1O78A

Biotin carboxyl carrier domain of transcarboxylase (1.3s) [10-48] deletion mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
84
structure length
84
Chain Sequence
MKLKVTVNGAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Studies on the Solution Structure of a Deletion Mutant of the Transcarboxylase Biotin Carrier Subunit
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
molecule tags Carrier protein
molecule keywords BIOTIN CARBOXYL CARRIER PROTEIN OF METHYLMALONYL-COA CARBOXY
total genus 6
structure length 84
sequence length 84
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2002-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1o78A00
2AWOA 2EJFC 3CRKC 2V4DA 4DK0A 2KCCA 1Y69U 1GUNA 2DNCA 3SDZA 1BDOA 1H9RA 1H9SB 1K8MA 3FMCA 1TU2B 2K7VA 3PUXA 3NE5B 3TZUA 2JXMB 4TQUS 1ZYRC 2E74C 2F1MA 2JEBI 4G7HC 2Q8IB 4BA1I 2D5DA 2BA0A 3PV0A 1DXMA 3MXUA 1H9MA 2D62A 3PUWA 3SE0A 4IQZA 1FR3A 1GHJA 2BDOA 4H0LC 4TKOB 2O5IC 3KLRA 4OO1H 1B9NA 3T51B 4H13C 1GUSA 1OXTA 2AUJD 1SMYC 4G7OC 1GUGA 3T56B 1Y8NB 2EVBA 1LABA 4IFDH 1ONLA 1Q12A 5A35A 2PCFB 1Q1BA 3A7AB 5BN3A 4KN7C 1V8QA 4IFDG 2NN6G 1IW7C 4JBWA 1K8OA 2A6ED 4JK1C 1HTPA 4HR7B 4KHZA 2JEAI 2B8FA 1GJXA 1B9MA 3M4YA 3M7NA 1E2ZA 1O7LA 1V43A 1HCZA 1Z6HA 2A68D 3D31A 5BN4A 1HPCA 4G7ZC 2A6HD 2LMCB 1TKWB 2A6HC 3PUVA 4OO1G 3T53B 2R6GA 2O5JC 1CFMA 4L8JA 3FPPA 4KKUA 1CI3M 1T5EA 2EJMA 2K32A 3QIAA 4XIGS 1YNNC 3W3AA 1CTMA 4H44C 1OXUA 2NN6H 3OPOA 4LK1C 3A8IE 1E2WA 1LACA 1GUOA 2EDGA 5KNBA 3M85A 3VR4A 2AUKA 3P20A 2BA1A 3ND9A 1H9SA 4XTCS 3H94A 1VDZA 3BG3A 2ZT9C 1ZKOA 5C0XG 1IYUA 3A8JE 2A68C 1VCIA 3VA7A 4KMUC 1GUTA 2B8GA 5KNDA 1HQMC 1Y8OB 4DK1A 5K36H 1DD2A 1OXVA 2D2CC 4DNRB 4KKTA 3I73A 4RCNA 4KN4C 3GQBA 3CRLC 3DXJC 4LJZC 3RLFA 4KKSA 1IW7D 3GD7A 2BE5D 3VR3A 1E2VA 3L7ZC 2E75C 2CW0C 3QJYA 3LNNA 4KI0A 4BA2I 3I72A 5BN5A 2A69C 4PV1C 1G291 1IYVA 5JEAH 1I6VC 5K36G 3OOCA 3WDNA 1H9KA 1OXSC 2PNRC 2JE6I 3AB9A 3VR6A 