 4KPUA 2WY2D 2X5XA 3I3SR 5ALUA 4B3XA 1VI6A 3NUGA 1SXIA 3FNIA 4UBJA 3RT9A 2IH4A 4EI7A 1VKNA 1XV5A 1L6IA 4YH1A 3E3NA 3ILSA 2HRCA 4MV7A 2JIPA 3ANLA 4OL9A 5AUPB 6LDHA 3QM1A 5G1NA 1N5RA 1WB5A 3HDTA 3L3BA 2WF6A 5F4BA 4B3MB 4PIPA 2UZAA 2AQIA 4BMOB 1WXXA 3S1SA 1DWOA 2VDMB 3BMCA 3QF4B 4P86A 3WG9A 4Q3LA 2O8BB 4CKCB 1RHJA 3IE1A 1YR2A 4N12A 2QD4A 3RRFA 2P4SA 3E3MA 2WTUA 1RWBA 1YR6A 2WQZA 3N2IA 3UWKA 2DAPA 2WIGA 3QIAA 1SM4A 1TYBE 4FEYA 4YALA 5ALHA 1N0UA 4C0XA 4NU6A 1F1JA 3JV7A 2RI1A 1YWGO 4FSHA 3RRZA 3RVLA 4YAJA 1YONA 5B4UA 2GTHA 3ZEIA 4MQUA 1K8YB 2J5QA 4O4HA 1W94A 1ZLXA 2ORVA 1DBVO 3PNBA 4CG3A 1F8FA 2FZCA 5ICCA 5FUQA 4YUXA 1YB2A 3WLRA 3UMRA 2ZIXA 1FE8A 2H0RA 2TMGA 4PPQA 2GHQA 5E0KB 1OYVA 2FK7A 2R5NA 3SF0A 3VOTA 5JS6A 3GRPA 1B2LA 3KLOA 4B2LA 5BW4A 1Y4AE 3JQFC 4O08A 2FEKA 1NP3A 1B00A 3AF0A 1RLUA 4ZYUA 3A4VA 5AW3A 1TCAA 4ZC1A 3BA1A 2AK3A 2R79A 1HV8A 5FH9A 2M32A 2PGXA 1TK2A 5IDVA 3Q7EA 2IKQA 3D7LA 4BATA 4XQ9A 4NYJR 4PLZA 1Y6FA 2HHCA 3WWZA 2Z9CA 3OAAD 4DR3B 3AIKA 2DQSA 3KV1A 4DV7B 5BV0A 4GOOD 1YHNA 2AFHE 3EJ6A 3VR4A 2QRVA 2A1TS 3BL8A 4NZNA 1KQGA 1H2HA 1BD4A 1PWEA 1B73A 2AUNA 4R2JA 3PUWA 5CBPB 1T6NA 3SHVA 1T9AA 4OJQA 3YASA 3BSWA 4UBOA 4DNPA 4HK4A 4F04A 2J5KA 3FHOA 5FHRA 3W7AA 4LEIA 4JI7B 3UOAB 5BOVA 1VIMA 3DFUA 3MTJA 1PJ2A 4F3YA 4ZVRA 1KP3A 2FF5A 4QYSA 2XTAA 4XRGA 5HWSA 4NZOA 4D25A 4G3XA 1CUJA 5EKSA 4WXPA 2XJ9A 3GZNB 5MHTA 3FUVA 5FBRB 2PUAA 2IXFA 2IW3A 1LC0A 3D2BA 3KKOA 4JR1A 4LRSB 1Z38A 1XJQA 1XXHB 4RZ3A 1KZYC 5EKUA 3RTEA 2CEAA 2EBWA 3D0KA 3EASA 3JYOA 5ALSA 1FX0B 2IHUA 1GD1O 3KJFA 4IDDA 4XVRA 3VU8A 3H9JA 4IL5A 2O1SA 3SOZA 3WXMA 1KGSA 2EKQA 