1O78A

Biotin carboxyl carrier domain of transcarboxylase (1.3s) [10-48] deletion mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
84
structure length
84
Chain Sequence
MKLKVTVNGAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIOTIN CARBOXYL CARRIER PROTEIN OF METHYLMALONYL-COA CARBOXY
publication title NMR Studies on the Solution Structure of a Deletion Mutant of the Transcarboxylase Biotin Carrier Subunit
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
molecule tags Carrier protein
total genus 6
structure length 84
sequence length 84
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2002-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1o78A00
1DCZA 3CRKC 1Y8PB 3MXUA 4G7OC 1O78A 1BDOA 1K8MA 1Y8OB 4H13C 2O5IC 1VF5C 1GHKA 1E2ZA 3SDZA 1Q90A 5C0XH 1OXSC 4KN4C 4OO1G 1PMRA 3VR3A 2L5TA 1OXXK 4GZYC 4G7ZC 1B9NA 1T5EA 4XTCS 1HQMC 5KNBA 3GD7A 2A68C 2BA1A 2KCCA 1TU2B 4JBWA 4LK1C 1GJXA 2R6GA 1LABA 1FR3A 3W3AA 3BDOA 3BG3A 3SE0A 3PV0A 2DNCA 1HTPA 2A6ED 2A6HD 3PUWA 3T53B 2LMCB 1OXUA 1E2VA 1GUOA 3I72A 5JEAH 4RCNA 3T56B 1G291 2B8FA 2CW0C 2K7VA 1ONLA 4DNRB 1VF7A 5K36H 3LNNA 1YNNC 2E75C 2YYZA 3PUXA 1ZYRC 1IW7D 5C0XG 1CFMA 3H94A 2A69C 4TKOB 4I7ZC 1OXTA 1H9JA 3MFYA 5KNDA 2E76C 1H9MA 1YNJC 1GUSA 1SMYC 3A7LA 4IFDG 1Q1BA 1VCIA 2NN6H 3QIAA 1GUNA 2DNEA 2D2CC 2PPBC 3OOCA 2PCFB 4H0LC 4LJZC 4DK0A 3DXJC 2BE5D 1Z6HA 3U9SA 3M4YA 3GQBA 2K32A 1DD2A 3A8JE 4KKUA 4PV1C 3RLFA 4DNTB 1H9SA 2IT1A 1GUTA 2EVBA 2AUKA 5BN4A 1LACA 1Q12A 4XIGS 3A8IE 1I6VC 1GUGA 2E74C 3FPPA 4OO1H 2K33A 3PUVA 3M7NA 2EDGA 1OXVA 3D4RA 2BA0A 1H9SB 1QJOA 3QJYA 3CRLC 5BN5A 1H9KA 2A68D 3VA7A 4G7HC 1B9MA 4KMUC 1HCZA 4TQUS 2O5JC 1GHJA 2JEAI 1CTMA 4BA1I 2EJFC 3VR6A 3KLRA 1ZKOA 2AWOA 3IFTA 3L7ZC 4H44C 1IYVA 1E2WA 4JK1C 2DN8A 5KNCA 2D62A 3D31A 3EQLC 1TKWB 1V43A 2A6EC 3A8KE 2D5DA 2A6HC 2ZT9C 2PNRC 3I73A 4KI0A 4L8JA 3WDNA 1K8OA 2B8GA 2JXMB 4IQZA 3I4LA 3N6RA 5JEAG 1CI3M 4KKSA 3T51B 2KA7A 2V4DA 3P20A 1O7LA 1Y69U 4DK1A 1HPCA 5A35A 2AUJD 4KHZA 5K36G 2A69D 3NE5B 2QF7A 4KN7C 3VR4A 1IW7C 4HR7B 3VR5A 1A6XA 1Q1EA 4IFDH 3LWUA 1DXMA 3ND9A 1FYCA 4BA2I 2F1MA 2NN6I 2BDOA 3OW7A 1VDZA 2JEBI 3M85A 2NN6G 1Y8NB 3HGBA 2JE6I 3PUYA 1Z7TA 3QG1A 5BN3A 3TZUA 3VR2A 3AB9A 2Q8IB 1EWHA 3OPOA 4KKTA 3FMCA 2BE5C 3IKJA 1IYUA 2EJGC 3A7AB 4OGQC 3PUZA 1H9RA 2EJMA 3ND8A 1V8QA
chains in the Genus database with same CATH superfamily
1SLJA 1YIJA 1DONA 2B63H 1OTCA 4FF4A 5LHY1 4X3KA 1K83B 2RQXA 3NTKA 5AFWA 5IGBA 2CVRA 4JVZA 4LFCQ 4A3EB 1K0RA 3CAMA 5EAYA 3I90A 3F2BA 2VS1A 2R7FA 1I50H 4DGZA 1AP0A 4NXNL 5HY6A 4KTAA 3BVZA 1K8GA 3E3XA 2F4VL 1TWHH 2K7VA 4PZ8A 3WWVA 2E75C 2EYPA 1SYEA 5TSSA 1IW7D 1L0YB 3GTMB 3D4DA 5IYCH 1HQRD 4B9XA 5I9PA 3CCJA 4HN7A 3QIAA 3PF4A 5JJIA 3DLLA 1EIHA 1BBWA 4LAAA 2JA7G 3M4YA 1KIXA 4JI6Q 2F0NA 5M5YB 3PQIA 3A8IE 4JYAL 1AW7A 3J80c 2AQ3B 2L11A 1STEA 4UPAA 3DHQA 5LL6X 1E1OA 2YTYA 3BVMA 1CTMA 1BR9A 2JEAI 3OW2A 2A74C 2CFMA 1D1IA 1ZKOA 1O7YA 5M3FH 3AFQA 5ELDA 4FO2A 3PIOA 3GP7A 4NB3A 1V43A 3L0OA 1Z9FA 4A3KH 3AU7A 1NE3A 1LT6D 1SYCA 3D4WA 1SJED 3KLSX 4EQ5A 4HJ7A 3N6RA 5C6AA 2OT2A 1SROA 2B2YC 1P16A 4JBKA 4O2DA 4DK1A 1D1KA 1N36L 1A2TA 1QUQB 1C48A 1EY5A 4Y52H 1ILQA 1DXMA 2I5LX 1UAPA 3I70A 1CQVA 2WP8J 3I4NH 3RLNA 3S1MH 4DV2L 3MHBA 5FLXL 2NN6G 2EYJA 1SJHD 5FJ8H 1O7ZA 4L5QA 4QGUA 5KRUA 1QNKA 5DAUA 1F2LA 3ND8A 2PNHA 4DR6Q 1D5MC 4M1UB 4H13C 2ZM6L 1Q90A 2HQLA 2L15A 3FKIB 2KCNA 3HOVB 4LK1C 4RKLA 4X66L 1PTOC 1EYCA 1PTOF 1Y1VG 2MJ8A 1LLRD 1SXTA 2Z1CA 1Q82C 2DJFC 4DA2A 4A3DH 4X62L 2NVYB 1R4PB 1E2VA 4XXEA 1EQVA 4CDDC 1UUPA 3GV6A 1PH4A 1ZEQX 3EVQA 5IGGA 4WFN3 2H4OA 2L55A 3NHHA 2PI2E 1YVCA 2EIFA 1SBBB 4EQNA 1X3EA 1CKNB 3KUPA 4KLKA 3HOUG 2PCFB 4JI7Q 3NENA 1EYDA 4FXGC 2JA5G 2EYLA 3M9BA 1JB3A 3PUVA 4LF5Q 1J8IA 1STYA 1HZAA 1TR5A 3OMGA 2HHHQ 5DM73 1PTOD 4J8QA 2M00A 4LFAQ 1U4LA 3QWNA 3S1RB 3GTMH 2I46A 1PRTC 1ESRA 4YY3Q 4DR1Q 2JJQA 2K5WA 1K3RA 3TMEA 1L1OA 2ZT9C 2UXCQ 4ID6A 3HKZE 3CCLA 1B8AA 5C3EG 2JSOA 3K58A 4EVOA 2RDFA 4KN7C 5IY0A 4C3JG 4GKJL 4PZ6A 2K04A 1KTKA 1RTOA 3PO3G 4HTHA 5D65A 4ZQ3A 1A8VA 1DGSA 1EFID 3HGBA 1E1TA 1Q7YC 1C8CA 4LFBL 1VQFA 3J81E 4KKTA 2BE5C 2Z4HA 3A56A 3RN5A 2PQAB 1PYWD 1CKMA 4FP5D 2F0EA 4KY6A 5EKLA 1KRTA 5C4XB 4LMQD 4DUZQ 1GO3E 1I94Q 2A1AA 3DWPA 1X56A 4RCOA 1S5FD 1TU2B 3KOJA 1IKMA 5GADC 2ZXPA 3GTOH 1VQ5A 1PRTD 3E0EA 3SR1A 3I4OA 4ME5A 4PZ7A 2ENBA 1B53A 4DU9A 1SE4A 3TDQA 2CHBD 4B3SL 5JVH3 4PQXA 4BY1H 3X3MA 1X3FA 1M1KC 1NBWA 2R7DA 3P7JA 5K36H 2N8NA 3K0XA 4X65L 3NWTA 4P74A 4TKOB 3DWAA 1MIUA 3T13A 2ZXRA 1MJEA 3JAMi 4AYBE 1HRJA 3ERSX 1U4PA 4JI4L 4QB4A 1RL2A 4DV1L 3VYRA 5CV6A 1WD1A 3GTKB 4IUPA 5C44B 2K05A 5LMUQ 2BE5D 2K01A 1F9RA 1KD1C 4C2MH 3HOVH 2UU9L 3H3VI 1HR0W 4K0KQ 5FK9C 3P1HA 5IP7H 4KJNA 1SE8A 1IBML 3F2CA 2IT1A 5CV9A 1Q12A 4TSSA 1SSOA 3FPPA 4ODGA 4HJ9A 1R9TH 2B2WC 3G7LA 5EKKA 1QCBD 2BA0A 4Q5VA 5BN5A 2NVXH 5IYCG 3J81i 2F0QA 2RCFA 4BY7G 1B3QA 2WB1E 5EQ0A 4P2CB 4A3BB 2CH4A 5KNCA 3PO2G 3STBC 2D62A 4ZYSA 2CCZA 2O2LD 1CI3M 4DAVA 4ALPA 3S1QB 2KA7A 2N88A 1Y69U 2KBNA 2F0MA 3D6WA 1EQRA 1WCMH 1TS3A 1HA6A 1EIFA 3RZOH 1XMOQ 1PH5A 1FYCA 2VQEL 3Q22A 1HR0L 1ZXTA 3HP3A 4J6HA 1VQIA 2AWNA 4DK6C 4IJLA 4HJ8A 1EY8A 1NCVA 3I91A 2JA9A 4DV7L 1VF5C 4EX5A 3SK4A 1G8ZD 1JOOA 4OIJA 2L5TA 3TREA 5C5MA 3FEWX 1KHIA 5LMNL 4GOPB 1DM0B 3CKIB 4A3GH 3CPFA 3S2HB 4CKBA 3STBD 4DAMA 4Y7NB 3MXNA 1PFSA 3E6ZX 4HSVA 3HOWB 2F0TA 1JMCA 5JPMC 3CW2C 4A3JH 2E2DC 3F8TA 5FO9B 1T5XD 4RGMA 4DV4L 5JJLA 2MUYA 3AFPA 2IY5B 3Q0AA 4BBRB 3TP5A 1HFGA 3X3NA 3BZKA 3W2DA 1X3PA 1RKNA 3KDFA 5KNDA 3HOXH 4A3LH 1U0LA 2CQAA 1MSHA 5FO8B 1TWGB 4JI0L 2PZUA 2F0OA 1F9SA 3EN2A 5CYUA 2LXJA 1Z6HA 1ASZA 2X69A 4DAYB 5JVG3 1P8LA 3O13A 4LUOA 5IP9H 3ICEA 4BXXH 1PTOH 1PVOA 4OO1H 1M4VA 5CBEE 4YCWA 1KNEA 4EQPA 1STGA 1HCZA 1SFOB 1VQ9A 1UE6A 1Y1WH 1YITA 4DAPA 1E0BA 4P73A 1H95A 2F0DA 2LS01 3RD4A 5JJZA 2D5DA 3MAQA 2F0SA 4I7AA 4PG3A 3H09A 4A3EG 2XWBB 5C44H 2YU9B 2RSNA 5I9OA 3NE5B 2QF7A 3Q6SA 3NQIA 5EPLA 3OTOL 2VY3A 2N78A 4FF3A 1NJIC 1SE3A 1D2BA 2JEBI 2X6LA 3IRBA 4C1NI 3QG1A 3MXPA 1EWHA 2KCTA 1G2TA 3IKJA 4IUUA 2B63B 2EJGC 3PUZA 3MXUA 3KF8B 3TP6A 3AQQA 4IZ8A 1BDOA 3TS2A 2XTIA 1I4HA 3GTLH 2EXZA 2EOTA 1QE6A 1L0WA 3CF5A 1I50B 1GJXA 3FDTA 4CHTB 1PV4A 3S1NH 3F2UA 2WAQE 4NDXA 4UHVA 2B29A 4A93G 1TWHB 1VQMA 3PIPA 1AN8A 1EYAA 4JOIC 1GUOA 4ZUIA 4HIKA 2SEBD 3I56A 5CV8A 3HKSA 2B8FA 2EZVA 1ONLA 4B9WA 3DM3A 4N9TA 2I07B 1ASYA 3WOFA 1WOCA 2RBMA 4WJWA 5C3WA 4DV0Q 1LV9A 1UE7A 3GV3A 1WVLA 1W3SA 2UUBL 4LF6L 3EFXD 1GD7A 1BKBA 1W6KA 4GNXA 4IUNA 1Q1BA 3CMEA 2WKDA 1JR0D 3OOCA 4JV5Q 1B4OA 2AQ1B 4KHPQ 4A3FH 4R4TA 3CU7A 4K5WA 1RJTA 3U9SA 5CR3A 1EY7A 4IPCA 2I0QA 2OCEA 3RLFA 3S2HH 4XQQA 3ERQA 2VXWA 1FNWA 3C1EA 3TN2A 3PGZA 5EKIA 4PMCA 5IODA 4JI8L 1YNXA 5M3FB 2VQFQ 1DYQA 5BR8Q 1EWCA 1SNQA 1UEBA 1IBKL 1O80A 4JC0A 1KLUD 3SK5A 4UDUC 2EJFC 4A3KB 1KAWA 3NBHB 2SOBA 2VB2X 2BH2A 3OWFA 4B3TL 3H15A 3QR8A 3EA6A 3FKIG 1VQ4A 3HOVG 2Z9HA 2LY7A 1NSNS 4P72A 3MZ5A 1IBLQ 4A75A 1I4RA 4OO1I 5E4XA 2O4XA 1XMQQ 4V0BA 4PMBA 2MQHA 4DXFA 2K6AA 5A2QL 3I4NB 1XYIA 4N8X1 3S24A 4KY5A 3ZYYX 3JAMc 3S1MB 1WTHA 2DUDA 2JN4A 3ND9A 4ZK9B 4QIWE 3RZDH 4F8MA 1QILA 3BU2A 4OHJA 4L5TA 4F88A 2K52A 3M4OB 1VQJA 4KD3A 1JWUD 1BOSA 3VR2A 4C1NK 2EJMA 1J9OA 2J0TD 5M5XH 1JJ2A 3HOZH 3CRKC 2FXQA 2EYHA 1RTNA 1V1PB 1O78A 3KF6B 1AH9A 2LXKA 4DKAC 1I4QA 4B3RQ 5GAHC 2NZOA 2NUCA 1OXSC 2E5LQ 2HT1A 4WRDA 3KJPA 2AQ2B 1HQMC 4A3DB 2L4NA 4FYDA 4LF5L 2YU9H 1QVFA 1B50A 3EBEA 3BG3A 1CK1A 4IPGA 3G71A 1DZ1A 2DY7A 1STHA 4RH6A 4LFAL 1LTID 5JEAH 1EY0A 4RCNA 4GLAC 2ZXOA 1CZGA 4DR1L 4GLVB 4HMJA 4RG1A 3OIQA 1C9OA 4HIDA 3H6MA 4DR4L 1H9JA 2KHSA 1Y14B 1TWAH 4RA8A 5FLXE 1XPRA 3S16B 3E9IA 1FGUA 4YIJA 3CQZH 4YHHQ 1HNWQ 1BCPC 1BCPF 1VQGA 1EQTA 4L5SA 4DNTB 3DMUA 2DY8A 2AUKA 2TSSA 2C5CA 1IL8A 1VQPA 4K2KA 2F0LA 3QJYA 3U50C 2VL6A 4OELB 3L2PA 2XSCA 1HTLD 4KMUC 5EPJA 3AYHB 4A3LG 5IOCA 1ESFA 4L6TB 4F7XA 1JJGA 2AWOA 1FVIA 4B3ML 2IPKD 2ATWA 5C4XG 1WTVA 4H7BA 3D31A 2ZTEA 1YHQA 4R8NA 2HQEA 3T1YL 1S72A 1HJPA 3I73A 1QWYA 1HZCA 2JXMB 4XYQA 3I4LA 4KHVA 3P20A 1AFPA 1X65A 1WTRA 2B39A 2H1EA 1ICWA 5E7NA 3A54A 3CCRA 2MFIA 3M3YH 2QILA 4N8FA 1BCPD 4X64Q 3C46A 4HIOA 2KJXA 5T1GA 1QB5D 3KBGA 2UUAL 5FLMH 2ZJQA 1FJGQ 2WINB 1VQ6A 1KDBA 5IYBH 1QUQA 1Y8PB 5IGFA 2UUCL 2Q2HA 2HDLA 4HEDA 4LWCA 2XWJB 4K0KL 3GTOB 4ZAIA 1PZKD 1WTPA 1LT5D 1LYLA 1MI2A 1B9NA 1F2YA 1T5EA 1HNZL 3MWYW 3IFDA 2RHQB 2Q2UA 1JWMD 3OSOA 1MJCA 4K5VA 4P75A 5FO7B 2E2IH 3AMUA 4BY1B 2B2UA 3SE0A 1XNQL 4DV3Q 1E24A 4K6DA 