3VR5A 1FYCA 2L5TA 2BE5C 3LWUA 4DNTB 1A6XA 1H9JA 2DN8A 1Y8PB 1Z7TA 1VF5C 2E76C 3A7LA 3HGBA 3VR2A 2YYZA 3IFTA 3QG1A 5JEAG 3EQLC 4I7ZC 5C0XH 3PUZA 3N6RA 1O78A 2KA7A 1EWHA 3PUYA 1GHKA 3MFYA 4GZYC 1OXXK 2A6EC 3I4LA 2EJGC 3OW7A 1VF7A 3U9SA 1DCZA 3A8KE 3D4RA 4OGQC 2NN6I 1PMRA 2IT1A 5KNCA 1Q1EA 3BDOA 3IKJA 3ND8A 1YNJC 2A69D 1Q90A 1QJOA 2K33A 2PPBC 2DNEA 2QF7A
chains in the Genus database with same CATH superfamily
3S16B 2ZTEA 4LF4Q 1VQNA 2DNCA 5ELFA 3P1HA 1TU2B 2K5HA 2GA4B 4IUVA 1VQ4A 4GKKQ 1SN8A 4OONA 3K5MA 2E74C 2R7ZB 3KDFA 2NTTA 3J81i 4IUUA 5EPLA 3J80c 2MUYA 1X3GA 4KK7A 4LFBL 1GUGA 5CV4A 4FYDA 5CBEE 1O7ZA 2WB1B 1IBKQ 4JI8Q 4K0KL 4IN3A 4X3KA 5IOCA 3MWYW 5M3MG 2J0TD 4IJHA 1Y1VG 2A6ED 1JB7A 3OYYA 1R9TB 4WJWA 3ONAB 3KUPA 2KHIA 2JA9A 1Z6HA 2PI2A 3D31A 4GKJQ 1ENCA 2JA8H 3MXNB 4LWCA 4OL7A 3C2PA 1EEID 1HZBA 4RGTA 5LHY1 1M8AA 2WB1G 3HOXH 1S5BD 1JT8A 1UEAB 4BY7B 4AIMA 2NN6H 1PH7A 2CWPA 4HJ5A 3KK7A 3CQZH 2IX0A 3UE0A 4B3TQ 3NTKA 3TMEA 1VDZA 4DR6L 2ZT9C 2OXPA 5C3XA 2F0JA 3PO3H 3HOVH 1R4QB 5IWAL 3VA7A 3K5OA 1HR0L 1YHBA 1IBML 4GNXC 1DD2A 2ZM6L 1EU3A 5IYCG 3CRLC 2RCFA 3CMAA 2MO1A 4HJ8A 2AQ2B 2TSSA 2UUBL 2F4VL 2LXJA 3HOVG 1DOMA 2EYJA 4L6TB 1SNMA 3CXCA 1I6HH 2RF4A 2VXWA 2VY3A 3AB9A 1XNRL 1Q86C 4RAUC 1CHQD 2PQAB 4CDDC 1N8RC 5K5PA 2QCPX 1VF5C 4N9PA 5JJLA 1LTSD 5C0XH 1OTCA 2ZTDA 3JAME 1SLJA 2XTIA 4MNOA 4N8FA 1HRJA 3Q22A 2WAQG 5FKAC 4A3LG 2EJGC 4DV3Q 2ICIA 1DCZA 1STBA 2SDFA 3BZKA 3D4RA 3K5LA 1YNJC 2ZJPA 1PTOH 3DHQA 4UHVA 1XMOQ 4MTKA 4GS3A 5G3LF 4YWMA 5GAGC 1BUVT 3GV6A 1IBLQ 3ZJYC 3J81j 1DXMA 4DV2L 1CSPA 1WTPA 1TWHB 1QUQB 1V1QA 4A93G 2FHTA 2Q2HA 1B9NA 2B2YC 4JG2A 4NXNL 3PIO3 2Z0SA 4RG1A 1O7YA 3TS0A 4EX5A 1EY0A 2Z1CA 1Q12A 4DR7L 1G2TA 1HZAA 3G7LA 4A3JG 1IW7C 4R4CA 1SNQA 1EOTA 2NUCA 4KHZA 4A93H 1KL9A 2K14A 4CBVA 3M4YA 4JI5L 1HR0W 4UDUC 5C4HA 5L37A 4G7ZC 1GVPA 4DKAC 1AZQA 2A6HC 4QIWB 4RFBA 4HCSA 4B3RQ 5C0XJ 2Z6BA 4XYQA 5EKIA 4JI1L 1L0XB 3D4WA 3QO2A 3J81c 1STNA 1U4RA 