2PS3A 1REQB 2H2HA 2Q99A 3IRVA 2IBSA 3EVEA 3RRMA 5A3RA 2LDXA 1RWOA 3U1BA 3W8EA 4XSHA 2AVNA 2GUGA 5JJCA 4QUEA 1TCCA 3LUGA 4RKWA 2QR2A 4Y6SA 1KAQA 1T1EA 4OOEA 1N7IA 2C2ZA 3LSYA 5ETJA 9GPBA 1O08A 2NU9B 4BWYA 4UHJA 5JS1A 1DJOA 4BAUA 3TLAA 4NJMA 4BNFA 4BRWA 2XCRB 3EZXA 5DBEX 4L51A 3V46A 3NHWA 3BC1A 4YP7A 4RM3A 3ZH2A 1P80A 1GFSA 3KZXA 4YUVA 4BZPA 3AFNA 3L7IA 3RYHA 1GJRA 4DV0B 1OAOC 3K6JA 2QD2A 2FKAA 5BRJA 3D4BA 5CM8B 3ZCUA 1TJ4A 3QWAA 4QM7A 2YW2A 1ZRSA 3IAS1 4QHSA 1H4VB 4OLFA 2EC5A 3BE5A 1UZAA 3DJYA 1MA0A 3FTDA 1G0OA 5EZ6B 4QXRA 3UC5A 4CKWB 2HZBA 3U6KA 4OVKA 1A96A 1U28A 3DOEA 1CFZA 3T7RA 2Z6UA 3HNPA 1PQ4A 4MROA 5HR5A 5BUZA 1ZGCA 3BJMA 2FY8A 1Z25A 5L8VA 2VBFA 4I5FA 4TS3A 1XTBA 1N2ZA 2ZYDA 1BO6A 3L41A 5IMBA 2BF7A 1YNSA 4NCJA 4YJ2F 5B3JC 1ISRA 2O3JA 3LJKA 3E18A 1IOLA 1H6CA 3QA3E 1P60A 5DM1A 4DA9A 1B1CA 3UB4A 3ENQA 4CDNA 1KO5A 1G7CA 2HF2A 3LYHA 4RENA 2QMZA 4XQ0A 4W5OA 1EYZA 1IDOA 4R51A 1ZUNA 1PV1A 4TRNA 1BMFD 5EJ7A 4Q3BA 3K20A 3QF7A 1ZM4A 3KCQA 2A1TR 3RLIA 1P0MA 2Y2UA 2JIQA 2RGNA 4JVMA 5KYNA 2H1IA 2Q2QA 1T8RA 2TMDA 5KI6A 4AJ2A 5I48A 3A4NA 1Y7HA 3ELYA 4F3TA 4TRMA 4BVEA 2BMVA 2P4QA 4WCFC 1WW3A 4YC7A 4CDRA 5C1IA 1VQ1A 4HBGA 1OZAA 4NG5A 2GAOA 3DBOB 2I2DA 2I54A 3RYTC 5HJ2A 1P17A 3A6KA 4CJXA 1N1GA 4RSHA 3RF6A 4AZVA 1N77A 3NBFA 1LK0A 2JJ8A 2EG5A 4HDSB 3N2KB 5ESDA 4AQ7A 2O0MA 4FCWA 1XF1A 3P0FA 2B8NA 2PTGA 1TZCA 3LLMA 1ID8A 3MEQA 4JBYA 3KSRA 4L4XA 1ZNYA 5BVHA 3E15A 1Y7TA 4XEHA 4CL0A 3KSZO 4J07A 4UVDA 1NASA 4WOKA 2NYVA 4E30A 1P33A 4NECA 2NU8B 3FOAA 3SGLA 2E1PA 4PLCA 1R5NA 4HGNA 3P52A 1NAIA 2BFBA 4BBZA 1Z3CA 3E9ZA 1JDZA 4UTRA 2E3JA 5I8PA 5AKXA 4X54A 