4UP7A 3D8GA 4X3UA 3J7ZC 3NTHA 3FP9A 2OTLA 4N9PA 1QVGA 3R93A 3ULPA 1BXTA 1L1OC 5FKAC 5ELCA 1ILPA 3U9OA 3M4OH 4A3BG 3FHWA 1ZYRC 1RD9D 3CP0A 2A69C 4NW2A 2XVSA 4CJ0B 1PH2A 5ELEA 2JA6H 4QUFA 2Z4IA 4C2MB 1NR4A 1TS4A 2MGSA 2WV6D 3A55A 3B6YA 2Y0SB 4H0LC 1S5ED 4DR3Q 2ZTCA 4J1MA 1E3PA 1VQ8A 2VW9A 4MNOA 1R9TB 2NVXB 1SNMA 3I55A 1IZ6A 4I65A 2OF1A 1I6VC 3CD6A 3BZCA 3U4VA 4R4IA 1STBA 1GOZA 3G6JB 1CKNA 3K8AA 3VA7A 2JA8H 1ET9A 4LF8L 3I4MH 1XJVA 4PNYA 4DR7L 4KK7A 3URYA 3M4QA 4H44C 1XWEA 3GTQH 4EQOA 2R92H 3CCVA 1WCMB 4L8JA 4YCUA 3OWEB 4R8IA 1TXYA 3S16H 1BO0A 2IWHA 3GTPB 3RZOB 1XTDA 2RSOA 4K6LA 4KKSA 3T51B 3CPWA 1G6PA 1ZYRD 3HOYB 2EY6A 3L9AX 5M9OA 3HOWG 4XT1B 2EYOA 4MZ9A 2A69D 5F2DA 2C9OA 3SK6A 3PF5A 1JQYD 3ONAB 2OTJA 4BA2I 4QQBX 5IYDH 3A5UA 4GKKL 4BBRG 3UDXA 2IX3A 3J7AF 4AQYQ 3PUYA 3K80C 1A3VA 4DNIA 2B2YA 4AH6A 4G7OC 3FVQA 2O5IC 2CH4W 1E2ZA 4ZKCB 5C0XH 4DV5Q 4LF9L 4A3GB 3G6EA 1S5CD 4OX9L 2UXBQ 2A68C 1JOQA 4GN4B 2RDHA 3W5OA 4A3JB 3MTSA 3C2PA 1DOKA 2K50A 3GTGH 2PO4A 2XN9C 1PYSB 4Z9CB 1FNUA 1D7QA 3DWQA 2PQAA 4C3IB 2XGTA 4NKLA 2K14A 2MO0A 3W1BA 3HOXB 3S14H 3J7A5 3PUXA 5M5WH 1F9PA 2F0WA 1JWSD 5J22A 4X3TA 1XXGA 1CHQD 4ABNA 5I2XA 2JYOA 3CCSA 1JICA 2F52A 5D14A 4POFA 3H0GB 4NXNQ 2TMPA 4R4OA 2K75A 3Q23A 2A5HA 3CC4A 1PTOB 4DK0A 1YZ6A 3A0JA 3KLSA 2JK8A 2K32A 1V1OA 3GDEA 1GUTA 1D5ZC 2EVBA 4MHEA 3KLWA 1SNOA 1TWCB 5DLQE 1SYGA 5I6YA 2B63G 1PZJD 4K14A 1Y1WB 2Z8LA 3TSSA 2A68D 4G7HC 2IX0A 2JA7B 1GHJA 5IT9c 4S3SA 1E2WA 1KQSA 1SMXA 1JE4A 1VMCA 4JYAQ 1MGSA 1NNXA 2K1BA 2A6HC 2EXDA 1K8OA 1J5EL 4IQZA 2R7ZB 2EYMA 1X32A 1LTGD 3V96A 1IHZA 1SNDA 5CV5A 2K03A 3SXHA 4IFDH 5M3MB 1TWFH 1X6OA 2GVAA 2E2JB 2L0CA 1X9NA 1MD2D 5I6WA 3Q24A 4JBMA 2G9HD 4A3CH 4C3HH 2LFNA 1PRTB 5DEHA 1PYBA 5LMNW 1Z47A 1N36Q 3K7UC 1IYUA 5JJKA 4KJOA 1HFNA 3GTLB 5EBDA 2H5XA 1Y8OB 1SDFA 4H02A 3VR3A 1JCKB 4RGOS 4DV2Q 3S1NB 1YJNA 3GTPH 5IGEA 5CV4A 1BNZA 1D6EC 3W1GA 3HOYH 3PSIA 4FXDA 2SNMA 2PMZE 1GUWA 5CMDA 4LF7Q 1KLGD 3J80E 5M3FG 1HNXL 1KABA 2C35B 5EBCA 2A6HD 2EE1A 2ZM6Q 1OXUA 2NVTH 1FGBD 4A3KG 4DNRB 1CZWA 1EU3A 1VQAA 3LNNA 5C0XI 3NK9A 4A3MH 3RNUA 4GOPA 4U673 1D8LA 2DJGC 1IBLL 1XPUA 3S9WA 4A3FB 2N55A 3R3OA 3DM1A 1VQEA 1QVCA 1VCIA 1A62A 2G9DA 1GUNA 4IUQA 2PYKA 4DR2L 3I4NG 1NAPA 3UDIA 5FJ8G 3D3RA 4FNFA 3A8JE 2PW5A 2E2HB 1VQ7A 3QO2A 3C3LA 4V190 1LACA 1N9WA 4JI1Q 1G2SA 1JB7A 2K33A 1IL2A 3D4RA 1DJRD 3HKZB 1F2MA 4C3IH 1CM9A 1B9MA 1FNVA 4WJ4A 4B3RL 4IPDA 1VQHA 2EY2A 1AE3A 2EPBA 3VR6A 2E5LL 1NUCA 4MIUA 2NB0A 4DAYA 2ID0A 4JI3L 4DV6Q 1WTQA 2KHIA 2QEJC 3UI2A 1RCVD 4GLXA 2A6EC 4A3DG 3H0GH 2B2WA 1KC8C 1RF2D 1WTWA 4K8IA 4YCVA 1XNRL 4G57A 3RZDB 1VQBA 1CA5A 3F1ZA 1B7YB 3VR4A 3V05A 2VUMB 1LTAD 4G4KA 1TWCH 3J7YW 3A5ZB 1A2UA 2KQ3A 2MPMA 3T4AC 4XT3B 4GNXC 2BDOA 3HOZB 5M5XB 1EEID 2N3SA 3M85A 2JA7H 5BN3A 3K81C 1Q86C 3J80L 4OGQC 4LFCL 3OYYA 2QKIC 1TIID 4GKJQ 1I6HH 1N32Q 5I2YA 2V1CC 5HURA 1TS5A 5IGCA 4YHHL 1HNWL 3EROA 3KYHC 2L9HA 1PMRA 1X3QA 2K5HA 1M90C 4IFDI 2R7ZH 4LFBQ 3S2DH 3LGJA 3CXCA 3J7AV 3PCOB 2R6GA 1FR3A 3BDOA 4AYBB 1SYBA 3PV0A 2ASBA 1HZ9A 2A6ED 3SK8A 4CKCA 5M3MH 1PHJA 2E2JH 3KF8A 3HFZB 2FINB 3K5MA 4K5XA 3T56B 2CW0C 5C0XJ 1VF7A 1EEFD 3TBIB 1KNAA 1L0XB 5A2QE 1TWAB 5C5LA 1WJJA 4JI6L 1IYJB 5C0XG 3H94A 1BUVT 3TEHB 4ZLTF 1NMFA 2J7ZA 3CQZB 2MP1A 3BDCA 5ELBA 1KRSA 3TS0A 2D0OA 2NN6H 3QB3A 2A8VA 2D2CC 4MTNA 5AJ3Q 2WB1B 1AZQA 3HG9A 3GQBA 2B3GA 1N33Q 3H91A 4CJ2C 2YTXA 5EGTA 5BN4A 2E74C 1TT2A 1RDPD 1FJGL 1UE1A 3K5LA 1LTRD 1JOKA 4RHRA 4TQUS 1SNCA 2HCCA 3VDYA 2UU9Q 3H3VC 4ULLA 1Y1VH 2SDFA 4FVMA 1IBMQ 3WOEA 1IYVA 1ENFA 2Z6KA 1SR3A 3QOJA 3CCUA 5KEEA 2ZJRA 1U5KA 3R8BA 4KI0A 4RGTA 3ULLA 2CW0D 4QMGA 4BY1G 4UAIA 3CC2A 3M3YB 2AUJD 2XRSD 5K36G 4JI2Q 2E2HH 3NBHA 3JC66 1S3OA 4OONA 4DR6L 5JAVA 1WFQA 2F3WA 3S15H 1PH8A 2K5QA 3NBIA 1NTGA 3D0FA 1GKHA 4YWMA 2AKWB 5C4ZA 4HAEA 2JA5H 1EU4A 5GAGC 1JE5A 1DCZA 5IP7G 3G4SA 2Y0SG 4UP8A 1B1ZA 1QZGA 1HR0Q 4IFDJ 4GZYC 3DEPA 3E9HA 2E2IB 1YBYA 5IWAQ 3GD7A 3RMHA 2Q8TA 3AEVA 3NP8A 4QY7A 4ZUJA 1KDAA 2VUMH 4DV7Q 3N52A 5CGKA 1JJCB 1BBUA 1V1PA 2LKVA 2QDBA 3KF6A 1UNSA 4QUCA 2MNAA 2EY5A 1HUNA 5C3EH 4JI7L 2JA6B 1EFWA 1I4GA 1YNNC 1CSPA 1UE5A 1N34Q 3J81c 1WCMG 3MFYA 1F77A 2E76C 2LSSA 3PO3H 4NXMQ 4LUVA 2K5VA 1Q46A 5E4WC 3HOYG 5C3XA 4LNQA 5D3IB 1PZID 4LJZC 1VQCA 2HHHL 2GVBA 3OIPA 5CBAE 4RAUC 4PV1C 1SEBD 2VNUD 2B2TA 5NUCA 2JA8B 1CT1D 4OIKA 4YY3L 3I4MB 2HIVA 4JI0Q 2UXCL 3GO5A 4POGA 4PMWA 2B2VA 4R1JA 3GTQB 2O5JC 4AIMA 4BA1I 2R92B 3DEOA 2R93B 4IOCA 2F0UA 4A3GG 4JK1C 5IE8A 4X3SA 5IIFA 2UXBL 3VYTA 3NTIA 2M2LA 2B2UC 2IX1A 1TKWB 2KHJA 4A4IA 4A3JG 1YNND 1O7LA 3RN2A 5A35A 1HPCA 2BCOA 2FMMA 5IT9L 2NYZD 1A3UA 4GS3A 4IOAA 4HR7B 3VR5A 3L3OC 2XRQD 4C3IG 1A6XA 2ICEC 3HOXG 4DN4M 4BBSB 4Q0FA 1EOVA 1NR2A 2K5NA 5ELNA 4DUZL 3ULJA 3F2DA 1I94L 4DUYQ 4HCSA 2WAQB 1BVSA 1ICFB 1CKOA 1H9RA 3H0GG 1Q81C 3OTOQ 1LTBD 2NBFA 5IP9G 2F0IA 4BXXG 4XYOA 3HS0C 3LX0A 4KN4C 4OO1G 3HZXA 4WJ3M 3GTGB 4DK3C 4JI5Q 4DFAA 3SGIA 2BA1A 3K59A 2F3IA 3M4PA 4BY7H 2XIWA 3PMFA 1HXYD 3PO2H 1Y1WG 4UP9A 2NTTA 3V2TA 3IL8A 3PUWA 2LMCB 3S14B 5M5WB 4LUZA 4E6IA 1G291 1YHBA 2M9VA 5LMUL 4HMIA 4C56C 1B3AA 5C44G 4FF1A 4A93B 3D6CA 3LWEA 2R7ZG 5CORA 1H9MA 1GUSA 1B70B 4BWGB 3T1HQ 2IJ0A 3ER0A 4WORA 2KENA 5KYIA 4R4QA 2F0KA 2OEOA 5J1ZA 3S17B 3K5NA 1DD2A 5M3MG 3J81j 5J3BA 1K8AC 2UUBQ 5GAEC 4LF6Q 3CCMA 1EY9A 1GUGA 4DR5Q 3NELA 3M7NA 1OXVA 3CRLC 1SNPA 2RA4A 2BOSA 1EIGA 3PIO3 2RDGA 1YJ9A 4CJ1B 4HJAA 4QIWB 2DN8A 2ZJPA 1XMOL 3MA2B 4JI8Q 1BCPB 1QG7A 4LF7L 2IL8A 4ZKBB 2HCIA 1YHAA 4IN3A 1IBKQ 2RVLA 3E0JA 3K0YA 3KFUA 1TWFB 1K28A 5E3FA 2F0VA 2L12A 1QZHA 5ELFA 4B3TQ 4BS9A 1G91A 1Q1EA 2F3VA 2EY1A 1ML0D 2RKSA 4C3HB 4LF4Q 2KECA 4UY8C 3K7AH 3RR5A 3NSWA 1TY0A 1EWIA 5KGUA 3CC7A 2KEDA 2Q8IB 2KCMA 1A15A 4A3FG 4A3IB 2R93H 3H3VH 2OQ0A 3HRZC 1K9MC 3CCQA 1JC7A 4OL7A 1V9PA 2CWAA 4QF4A 1QOHA 1I3QB 4QJFA 3SDZA 4X6AH 1EOTA 1OXXK 1VQNA 4CBVA 1WD0A 4HIMA 4XTCS 4JI1L 1A3TA 1PLFA 5KNBA 4U68A 1F2ZA 2KOLA 1TS2A 1X55A 2UXDQ 2CKZB 4OWWB 1K83H 2NVTB 4RHSA 5HGTA 3W3AA 3HKZG 1HUMA 3T16A 5EPKA 3T53B 4A3MB 1J6QA 4BBSH 5KIXA 1LT3D 4DV6L 4A3EH 3KK7A 2HDMA 5GQOA 2KEEA 1I4XA 1RIPA 1CFMA 4RMFA 1MBYA 3TQYA 1U9RA 1SMYC 4CDEC 2AMCB 3GTJB 1PRTF 2PPBC 1TY2A 2A19A 4DF7A 3JAME 2VUMG 1WI5A 4L63B 4DR4Q 4KKUA 4MN3A 3HOZG 1L1OB 1YEZA 3BYTB 3EJIA 5C4HA 1BQQT 1X54A 3UDFA 1QJOA 2FJ2A 1L2FA 4IURA 4O1NA 1N32L 5M5YH 1EIYB 2VB3X 4CKEA 2L1BA 1DOMA 4A93H 3IFTA 3L7ZC 4TRDA 2JQOA 2MO1A 2F4VQ 1LTSD 3EQLC 5JEAJ 3A8KE 2Z0SA 1PH7A 1BBXC 1PH1A 2B8GA 5JEAG 1K73C 4CDFC 1FD7D 1E7ZA 1PXUA 2V4DA 4GN5A 3NWSA 4AYBG 3S17H 4KHZA 2IW3A 2R61A 2BDNA 4GOPC 4B3MQ 1SMYD 3T1YQ 1EYGA 2FMCA 1VS0A 1WYDA 1I5FA 1IXRA 1VQLA 1C4QA 3OW7A 2CWPA 5FOBB 1I6HB 1LT4D 3G48A 2GA4B 4ZCKA 2OWOA 3AB9A 1PFNA 3SVMA 4YWKA 1SYDA 4EGVA 1V8QA 5AJ3L 3I8ZA 2I5MX 3S2DB 5K5PA 2WB1G 1N33L 2HUGA 1GXDC 1LTTD 4ILWA 1C7YA 1CHPD 3Q8DA 3NXWA 2E8GA 4JBWA 2ES2A 2UUAQ 3C1FA 4DV0L 1W6JA 1LABA 2ZTDA 1UEAB 3FKIH 2DNCA 2UUCQ 3R2TA 3BYYB 4OWTB 1WTOA 1CUKA 3JAML 3OHXC 3I72A 2KVMA 1HNZQ 4JV5L 4KHPL 3EIVA 1PA6A 2D0PA 2EYFA 1II3A 2NVYH 4A3IH 1GM5A 1SAPA 4I7ZC 1OXTA 2PI2A 2HD3A 1XNQQ 1S40A 1B44D 1YNJC 1C0AA 3DUZA 4XQNA 1I3QH 2ICIA 4JI2L 5ELOA 4M8AA 2AHOB 5LL6S 2VQFL 5BR8L 3VA5A 2F0PA 1BF4A 3J81L 5H1SE 3ZJYC 1S4ZA 1TQOA 2PZTA 2YV5A 1IKLA 3M7GA 5JOBA 5FLMG 1CQFA 3RLOA 2Q2TA 1ENAA 4IUTA 2BH8A 2OXPA 4XIGS 5C4JB 2RCNA 5IYBG 1KAAA 4JG2A 4RFBA 1Y1VB 1YJWA 4X66Q 1Q3LA 2IHFA 1H9KA 4J15A 2F0GA 5DNFA 1XMQL 1STNA 3CMAA 4JBJA 1VQKA 4X62Q 5IWAL 2PZWA 2DGYA 3OMCA 4HCEA 1PH9A 3KJOA 1CSQA 3FRPB 1MSGA 2PNRC 3GTJH 3S1RH 4NP5A 2GN5A 2JP1A 4LF8Q 2K5DA 3CHBD 2FFKB 5FLXc 1WTXA 3TRZA 3S15B 4DR7Q 3A74A 3I2ZA 1VMPA 4OWXB 3HOUB 3IAYA 3HEJA 1YNJD 1STAA 3LWUA 1G6ZA 1N34L 1SN8A 2JA6G 4CGYB 2JA5B 1F9QA 2F0FA 1ENCA 1A63A 4FF2A 4NXML 2WKCA 4RKBA 2JE6I 4YWLA 4IJHA 1OO9B 2QA4A 4A76A 2QDLA 1JT8A 3MXNB 3A7AB 3TZDA 2K4KA 3UDGA 1KDCA 3U58A 1CA6A 4XDXA 1K8MA 4HJ5A 4IO9A 4GKKQ 2QW7A 2RF4A 1EY6A 3K57A 4G7ZC 2NVQB 2YTVA 3J80i 2KCCA 3CCEA 2JA8G 1EZ6A 2F0HA 1HZBA 4TVAB 3KDFB 3I4MG 5C4XH 3VYUA 5C3EB 1HTPA 2Z6KC 5E1FA 3I7FA 4DPGA 1LM0A 4LF9Q 4C3JB 1Q8KA 2R92G 3MFGA 2R93G 1YI2A 4OX9Q 3K6OA 3PO3B 1AE2A 1FL0A 1PDQA 1M8AA 3R2IA 1SRUA 1EZ8A 3TP8A 3NEMA 1EQQA 2F0JA 4HSPA 3BVGA 3A7LA 2J4XA 5IYDG 3UE0A 2WACA 1LTLA 4P71A 2NZHA 1K3BC 1VQDA 4BBSG 3NQTA 5CV7A 3BDLA 3GTKH 1H9SA 2D9UA 2EQSA 2PQEA 5CC4A 4DUYL 5ISRA 3MEHA 2XNAC 5COYA 2WAQG 2EDGA 1H9SB 1PFBA 2R3ZA 5HGQA 3QOLA 4JCVE 5D3DA 4MTKA 2NZ1D 1B2TA 4RWSC 3KLRA 2IHEA 5G3LF 4B3SQ 