3NQTA 2IHEA 3VR4A 4FF3A 1VQGA 2NWGA 5DAUA 2GVBA 3HKZB 3BG3A 5IGFA 3S2HB 4G57A 5IYBG 4U68A 1PTOF 1HZ9A 1RCVD 2ALYB 2H1EA 2R93B 2JP1A 1YBYA 3DWQA 4NB3A 1Q82C 4V190 4LFAL 1CQVA 4A93B 5EKLA 3TP8A 1CKOA 1K9MC 1PH2A 1G291 3F2UA 1K8GA 2HUGA 3WDNA 4A3IB 1OXSC 3I4NH 5E4XA 2BE5C 4H7BA 3HOXB 2AMCB 2JJQA 1PTOD 1Y8PB 4KY5A 3EQLC 3GTLH 3GTLB 1N32Q 1GHKA 1S3OA 3MFYA 4IPGA 1HR0Q 1IBMQ 2OF1A 4DAVA 1F2LA 5KYLA 2B63B 4BY7G 3I4NB 2N3SA 4B3TL 3NTHA 2KCCA 1E24A 1H9SB 4Q0FA 4C3HB 3G6EA 2Z9HA 2DY8A 2B2VA 4JI6Q 3SEBA 1XTCD 3CPFA 3FKIG 2EXZA 1YJ9A 4AYBG 2BCOA 1SMXA 3I70A 3PO2G 4JI2Q 3CAMA 3KLRA 1V1OA 2PMZE 4DXGA 1T5XD 5EBCA 1ESFA 2XVSA 2F0LA 2F0IA 2E2IB 2VZAA 1LTGD 4DUYQ 4O2DA 3MA2B 2EIFA 4MZ9A 1BBUA 5LL6X 2RKSA 1VQBA 3C1EA 4IOCA 1PH4A 4NW2A 5H1SE 3GP7A 1KNAA 1PTOB 1DZ1A 1B3QA 1EUJA 2VB2X 2RBMA 5BN4A 5M5YH 3GTOB 2MHVA 3PUVA 2SOBA 4LF5Q 2XWJB 1NBWA 3H91A 4X64Q 1PYWD 4GKJL 2O5JC 3T1YL 3MXNA 1XYIA 1K28A 3I3CA 1N33L 2K05A 1E2WA 2MO0A 1ILQA 2AQ1B 4LW1A 3PIP3 4XTCS 1TR5A 2WINB 4RGMA 1IBKL 1D8LA 2JA7B 2Z6KC 3S14H 3K0YA 4LFBQ 1BKBA 1YNND 2QDBA 1DJRD 1VQEA 2HD3A 4QCLA 3HZXA 4ZQ3A 3F2CA 3GTPB 4EQNA 3GQBA 4XT1B 3RLFA 2KJXA 4ODGA 4A3EH 3RZDH 3VYRA 1R9TH 2MJ8A 3FEWX 1D7QA 1E2VA 3UDIA 1CM9A 4ILWA 2WV6D 4UP7A 2UUCQ 1L1OA 2D0PA 1JJ2A 4LF4L 5M5WH 3K57A 1VQPA 3U4ZA 3VR6A 4DNTB 4A3IG 3WWVA 5JEAG 3H3VC 3S17B 3AU7A 4DV2Q 3I2ZA 1OXXK 2GVAA 3U9SA 4ZLTF 1WTQA 3PO3B 1IBLL 1FJGQ 2J4XA 5IIFA 3Q23A 1KXLA 3TP5A 2LXKA 5HGQA 4ZRZA 3ULPA 4KV6A 1A3VA 1IKLA 1STGA 3HKSA 3VYTA 3SK6A 2KENA 2M9VA 1EY7A 1PFBA 3MFGA 3OTOL 2E2HH 4X3UA 4EVOA 5FLXc 1HH2P 4XQQA 3CMEA 3GTGB 4TKOB 4A3FB 3G71A 2Q2UA 2O5IC 1TT2A 1GD7A 1IZ6A 1K0RA 2WP8J 2NZ1D 2JA5B 3E0EA 4P74A 4OXPA 1WD1A 2K75A 3OSOA 1HXYD 1LTBD 3BZCA 2F3IA 4DV1Q 2JA6G 2Q8TA 2UUBQ 1MIUA 1PFSA 4IALA 4DN4M 1QNKA 1BXTA 4BY1H 4FP5D 4R4TA 2VNUD 5A2QL 4ZYSA 1BCPB 1D2BA 1N36L 5CV6A 3V2TA 1PYSB 3QWNA 1QZHA 4J8QA 3PF4A 2ZJQA 4KKUA 3HOWB 1B53A 3S1RB 1EY6A 1LTAD 1OXUA 