1J0XO 1SVNA 4CETA 4I99A 2JLXA 1N6LA 3VC2A 1QONA 1D2GA 5ALLA 5CXQA 4KLRA 4L9AA 4GL4A 1QUFA 2P2ZA 2XIJA 1IBLB 3FROA 1MD9A 1JUDA 4Q02A 1DCTA 1T4DA 4UXHA 4X7BA 1RTTA 2JFUA 3X1KA 1RI2A 3DAYA 1KAHA 2QVGA 3F49S 2IXTA 4RFLA 1IDN1 2C0QA 5LDHA 3GBSA 4G56A 1WQ4A 2R7LA 3SLRA 4C0JA 4IZOA 4JGBA 5A4FS 2FE4A 5M29A 1EFTA 1FFEA 1K6IA 3ZHUA 3CE9A 3UJ6A 1J0EA 1KJ9A 1Y6RA 3CYFA 3MYYA 4KLNA 3BRCA 1E9SA 3M49A 3UATA 1ONSA 3GDGA 1NDHA 2AG1A 1L5KA 2DWQA 3G8BA 3UJ9A 2GXAA 1DO8A 4MQ6A 1SHZA 1PUJA 7REQA 1J5EB 1FNNA 4KPGA 5LYJB 5H02A 3RAPR 4HVLA 1Z0ZA 4RA9A 1EIWA 4WA7A 3DVQX 1RQ7A 1KMNA 4YLYA 3JQBA 2WU3A 1O96A 4IO0A 5JNTA 4JITA 2AD5A 2IXDA 2C94A 1C0EA 1VXRA 2GO7A 2NN3C 4HAYA 3EG9B 2OKGA 2JJ2D 4ZVVA 2QLFA 1U5BB 2FU5C 4TSKA 3CXRA 4F5EA 2REBA 4KLZA 1MRSA 2BTQA 3C1UA 3T3EA 4ITRC 4HEQA 2I8CA 3V1TC 5JYEA 5EIAA 1YZGA 2YXBA 1T5OA 2Y76A 3ZWDA 3H17A 5I8WA 4G0NA 4G8DA 3A04A 1XO1A 2FPMA 1FVHA 1UPBA 1TW2A 3MTBA 4GEKA 4UZFA 1YJBA 4YJHA 3TL2A 3UUGA 5DSXA 3ZWAA 1MDFA 3EA0A 5B37A 2MCFA 3BSFA 1QC5B 3AINA 1C4KA 2X1HA 3I9FA 1DDIA 1OTXA 3H11A 4LVNA 4N6NA 5D6NA 1INLA 1ND5A 3BGDA 1E2MA 1LY1A 2C58A 3TRDA 3ZKWA 3AOEA 3EA4A 3UPUA 4IIGA 1BW9B 3FYCA 1GKLA 4NMWA 3BM5A 4KAAA 1SB9A 3GUUA 4UTXA 4ENRA 4LOKA 5CMLA 2IA5A 1VZ2A 4WGFA 4WESB 3BHMA 1H3FA 2PY6A 1KIMA 4HQLA 4BKRA 3FWYA 3GDFA 1WB4A 5EPUA 1R0ZA 1XXHA 2C95A 1QGYA 4IUBS 3ZV5A 1JIVA 3OCJA 2HNBA 5AO9A 4QTTB 3ZVLA 5AUNB 5IKMA 5B55A 1KOLA 3WIBA 1SCBA 2CJFA 1N33B 2H18A 4PGGA 1B8OA 1ZJ5A 2AJDA 1NJ2A 3I2YX 1DINA 3V4PB 1T2NA 1UJMA 3KCNA 4QQFA 3BIJA 1HGXA 1I10A 1PFVA 1ZNZA 1MB9A 4DXAA 1L4EA 4TT3A 3OC6A 4WY2A 1WVMA 3ILVA 4L4UA 5EN4A 4TZ0A 