4JI5L 1EY4A 4X65Q 3WDNA 1UWVA 2P5ZX 1QNUA 4A3BH 4NPSA 1RODA 3BZDB 4KY7A 2FHTA 3P75A 4X64L 5T1IA 2QCPX 1SE2A 3BJUA 4JI4Q 4DV1Q 3S1QH 1K0SA 3U4ZA 5C4JH 4JPBW 2CQOA 3ITPA 1J5EQ 4R4CA 3NPPA 2Z6BA 4QCLA 1Y8NB 3SHLA 1NMGA 2PMZB 3TP7A 3T1HL 4NMZA 1PH3A 3MVVA 3VYSA 1U4RA 1JORA 4DV3L 2B2TC 1U4MA 4BY7B 1GHKA 4RGNA 4F87A 3PO2B 1S5DD 5I4DA 2RHSB 5L37A 1AEXA 1S5BD 2NTSA 3FPUB 4DR5L 3PIP3 4XQJA 2B2VC 2A73B 4O42A 5G3LD 2QEXA 3BS1A 1V1QA 4APVA 4O0AA 3HOUH 4GNXB 4LW1A 1EUJA 2Q8RE 5JPNC 1LO5D 3MXGA 1PFMA 2I5HA 1I4PA 2HIXA 5J39A 4Y7NH 1G51A 1O7IA 3HOWH 5EJWA 1HHVA 1MKHA 5IT9E 4KV6A 4DR3L 3MC0B 2VQEQ 2YYZA 4ME3A 2NWGA 2K28A 1Q8IA 4GN3B 4CDCC 1EL0A 1VQOA 1HNXQ 2N49A 4OXPA 4R9WA 1W2BA 1HH2P 1SYFA 1T9HA 1KL9A 4BBRH 4IFDG 1LUZA 5IGDA 1XTCD 2DNEA 4IALA 3UE1A 2Q2IA 4FDBA 4L5RC 2NVQH 1NY4A 4LF4L 3DXJC 4A3CG 4OEMB 4C3HG 1TWGH 4B08A 2G5DA 2OQKA 3RUZA 2PW7A 2WFWA 2VZAA 1RHPA 4QL5A 2ALYB 4K2LA 5LMNQ 4ZRZA 4IPHA 4A3IG 4C3JH 1ET6A 4DR2Q 2X6GA 1E22A 1DOLA 5GROA 1MHWC 2Y0SE 1HA5A 1KXLA 3K5OA 4IUVA 3I3CA 1SFOH 4DV4Q 4JOIA 2UXDL 2WIIB 1XPOA 3MEFA 5DM63 1TVXA 5KYLA 4JW0A 4AQYL 3KBXA 1D5XC 2F4IA 3K7AB 1GVPA 4A3MG 1XX8A 1IW7C 4JI3Q 1N8RC 4KD4A 2F1MA 1PH6A 2SNSA 4DV5L 2NN6I 4DXGA 2KUMA 1VDZA 3SEBA 1AZPA 4K8JA 2MHVA 2QGQA 1Z7TA 3TZUA 2F03A 3OPOA 1A0IA 1R4QB 3FMCA 1XNRQ 4FXKC 1X3GA 3NUCA 3E5SA
chains in the Genus database with same CATH topology
1DONA 4FF4A 5LHY1 4X3KA 1K83B 2RQXA 3NTKA 5AFWA 5IGBA 2CVRA 4A3EB 3I90A 4DGZA 1AP0A 4KTAA 3BVZA 2K7VA 2E75C 2EYPA 1SYEA 5TSSA 1IW7D 1L0YB 3GTMB 3D4DA 1HQRD 4B9XA 5I9PA 4HN7A 3QIAA 1EIHA 4LAAA 3M4YA 2F0NA 5M5YB 3A8IE 1AW7A 2AQ3B 2L11A 1STEA 3DHQA 5LL6X 3BVMA 1CTMA 1BR9A 2JEAI 2A74C 1D1IA 1ZKOA 1O7YA 5ELDA 4FO2A 3GP7A 1V43A 3AU7A 1LT6D 1SYCA 3D4WA 1SJED 3KLSX 3N6RA 5C6AA 2OT2A 2B2YC 4DK1A 1D1KA 1A2TA 1C48A 1EY5A 1ILQA 1DXMA 1UAPA 3I70A 1CQVA 2WP8J 3MHBA 5FLXL 2NN6G 2EYJA 1SJHD 1O7ZA 5KRUA 1QNKA 5DAUA 1F2LA 3ND8A 1D5MC 4M1UB 4H13C 1Q90A 3FKIB 2KCNA 3HOVB 4LK1C 4RKLA 1PTOC 1EYCA 1PTOF 2Z1CA 2MJ8A 1LLRD 1SXTA 4DA2A 2NVYB 1R4PB 1E2VA 4XXEA 1EQVA 1UUPA 3GV6A 1ZEQX 3EVQA 5IGGA 4WFN3 2H4OA 2L55A 3NHHA 1SBBB 4EQNA 3KUPA 2PCFB 1EYDA 4FXGC 2EYLA 1JB3A 3PUVA 1J8IA 1STYA 1TR5A 3OMGA 5DM73 1PTOD 4J8QA 2M00A 1U4LA 3QWNA 3S1RB 2I46A 1PRTC 1ESRA 2K5WA 3TMEA 2ZT9C 4ID6A 2JSOA 3K58A 4EVOA 2RDFA 4KN7C 4C3JG 2K04A 1KTKA 1RTOA 4HTHA 5D65A 4ZQ3A 1EFID 3HGBA 1C8CA 3J81E 4KKTA 2BE5C 2Z4HA 3A56A 1PYWD 4FP5D 2F0EA 4KY6A 5EKLA 5C4XB 4LMQD 3DWPA 4RCOA 1S5FD 1TU2B 1IKMA 2ZXPA 1PRTD 3SR1A 4ME5A 2ENBA 4DU9A 1B53A 1SE4A 3TDQA 2CHBD 5JVH3 4PQXA 3X3MA 3P7JA 5K36H 3NWTA 4TKOB 3DWAA 3T13A 2ZXRA 1HRJA 1U4PA 4QB4A 1WD1A 3VYRA 5CV6A 3GTKB 4IUPA 5C44B 2K05A 2BE5D 2K01A 1F9RA 5FK9C 3P1HA 4KJNA 2IT1A 5CV9A 1Q12A 4TSSA 1SSOA 3FPPA 4ODGA 2B2WC 3G7LA 5EKKA 1QCBD 2BA0A 4Q5VA 5BN5A 2F0QA 5EQ0A 4P2CB 4A3BB 5KNCA 2D62A 4ZYSA 2O2LD 1CI3M 4DAVA 3S1QB 2KA7A 2N88A 1Y69U 3D6WA 2F0MA 1TS3A 1HA6A 1FYCA 3Q22A 1ZXTA 3HP3A 4J6HA 2AWNA 1EY8A 1NCVA 3I91A 1VF5C 3SK4A 1G8ZD 1JOOA 4OIJA 2L5TA 5C5MA 3FEWX 1DM0B 3CKIB 3S2HB 4CKBA 4Y7NB 3MXNA 3E6ZX 4HSVA 3HOWB 2F0TA 5JPMC 2E2DC 5FO9B 1T5XD 4RGMA 2MUYA 3Q0AA 4BBRB 3TP5A 1HFGA 3X3NA 3W2DA 1X3PA 1RKNA 5KNDA 2CQAA 1MSHA 5FO8B 1TWGB 2PZUA 2F0OA 1F9SA 5CYUA 1Z6HA 2X69A 5JVG3 3O13A 1PTOH 4OO1H 1M4VA 5CBEE 1KNEA 4EQPA 1STGA 1HCZA 1SFOB 4DAPA 1E0BA 2F0DA 2LS01 3RD4A 5JJZA 2D5DA 3MAQA 2F0SA 3H09A 2XWBB 2YU9B 2RSNA 5I9OA 3NE5B 2QF7A 3Q6SA 3NQIA 5EPLA 4FF3A 1SE3A 1D2BA 2JEBI 2X6LA 4C1NI 3QG1A 3MXPA 1EWHA 1G2TA 3IKJA 4IUUA 2B63B 2EJGC 3PUZA 3MXUA 3TP6A 4IZ8A 1BDOA 1I4HA 2EXZA 2EOTA 1QE6A 1I50B 1GJXA 3FDTA 4CHTB 3F2UA 4NDXA 1TWHB 1AN8A 1EYAA 1GUOA 4ZUIA 2SEBD 5CV8A 2B8FA 2EZVA 1ONLA 4B9WA 4N9TA 2I07B 3WOFA 2RBMA 4WJWA 5C3WA 1LV9A 3GV3A 1WVLA 3EFXD 1W6KA 4IUNA 1Q1BA 2WKDA 1JR0D 3OOCA 1B4OA 2AQ1B 3CU7A 4K5WA 1RJTA 3U9SA 5CR3A 1EY7A 3RLFA 4XQQA 3ERQA 2VXWA 1FNWA 3C1EA 3TN2A 5EKIA 4PMCA 5IODA 5M3FB 1DYQA 1EWCA 1SNQA 1O80A 1KLUD 3SK5A 4UDUC 2EJFC 4A3KB 2SOBA 2VB2X 3OWFA 3EA6A 2LY7A 1NSNS 3MZ5A 1I4RA 4OO1I 5E4XA 2O4XA 4V0BA 4PMBA 4DXFA 2K6AA 5A2QL 3I4NB 1XYIA 3S1MB 4KY5A 3ZYYX 3ND9A 4ZK9B 4F8MA 1QILA 4OHJA 4F88A 3M4OB 4KD3A 1JWUD 1BOSA 3VR2A 4C1NK 2EJMA 1J9OA 2J0TD 3CRKC 2EYHA 1RTNA 1V1PB 1O78A 1I4QA 2NUCA 1OXSC 4WRDA 2AQ2B 1HQMC 4A3DB 2L4NA 4FYDA 1B50A 3BG3A 1CK1A 1DZ1A 2DY7A 1STHA 4RH6A 1LTID 5JEAH 1EY0A 4RCNA 2ZXOA 1CZGA 4HMJA 3OIQA 3H6MA 1H9JA 2KHSA 4RA8A 5FLXE 3S16B 4YIJA 1BCPC 1BCPF 1EQTA 4DNTB 3DMUA 2DY8A 2AUKA 2TSSA 2C5CA 1IL8A 4K2KA 2F0LA 3QJYA 2XSCA 1HTLD 4KMUC 5EPJA 5IOCA 1ESFA 4L6TB 4F7XA 2AWOA 2IPKD 1WTVA 4H7BA 3D31A 4R8NA 2HQEA 3I73A 1QWYA 2JXMB 4XYQA 3I4LA 4KHVA 3P20A 1AFPA 1WTRA 2B39A 2H1EA 1ICWA 3A54A 2QILA 1BCPD 3C46A 2KJXA 5T1GA 1QB5D 3KBGA 2WINB 1KDBA 1Y8PB 5IGFA 2HDLA 4HEDA 2XWJB 3GTOB 4ZAIA 1PZKD 1WTPA 1LT5D 1MI2A 1B9NA 1F2YA 1T5EA 3MWYW 3IFDA 1JWMD 3OSOA 4K5VA 5FO7B 3AMUA 4BY1B 2B2UA 3SE0A 4K6DA 3D8GA 4X3UA 3NTHA 4N9PA 3R93A 1BXTA 5FKAC 5ELCA 1ILPA 3U9OA 1ZYRC 1RD9D 2A69C 4CJ0B 4NW2A 2XVSA 5ELEA 4QUFA 2Z4IA 4C2MB 1NR4A 1TS4A 2MGSA 2WV6D 3A55A 2Y0SB 4H0LC 1S5ED 4J1MA 1R9TB 2NVXB 1SNMA 4I65A 2OF1A 1I6VC 1STBA 1GOZA 3G6JB 3VA7A 1ET9A 4PNYA 4KK7A 3URYA 4H44C 1XWEA 4EQOA 1WCMB 4L8JA 3OWEB 4R8IA 1BO0A 2IWHA 3GTPB 3RZOB 4KKSA 3T51B 2RSOA 4K6LA 1ZYRD 3HOYB 2EY6A 3L9AX 5M9OA 4XT1B 2EYOA 2A69D 5F2DA 2C9OA 3SK6A 1JQYD 3ONAB 4BA2I 2IX3A 3J7AF 3PUYA 1A3VA 2B2YA 4G7OC 3FVQA 2O5IC 4A3GB 1E2ZA 4ZKCB 5C0XH 1S5CD 2A68C 1JOQA 2RDHA 4A3JB 3MTSA 3C2PA 1DOKA 2PO4A 2XN9C 4Z9CB 1FNUA 3DWQA 4C3IB 4NKLA 3HOXB 3PUXA 1F9PA 2F0WA 1JWSD 5J22A 4X3TA 1XXGA 1CHQD 4ABNA 5I2XA 2JYOA 1JICA 5D14A 3H0GB 2TMPA 3Q23A 2A5HA 1PTOB 4DK0A 3KLSA 2K32A 1V1OA 1GUTA 1D5ZC 2EVBA 4MHEA 1SNOA 1TWCB 1SYGA 5I6YA 1PZJD 4K14A 1Y1WB 2Z8LA 3TSSA 2A68D 4G7HC 2IX0A 2JA7B 1GHJA 4S3SA 1E2WA 1JE4A 1VMCA 1MGSA 2K1BA 2A6HC 1K8OA 4IQZA 2R7ZB 2EYMA 1X32A 1LTGD 3V96A 1IHZA 1SNDA 5CV5A 2K03A 3SXHA 4IFDH 5M3MB 2E2JB 2L0CA 1MD2D 5I6WA 3Q24A 2G9HD 2LFNA 1PRTB 5DEHA 1Z47A 1IYUA 4KJOA 1HFNA 3GTLB 5EBDA 1Y8OB 1SDFA 3VR3A 1JCKB 4RGOS 3S1NB 5IGEA 5CV4A 1BNZA 1D6EC 4FXDA 2SNMA 1GUWA 5CMDA 1KLGD 3J80E 1KABA 5EBCA 2A6HD 2EE1A 1OXUA 1FGBD 4DNRB 1CZWA 1EU3A 3LNNA 5C0XI 3NK9A 4U673 3S9WA 4A3FB 2N55A 3R3OA 3DM1A 1VCIA 4IUQA 2G9DA 1GUNA 2PYKA 1NAPA 3D3RA 4FNFA 3A8JE 2PW5A 2E2HB 3QO2A 3C3LA 4V190 1LACA 1G2SA 2K33A 3D4RA 1DJRD 3HKZB 1F2MA 1CM9A 1B9MA 1FNVA 2EY2A 2EPBA 3VR6A 1NUCA 4MIUA 2NB0A 4DAYA 2ID0A 1WTQA 2QEJC 3UI2A 1RCVD 2A6EC 2B2WA 1RF2D 1WTWA 4K8IA 4G57A 3RZDB 1CA5A 3VR4A 3V05A 2VUMB 1LTAD 4G4KA 3J7YW 1A2UA 2KQ3A 2MPMA 3T4AC 4XT3B 2BDOA 3HOZB 5M5XB 1EEID 3M85A 5BN3A 3J80L 4OGQC 2QKIC 1TIID 5I2YA 5HURA 1TS5A 5IGCA 3EROA 2L9HA 1PMRA 1X3QA 4IFDI 3J7AV 2R6GA 1FR3A 3BDOA 4AYBB 1SYBA 3PV0A 2A6ED 3SK8A 4CKCA 3KF8A 2FINB 3K5MA 4K5XA 3T56B 2CW0C 5C0XJ 1VF7A 1EEFD 3TBIB 1KNAA 1L0XB 5A2QE 1TWAB 5C5LA 5C0XG 3H94A 1BUVT 4ZLTF 2J7ZA 3CQZB 2MP1A 3BDCA 5ELBA 2NN6H 3QB3A 2D2CC 2WB1B 1AZQA 3HG9A 3GQBA 3H91A 4CJ2C 5EGTA 5BN4A 2E74C 1TT2A 1RDPD 3K5LA 1LTRD 1JOKA 4RHRA 4TQUS 1SNCA 2HCCA 3H3VC 4ULLA 2SDFA 4FVMA 3WOEA 1IYVA 1ENFA 3QOJA 5KEEA 3R8BA 4KI0A 4RGTA 2CW0D 4QMGA 4UAIA 3M3YB 2AUJD 2XRSD 5K36G 3NBHA 5JAVA 2F3WA 2K5QA 3NBIA 5C4ZA 4HAEA 1EU4A 1DCZA 1B1ZA 4IFDJ 4GZYC 3DEPA 2E2IB 3GD7A 3RMHA 2Q8TA 3NP8A 4ZUJA 1KDAA 3N52A 5CGKA 2LKVA 1V1PA 2QDBA 1UNSA 4QUCA 2EY5A 1HUNA 2JA6B 1I4GA 1YNNC 3MFYA 1F77A 2E76C 5E4WC 5C3XA 5D3IB 1PZID 4LJZC 3OIPA 5CBAE 4RAUC 4PV1C 1SEBD 2VNUD 2B2TA 5NUCA 2JA8B 1CT1D 4OIKA 3I4MB 3GO5A 4PMWA 2B2VA 3GTQB 2O5JC 4BA1I 2R92B 3DEOA 2R93B 2F0UA 4JK1C 4X3SA 5IIFA 3VYTA 3NTIA 2M2LA 2B2UC 2IX1A 1TKWB 1YNND 1O7LA 5A35A 1HPCA 2BCOA 2FMMA 5IT9L 2NYZD 1A3UA 4HR7B 3VR5A 3L3OC 2XRQD 4C3IG 1A6XA 2ICEC 4DN4M 4BBSB 4Q0FA 1NR2A 4HCSA 2WAQB 1H9RA 1LTBD 2NBFA 2F0IA 4XYOA 3HS0C 3LX0A 4KN4C 4OO1G 3HZXA 3GTGB 4DFAA 2BA1A 3K59A 2XIWA 3PMFA 1HXYD 2NTTA 3V2TA 3IL8A 3PUWA 2LMCB 3S14B 5M5WB 4E6IA 1G291 2M9VA 4HMIA 4C56C 1B3AA 4FF1A 4A93B 3D6CA 3LWEA 5CORA 1H9MA 1GUSA 4BWGB 2IJ0A 4WORA 5KYIA 2F0KA 2OEOA 5J1ZA 3S17B 3K5NA 1DD2A 1EY9A 1GUGA 3M7NA 1OXVA 3CRLC 1SNPA 2RA4A 2BOSA 1EIGA 3PIO3 2RDGA 4CJ1B 4QIWB 2DN8A 3MA2B 1BCPB 1QG7A 2IL8A 4ZKBB 2HCIA 4IN3A 2RVLA 3E0JA 3K0YA 1TWFB 5E3FA 2F0VA 2L12A 5ELFA 4BS9A 1G91A 1Q1EA 2F3VA 2EY1A 1ML0D 2RKSA 4C3HB 2KECA 3NSWA 1TY0A 5KGUA 2KEDA 2Q8IB 1A15A 4A3IB 3HRZC 1JC7A 4OL7A 4QF4A 1QOHA 1I3QB 3SDZA 1EOTA 1OXXK 4CBVA 1WD0A 4XTCS 5KNBA 1A3TA 