1SMYD 1X9NA 1RF2D 1D5ZC 2MFIA 4KD4A 2K4KA 4K8IA 4CDFC 1CSQA 4L5TA 4C3HG 3KF6A 2Y0SE 5CGKA 5LL6S 1I4QA 1SJED 1GUTA 1HFGA 2H4OA 3TREA 1Y8OB 1EZ6A 2K5QA 4K2KA 2UXCL 4DR2L 1RKNA 1TY2A 5E1FA 2JA5H 3DXJC 1I94L 3STBD 3U4VA 1RJTA 1U0LA 4TVAB 2UU9Q 1X3FA 4HAEA 3GTGH 1Y14B 3QOLA 1QG7A 4WRDA 1Q8IA 2MP1A 4B3SL 1GUWA 4JYAQ 3RZOH 4ME5A 1SRUA 1QVCA 1KDCA 2CW0D 3CKIB 4DFAA 1A6XA 4I65A 4YHHQ 2YYZA 3QG1A 3A0JA 1PA6A 2VUMB 2L0CA 1BCPD 3H0GH 5IGEA 2VUMG 3BU2A 4IO9A 3I4LA 2CVRA 3SVMA 5JVH3 3A74A 3OIQA 5CBAE 5E7NA 5C3EG 4F7XA 1MJEA 1BVSA 2K33A 1KAWA 2PW5A 5AFWA 2QA4A 4DXFA 4CGYB 4YCUA 4O0AA 4LNQA 1TQOA 2EQSA 5LMNL 1Y1VB 3E6ZX 2NVXH 1LV9A 2F0HA 3S17H 4GNXA 1GOZA 2UXBQ 1SDFA 2N78A 2NB0A 5IYCH 4J1MA 2KEEA 4AQYL 1H9MA 1SE8A 3I55A 1FR3A 1BNZA 1VQ8A 3FDTA 1PZJD 1C9OA 1GUSA 4Y7NB 2B2UA 4KY7A 3H3VH 4LF9Q 2NZHA 3BVMA 1L2FA 1V1PA 2YTYA 4JI3Q 1KLGD 1XMQL 1HNXQ 2PCFB 4DV7Q 2HCCA 2NN6G 1YJNA 3CHBD 2X6LA 1PRTF 1BR9A 4GOPA 4A3JB 5M3MB 2L12A 4LF7L 1S5ED 4PMWA 4R4QA 1B9MA 1VMCA 3C46A 3D8GA 4JC0A 5JAVA 2RSNA 4JBJA 4A3LH 2Q2IA 3M7GA 4RGNA 3M3YB 2F0VA 3FKIH 3BDCA 1S5DD 2EXDA 3HOUB 5I9OA 1HZCA 3FHWA 2QGQA 4JI4L 4A3CG 1TWHH 1TWCH 4B3ML 3ND9A 1TWCB 5AJ3L 3O13A 1O80A 1JCKB 3TS2A 3DEPA 3U50C 2F0EA 1CZGA 1F77A 4R8IA 4DAPA 3ULLA 1CKNB 1UE5A 3BS1A 1BOSA 4J6HA 4LJZC 2WAQB 5HURA 4LF6L 3L7ZC 1S40A 4BA2I 3J80E 1TS2A 4DK6C 3VDYA 1NJIC 1BCPF 1IYVA 1AEXA 2F0WA 3K80C 5ELNA 5HY6A 5HGTA 5KEEA 1NR2A 3CC7A 1ASZA 1HHVA 1Q46A 3OHXC 4X66Q 3LGJA 3KOJA 1B1ZA 2EYFA 3I56A 3NWTA 4BBRB 2N88A 2QDLA 2Z8LA 3EJIA 2A6EC 3S1RH 3K81C 2F3WA 3F8TA 2E8GA 4LF7Q 2LY7A 5M3FB 1PFNA 1RTNA 2F0QA 2EJFC 2EY2A 3AYHB 1BDOA 1H9RA 1KABA 4DV7L 1NSNS 4QUCA 5IYBH 2KHJA 2PO4A 2QW7A 1HJPA 3CU7A 4M1UB 3BVZA 2D62A 1U9RA 2UXDQ 2G9DA 2PZUA 1F2YA 3TEHB 1WCMB 3T51B 5DEHA 1SBBB 1PH1A 3T56B 3UDXA 3K5NA 3GTMH 1EU4A 3A7AB 4M8AA 1SYCA 2P5ZX 1I4RA 5C5LA 1LT3D 2YU9B 4JK1C 4QGUA 5IGBA 2Z4IA 1DOKA 1SXTA 3EIVA 4TSSA 4DAYA 2HCIA 5GROA 1PRTB 2OQ0A 