2H1OA 1KEZA 3HYTA 2ID7A 5IAAA 3G2JA 2O8CB 3B1JA 4PLPA 3NRBA 4B5LA 1YZLA 1GCGA 2QYTA 5B64A 3R3WA 2XY4A 4RHFA 3FYUA 3N2GA 4QT0A 4RD0A 2I8AA 3CLRC 4A10A 2Z5LA 1OILA 1Z26A 4BQQA 2VRBA 4EHAA 3IMKA 4MVJI 1OLXA 3AR5A 5FWDA 2A14A 3M7IA 1W36B 2VPTA 1OH5A 1O0CA 1UJNA 3PNPA 4B0PA 4UCXA 4AL4A 2YWEA 1YU9A 5BXYA 1KBZA 4MUMA 2DHCA 3IQWA 3X3HA 4OMFG 1W59A 4CMHA 5JJLA 4H3SA 2NLOA 2ZPTX 4NYIR 1DLIA 1HXHA 4AAYA 1A9SA 5THKA 4EY3A 5T6MA 2CXSA 4RD6A 4PQFA 2NO7A 4ARZB 2WWTA 3HVHA 3OHSX 2YHUA 2BUAA 2QTRA 1C9YA 2FFHA 3AHFA 3FCCA 4HB0A 2G08A 5G40A 2OD7A 4MV1A 2H1LA 3AFHA 1CDDA 2B1QA 3V7UA 2UUCB 3MXOA 3M6IA 4J75A 3EIQA 2QTTA 3OZWA 1KY3A 1UT6A 4KBGA 3K5HA 2R1TB 1Y5RA 1IB6A 4RNDB 3WQHA 1TJPB 4HSEA 1JKIA 2WYHA 1E2HA 1N5LA 2AMFA 1WTCA 4FMCF 1T6YA 4KXYA 4OA8A 4Q3EA 3SFTA 3GJZA 1KQ3A 1XCOA 2BL4A 1XQ6A 4R83A 2G8NA 1QX3A 2QY6A 5EESA 3D6UA 4R2XA 3FNFA 5BSVA 4L78A 3TX6A 1FLDA 5K0CA 2O2DA 1FBTA 4YPOA 3TSAA 1PS9A 1PFQA 1WB6A 1W48A 5LL6P 2YN0A 3IOCA 4HAWA 4E5MA 1KFKB 4XB2A 1EXDA 1GG5A 3AILA 3K9LA 4H0FA 2XTZA 2DQ4A 4UAUA 1X77A 3LCCA 2W37A 4LRYA 2HSJA 3K1ZA 4QVGA 3H97A 4ROTA 4UBKA 1WULS 2YN2A 1LTHR 3AYXB 4G63A 4A5SA 4N9WA 2HIMA 5JWRA 4DT1A 1UUFA 5DSZA 1M1NB 1U3DA 4OFBA 5E1BA 2PU5A 3VSCA 2CSUA 1QHSA 1CQPA 2X15A 2ZUSA 4KXUA 3ZY5A 2XV1A 3VI4B 2H31A 4MXDA 1NY5A 1O0SA 1H8HD 2X8BA 2Z30A 3BFVA 4CMAA 4ER5A 5K09A 4X71A 1G4UR 3SS9X 3NIBA 4Z7QB 1NKVA 1Q12A 3IURA 4EO9A 5KSWB 4L27A 3G7UA 5KC8A 3MCWA 2QP9X 4NJMB 4HUJA 1P7VA 2D1TA 1I24A 3NC1C 4UKDA 1GTZA 3TFOA 2DYKA 2V58A 3HO1A 1W6RA 1O6CA 3IMFA 4UJ3A 4CF4A 5HM6A 4F4JA 3ENNA 1UEIA 4AKGA 2P77A 5IF9A 5BYKA 3RIHA 1RP7A 3RQSA 2IS1A 3BFXA 