1PLFA 4U68A 1F2ZA 2KOLA 1TS2A 2NVTB 4RHSA 5HGTA 3W3AA 1HUMA 3T16A 5EPKA 3T53B 4A3MB 5KIXA 1LT3D 3KK7A 2HDMA 2KEEA 1I4XA 1CFMA 1MBYA 1U9RA 1SMYC 3GTJB 1PRTF 2PPBC 1TY2A 4DF7A 3JAME 4L63B 4KKUA 4MN3A 3BYTB 3EJIA 5C4HA 1BQQT 1QJOA 2FJ2A 4IURA 4O1NA 2VB3X 4CKEA 2L1BA 1DOMA 3IFTA 3L7ZC 4TRDA 1LTSD 3EQLC 5JEAJ 3A8KE 1BBXC 2B8GA 5JEAG 1FD7D 2V4DA 1PXUA 3NWSA 4KHZA 2IW3A 2R61A 2BDNA 1SMYD 2FMCA 1C4QA 3OW7A 5FOBB 1I6HB 1LT4D 2GA4B 3AB9A 1PFNA 3SVMA 1SYDA 4EGVA 1V8QA 3I8ZA 3S2DB 5K5PA 2HUGA 1GXDC 1LTTD 4ILWA 1CHPD 3NXWA 4JBWA 3C1FA 1W6JA 1LABA 1UEAB 2DNCA 3R2TA 3BYYB 1WTOA 3JAML 3OHXC 3I72A 2KVMA 2EYFA 1II3A 1SAPA 4I7ZC 1OXTA 1B44D 1YNJC 3DUZA 4XQNA 2ICIA 4M8AA 5LL6S 3VA5A 2F0PA 1BF4A 3J81L 1S4ZA 1TQOA 2PZTA 3M7GA 1IKLA 5JOBA 1CQFA 1ENAA 4IUTA 2OXPA 4XIGS 5C4JB 1KAAA 4RFBA 1Y1VB 1Q3LA 1H9KA 2F0GA 5DNFA 1STNA 2PZWA 3OMCA 4HCEA 3FRPB 1MSGA 2PNRC 4NP5A 2JP1A 2K5DA 3CHBD 2FFKB 1WTXA 3S15B 1VMPA 3HOUB 3IAYA 3HEJA 1YNJD 1STAA 3LWUA 1G6ZA 4CGYB 2JA5B 1F9QA 2F0FA 1ENCA 4FF2A 2WKCA 4RKBA 2JE6I 1OO9B 3A7AB 3TZDA 1KDCA 1CA6A 4XDXA 1K8MA 1EY6A 3K57A 4G7ZC 2NVQB 2KCCA 1EZ6A 2F0HA 3VYUA 5C3EB 1HTPA 5E1FA 4C3JB 3MFGA 3K6OA 3PO3B 1PDQA 1M8AA 3R2IA 1EZ8A 3TP8A 2F0JA 4HSPA 3BVGA 3A7LA 2J4XA 2WACA 3NQTA 5CV7A 3BDLA 1H9SA 2D9UA 2PQEA 5CC4A 5ISRA 3MEHA 2XNAC 5COYA 2EDGA 1H9SB 1PFBA 2R3ZA 3QOLA 5D3DA 2NZ1D 1B2TA 4RWSC 3KLRA 5G3LF 1EY4A 3WDNA 1QNUA 1RODA 3BZDB 4KY7A 2FHTA 3P75A 5T1IA 2QCPX 1SE2A 3ITPA 3NPPA 4QCLA 1Y8NB 3SHLA 2PMZB 3TP7A 4NMZA 3MVVA 3VYSA 1U4RA 1JORA 2B2TC 1U4MA 4BY7B 1GHKA 4RGNA 4F87A 3PO2B 1S5DD 5I4DA 1AEXA 1S5BD 2NTSA 3FPUB 3PIP3 4XQJA 2B2VC 2A73B 4O42A 5G3LD 3BS1A 2Q8RE 5JPNC 1LO5D 3MXGA 1PFMA 1I4PA 5J39A 5EJWA 1HHVA 5IT9E 4KV6A 3MC0B 2YYZA 2NWGA 2K28A 1Q8IA 1EL0A 4R9WA 1SYFA 4IFDG 5IGDA 1XTCD 2DNEA 4IALA 3DXJC 4C3HG 4B08A 3RUZA 2PW7A 1RHPA 4K2LA 4ZRZA 1ET6A 2X6GA 1DOLA 1HA5A 3K5OA 4IUVA 3I3CA 2WIIB 5DM63 1TVXA 5KYLA 3KBXA 1D5XC 2F4IA 3K7AB 1XX8A 1IW7C 4KD4A 2F1MA 2SNSA 2NN6I 4DXGA 2KUMA 1VDZA 3SEBA 1AZPA 4K8JA 2MHVA 1Z7TA 3TZUA 2F03A 3OPOA 1R4QB 3FMCA 4FXKC 3NUCA 3E5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCZ A;  3CRK C;  1Y8P B;  3MXU A;  4G7O C;  1O78 A;  1BDO A;  1K8M A;  1Y8O B;  4H13 C;  2O5I C;  1VF5 C;  1GHK A;  1E2Z A;  3SDZ A;  1Q90 A;  5C0X H;  1OXS C;  4KN4 C;  4OO1 G;  1PMR A;  3VR3 A;  2L5T A;  1OXX K;  4GZY C;  4G7Z C;  1B9N A;  1T5E A;  4XTC S;  1HQM C;  5KNB A;  3GD7 A;  2A68 C;  2BA1 A;  2KCC A;  1TU2 B;  4JBW A;  4LK1 C;  1GJX A;  2R6G A;  1LAB A;  1FR3 A;  3W3A A;  3BDO A;  3BG3 A;  3SE0 A;  3PV0 A;  2DNC A;  1HTP A;  2A6E D;  2A6H D;  3PUW A;  3T53 B;  2LMC B;  1OXU A;  1E2V A;  1GUO A;  3I72 A;  5JEA H;  4RCN A;  3T56 B;  1G29 1;  2B8F A;  2CW0 C;  2K7V A;  1ONL A;  4DNR B;  1VF7 A;  5K36 H;  3LNN A;  1YNN C;  2E75 C;  2YYZ A;  3PUX A;  1ZYR C;  1IW7 D;  5C0X G;  1CFM A;  3H94 A;  2A69 C;  4TKO B;  4I7Z C;  1OXT A;  1H9J A;  3MFY A;  5KND A;  2E76 C;  1H9M A;  1YNJ C;  1GUS A;  1SMY C;  3A7L A;  4IFD G;  1Q1B A;  1VCI A;  2NN6 H;  3QIA A;  1GUN A;  2DNE A;  2D2C C;  2PPB C;  3OOC A;  2PCF B;  4H0L C;  4LJZ C;  4DK0 A;  3DXJ C;  2BE5 D;  1Z6H A;  3U9S A;  3M4Y A;  3GQB A;  2K32 A;  1DD2 A;  3A8J E;  4KKU A;  4PV1 C;  3RLF A;  4DNT B;  1H9S A;  2IT1 A;  1GUT A;  2EVB A;  2AUK A;  5BN4 A;  1LAC A;  1Q12 A;  4XIG S;  3A8I E;  1I6V C;  1GUG A;  2E74 C;  3FPP A;  4OO1 H;  2K33 A;  3PUV A;  3M7N A;  2EDG A;  1OXV A;  3D4R A;  2BA0 A;  1H9S B;  1QJO A;  3QJY A;  3CRL C;  5BN5 A;  1H9K A;  2A68 D;  3VA7 A;  4G7H C;  1B9M A;  4KMU C;  1HCZ A;  4TQU S;  2O5J C;  1GHJ A;  2JEA I;  1CTM A;  4BA1 I;  2EJF C;  3VR6 A;  3KLR A;  1ZKO A;  2AWO A;  3IFT A;  3L7Z C;  4H44 C;  1IYV A;  1E2W A;  4JK1 C;  2DN8 A;  5KNC A;  2D62 A;  3D31 A;  3EQL C;  1TKW B;  1V43 A;  2A6E C;  3A8K E;  2D5D A;  2A6H C;  2ZT9 C;  2PNR C;  3I73 A;  4KI0 A;  4L8J A;  3WDN A;  1K8O A;  2B8G A;  2JXM B;  4IQZ A;  3I4L A;  3N6R A;  5JEA G;  1CI3 M;  4KKS A;  3T51 B;  2KA7 A;  2V4D A;  3P20 A;  1O7L A;  1Y69 U;  4DK1 A;  1HPC A;  5A35 A;  2AUJ D;  4KHZ A;  5K36 G;  2A69 D;  3NE5 B;  2QF7 A;  4KN7 C;  3VR4 A;  1IW7 C;  4HR7 B;  3VR5 A;  1A6X A;  1Q1E A;  4IFD H;  3LWU A;  1DXM A;  3ND9 A;  1FYC A;  4BA2 I;  2F1M A;  2NN6 I;  2BDO A;  3OW7 A;  1VDZ A;  2JEB I;  3M85 A;  2NN6 G;  1Y8N B;  3HGB A;  2JE6 I;  3PUY A;  1Z7T A;  3QG1 A;  5BN3 A;  3TZU A;  3VR2 A;  3AB9 A;  2Q8I B;  1EWH A;  3OPO A;  4KKT A;  3FMC A;  2BE5 C;  3IKJ A;  1IYU A;  2EJG C;  3A7A B;  4OGQ C;  3PUZ A;  1H9R A;  2EJM A;  3ND8 A;  1V8Q A; 
#chains in the Genus database with same CATH topology
 1SLJ A;  1YIJ A;  1DON A;  2B63 H;  1OTC A;  4FF4 A;  5LHY 1;  4X3K A;  1K83 B;  2RQX A;  3NTK A;  5AFW A;  5IGB A;  2CVR A;  4JVZ A;  4LFC Q;  4A3E B;  1K0R A;  3CAM A;  5EAY A;  3I90 A;  3F2B A;  2VS1 A;  2R7F A;  1I50 H;  4DGZ A;  1AP0 A;  4NXN L;  5HY6 A;  4KTA A;  3BVZ A;  1K8G A;  3E3X A;  2F4V L;  1TWH H;  2K7V A;  4PZ8 A;  3WWV A;  2E75 C;  2EYP A;  1SYE A;  5TSS A;  1IW7 D;  1L0Y B;  3GTM B;  3D4D A;  5IYC H;  1HQR D;  4B9X A;  5I9P A;  3CCJ A;  4HN7 A;  3QIA A;  3PF4 A;  5JJI A;  3DLL A;  1EIH A;  1BBW A;  4LAA A;  2JA7 G;  3M4Y A;  1KIX A;  4JI6 Q;  2F0N A;  5M5Y B;  3PQI A;  3A8I E;  4JYA L;  1AW7 A;  3J80 c;  2AQ3 B;  2L11 A;  1STE A;  4UPA A;  3DHQ A;  5LL6 X;  1E1O A;  2YTY A;  3BVM A;  1CTM A;  1BR9 A;  2JEA I;  3OW2 A;  2A74 C;  2CFM A;  1D1I A;  1ZKO A;  1O7Y A;  5M3F H;  3AFQ A;  5ELD A;  4FO2 A;  3PIO A;  3GP7 A;  4NB3 A;  1V43 A;  3L0O A;  1Z9F A;  4A3K H;  3AU7 A;  1NE3 A;  1LT6 D;  1SYC A;  3D4W A;  1SJE D;  3KLS X;  4EQ5 A;  4HJ7 A;  3N6R A;  5C6A A;  2OT2 A;  1SRO A;  2B2Y C;  1P16 A;  4JBK A;  4O2D A;  4DK1 A;  1D1K A;  1N36 L;  1A2T A;  1QUQ B;  1C48 A;  1EY5 A;  4Y52 H;  1ILQ A;  1DXM A;  2I5L X;  1UAP A;  3I70 A;  1CQV A;  2WP8 J;  3I4N H;  3RLN A;  3S1M H;  4DV2 L;  3MHB A;  5FLX L;  2NN6 G;  2EYJ A;  1SJH D;  5FJ8 H;  1O7Z A;  4L5Q A;  4QGU A;  5KRU A;  1QNK A;  5DAU A;  1F2L A;  3ND8 A;  2PNH A;  4DR6 Q;  1D5M C;  4M1U B;  4H13 C;  2ZM6 L;  1Q90 A;  2HQL A;  2L15 A;  3FKI B;  2KCN A;  3HOV B;  4LK1 C;  4RKL A;  4X66 L;  1PTO C;  1EYC A;  1PTO F;  1Y1V G;  2MJ8 A;  1LLR D;  1SXT A;  2Z1C A;  1Q82 C;  2DJF C;  4DA2 A;  4A3D H;  4X62 L;  2NVY B;  1R4P B;  1E2V A;  4XXE A;  1EQV A;  4CDD C;  1UUP A;  3GV6 A;  1PH4 A;  1ZEQ X;  3EVQ A;  5IGG A;  4WFN 3;  2H4O A;  2L55 A;  3NHH A;  2PI2 E;  1YVC A;  2EIF A;  1SBB B;  4EQN A;  1X3E A;  1CKN B;  3KUP A;  4KLK A;  3HOU G;  2PCF B;  4JI7 Q;  3NEN A;  1EYD A;  4FXG C;  2JA5 G;  2EYL A;  3M9B A;  1JB3 A;  3PUV A;  4LF5 Q;  1J8I A;  1STY A;  1HZA A;  1TR5 A;  3OMG A;  2HHH Q;  5DM7 3;  1PTO D;  4J8Q A;  2M00 A;  4LFA Q;  1U4L A;  3QWN A;  3S1R B;  3GTM H;  2I46 A;  1PRT C;  1ESR A;  4YY3 Q;  4DR1 Q;  2JJQ A;  2K5W A;  1K3R A;  3TME A;  1L1O A;  2ZT9 C;  2UXC Q;  4ID6 A;  3HKZ E;  3CCL A;  1B8A A;  5C3E G;  2JSO A;  3K58 A;  4EVO A;  2RDF A;  4KN7 C;  5IY0 A;  4C3J G;  4GKJ L;  4PZ6 A;  2K04 A;  1KTK A;  1RTO A;  3PO3 G;  4HTH A;  5D65 A;  4ZQ3 A;  1A8V A;  1DGS A;  1EFI D;  3HGB A;  1E1T A;  1Q7Y C;  1C8C A;  4LFB L;  1VQF A;  3J81 E;  4KKT A;  2BE5 C;  2Z4H A;  3A56 A;  3RN5 A;  2PQA B;  1PYW D;  1CKM A;  4FP5 D;  2F0E A;  4KY6 A;  5EKL A;  1KRT A;  5C4X B;  4LMQ D;  4DUZ Q;  1GO3 E;  1I94 Q;  2A1A A;  3DWP A;  1X56 A;  4RCO A;  1S5F D;  1TU2 B;  3KOJ A;  1IKM A;  5GAD C;  2ZXP A;  3GTO H;  1VQ5 A;  1PRT D;  3E0E A;  3SR1 A;  3I4O A;  4ME5 A;  4PZ7 A;  2ENB A;  1B53 A;  4DU9 A;  1SE4 A;  3TDQ A;  2CHB D;  4B3S L;  5JVH 3;  4PQX A;  4BY1 H;  3X3M A;  1X3F A;  1M1K C;  1NBW A;  2R7D A;  3P7J A;  5K36 H;  2N8N A;  3K0X A;  4X65 L;  3NWT A;  4P74 A;  4TKO B;  3DWA A;  1MIU A;  3T13 A;  2ZXR A;  1MJE A;  3JAM i;  4AYB E;  1HRJ A;  3ERS X;  1U4P A;  4JI4 L;  4QB4 A;  1RL2 A;  4DV1 L;  3VYR A;  5CV6 A;  1WD1 A;  3GTK B;  4IUP A;  5C44 B;  2K05 A;  5LMU Q;  2BE5 D;  2K01 A;  1F9R A;  1KD1 C;  4C2M H;  3HOV H;  2UU9 L;  3H3V I;  1HR0 W;  4K0K Q;  5FK9 C;  3P1H A;  5IP7 H;  4KJN A;  1SE8 A;  1IBM L;  3F2C A;  2IT1 A;  5CV9 A;  1Q12 A;  4TSS A;  1SSO A;  3FPP A;  4ODG A;  4HJ9 A;  1R9T H;  2B2W C;  3G7L A;  5EKK A;  1QCB D;  2BA0 A;  4Q5V A;  5BN5 A;  2NVX H;  5IYC G;  3J81 i;  2F0Q A;  2RCF A;  4BY7 G;  1B3Q A;  2WB1 E;  5EQ0 A;  4P2C B;  4A3B B;  2CH4 A;  5KNC A;  