4XT3B 5C6AA 3RNUA 2R6GA 5CMDA 1S72A 3S15H 1D5XC 5DM63 3QIAA 3NELA 5J3BA 1W3SA 3KF6B 1TWAH 1KAAA 3PIPA 3MXPA 5C44B 5LMUL 3L3OC 2IJ0A 1WCMH 1SAPA 2VQEQ 2F0PA 2TMPA 2UU9L 2A68C 1JJGA 5M3FH 1FL0A 1KTKA 5M5WB 1VQJA 2KHSA 1PRTC 4DNRB 2O2LD 2AQ3B 4JOIC 5ISRA 4KKSA 3P75A 1VQDA 1TIID 2NVYH 2K1BA 4HIDA 1LTRD 1BO0A 1JB3A 2A69C 5C4JH 2B2YA 5I2YA 4A75A 1J6QA 4OX9Q 3TZDA 1JWMD 1VQOA 1K8AC 3GTMB 5EAYA 1J5EL 3I90A 2IX3A 1JMCA 3AEVA 4IUTA 3G48A 5D3DA 3IFTA 1EYCA 1QILA 3K7AH 4I7ZC 4P73A 3RUZA 2BH2A 1YITA 3CCMA 3HOZH 2ZTCA 2F3VA 4OGQC 4YCWA 4X66L 2B63H 4QJFA 5FO9B 2ES2A 4DV1L 3CC4A 1K8MA 1HNZQ 4ABNA 4HN7A 4L63B 4RCOA 4F88A 2KCTA 1KD1C 4IUNA 2PYKA 4C3JH 1EIHA 4BS9A 4ZKBB 3PF5A 4OELB 3SHLA 1B3AA 4A3BG 3OTOQ 1JE5A 5IT9c 4LUOA 4GOPB 2NVQH 5BN3A 1F9QA 4KN7C 1JOOA 4JCVE 1NE3A 3HKZE 2NZOA 1FGUA 2VS1A 4C3JG 3Q8DA 1K8OA 5GAEC 2MPMA 1HTPA 4KHVA 2BDNA 2RHQB 1A8VA 4MN3A 3NUCA 3J81E 1FJGL 4IUPA 3W5OA 1RL2A 4X3SA 1Z9FA 2A6HD 4IZ8A 3D4DA 1B70B 1EYAA 3IAYA 1NAPA 1CT1D 3PCOB 5GAHC 2ZJRA 1NNXA 2D9UA 1QUQA 4XIGS 1II3A 5LMNQ 1Y1WG 2EE1A 2EDGA 1AH9A 3BVGA 5EQ0A 1H9SA 1VQKA 2K01A 1E7ZA 1ZKOA 3CCRA 5IGDA 2QILA 2OCEA 1VQHA 3I7FA 3M4OB 5KNDA 3I4MG 4DK1A 4A3IH 1A15A 1CQFA 1NMFA 1X3QA 2KQ3A 2XNAC 1SE4A 3GD7A 1PVOA 4JYAL 1QNUA 3KF8B 2E75C 3E9IA 1KC8C 4A3KB 3I72A 4IURA 4B3SQ 4DR4Q 4DR5L 2A73B 1JORA 4X65Q 4RH6A 1VQ9A 1H9KA 3VR5A 1MHWC 1TWGH 5FJ8G 1JOQA 2L5TA 3Q0AA 4DU9A 5J1ZA 4WJ4A 1X54A 3SK5A 1CUKA 1I4GA 4CKEA 4DV4Q 5IP9G 1MSHA 2VQFQ 2I5MX 3D3RA 5IODA 2LFNA 3MZ5A 3BDOA 5C4XG 1JJCB 1LM0A 5FJ8H 2DNEA 1LO5D 1I4PA 3NPPA 4R8NA 3DM3A 3OIPA 1GUNA 2NVXB 4K6LA 1STEA 4C3HH 3K7AB 2F03A 2G5DA 2JXMB 3GO5A 1FVIA 1XWEA 3M4PA 4A3MG 1I94Q 1MD2D 3DWAA 4JI2L 4BXXH 1ENFA 4GN5A 4QIWE 1G51A 2PI2E 3S1MB 2KCNA 4DR2Q 4IPDA 1K83H 3UI2A 4BY1B 4U673 1J9OA 5DM73 2EVBA 1CA6A 4JOIA 4Q5VA 3AFQA 1MKHA 2RHSB 4RA8A 2EYMA 3AMUA 4F8MA 4LF6Q 1AP0A 4DAMA 4RKLA 3QR8A 3RN2A 3GV3A 4P71A 1EQTA 1SJHD 3NTIA 1N32L 2KBNA 4DR1L 4OO1G 