4ZQCB 3OUTA 1UK6A 3V7FA 1XU7A 1G2PA 3RVBA 3FWZA 1ECBA 1G6Q1 4XSGA 1WD7A 2RI0A 3OP1A 2V0NA 3ZNPA 5CFNA 5JJBA 4D82A 1UQUA 2J3KA 4WI1A 3TH5A 1UMKA 3P4UA 5J1SB 1XZIA 2QX6A 4MVXA 2C7BA 4RSRA 3M33A 5JI3E 2NUAA 1ESZA 1XUOA 3M89A 2IHVA 4BGEA 2GM4A 4Y0AA 1DQZA 1G6OA 1NN1A 1DBPA 2GZSA 4X8LA 2HREA 3M6UA 4FFBB 4GRAA 4DG5A 4EA7A 2AE1A 3FOZA 2JD0A 3CZCA 4JIMA 3CEMA 2QQEA 2R3SA 4DMLA 4Q12A 4WCVA 4DLPA 4I8XA 4W1RA 5TS2A 1T43A 2L0XA 4F2HA 1GKUB 5BSEA 3FGZA 3H5TA 3PR2B 2O3UA 3DD5A 3UXEA 5H4HA 1RR6A 3GB9A 3FZYA 5D85A 1IBCA 2F48A 3HO6A 1FEZA 4L28A 4YPVA 1VJ5A 3HA5A 5CBPA 1XPRA 2VT2A 4LF8B 2PKWA 3DLHA 5EFZA 3WL5A 2UXBB 2P62A 3GWZA 4CM9A 1MAUA 3DTNA 4KTTE 2B3DA 3WL6A 3DR3A 3TQHA 2ZKIA 2G1UA 2AFIA 4M8SA 4O2AF 4PGFA 1I7DA 4GL2A 4CV0A 3NEAA 3EQ2A 4DMMA 4RHXA 1U5CA 1LU9A 3CO5A 4ARSA 4Q9IA 3I53A 4B32A 2RK3A 4H7KA 5I9TA 2AV6A 5K0TA 1MG0A 4JOBA 1GVHA 5ADUS 2CMFA 5ECYA 1Y8QA 1J1IA 2YCBA 2CVHA 1ZVJA 3MRSA 3N1UA 1EXMA 3Q7RA 4GSYA 4L5CA 3EXHB 4LW8A 2R66A 3F47A 1XHEA 2J9ZB 3H84A 3RS5A 3U7JA 2IU4A 2WABA 2OT3B 3C6XA 3JSXA 3MXTA 4YDRA 4DSAA 1A5TA 4B8ZA 2QI9F 3KJXA 4QT4A 2F9LA 3FTEA 1MN6A 3RM3A 2BGMA 1MC5A 5FA8A 3T99A 2QTVA 1QPGA 3OSUA 5F3DA 1DJNA 3OZEA 5HDQA 4NH4A 1HORA 2W90A 3KQMA 4QDUA 2B99A 3NYRA 4EEZA 1U0BB 1ADFA 2PZFA 4OH1A 3VNSA 2H51A 1EX7A 1A2KC 1S0UA 1GHTA 1PJAA 4MA5A 2FPGA 3DA8A 2CF5A 5EP1A 1E1NA 3NBMA 1BE1A 4PG6A 2RK6A 1AS0A 1PP4A 3E8XA 3K8YA 3T0FA 5G3ZA 3DKKA 4IXTA 5K4GA 3DPIA 4RE5A 4DC9A 3FCEA 4NOJA 2C7PA 1LXCA 1U0FA 1N36B 1ZHHA 4TRJA 3DHVA 1R0WA 1KJQA 4CLDA 2JD1A 5EE9A 3UW1A 3NKVA 4ZI7A 3L6RA 3HKBB 2X77A 2A57A 3ED5A 1OB2A 2Q1XA 3PV0A 4X41A 5A71A 