3PO2 G;  3STB C;  2D62 A;  4ZYS A;  2CCZ A;  2O2L D;  1CI3 M;  4DAV A;  4ALP A;  3S1Q B;  2KA7 A;  2N88 A;  1Y69 U;  2KBN A;  2F0M A;  3D6W A;  1EQR A;  1WCM H;  1TS3 A;  1HA6 A;  1EIF A;  3RZO H;  1XMO Q;  1PH5 A;  1FYC A;  2VQE L;  3Q22 A;  1HR0 L;  1ZXT A;  3HP3 A;  4J6H A;  1VQI A;  2AWN A;  4DK6 C;  4IJL A;  4HJ8 A;  1EY8 A;  1NCV A;  3I91 A;  2JA9 A;  4DV7 L;  1VF5 C;  4EX5 A;  3SK4 A;  1G8Z D;  1JOO A;  4OIJ A;  2L5T A;  3TRE A;  5C5M A;  3FEW X;  1KHI A;  5LMN L;  4GOP B;  1DM0 B;  3CKI B;  4A3G H;  3CPF A;  3S2H B;  4CKB A;  3STB D;  4DAM A;  4Y7N B;  3MXN A;  1PFS A;  3E6Z X;  4HSV A;  3HOW B;  2F0T A;  1JMC A;  5JPM C;  3CW2 C;  4A3J H;  2E2D C;  3F8T A;  5FO9 B;  1T5X D;  4RGM A;  4DV4 L;  5JJL A;  2MUY A;  3AFP A;  2IY5 B;  3Q0A A;  4BBR B;  3TP5 A;  1HFG A;  3X3N A;  3BZK A;  3W2D A;  1X3P A;  1RKN A;  3KDF A;  5KND A;  3HOX H;  4A3L H;  1U0L A;  2CQA A;  1MSH A;  5FO8 B;  1TWG B;  4JI0 L;  2PZU A;  2F0O A;  1F9S A;  3EN2 A;  5CYU A;  2LXJ A;  1Z6H A;  1ASZ A;  2X69 A;  4DAY B;  5JVG 3;  1P8L A;  3O13 A;  4LUO A;  5IP9 H;  3ICE A;  4BXX H;  1PTO H;  1PVO A;  4OO1 H;  1M4V A;  5CBE E;  4YCW A;  1KNE A;  4EQP A;  1STG A;  1HCZ A;  1SFO B;  1VQ9 A;  1UE6 A;  1Y1W H;  1YIT A;  4DAP A;  1E0B A;  4P73 A;  1H95 A;  2F0D A;  2LS0 1;  3RD4 A;  5JJZ A;  2D5D A;  3MAQ A;  2F0S A;  4I7A A;  4PG3 A;  3H09 A;  4A3E G;  2XWB B;  5C44 H;  2YU9 B;  2RSN A;  5I9O A;  3NE5 B;  2QF7 A;  3Q6S A;  3NQI A;  5EPL A;  3OTO L;  2VY3 A;  2N78 A;  4FF3 A;  1NJI C;  1SE3 A;  1D2B A;  2JEB I;  2X6L A;  3IRB A;  4C1N I;  3QG1 A;  3MXP A;  1EWH A;  2KCT A;  1G2T A;  3IKJ A;  4IUU A;  2B63 B;  2EJG C;  3PUZ A;  3MXU A;  3KF8 B;  3TP6 A;  3AQQ A;  4IZ8 A;  1BDO A;  3TS2 A;  2XTI A;  1I4H A;  3GTL H;  2EXZ A;  2EOT A;  1QE6 A;  1L0W A;  3CF5 A;  1I50 B;  1GJX A;  3FDT A;  4CHT B;  1PV4 A;  3S1N H;  3F2U A;  2WAQ E;  4NDX A;  4UHV A;  2B29 A;  4A93 G;  1TWH B;  1VQM A;  3PIP A;  1AN8 A;  1EYA A;  4JOI C;  1GUO A;  4ZUI A;  4HIK A;  2SEB D;  3I56 A;  5CV8 A;  3HKS A;  2B8F A;  2EZV A;  1ONL A;  4B9W A;  3DM3 A;  4N9T A;  2I07 B;  1ASY A;  3WOF A;  1WOC A;  2RBM A;  4WJW A;  5C3W A;  4DV0 Q;  1LV9 A;  1UE7 A;  3GV3 A;  1WVL A;  1W3S A;  2UUB L;  4LF6 L;  3EFX D;  1GD7 A;  1BKB A;  1W6K A;  4GNX A;  4IUN A;  1Q1B A;  3CME A;  2WKD A;  1JR0 D;  3OOC A;  4JV5 Q;  1B4O A;  2AQ1 B;  4KHP Q;  4A3F H;  4R4T A;  3CU7 A;  4K5W A;  1RJT A;  3U9S A;  5CR3 A;  1EY7 A;  4IPC A;  2I0Q A;  2OCE A;  3RLF A;  3S2H H;  4XQQ A;  3ERQ A;  2VXW A;  1FNW A;  3C1E A;  3TN2 A;  3PGZ A;  5EKI A;  4PMC A;  5IOD A;  4JI8 L;  1YNX A;  5M3F B;  2VQF Q;  1DYQ A;  5BR8 Q;  1EWC A;  1SNQ A;  1UEB A;  1IBK L;  1O80 A;  4JC0 A;  1KLU D;  3SK5 A;  4UDU C;  2EJF C;  4A3K B;  1KAW A;  3NBH B;  2SOB A;  2VB2 X;  2BH2 A;  3OWF A;  4B3T L;  3H15 A;  3QR8 A;  3EA6 A;  3FKI G;  1VQ4 A;  3HOV G;  2Z9H A;  2LY7 A;  1NSN S;  4P72 A;  3MZ5 A;  1IBL Q;  4A75 A;  1I4R A;  4OO1 I;  5E4X A;  2O4X A;  1XMQ Q;  4V0B A;  4PMB A;  2MQH A;  4DXF A;  2K6A A;  5A2Q L;  3I4N B;  1XYI A;  4N8X 1;  3S24 A;  4KY5 A;  3ZYY X;  3JAM c;  3S1M B;  1WTH A;  2DUD A;  2JN4 A;  3ND9 A;  4ZK9 B;  4QIW E;  3RZD H;  4F8M A;  1QIL A;  3BU2 A;  4OHJ A;  4L5T A;  4F88 A;  2K52 A;  3M4O B;  1VQJ A;  4KD3 A;  1JWU D;  1BOS A;  3VR2 A;  4C1N K;  2EJM A;  1J9O A;  2J0T D;  5M5X H;  1JJ2 A;  3HOZ H;  3CRK C;  2FXQ A;  2EYH A;  1RTN A;  1V1P B;  1O78 A;  3KF6 B;  1AH9 A;  2LXK A;  4DKA C;  1I4Q A;  4B3R Q;  5GAH C;  2NZO A;  2NUC A;  1OXS C;  2E5L Q;  2HT1 A;  4WRD A;  3KJP A;  2AQ2 B;  1HQM C;  4A3D B;  2L4N A;  4FYD A;  4LF5 L;  2YU9 H;  1QVF A;  1B50 A;  3EBE A;  3BG3 A;  1CK1 A;  4IPG A;  3G71 A;  1DZ1 A;  2DY7 A;  1STH A;  4RH6 A;  4LFA L;  1LTI D;  5JEA H;  1EY0 A;  4RCN A;  4GLA C;  2ZXO A;  1CZG A;  4DR1 L;  4GLV B;  4HMJ A;  4RG1 A;  3OIQ A;  1C9O A;  4HID A;  3H6M A;  4DR4 L;  1H9J A;  2KHS A;  1Y14 B;  1TWA H;  4RA8 A;  5FLX E;  1XPR A;  3S16 B;  3E9I A;  1FGU A;  4YIJ A;  3CQZ H;  4YHH Q;  1HNW Q;  1BCP C;  1BCP F;  1VQG A;  1EQT A;  4L5S A;  4DNT B;  3DMU A;  2DY8 A;  2AUK A;  2TSS A;  2C5C A;  1IL8 A;  1VQP A;  4K2K A;  2F0L A;  3QJY A;  3U50 C;  2VL6 A;  4OEL B;  3L2P A;  2XSC A;  1HTL D;  4KMU C;  5EPJ A;  3AYH B;  4A3L G;  5IOC A;  1ESF A;  4L6T B;  4F7X A;  1JJG A;  2AWO A;  1FVI A;  4B3M L;  2IPK D;  2ATW A;  5C4X G;  1WTV A;  4H7B A;  3D31 A;  2ZTE A;  1YHQ A;  4R8N A;  2HQE A;  3T1Y L;  1S72 A;  1HJP A;  3I73 A;  1QWY A;  1HZC A;  2JXM B;  4XYQ A;  3I4L A;  4KHV A;  3P20 A;  1AFP A;  1X65 A;  1WTR A;  2B39 A;  2H1E A;  1ICW A;  5E7N A;  3A54 A;  3CCR A;  2MFI A;  3M3Y H;  2QIL A;  4N8F A;  1BCP D;  4X64 Q;  3C46 A;  4HIO A;  2KJX A;  5T1G A;  1QB5 D;  3KBG A;  2UUA L;  5FLM H;  2ZJQ A;  1FJG Q;  2WIN B;  1VQ6 A;  1KDB A;  5IYB H;  1QUQ A;  1Y8P B;  5IGF A;  2UUC L;  2Q2H A;  2HDL A;  4HED A;  4LWC A;  2XWJ B;  4K0K L;  3GTO B;  4ZAI A;  1PZK D;  1WTP A;  1LT5 D;  1LYL A;  1MI2 A;  1B9N A;  1F2Y A;  1T5E A;  1HNZ L;  3MWY W;  3IFD A;  2RHQ B;  2Q2U A;  1JWM D;  3OSO A;  1MJC A;  4K5V A;  4P75 A;  5FO7 B;  2E2I H;  3AMU A;  4BY1 B;  2B2U A;  3SE0 A;  1XNQ L;  4DV3 Q;  1E24 A;  4K6D A;  4UP7 A;  3D8G A;  4X3U A;  3J7Z C;  3NTH A;  3FP9 A;  2OTL A;  4N9P A;  1QVG A;  3R93 A;  3ULP A;  1BXT A;  1L1O C;  5FKA C;  5ELC A;  1ILP A;  3U9O A;  3M4O H;  4A3B G;  3FHW A;  1ZYR C;  1RD9 D;  3CP0 A;  2A69 C;  4NW2 A;  2XVS A;  4CJ0 B;  1PH2 A;  5ELE A;  2JA6 H;  4QUF A;  2Z4I A;  4C2M B;  1NR4 A;  1TS4 A;  2MGS A;  2WV6 D;  3A55 A;  3B6Y A;  2Y0S B;  4H0L C;  1S5E D;  4DR3 Q;  2ZTC A;  4J1M A;  1E3P A;  1VQ8 A;  2VW9 A;  4MNO A;  1R9T B;  2NVX B;  1SNM A;  3I55 A;  1IZ6 A;  4I65 A;  2OF1 A;  1I6V C;  3CD6 A;  3BZC A;  3U4V A;  4R4I A;  1STB A;  1GOZ A;  3G6J B;  1CKN A;  3K8A A;  3VA7 A;  2JA8 H;  1ET9 A;  4LF8 L;  3I4M H;  1XJV A;  4PNY A;  4DR7 L;  4KK7 A;  3URY A;  3M4Q A;  4H44 C;  1XWE A;  3GTQ H;  4EQO A;  2R92 H;  3CCV A;  1WCM B;  4L8J A;  4YCU A;  3OWE B;  4R8I A;  1TXY A;  3S16 H;  1BO0 A;  2IWH A;  3GTP B;  3RZO B;  1XTD A;  2RSO A;  4K6L A;  4KKS A;  3T51 B;  3CPW A;  1G6P A;  1ZYR D;  3HOY B;  2EY6 A;  3L9A X;  5M9O A;  3HOW G;  4XT1 B;  2EYO A;  4MZ9 A;  2A69 D;  5F2D A;  2C9O A;  3SK6 A;  3PF5 A;  1JQY D;  3ONA B;  2OTJ A;  4BA2 I;  4QQB X;  5IYD H;  3A5U A;  4GKK L;  4BBR G;  3UDX A;  2IX3 A;  3J7A F;  4AQY Q;  3PUY A;  3K80 C;  1A3V A;  4DNI A;  2B2Y A;  4AH6 A;  4G7O C;  3FVQ A;  2O5I C;  2CH4 W;  1E2Z A;  4ZKC B;  5C0X H;  4DV5 Q;  4LF9 L;  4A3G B;  3G6E A;  1S5C D;  4OX9 L;  2UXB Q;  2A68 C;  1JOQ A;  4GN4 B;  2RDH A;  3W5O A;  4A3J B;  3MTS A;  3C2P A;  1DOK A;  2K50 A;  3GTG H;  2PO4 A;  2XN9 C;  1PYS B;  4Z9C B;  1FNU A;  1D7Q A;  3DWQ A;  2PQA A;  4C3I B;  2XGT A;  4NKL A;  2K14 A;  2MO0 A;  3W1B A;  3HOX B;  3S14 H;  3J7A 5;  3PUX A;  5M5W H;  1F9P A;  2F0W A;  1JWS D;  5J22 A;  4X3T A;  1XXG A;  1CHQ D;  4ABN A;  5I2X A;  2JYO A;  3CCS A;  1JIC A;  2F52 A;  5D14 A;  4POF A;  3H0G B;  4NXN Q;  2TMP A;  4R4O A;  2K75 A;  3Q23 A;  2A5H A;  3CC4 A;  1PTO B;  4DK0 A;  1YZ6 A;  3A0J A;  3KLS A;  2JK8 A;  2K32 A;  1V1O A;  3GDE A;  1GUT A;  1D5Z C;  2EVB A;  4MHE A;  3KLW A;  1SNO A;  1TWC B;  5DLQ E;  1SYG A;  5I6Y A;  2B63 G;  1PZJ D;  4K14 A;  1Y1W B;  2Z8L A;  3TSS A;  2A68 D;  4G7H C;  2IX0 A;  2JA7 B;  1GHJ A;  5IT9 c;  4S3S A;  1E2W A;  1KQS A;  1SMX A;  1JE4 A;  1VMC A;  4JYA Q;  1MGS A;  1NNX A;  2K1B A;  2A6H C;  2EXD A;  1K8O A;  1J5E L;  4IQZ A;  2R7Z B;  2EYM A;  1X32 A;  1LTG D;  3V96 A;  1IHZ A;  1SND A;  5CV5 A;  2K03 A;  3SXH A;  4IFD H;  5M3M B;  1TWF H;  1X6O A;  2GVA A;  2E2J B;  2L0C A;  1X9N A;  1MD2 D;  5I6W A;  3Q24 A;  4JBM A;  2G9H D;  4A3C H;  4C3H H;  2LFN A;  1PRT B;  5DEH A;  1PYB A;  5LMN W;  1Z47 A;  1N36 Q;  3K7U C;  1IYU A;  5JJK A;  4KJO A;  1HFN A;  3GTL B;  5EBD A;  2H5X A;  1Y8O B;  1SDF A;  4H02 A;  3VR3 A;  1JCK B;  4RGO S;  4DV2 Q;  3S1N B;  1YJN A;  3GTP H;  5IGE A;  5CV4 A;  1BNZ A;  1D6E C;  3W1G A;  3HOY H;  3PSI A;  4FXD A;  2SNM A;  2PMZ E;  1GUW A;  5CMD A;  4LF7 Q;  1KLG D;  3J80 E;  5M3F G;  1HNX L;  1KAB A;  2C35 B;  5EBC A;  2A6H D;  2EE1 A;  2ZM6 Q;  1OXU A;  2NVT H;  1FGB D;  4A3K G;  4DNR B;  1CZW A;  1EU3 A;  1VQA A;  3LNN A;  5C0X I;  3NK9 A;  4A3M H;  3RNU A;  4GOP A;  4U67 3;  