3T53B 1RDPD 1U5KA 3EVQA 3S1QB 1BBXC 3S1QH 3F2BA 1UNSA 3GTQH 2K32A 5AJ3Q 4A76A 1YNNC 2L11A 3W3AA 1EQQA 5CC4A 3CW2C 2BA1A 3MTSA 4C3JB 2RDFA 1WTHA 3PQIA 4OIJA 5G3LD 2AHOB 4LFAQ 5NUCA 4P72A 3QOJA 1B4OA 2R7ZG 4GOPC 4KLKA 1E1TA 1ILPA 1RIPA 3RMHA 5CORA 1PZKD 3K8AA 3LNNA 2Q8RE 2YTVA 2M2LA 1YVCA 3EROA 1XMQQ 1S5CD 2A5HA 4HTHA 2ID0A 4NDXA 3OOCA 1XXGA 5IGGA 2I5LX 5T1GA 2OQKA 3IFDA 1EQVA 1EOVA 3BYTB 1YIJA 2E76C 4HIOA 3EN2A 1ESRA 5IGCA 4B3RL 1P16A 1EWHA 4E6IA 5EPJA 2I46A 3UDFA 1Z47A 3ZYYX 2B39A 4K5XA 5C4JB 3MVVA 1PTOC 1Q1EA 1SNCA 3ND8A 4NXMQ 4EGVA 2NVTB 4DF7A 2AWOA 3CRKC 4PNYA 2C5CA 3H6MA 4GLVB 4QMGA 2JA8B 3URYA 3R8BA 4C1NI 1PDQA 1O7IA 4IPCA 4JV5L 4PG3A 2R92B 1L1OB 4HIKA 1I3QH 2R7FA 4DA2A 3T1YQ 2EZVA 4BA1I 1EY9A 5JPMC 5FLXL 1WYDA 4DR3Q 1TWAB 2WKCA 2N55A 4YHHL 2JSOA 4H0LC 4K8JA 1N34Q 2EYHA 1CZWA 5M5YB 3HOVB 1FGBD 2VB3X 2I0QA 2KUMA 4PZ6A 5CV8A 3PSIA 4GNXB 5EPKA 2H5XA 1A3TA 2GN5A 1LUZA 2B8FA 4ID6A 1ICFB 4LUZA 1O7LA 3J80i 4DV3L 2NBFA 1SE2A 3OWFA 4PZ7A 4YCVA 1AFPA 5C3EB 3RD4A 4N9TA 3P7JA 2C35B 3QB3A 3OMGA 1VQCA 4A3BH 4LK1C 4A3DH 3A8IE 2QEXA 3M85A 4MIUA 3A55A 4A3GG 2L9HA 1IYUA 1KNEA 3KYHC 5K36H 2NVQB 1HTLD 3RR5A 2X69A 2Y0SG 4FO2A 1OXVA 5GQOA 4PMBA 5ELEA 4RCNA 4KN4C 1ASYA 5CV7A 4NP5A 4QF4A 4DPGA 2CW0C 4DK3C 5BN5A 2E2DC 1JQYD 1KRSA 5TSSA 3KF8A 5JEAH 3MEFA 3F2DA 4XDXA 5K36G 1Y1WH 3JC66 2ZXOA 2RCNA 3KBXA 3VYUA 5IP7H 1FNUA 5CV9A 5ELBA 1HQRD 3HGBA 1E0BA 2B2UC 2EY6A 4OWTB 4QQBX 4KHPQ 3I91A 4A3FG 4AYBB 1PMRA 3X3MA 1QJOA 4JBMA 4RGOS 4ZCKA 1EEFD 3S2HH 5C0XI 3GDEA 4HSVA 3SDZA 4K0KQ 4Y52H 2EOTA 3K59A 2HDMA 4JI8L 2K7VA 5C5MA 1STYA 2E2JH 2JA6B 2FINB 4WFN3 2F1MA 2JEBI 3A54A 1V9PA 3GTKB 2Q8IB 3A5UA 1CHPD 3E9HA 1N34L 1YEZA 3PV0A 1TS5A 3NSWA 3PO3G 3A56A 2V1CC 2N8NA 4IFDJ 2XN9C 5FLXE 2HT1A 2PZTA 2L55A 1YJWA 1AE2A 2CQAA 4V0BA 3NK9A 1MJCA 1LABA 1ONLA 1X55A 3NENA 1YHAA 5A35A 1Q1BA 2UUCL 1HA5A 1U4PA 1WI5A 3KJPA 4IFDG 1PFMA 3DMUA 2EYOA 3K58A 2F0DA 3DLLA 5CV5A 3JAMc 1GJXA 3V05A 