1Y98A 4OUDB 2E55A 1X1RA 3QZUA 2CNBA 2YJ6A 5G41A 1W4AA 2ZE7A 1HC7A 3OPNA 2PUFA 3LH5A 4PYOA 2WMOB 4R2WA 3UNXA 3C6MA 1QV7A 3E6AA 1Z37A 4WY5A 2AOWA 4B1FA 4B3SB 1FP2A 3VO8A 1I33A 1X6VA 1YZYA 5HS6A 3LKBA 1DUSA 2GJ4A 1WXFA 3H1PA 2ZCVA 3E9EA 5K0ZA 3HYLA 5KWVA 5CR9A 5LA6F 4O4JA 3WWDA 4IF4A 3EZ6A 5BQOA 1KVSA 2VJAA 3RQIA 3RJZA 4M22A 4CKBB 4EF4A 2ZS9A 3B1FA 2VTKA 3L7MA 3OCWA 2C7GA 1VOTA 1HM5A 4J1QA 1C0KA 2JGEA 1TUIA 1JAXA 4HD8A 4QGGA 4BX9A 5BW8A 5FB3A 1P2FA 2C9YA 1FFSA 3OOJA 4TWJA 2N46A 4TYWA 1XGKA 1EVQA 2M2IA 1M7HA 1PD1A 4ZCQA 1F7UA 1D1PA 1DCFA 1ULAA 5DNAA 4YNBA 4INZA 4RTJA 2SKDA 1HQYE 4H59A 4RVGA 4V1CB 5E6SB 5JY6A 3GEMA 3ZC3A 4A6DA 4NJEA 3FBTA 1E59A 3FPCA 1BYIA 1V5GA 3NFYA 4PYLA 5ENDA 3R9IA 3SDSA 4DL9A 4JT8A 2AXNA 2HF7A 3FLEA 3U17A 3PX7A 4BCDA 2ONYA 3TDNA 2HU2A 1EGAA 1SCAA 3AGPA 3IB3A 4RFVA 4C7OB 2RH8A 3WK4A 3NH6A 1V1RA 3A8TA 4C7KA 1PT6A 3B2NA 1K6EA 1EJ2A 3LNCA 3WGMA 2IPOA 4DMKA 3CLTD 2ERYA 2GJAA 2FZGA 4B5KA 1YDGA 3IBCA 3OEHA 1Q0HA 4OHUA 1ZH2A 1ZFNA 4RTNA 1P6QA 3DMHA 4AKIA 3B3JA 3O74A 4NCXA 2ZBPA 3E1KA 2XT9A 4DR2B 1XTSA 3LZ6A 4JVOA 5AJWA 3MJHA 1AGNA 4V2IA 4IILA 2JCXA 4PSKA 3JVIA 4D9BA 2OV1A 4HDCA 3GCDA 3QBDA 3QFCA 4KAXA 5FPKA 5KVSA 2HJVA 2XDAA 3MIZA 5DPMA 1XAGA 2R6R1 4X66B 3OE1A 4HAXA 3VTFA 3CIOA 3CVVA 5SZJA 1DGQA 2VAWA 4XGIA 4QVKA 1XJ0A 2WJIA 4G65A 5C52B 1J39A 5JALA 4KDCA 3WDSA 2ACWA 1WHSB 3W9SA 4KWEA 5BO5A 5I7WA 1QH1B 1TEXA 1RJ9B 1N0IA 1XIVA 2J41A 1UFQA 4EPXA 3V8VA 2GD2A 2R751 1SVWA 2YIDA 3ESRA 3GEBA 3ILHA 3PXAA 3K9CA 4LQLA 2F1IA 1G59A 1UF9A 3C15C 1R2QA 3NATA 4LMBA 5CFLA 3FI9A 3QPDA 4ZREA 2VYVA 1QIGA 3HACA 3K2IA 3GQBB 1LBTA 3LKDA 2I66A