1D8L A;  2DJG C;  1IBL L;  1XPU A;  3S9W A;  4A3F B;  2N55 A;  3R3O A;  3DM1 A;  1VQE A;  1QVC A;  1VCI A;  1A62 A;  2G9D A;  1GUN A;  4IUQ A;  2PYK A;  4DR2 L;  3I4N G;  1NAP A;  3UDI A;  5FJ8 G;  3D3R A;  4FNF A;  3A8J E;  2PW5 A;  2E2H B;  1VQ7 A;  3QO2 A;  3C3L A;  4V19 0;  1LAC A;  1N9W A;  4JI1 Q;  1G2S A;  1JB7 A;  2K33 A;  1IL2 A;  3D4R A;  1DJR D;  3HKZ B;  1F2M A;  4C3I H;  1CM9 A;  1B9M A;  1FNV A;  4WJ4 A;  4B3R L;  4IPD A;  1VQH A;  2EY2 A;  1AE3 A;  2EPB A;  3VR6 A;  2E5L L;  1NUC A;  4MIU A;  2NB0 A;  4DAY A;  2ID0 A;  4JI3 L;  4DV6 Q;  1WTQ A;  2KHI A;  2QEJ C;  3UI2 A;  1RCV D;  4GLX A;  2A6E C;  4A3D G;  3H0G H;  2B2W A;  1KC8 C;  1RF2 D;  1WTW A;  4K8I A;  4YCV A;  1XNR L;  4G57 A;  3RZD B;  1VQB A;  1CA5 A;  3F1Z A;  1B7Y B;  3VR4 A;  3V05 A;  2VUM B;  1LTA D;  4G4K A;  1TWC H;  3J7Y W;  3A5Z B;  1A2U A;  2KQ3 A;  2MPM A;  3T4A C;  4XT3 B;  4GNX C;  2BDO A;  3HOZ B;  5M5X B;  1EEI D;  2N3S A;  3M85 A;  2JA7 H;  5BN3 A;  3K81 C;  1Q86 C;  3J80 L;  4OGQ C;  4LFC L;  3OYY A;  2QKI C;  1TII D;  4GKJ Q;  1I6H H;  1N32 Q;  5I2Y A;  2V1C C;  5HUR A;  1TS5 A;  5IGC A;  4YHH L;  1HNW L;  3ERO A;  3KYH C;  2L9H A;  1PMR A;  1X3Q A;  2K5H A;  1M90 C;  4IFD I;  2R7Z H;  4LFB Q;  3S2D H;  3LGJ A;  3CXC A;  3J7A V;  3PCO B;  2R6G A;  1FR3 A;  3BDO A;  4AYB B;  1SYB A;  3PV0 A;  2ASB A;  1HZ9 A;  2A6E D;  3SK8 A;  4CKC A;  5M3M H;  1PHJ A;  2E2J H;  3KF8 A;  3HFZ B;  2FIN B;  3K5M A;  4K5X A;  3T56 B;  2CW0 C;  5C0X J;  1VF7 A;  1EEF D;  3TBI B;  1KNA A;  1L0X B;  5A2Q E;  1TWA B;  5C5L A;  1WJJ A;  4JI6 L;  1IYJ B;  5C0X G;  3H94 A;  1BUV T;  3TEH B;  4ZLT F;  1NMF A;  2J7Z A;  3CQZ B;  2MP1 A;  3BDC A;  5ELB A;  1KRS A;  3TS0 A;  2D0O A;  2NN6 H;  3QB3 A;  2A8V A;  2D2C C;  4MTN A;  5AJ3 Q;  2WB1 B;  1AZQ A;  3HG9 A;  3GQB A;  2B3G A;  1N33 Q;  3H91 A;  4CJ2 C;  2YTX A;  5EGT A;  5BN4 A;  2E74 C;  1TT2 A;  1RDP D;  1FJG L;  1UE1 A;  3K5L A;  1LTR D;  1JOK A;  4RHR A;  4TQU S;  1SNC A;  2HCC A;  3VDY A;  2UU9 Q;  3H3V C;  4ULL A;  1Y1V H;  2SDF A;  4FVM A;  1IBM Q;  3WOE A;  1IYV A;  1ENF A;  2Z6K A;  1SR3 A;  3QOJ A;  3CCU A;  5KEE A;  2ZJR A;  1U5K A;  3R8B A;  4KI0 A;  4RGT A;  3ULL A;  2CW0 D;  4QMG A;  4BY1 G;  4UAI A;  3CC2 A;  3M3Y B;  2AUJ D;  2XRS D;  5K36 G;  4JI2 Q;  2E2H H;  3NBH A;  3JC6 6;  1S3O A;  4OON A;  4DR6 L;  5JAV A;  1WFQ A;  2F3W A;  3S15 H;  1PH8 A;  2K5Q A;  3NBI A;  1NTG A;  3D0F A;  1GKH A;  4YWM A;  2AKW B;  5C4Z A;  4HAE A;  2JA5 H;  1EU4 A;  5GAG C;  1JE5 A;  1DCZ A;  5IP7 G;  3G4S A;  2Y0S G;  4UP8 A;  1B1Z A;  1QZG A;  1HR0 Q;  4IFD J;  4GZY C;  3DEP A;  3E9H A;  2E2I B;  1YBY A;  5IWA Q;  3GD7 A;  3RMH A;  2Q8T A;  3AEV A;  3NP8 A;  4QY7 A;  4ZUJ A;  1KDA A;  2VUM H;  4DV7 Q;  3N52 A;  5CGK A;  1JJC B;  1BBU A;  1V1P A;  2LKV A;  2QDB A;  3KF6 A;  1UNS A;  4QUC A;  2MNA A;  2EY5 A;  1HUN A;  5C3E H;  4JI7 L;  2JA6 B;  1EFW A;  1I4G A;  1YNN C;  1CSP A;  1UE5 A;  1N34 Q;  3J81 c;  1WCM G;  3MFY A;  1F77 A;  2E76 C;  2LSS A;  3PO3 H;  4NXM Q;  4LUV A;  2K5V A;  1Q46 A;  5E4W C;  3HOY G;  5C3X A;  4LNQ A;  5D3I B;  1PZI D;  4LJZ C;  1VQC A;  2HHH L;  2GVB A;  3OIP A;  5CBA E;  4RAU C;  4PV1 C;  1SEB D;  2VNU D;  2B2T A;  5NUC A;  2JA8 B;  1CT1 D;  4OIK A;  4YY3 L;  3I4M B;  2HIV A;  4JI0 Q;  2UXC L;  3GO5 A;  4POG A;  4PMW A;  2B2V A;  4R1J A;  3GTQ B;  2O5J C;  4AIM A;  4BA1 I;  2R92 B;  3DEO A;  2R93 B;  4IOC A;  2F0U A;  4A3G G;  4JK1 C;  5IE8 A;  4X3S A;  5IIF A;  2UXB L;  3VYT A;  3NTI A;  2M2L A;  2B2U C;  2IX1 A;  1TKW B;  2KHJ A;  4A4I A;  4A3J G;  1YNN D;  1O7L A;  3RN2 A;  5A35 A;  1HPC A;  2BCO A;  2FMM A;  5IT9 L;  2NYZ D;  1A3U A;  4GS3 A;  4IOA A;  4HR7 B;  3VR5 A;  3L3O C;  2XRQ D;  4C3I G;  1A6X A;  2ICE C;  3HOX G;  4DN4 M;  4BBS B;  4Q0F A;  1EOV A;  1NR2 A;  2K5N A;  5ELN A;  4DUZ L;  3ULJ A;  3F2D A;  1I94 L;  4DUY Q;  4HCS A;  2WAQ B;  1BVS A;  1ICF B;  1CKO A;  1H9R A;  3H0G G;  1Q81 C;  3OTO Q;  1LTB D;  2NBF A;  5IP9 G;  2F0I A;  4BXX G;  4XYO A;  3HS0 C;  3LX0 A;  4KN4 C;  4OO1 G;  3HZX A;  4WJ3 M;  3GTG B;  4DK3 C;  4JI5 Q;  4DFA A;  3SGI A;  2BA1 A;  3K59 A;  2F3I A;  3M4P A;  4BY7 H;  2XIW A;  3PMF A;  1HXY D;  3PO2 H;  1Y1W G;  4UP9 A;  2NTT A;  3V2T A;  3IL8 A;  3PUW A;  2LMC B;  3S14 B;  5M5W B;  4LUZ A;  4E6I A;  1G29 1;  1YHB A;  2M9V A;  5LMU L;  4HMI A;  4C56 C;  1B3A A;  5C44 G;  4FF1 A;  4A93 B;  3D6C A;  3LWE A;  2R7Z G;  5COR A;  1H9M A;  1GUS A;  1B70 B;  4BWG B;  3T1H Q;  2IJ0 A;  3ER0 A;  4WOR A;  2KEN A;  5KYI A;  4R4Q A;  2F0K A;  2OEO A;  5J1Z A;  3S17 B;  3K5N A;  1DD2 A;  5M3M G;  3J81 j;  5J3B A;  1K8A C;  2UUB Q;  5GAE C;  4LF6 Q;  3CCM A;  1EY9 A;  1GUG A;  4DR5 Q;  3NEL A;  3M7N A;  1OXV A;  3CRL C;  1SNP A;  2RA4 A;  2BOS A;  1EIG A;  3PIO 3;  2RDG A;  1YJ9 A;  4CJ1 B;  4HJA A;  4QIW B;  2DN8 A;  2ZJP A;  1XMO L;  3MA2 B;  4JI8 Q;  1BCP B;  1QG7 A;  4LF7 L;  2IL8 A;  4ZKB B;  2HCI A;  1YHA A;  4IN3 A;  1IBK Q;  2RVL A;  3E0J A;  3K0Y A;  3KFU A;  1TWF B;  1K28 A;  5E3F A;  2F0V A;  2L12 A;  1QZH A;  5ELF A;  4B3T Q;  4BS9 A;  1G91 A;  1Q1E A;  2F3V A;  2EY1 A;  1ML0 D;  2RKS A;  4C3H B;  4LF4 Q;  2KEC A;  4UY8 C;  3K7A H;  3RR5 A;  3NSW A;  1TY0 A;  1EWI A;  5KGU A;  3CC7 A;  2KED A;  2Q8I B;  2KCM A;  1A15 A;  4A3F G;  4A3I B;  2R93 H;  3H3V H;  2OQ0 A;  3HRZ C;  1K9M C;  3CCQ A;  1JC7 A;  4OL7 A;  1V9P A;  2CWA A;  4QF4 A;  1QOH A;  1I3Q B;  4QJF A;  3SDZ A;  4X6A H;  1EOT A;  1OXX K;  1VQN A;  4CBV A;  1WD0 A;  4HIM A;  4XTC S;  4JI1 L;  1A3T A;  1PLF A;  5KNB A;  4U68 A;  1F2Z A;  2KOL A;  1TS2 A;  1X55 A;  2UXD Q;  2CKZ B;  4OWW B;  1K83 H;  2NVT B;  4RHS A;  5HGT A;  3W3A A;  3HKZ G;  1HUM A;  3T16 A;  5EPK A;  3T53 B;  4A3M B;  1J6Q A;  4BBS H;  5KIX A;  1LT3 D;  4DV6 L;  4A3E H;  3KK7 A;  2HDM A;  5GQO A;  2KEE A;  1I4X A;  1RIP A;  1CFM A;  4RMF A;  1MBY A;  3TQY A;  1U9R A;  1SMY C;  4CDE C;  2AMC B;  3GTJ B;  1PRT F;  2PPB C;  1TY2 A;  2A19 A;  4DF7 A;  3JAM E;  2VUM G;  1WI5 A;  4L63 B;  4DR4 Q;  4KKU A;  4MN3 A;  3HOZ G;  1L1O B;  1YEZ A;  3BYT B;  3EJI A;  5C4H A;  1BQQ T;  1X54 A;  3UDF A;  1QJO A;  2FJ2 A;  1L2F A;  4IUR A;  4O1N A;  1N32 L;  5M5Y H;  1EIY B;  2VB3 X;  4CKE A;  2L1B A;  1DOM A;  4A93 H;  3IFT A;  3L7Z C;  4TRD A;  2JQO A;  2MO1 A;  2F4V Q;  1LTS D;  3EQL C;  5JEA J;  3A8K E;  2Z0S A;  1PH7 A;  1BBX C;  1PH1 A;  2B8G A;  5JEA G;  1K73 C;  4CDF C;  1FD7 D;  1E7Z A;  1PXU A;  2V4D A;  4GN5 A;  3NWS A;  4AYB G;  3S17 H;  4KHZ A;  2IW3 A;  2R61 A;  2BDN A;  4GOP C;  4B3M Q;  1SMY D;  3T1Y Q;  1EYG A;  2FMC A;  1VS0 A;  1WYD A;  1I5F A;  1IXR A;  1VQL A;  1C4Q A;  3OW7 A;  2CWP A;  5FOB B;  1I6H B;  1LT4 D;  3G48 A;  2GA4 B;  4ZCK A;  2OWO A;  3AB9 A;  1PFN A;  3SVM A;  4YWK A;  1SYD A;  4EGV A;  1V8Q A;  5AJ3 L;  3I8Z A;  2I5M X;  3S2D B;  5K5P A;  2WB1 G;  1N33 L;  2HUG A;  1GXD C;  1LTT D;  4ILW A;  1C7Y A;  1CHP D;  3Q8D A;  3NXW A;  2E8G A;  4JBW A;  2ES2 A;  2UUA Q;  3C1F A;  4DV0 L;  1W6J A;  1LAB A;  2ZTD A;  1UEA B;  3FKI H;  2DNC A;  2UUC Q;  3R2T A;  3BYY B;  4OWT B;  1WTO A;  1CUK A;  3JAM L;  3OHX C;  3I72 A;  2KVM A;  1HNZ Q;  4JV5 L;  4KHP L;  3EIV A;  1PA6 A;  2D0P A;  2EYF A;  1II3 A;  2NVY H;  4A3I H;  1GM5 A;  1SAP A;  4I7Z C;  1OXT A;  2PI2 A;  2HD3 A;  1XNQ Q;  1S40 A;  1B44 D;  1YNJ C;  1C0A A;  3DUZ A;  4XQN A;  1I3Q H;  2ICI A;  4JI2 L;  5ELO A;  4M8A A;  2AHO B;  5LL6 S;  2VQF L;  5BR8 L;  3VA5 A;  2F0P A;  1BF4 A;  3J81 L;  5H1S E;  3ZJY C;  1S4Z A;  1TQO A;  2PZT A;  2YV5 A;  1IKL A;  3M7G A;  5JOB A;  5FLM G;  1CQF A;  3RLO A;  2Q2T A;  1ENA A;  4IUT A;  2BH8 A;  2OXP A;  4XIG S;  5C4J B;  2RCN A;  5IYB G;  1KAA A;  4JG2 A;  4RFB A;  1Y1V B;  1YJW A;  4X66 Q;  1Q3L A;  2IHF A;  1H9K A;  4J15 A;  2F0G A;  5DNF A;  1XMQ L;  1STN A;  3CMA A;  4JBJ A;  1VQK A;  4X62 Q;  5IWA L;  2PZW A;  2DGY A;  3OMC A;  4HCE A;  1PH9 A;  3KJO A;  1CSQ A;  3FRP B;  1MSG A;  2PNR C;  3GTJ H;  3S1R H;  4NP5 A;  2GN5 A;  2JP1 A;  4LF8 Q;  2K5D A;  3CHB D;  2FFK B;  5FLX c;  1WTX A;  3TRZ A;  3S15 B;  4DR7 Q;  3A74 A;  3I2Z A;  1VMP A;  4OWX B;  3HOU B;  3IAY A;  3HEJ A;  1YNJ D;  1STA A;  3LWU A;  1G6Z A;  1N34 L;  1SN8 A;  2JA6 G;  4CGY B;  2JA5 B;  1F9Q A;  2F0F A;  1ENC A;  1A63 A;  4FF2 A;  4NXM L;  2WKC A;  4RKB A;  2JE6 I;  4YWL A;  