1BQQT 4FF4A 4BBRG 1V43A 2N49A 1JWSD 3HOZG 2LMCB 4A3MH 1MSGA 3I4MB 1LTTD 4BXXG 4WJ3M 1I4XA 3TSSA 3R3OA 2B63G 1TY0A 2CQOA 4C1NK 3A5ZB 2SNMA 1G6ZA 4DV6L 1GO3E 4ALPA 4FXKC 5E3FA 4BBRH 2AUKA 3P20A 1N33Q 2NVTH 3DUZA 1IKMA 1LTID 2ICEC 1L0YB 3TBIB 5IYDH 4KD3A 1UUPA 4JBKA 1QB5D 1G2SA 1WFQA 4JW0A 1HQMC 4X64L 5FK9C 4LF5L 3C3LA 5IT9L 4AYBE 2JK8A 3RLNA 1A2TA 1E22A 3CCVA 2FFKB 4P75A 4EQPA 4K5VA 4QY7A 4R4OA 1WTWA 4C3IH 3C1FA 2K5DA 5C4XB 4DUYL 4BBSG 3CCSA 3KJOA 1XMOL 2PQEA 4HMJA 2KEDA 3H0GG 3S1NH 3S2DB 3HKZG 4AH6A 2DN8A 3VR2A 4DAYB 2NTSA 5C3EH 1EIGA 4DR1Q 2B2WA 3V96A 2R61A 3R93A 1UE7A 2KOLA 3DWPA 1JWUD 1EFWA 4DR6Q 3HP3A 2HIVA 2QKIC 3HOUH 2ZXRA 2F0SA 2K04A 4R4IA 2OEOA 2OTLA 1BCPC 2DY7A 3ICEA 3EFXD 4XXEA 3WOEA 1NCVA 1NUCA 3W1BA 4OO1I 1F9PA 5T1IA 3DEOA 3STBC 5JJIA 2R92G 4UP8A 4UP9A 2ZM6Q 1SNDA 1HUNA 4HEDA 1DOLA 1M90C 2WIIB 5FLMG 4Y7NH 1YZ6A 3UE1A 1C48A 1SR3A 2K6AA 1B44D 2Z6KA 3MEHA 2LKVA 1AN8A 2F4IA 4FNFA 4HSPA 3MAQA 4FXGC 3JAMi 3GTJH 1DM0B 1TWGB 3S1NB 3UDGA 1HCZA 2WKDA 4A4IA 1A63A 1HPCA 1Y1VH 1TKWB 3I4MH 3S24A 4C56C 3TP7A 2E2JB 3FPPA 3ITPA 1YNJD 3SGIA 4GKKL 1GXDC 1ZYRD 2EJMA 4JV5Q 4J15A 1J8IA 4DGZA 1CTMA 1SYGA 1LT5D 4XQJA 1S4ZA 1XJVA 3CQZB 1PRTD 3H0GB 4DV6Q 2QEJC 4DR5Q 4JI1Q 3HOXG 3H94A 4NXML 1PXUA 1LT6D 3HOYB 1NR4A 2WFWA 5DLQE 4YWLA 2XSCA 2RVLA 2MQHA 3CCQA 2R93H 3EA6A 4DR3L 4N8X1 4JI5Q 1TWFB 4FVMA 3ERQA 1IL8A 2OWOA 4OWXB 4A3EB 1WVLA 2JA6H 2DUDA 1X32A 1AZPA 3MXGA 1D1IA 2K50A 4H02A 4PQXA 4DR7Q 4FDBA 2G9HD 2KCMA 4R1JA 1FYCA 1EFID 4NXNQ 3GTQB 4HJ9A 2YTXA 1PZID 3PUZA 3NBIA 1O78A 1M1KC 4S3SA 4L5RC 3PUYA 3RN5A 1PH6A 2E5LL 1E1OA 5CYUA 4DK0A 4CJ0B 4BWGB 2NN6I 1GKHA 3IKJA 1W6JA 1PYBA 1PH5A 5ELDA 2F0GA 2HHHQ 1EY5A 3GTPH 3RLOA 2I5HA 3TZUA 3U58A 2F0NA 2IW3A 1EQRA 4G7HC 3BDLA 2D5DA 3NWSA 3KBGA 4B9WA 2XRSD 4KHPL 3PUWA 3SE0A 2CH4W 3EBEA 4ZUIA 1YHQA 3FRPB 1ICWA 4OO1H 1OXTA 1XNRQ 2VL6A 3MHBA 1WTOA 4KY6A 2RSOA 1LYLA 1MI2A 2Q2TA 1I5FA 1HNZL 4A3KH 4C2MB 1PH8A 5FO7B 4RMFA 