4IJH A;  1OO9 B;  2QA4 A;  4A76 A;  2QDL A;  1JT8 A;  3MXN B;  3A7A B;  3TZD A;  2K4K A;  3UDG A;  1KDC A;  3U58 A;  1CA6 A;  4XDX A;  1K8M A;  4HJ5 A;  4IO9 A;  4GKK Q;  2QW7 A;  2RF4 A;  1EY6 A;  3K57 A;  4G7Z C;  2NVQ B;  2YTV A;  3J80 i;  2KCC A;  3CCE A;  2JA8 G;  1EZ6 A;  2F0H A;  1HZB A;  4TVA B;  3KDF B;  3I4M G;  5C4X H;  3VYU A;  5C3E B;  1HTP A;  2Z6K C;  5E1F A;  3I7F A;  4DPG A;  1LM0 A;  4LF9 Q;  4C3J B;  1Q8K A;  2R92 G;  3MFG A;  2R93 G;  1YI2 A;  4OX9 Q;  3K6O A;  3PO3 B;  1AE2 A;  1FL0 A;  1PDQ A;  1M8A A;  3R2I A;  1SRU A;  1EZ8 A;  3TP8 A;  3NEM A;  1EQQ A;  2F0J A;  4HSP A;  3BVG A;  3A7L A;  2J4X A;  5IYD G;  3UE0 A;  2WAC A;  1LTL A;  4P71 A;  2NZH A;  1K3B C;  1VQD A;  4BBS G;  3NQT A;  5CV7 A;  3BDL A;  3GTK H;  1H9S A;  2D9U A;  2EQS A;  2PQE A;  5CC4 A;  4DUY L;  5ISR A;  3MEH A;  2XNA C;  5COY A;  2WAQ G;  2EDG A;  1H9S B;  1PFB A;  2R3Z A;  5HGQ A;  3QOL A;  4JCV E;  5D3D A;  4MTK A;  2NZ1 D;  1B2T A;  4RWS C;  3KLR A;  2IHE A;  5G3L F;  4B3S Q;  4JI5 L;  1EY4 A;  4X65 Q;  3WDN A;  1UWV A;  2P5Z X;  1QNU A;  4A3B H;  4NPS A;  1ROD A;  3BZD B;  4KY7 A;  2FHT A;  3P75 A;  4X64 L;  5T1I A;  2QCP X;  1SE2 A;  3BJU A;  4JI4 Q;  4DV1 Q;  3S1Q H;  1K0S A;  3U4Z A;  5C4J H;  4JPB W;  2CQO A;  3ITP A;  1J5E Q;  4R4C A;  3NPP A;  2Z6B A;  4QCL A;  1Y8N B;  3SHL A;  1NMG A;  2PMZ B;  3TP7 A;  3T1H L;  4NMZ A;  1PH3 A;  3MVV A;  3VYS A;  1U4R A;  1JOR A;  4DV3 L;  2B2T C;  1U4M A;  4BY7 B;  1GHK A;  4RGN A;  4F87 A;  3PO2 B;  1S5D D;  5I4D A;  2RHS B;  5L37 A;  1AEX A;  1S5B D;  2NTS A;  3FPU B;  4DR5 L;  3PIP 3;  4XQJ A;  2B2V C;  2A73 B;  4O42 A;  5G3L D;  2QEX A;  3BS1 A;  1V1Q A;  4APV A;  4O0A A;  3HOU H;  4GNX B;  4LW1 A;  1EUJ A;  2Q8R E;  5JPN C;  1LO5 D;  3MXG A;  1PFM A;  2I5H A;  1I4P A;  2HIX A;  5J39 A;  4Y7N H;  1G51 A;  1O7I A;  3HOW H;  5EJW A;  1HHV A;  1MKH A;  5IT9 E;  4KV6 A;  4DR3 L;  3MC0 B;  2VQE Q;  2YYZ A;  4ME3 A;  2NWG A;  2K28 A;  1Q8I A;  4GN3 B;  4CDC C;  1EL0 A;  1VQO A;  1HNX Q;  2N49 A;  4OXP A;  4R9W A;  1W2B A;  1HH2 P;  1SYF A;  1T9H A;  1KL9 A;  4BBR H;  4IFD G;  1LUZ A;  5IGD A;  1XTC D;  2DNE A;  4IAL A;  3UE1 A;  2Q2I A;  4FDB A;  4L5R C;  2NVQ H;  1NY4 A;  4LF4 L;  3DXJ C;  4A3C G;  4OEM B;  4C3H G;  1TWG H;  4B08 A;  2G5D A;  2OQK A;  3RUZ A;  2PW7 A;  2WFW A;  2VZA A;  1RHP A;  4QL5 A;  2ALY B;  4K2L A;  5LMN Q;  4ZRZ A;  4IPH A;  4A3I G;  4C3J H;  1ET6 A;  4DR2 Q;  2X6G A;  1E22 A;  1DOL A;  5GRO A;  1MHW C;  2Y0S E;  1HA5 A;  1KXL A;  3K5O A;  4IUV A;  3I3C A;  1SFO H;  4DV4 Q;  4JOI A;  2UXD L;  2WII B;  1XPO A;  3MEF A;  5DM6 3;  1TVX A;  5KYL A;  4JW0 A;  4AQY L;  3KBX A;  1D5X C;  2F4I A;  3K7A B;  1GVP A;  4A3M G;  1XX8 A;  1IW7 C;  4JI3 Q;  1N8R C;  4KD4 A;  2F1M A;  1PH6 A;  2SNS A;  4DV5 L;  2NN6 I;  4DXG A;  2KUM A;  1VDZ A;  3SEB A;  1AZP A;  4K8J A;  2MHV A;  2QGQ A;  1Z7T A;  3TZU A;  2F03 A;  3OPO A;  1A0I A;  1R4Q B;  3FMC A;  1XNR Q;  4FXK C;  1X3G A;  3NUC A;  3E5S A; 
#chains in the Genus database with same CATH homology
 1DON A;  4FF4 A;  5LHY 1;  4X3K A;  1K83 B;  2RQX A;  3NTK A;  5AFW A;  5IGB A;  2CVR A;  4A3E B;  3I90 A;  4DGZ A;  1AP0 A;  4KTA A;  3BVZ A;  2K7V A;  2E75 C;  2EYP A;  1SYE A;  5TSS A;  1IW7 D;  1L0Y B;  3GTM B;  3D4D A;  1HQR D;  4B9X A;  5I9P A;  4HN7 A;  3QIA A;  1EIH A;  4LAA A;  3M4Y A;  2F0N A;  5M5Y B;  3A8I E;  1AW7 A;  2AQ3 B;  2L11 A;  1STE A;  3DHQ A;  5LL6 X;  3BVM A;  1CTM A;  1BR9 A;  2JEA I;  2A74 C;  1D1I A;  1ZKO A;  1O7Y A;  5ELD A;  4FO2 A;  3GP7 A;  1V43 A;  3AU7 A;  1LT6 D;  1SYC A;  3D4W A;  1SJE D;  3KLS X;  3N6R A;  5C6A A;  2OT2 A;  2B2Y C;  4DK1 A;  1D1K A;  1A2T A;  1C48 A;  1EY5 A;  1ILQ A;  1DXM A;  1UAP A;  3I70 A;  1CQV A;  2WP8 J;  3MHB A;  5FLX L;  2NN6 G;  2EYJ A;  1SJH D;  1O7Z A;  5KRU A;  1QNK A;  5DAU A;  1F2L A;  3ND8 A;  1D5M C;  4M1U B;  4H13 C;  1Q90 A;  3FKI B;  2KCN A;  3HOV B;  4LK1 C;  4RKL A;  1PTO C;  1EYC A;  1PTO F;  2Z1C A;  2MJ8 A;  1LLR D;  1SXT A;  4DA2 A;  2NVY B;  1R4P B;  1E2V A;  4XXE A;  1EQV A;  1UUP A;  3GV6 A;  1ZEQ X;  3EVQ A;  5IGG A;  4WFN 3;  2H4O A;  2L55 A;  3NHH A;  1SBB B;  4EQN A;  3KUP A;  2PCF B;  1EYD A;  4FXG C;  2EYL A;  1JB3 A;  3PUV A;  1J8I A;  1STY A;  1TR5 A;  3OMG A;  5DM7 3;  1PTO D;  4J8Q A;  2M00 A;  1U4L A;  3QWN A;  3S1R B;  2I46 A;  1PRT C;  1ESR A;  2K5W A;  3TME A;  2ZT9 C;  4ID6 A;  2JSO A;  3K58 A;  4EVO A;  2RDF A;  4KN7 C;  4C3J G;  2K04 A;  1KTK A;  1RTO A;  4HTH A;  5D65 A;  4ZQ3 A;  1EFI D;  3HGB A;  1C8C A;  3J81 E;  4KKT A;  2BE5 C;  2Z4H A;  3A56 A;  1PYW D;  4FP5 D;  2F0E A;  4KY6 A;  5EKL A;  5C4X B;  4LMQ D;  3DWP A;  4RCO A;  1S5F D;  1TU2 B;  1IKM A;  2ZXP A;  1PRT D;  3SR1 A;  4ME5 A;  2ENB A;  4DU9 A;  1B53 A;  1SE4 A;  3TDQ A;  2CHB D;  5JVH 3;  4PQX A;  3X3M A;  3P7J A;  5K36 H;  3NWT A;  4TKO B;  3DWA A;  3T13 A;  2ZXR A;  1HRJ A;  1U4P A;  4QB4 A;  1WD1 A;  3VYR A;  5CV6 A;  3GTK B;  4IUP A;  5C44 B;  2K05 A;  2BE5 D;  2K01 A;  1F9R A;  5FK9 C;  3P1H A;  4KJN A;  2IT1 A;  5CV9 A;  1Q12 A;  4TSS A;  1SSO A;  3FPP A;  4ODG A;  2B2W C;  3G7L A;  5EKK A;  1QCB D;  2BA0 A;  4Q5V A;  5BN5 A;  2F0Q A;  5EQ0 A;  4P2C B;  4A3B B;  5KNC A;  2D62 A;  4ZYS A;  2O2L D;  1CI3 M;  4DAV A;  3S1Q B;  2KA7 A;  2N88 A;  1Y69 U;  3D6W A;  2F0M A;  1TS3 A;  1HA6 A;  1FYC A;  3Q22 A;  1ZXT A;  3HP3 A;  4J6H A;  2AWN A;  1EY8 A;  1NCV A;  3I91 A;  1VF5 C;  3SK4 A;  1G8Z D;  1JOO A;  4OIJ A;  2L5T A;  5C5M A;  3FEW X;  1DM0 B;  3CKI B;  3S2H B;  4CKB A;  4Y7N B;  3MXN A;  3E6Z X;  4HSV A;  3HOW B;  2F0T A;  5JPM C;  2E2D C;  5FO9 B;  1T5X D;  4RGM A;  2MUY A;  3Q0A A;  4BBR B;  3TP5 A;  1HFG A;  3X3N A;  3W2D A;  1X3P A;  1RKN A;  5KND A;  2CQA A;  1MSH A;  5FO8 B;  1TWG B;  2PZU A;  2F0O A;  1F9S A;  5CYU A;  1Z6H A;  2X69 A;  5JVG 3;  3O13 A;  1PTO H;  4OO1 H;  1M4V A;  5CBE E;  1KNE A;  4EQP A;  1STG A;  1HCZ A;  1SFO B;  4DAP A;  1E0B A;  2F0D A;  2LS0 1;  3RD4 A;  5JJZ A;  2D5D A;  3MAQ A;  2F0S A;  3H09 A;  2XWB B;  2YU9 B;  2RSN A;  5I9O A;  3NE5 B;  2QF7 A;  3Q6S A;  3NQI A;  5EPL A;  4FF3 A;  1SE3 A;  1D2B A;  2JEB I;  2X6L A;  4C1N I;  3QG1 A;  3MXP A;  1EWH A;  1G2T A;  3IKJ A;  4IUU A;  2B63 B;  2EJG C;  3PUZ A;  3MXU A;  3TP6 A;  4IZ8 A;  1BDO A;  1I4H A;  2EXZ A;  2EOT A;  1QE6 A;  1I50 B;  1GJX A;  3FDT A;  4CHT B;  3F2U A;  4NDX A;  1TWH B;  1AN8 A;  1EYA A;  1GUO A;  4ZUI A;  2SEB D;  5CV8 A;  2B8F A;  2EZV A;  1ONL A;  4B9W A;  4N9T A;  2I07 B;  3WOF A;  2RBM A;  4WJW A;  5C3W A;  1LV9 A;  3GV3 A;  1WVL A;  3EFX D;  1W6K A;  4IUN A;  1Q1B A;  2WKD A;  1JR0 D;  3OOC A;  1B4O A;  2AQ1 B;  3CU7 A;  4K5W A;  1RJT A;  3U9S A;  5CR3 A;  1EY7 A;  3RLF A;  4XQQ A;  3ERQ A;  2VXW A;  1FNW A;  3C1E A;  3TN2 A;  5EKI A;  4PMC A;  5IOD A;  5M3F B;  1DYQ A;  1EWC A;  1SNQ A;  1O80 A;  1KLU D;  3SK5 A;  4UDU C;  2EJF C;  4A3K B;  2SOB A;  2VB2 X;  3OWF A;  3EA6 A;  2LY7 A;  1NSN S;  3MZ5 A;  1I4R A;  4OO1 I;  5E4X A;  2O4X A;  4V0B A;  4PMB A;  4DXF A;  2K6A A;  5A2Q L;  3I4N B;  1XYI A;  3S1M B;  4KY5 A;  3ZYY X;  3ND9 A;  4ZK9 B;  4F8M A;  1QIL A;  4OHJ A;  4F88 A;  3M4O B;  4KD3 A;  1JWU D;  1BOS A;  3VR2 A;  4C1N K;  2EJM A;  1J9O A;  2J0T D;  3CRK C;  2EYH A;  1RTN A;  1V1P B;  1O78 A;  1I4Q A;  2NUC A;  1OXS C;  4WRD A;  2AQ2 B;  1HQM C;  4A3D B;  2L4N A;  4FYD A;  1B50 A;  3BG3 A;  1CK1 A;  1DZ1 A;  2DY7 A;  1STH A;  4RH6 A;  1LTI D;  5JEA H;  1EY0 A;  4RCN A;  2ZXO A;  1CZG A;  4HMJ A;  3OIQ A;  3H6M A;  1H9J A;  2KHS A;  4RA8 A;  5FLX E;  3S16 B;  4YIJ A;  1BCP C;  1BCP F;  1EQT A;  4DNT B;  3DMU A;  2DY8 A;  2AUK A;  2TSS A;  2C5C A;  1IL8 A;  4K2K A;  2F0L A;  3QJY A;  2XSC A;  1HTL D;  4KMU C;  5EPJ A;  5IOC A;  1ESF A;  4L6T B;  4F7X A;  2AWO A;  2IPK D;  1WTV A;  4H7B A;  3D31 A;  4R8N A;  2HQE A;  3I73 A;  1QWY A;  2JXM B;  4XYQ A;  3I4L A;  4KHV A;  3P20 A;  1AFP A;  1WTR A;  2B39 A;  2H1E A;  1ICW A;  3A54 A;  2QIL A;  1BCP D;  3C46 A;  2KJX A;  5T1G A;  1QB5 D;  3KBG A;  2WIN B;  1KDB A;  1Y8P B;  5IGF A;  2HDL A;  4HED A;  2XWJ B;  3GTO B;  4ZAI A;  1PZK D;  1WTP A;  1LT5 D;  1MI2 A;  1B9N A;  1F2Y A;  1T5E A;  3MWY W;  3IFD A;  1JWM D;  3OSO A;  4K5V A;  5FO7 B;  3AMU A;  4BY1 B;  2B2U A;  3SE0 A;  4K6D A;  3D8G A;  4X3U A;  3NTH A;  4N9P A;  3R93 A;  1BXT A;  5FKA C;  5ELC A;  1ILP A;  3U9O A;  1ZYR C;  1RD9 D;  2A69 C;  4CJ0 B;  4NW2 A;  2XVS A;  5ELE A;  4QUF A;  2Z4I A;  4C2M B;  1NR4 A;  1TS4 A;  2MGS A;  2WV6 D;  3A55 A;  2Y0S B;  4H0L C;  1S5E D;  4J1M A;  1R9T B;  2NVX B;  1SNM A;  4I65 A;  2OF1 A;  1I6V C;  1STB A;  1GOZ A;  3G6J B;  3VA7 A;  1ET9 A;  4PNY A;  4KK7 A;  3URY A;  4H44 C;  1XWE A;  4EQO A;  1WCM B;  4L8J A;  3OWE B;  4R8I A;  1BO0 A;  2IWH A;  3GTP B;  3RZO B;  4KKS A;  3T51 B;  2RSO A;  4K6L A;  1ZYR D;  3HOY B;  2EY6 A;  3L9A X;  5M9O A;  4XT1 B;  2EYO A;  2A69 D;  5F2D A;  2C9O A;  3SK6 A;  1JQY D;  3ONA B;  4BA2 I;  2IX3 A;  3J7A F;  3PUY A;  1A3V A;  2B2Y A;  4G7O C;  3FVQ A;  2O5I C;  4A3G B;  1E2Z A;  4ZKC B;  5C0X H;  1S5C D;  2A68 C;  1JOQ A;  2RDH A;  4A3J B;  3MTS A;  3C2P A;  1DOK A;  2PO4 A;  2XN9 C;  4Z9C B;  1FNU A;  3DWQ A;  4C3I B;  4NKL A;  3HOX B;  3PUX A;  1F9P A;  2F0W A;  1JWS D;  5J22 A;  4X3T A;  1XXG A;  1CHQ D;  4ABN A;  5I2X A;  2JYO A;  1JIC A;  5D14 A;  3H0G B;  2TMP A;  3Q23 A;  2A5H A;  1PTO B;  4DK0 A;  3KLS A;  2K32 A;  1V1O A;  1GUT A;  1D5Z C;  2EVB A;  4MHE A;  1SNO A;  1TWC B;  1SYG A;  5I6Y A;  1PZJ D;  4K14 A;  1Y1W B;  2Z8L A;  3TSS A;  2A68 D;  4G7H C;  2IX0 A;  2JA7 B;  1GHJ A;  4S3S A;  1E2W A;  1JE4 A;  1VMC A;  1MGS A;  2K1B A;  2A6H C;  1K8O A;  4IQZ A;  2R7Z B;  2EYM A;  1X32 A;  1LTG D;  3V96 A;  1IHZ A;  1SND A;  5CV5 A;  2K03 A;  3SXH A;  4IFD H;  5M3M B;  2E2J B;  2L0C A;  1MD2 D;  5I6W A;  3Q24 A;  2G9H D;  2LFN A;  1PRT B;  5DEH A;  1Z47 A;  1IYU A;  4KJO A;  1HFN A;  3GTL B;  5EBD A;  1Y8O B;  1SDF A;  3VR3 A;  1JCK B;  4RGO S;  3S1N B;  5IGE A;  5CV4 A;  1BNZ A;  1D6E C;  4FXD A;  2SNM A;  1GUW A;  5CMD A;  1KLG D;  3J80 E;  1KAB A;  5EBC A;  2A6H D;  2EE1 A;  1OXU A;  1FGB D;  4DNR B;  1CZW A;  1EU3 A;  3LNN A;  5C0X I;  3NK9 A;  4U67 3;  3S9W A;  4A3F B;  2N55 A;  3R3O A;  3DM1 A;  1VCI A;  4IUQ A;  2G9D A;  1GUN A;  2PYK A;  1NAP A;  3D3R A;  4FNF A;  3A8J E;  2PW5 A;  2E2H B;  3QO2 A;  3C3L A;  4V19 0;  1LAC A;  1G2S A;  2K33 A;  3D4R A;  1DJR D;  3HKZ B;  1F2M A;  1CM9 A;  1B9M A;  1FNV A;  2EY2 A;  2EPB A;  3VR6 A;  1NUC A;  4MIU A;  2NB0 A;  4DAY A;  2ID0 A;  1WTQ A;  2QEJ C;  3UI2 A;  1RCV D;  2A6E C;  2B2W A;  1RF2 D;  1WTW A;  4K8I A;  4G57 A;  3RZD B;  1CA5 A;  3VR4 A;  3V05 A;  2VUM B;  1LTA D;  4G4K A;  3J7Y W;  1A2U A;  2KQ3 A;  2MPM A;  3T4A C;  4XT3 B;  2BDO A;  3HOZ B;  5M5X B;  1EEI D;  3M85 A;  5BN3 A;  3J80 L;  4OGQ C;  2QKI C;  1TII D;  5I2Y A;  5HUR A;  1TS5 A;  5IGC A;  3ERO A;  2L9H A;  1PMR A;  1X3Q A;  4IFD I;  3J7A V;  2R6G A;  1FR3 A;  3BDO A;  4AYB B;  1SYB A;  3PV0 A;  2A6E D;  3SK8 A;  4CKC A;  3KF8 A;  2FIN B;  3K5M A;  4K5X A;  3T56 B;  2CW0 C;  5C0X J;  1VF7 A;  1EEF D;  3TBI B;  1KNA A;  1L0X B;  5A2Q E;  1TWA B;  5C5L A;  5C0X G;  3H94 A;  1BUV T;  4ZLT F;  2J7Z A;  3CQZ B;  2MP1 A;  3BDC A;  5ELB A;  2NN6 H;  3QB3 A;  2D2C C;  2WB1 B;  1AZQ A;  3HG9 A;  3GQB A;  3H91 A;  4CJ2 C;  5EGT A;  5BN4 A;  2E74 C;  1TT2 A;  1RDP D;  3K5L A;  1LTR D;  1JOK A;  4RHR A;  4TQU S;  1SNC A;  2HCC A;  3H3V C;  4ULL A;  2SDF A;  4FVM A;  3WOE A;  1IYV A;  1ENF A;  3QOJ A;  5KEE A;  3R8B A;  4KI0 A;  4RGT A;  2CW0 D;  4QMG A;  4UAI A;  3M3Y B;  2AUJ D;  2XRS D;  5K36 G;  3NBH A;  5JAV A;  2F3W A;  2K5Q A;  3NBI A;  5C4Z A;  4HAE A;  1EU4 A;  1DCZ A;  1B1Z A;  4IFD J;  4GZY C;  3DEP A;  2E2I B;  3GD7 A;  3RMH A;  2Q8T A;  3NP8 A;  4ZUJ A;  1KDA A;  3N52 A;  5CGK A;  2LKV A;  1V1P A;  2QDB A;  1UNS A;  4QUC A;  2EY5 A;  1HUN A;  2JA6 B;  1I4G A;  1YNN C;  3MFY A;  1F77 A;  2E76 C;  5E4W C;  5C3X A;  5D3I B;  1PZI D;  4LJZ C;  3OIP A;  5CBA E;  4RAU C;  4PV1 C;  1SEB D;  2VNU D;  2B2T A;  5NUC A;  2JA8 B;  1CT1 D;  4OIK A;  3I4M B;  3GO5 A;  4PMW A;  2B2V A;  3GTQ B;  2O5J C;  4BA1 I;  2R92 B;  3DEO A;  2R93 B;  2F0U A;  4JK1 C;  4X3S A;  5IIF A;  3VYT A;  3NTI A;  2M2L A;  2B2U C;  2IX1 A;  1TKW B;  1YNN D;  1O7L A;  5A35 A;  1HPC A;  2BCO A;  2FMM A;  5IT9 L;  2NYZ D;  1A3U A;  4HR7 B;  3VR5 A;  3L3O C;  2XRQ D;  4C3I G;  1A6X A;  2ICE C;  4DN4 M;  4BBS B;  4Q0F A;  1NR2 A;  4HCS A;  2WAQ B;  1H9R A;  1LTB D;  2NBF A;  2F0I A;  4XYO A;  3HS0 C;  3LX0 A;  4KN4 C;  4OO1 G;  3HZX A;  3GTG B;  4DFA A;  2BA1 A;  3K59 A;  2XIW A;  3PMF A;  1HXY D;  2NTT A;  3V2T A;  3IL8 A;  3PUW A;  2LMC B;  3S14 B;  5M5W B;  4E6I A;  1G29 1;  2M9V A;  4HMI A;  4C56 C;  1B3A A;  4FF1 A;  4A93 B;  3D6C A;  3LWE A;  5COR A;  1H9M A;  1GUS A;  4BWG B;  2IJ0 A;  4WOR A;  5KYI A;  2F0K A;  2OEO A;  5J1Z A;  3S17 B;  3K5N A;  1DD2 A;  1EY9 A;  1GUG A;  3M7N A;  1OXV A;  3CRL C;  1SNP A;  2RA4 A;  2BOS A;  1EIG A;  3PIO 3;  2RDG A;  4CJ1 B;  4QIW B;  2DN8 A;  3MA2 B;  1BCP B;  1QG7 A;  2IL8 A;  4ZKB B;  2HCI A;  4IN3 A;  2RVL A;  3E0J A;  3K0Y A;  1TWF B;  5E3F A;  2F0V A;  2L12 A;  5ELF A;  4BS9 A;  1G91 A;  1Q1E A;  2F3V A;  2EY1 A;  1ML0 D;  2RKS A;  4C3H B;  2KEC A;  3NSW A;  1TY0 A;  5KGU A;  2KED A;  2Q8I B;  1A15 A;  4A3I B;  3HRZ C;  1JC7 A;  4OL7 A;  4QF4 A;  1QOH A;  1I3Q B;  3SDZ A;  1EOT A;  1OXX K;  4CBV A;  1WD0 A;  4XTC S;  5KNB A;  1A3T A;  1PLF A;  4U68 A;  1F2Z A;  2KOL A;  1TS2 A;  2NVT B;  4RHS A;  5HGT A;  3W3A A;  1HUM A;  3T16 A;  5EPK A;  3T53 B;  4A3M B;  5KIX A;  1LT3 D;  3KK7 A;  2HDM A;  2KEE A;  1I4X A;  1CFM A;  1MBY A;  1U9R A;  1SMY C;  3GTJ B;  1PRT F;  2PPB C;  1TY2 A;  4DF7 A;  3JAM E;  4L63 B;  4KKU A;  4MN3 A;  3BYT B;  3EJI A;  5C4H A;  1BQQ T;  1QJO A;  2FJ2 A;  4IUR A;  4O1N A;  2VB3 X;  4CKE A;  2L1B A;  1DOM A;  3IFT A;  3L7Z C;  4TRD A;  1LTS D;  3EQL C;  5JEA J;  3A8K E;  1BBX C;  2B8G A;  5JEA G;  1FD7 D;  2V4D A;  1PXU A;  3NWS A;  4KHZ A;  2IW3 A;  2R61 A;  2BDN A;  1SMY D;  2FMC A;  1C4Q A;  3OW7 A;  5FOB B;  1I6H B;  1LT4 D;  2GA4 B;  3AB9 A;  1PFN A;  3SVM A;  1SYD A;  4EGV A;  1V8Q A;  3I8Z A;  3S2D B;  5K5P A;  2HUG A;  1GXD C;  1LTT D;  4ILW A;  1CHP D;  3NXW A;  4JBW A;  3C1F A;  1W6J A;  1LAB A;  1UEA B;  2DNC A;  3R2T A;  3BYY B;  1WTO A;  3JAM L;  3OHX C;  3I72 A;  2KVM A;  2EYF A;  1II3 A;  1SAP A;  4I7Z C;  1OXT A;  1B44 D;  1YNJ C;  3DUZ A;  4XQN A;  2ICI A;  4M8A A;  5LL6 S;  3VA5 A;  2F0P A;  1BF4 A;  3J81 L;  1S4Z A;  1TQO A;  2PZT A;  3M7G A;  1IKL A;  5JOB A;  1CQF A;  1ENA A;  4IUT A;  2OXP A;  4XIG S;  5C4J B;  1KAA A;  4RFB A;  1Y1V B;  1Q3L A;  1H9K A;  2F0G A;  5DNF A;  1STN A;  2PZW A;  3OMC A;  4HCE A;  3FRP B;  1MSG A;  2PNR C;  4NP5 A;  2JP1 A;  2K5D A;  3CHB D;  2FFK B;  1WTX A;  3S15 B;  1VMP A;  3HOU B;  3IAY A;  3HEJ A;  1YNJ D;  1STA A;  3LWU A;  1G6Z A;  4CGY B;  2JA5 B;  1F9Q A;  2F0F A;  1ENC A;  4FF2 A;  2WKC A;  4RKB A;  2JE6 I;  1OO9 B;  3A7A B;  3TZD A;  1KDC A;  1CA6 A;  4XDX A;  1K8M A;  1EY6 A;  3K57 A;  4G7Z C;  2NVQ B;  2KCC A;  1EZ6 A;  2F0H A;  3VYU A;  5C3E B;  1HTP A;  5E1F A;  4C3J B;  3MFG A;  3K6O A;  3PO3 B;  1PDQ A;  1M8A A;  3R2I A;  1EZ8 A;  3TP8 A;  2F0J A;  4HSP A;  3BVG A;  3A7L A;  2J4X A;  2WAC A;  3NQT A;  5CV7 A;  3BDL A;  1H9S A;  2D9U A;  2PQE A;  5CC4 A;  5ISR A;  3MEH A;  2XNA C;  5COY A;  2EDG A;  1H9S B;  1PFB A;  2R3Z A;  3QOL A;  5D3D A;  2NZ1 D;  1B2T A;  4RWS C;  3KLR A;  5G3L F;  1EY4 A;  3WDN A;  1QNU A;  1ROD A;  3BZD B;  4KY7 A;  2FHT A;  3P75 A;  5T1I A;  2QCP X;  1SE2 A;  3ITP A;  3NPP A;  4QCL A;  1Y8N B;  3SHL A;  2PMZ B;  3TP7 A;  4NMZ A;  3MVV A;  3VYS A;  1U4R A;  1JOR A;  2B2T C;  1U4M A;  4BY7 B;  1GHK A;  4RGN A;  4F87 A;  3PO2 B;  1S5D D;  5I4D A;  1AEX A;  1S5B D;  2NTS A;  3FPU B;  3PIP 3;  4XQJ A;  2B2V C;  2A73 B;  4O42 A;  5G3L D;  3BS1 A;  2Q8R E;  5JPN C;  1LO5 D;  3MXG A;  1PFM A;  1I4P A;  5J39 A;  5EJW A;  1HHV A;  5IT9 E;  4KV6 A;  3MC0 B;  2YYZ A;  2NWG A;  2K28 A;  1Q8I A;  1EL0 A;  4R9W A;  1SYF A;  4IFD G;  5IGD A;  1XTC D;  2DNE A;  4IAL A;  3DXJ C;  4C3H G;  4B08 A;  3RUZ A;  2PW7 A;  1RHP A;  4K2L A;  4ZRZ A;  1ET6 A;  2X6G A;  1DOL A;  1HA5 A;  3K5O A;  4IUV A;  3I3C A;  2WII B;  5DM6 3;  1TVX A;  5KYL A;  3KBX A;  1D5X C;  2F4I A;  3K7A B;  1XX8 A;  1IW7 C;  4KD4 A;  2F1M A;  2SNS A;  2NN6 I;  4DXG A;  2KUM A;  1VDZ A;  3SEB A;  1AZP A;  4K8J A;  2MHV A;  1Z7T A;  3TZU A;  2F03 A;  3OPO A;  1R4Q B;  3FMC A;  4FXK C;  3NUC A;  3E5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...