3BZDB 1EYGA 2F4VQ 1RTOA 1X56A 2VUMH 2M00A 3FPUB 1C8CA 4YY3L 1KRTA 5M3MH 5JJKA 1CKNA 1RHPA 3Q6SA 1JICA 1I50B 1QWYA 1TS3A 2DJFC 2K5NA 5D3IB 4DV5Q 3K0XA 3SR1A 5IWAQ 2R92H 4A3KG 1X3EA 3D0FA 1STAA 1TVXA 3G6JB 3LX0A 3M9BA 1CI3M 1M4VA 5FOBB 1LACA 2WB1E 5KNBA 1W2BA 4LMQD 1AE3A 2PQAA 5FLMH 4RHSA 1VQFA 2FXQA 3I8ZA 5JJZA 1XPOA 1EY4A 3HOYH 1HUMA 4RKBA 4KMUC 4LUVA 2VQFL 1YI2A 4FF1A 5I6YA 4PMCA 4IFDI 2D2CC 4OWWB 4A3BB 3CCJA 1STHA 2X6GA 1H95A 2BE5D 3WOFA 1F9SA 3T13A 4KI0A 3T16A 1YNXA 4X65L 3OW2A 4PV1C 2HDLA 1I6HB 4NPSA 1WJJA 3W2DA 1Q8KA 1PV4A 3CPWA 2CCZA 3H3VI 3HEJA 1MGSA 4PZ8A 1F2ZA 1UEBA 1SROA 2KA7A 1QCBD 5C4XH 3J81L 4A3CH 1NTGA 3A8KE 2BH8A 4K2LA 2A69D 1Q90A 2WAQE 2XWBB 2JE6I 3DM1A 5C44H 1DGSA 3U9OA 1EZ8A 3SK4A 3NHHA 1NMGA 4A3GH 4BBSH 3D6WA 4WORA 4BY7H 2F0FA 4TQUS 1ZYRC 1ET6A 5KRUA 2XRQD 1D1KA 1SE3A 3Q24A 1XNQL 3J7AF 4H13C 2SEBD 1K3RA 2F0UA 4QB4A 3D6CA 1SFOB 1RD9D 1LTLA 4POGA 1Y8NB 4DV0Q 2AKWB 1BBWA 3HS0C 3ULJA 4UY8C 5IP7G 3NP8A 1ZXTA 5F2DA 3X3NA 2HQEA 1VQ6A 1S5FD 4O42A 2ZXPA 4TRDA 1CK1A 1FD7D 4DUZL 3PIOA 3M4OH 1A3UA 4L8JA 3R2TA 4KJNA 1SYEA 2NYZD 3HFZB 3H15A 2K52A 1ET9A 3AQQA 4H44C 2UUAQ 1GUOA 3CCEA 1D5MC 2MGSA 4LFCL 5BR8Q 2EY5A 3J7YW 1HNWL 2OT2A 3MC0B 3S14B 1SEBD 2BOSA 3J80L 1PH9A 1XX8A 1K83B 1T9HA 4C2MH 4KKTA 2FJ2A 3KLWA 4POFA 1X65A 4GN4B 2CH4A 4X6AH 1IW7D 1QVGA 2HQLA 3E5SA 3VR3A 1EIYB 1VQLA 5ELOA 4XYOA 3QJYA 4HJAA 2YV5A 4O1NA 5IY0A 1JOKA 3M3YH 3E0JA 2IHFA 4B3MQ 1X3PA 5EGTA 4APVA 4CHTB 2CWAA 1PH3A 1KDAA 3N52A 1G6PA 2F0KA 3GTOH 2LSSA 2EPBA 3L0OA 4P2CB 4CKBA 4ZKCB 1RODA 2A8VA 1SFOH 4X62Q 4JI0Q 1C7YA 2J7ZA 2R93G 4JI7Q 5M5XB 1WOCA 4YWKA 1LT4D 2IT1A 2VQEL 5A2QE 1WCMG 4XQNA 1G8ZD 1J5EQ 4LF8Q 4OX9L 1G91A 3F1ZA 5COYA 1GM5A 4L5SA 4BBSB 1HNXL 4A3GB 4GLXA 4FF2A 3ER0A 4JI3L 3PUXA 1IXRA 1SSOA 3K6OA 1NY4A 3HOZB 4Z9CB 3CCLA 2JA7G 4DV4L 1B50A 3MXUA 2IWHA 1A0IA 1AW7A 4C3IG 4YIJA 5ELCA 3TN2A 1JE4A 4FXDA 2JYOA 4HMIA 2SNSA 2B3GA 2Z4HA 4CJ2C 3KLSA 4DR4L 3VA5A 5J39A 1X6OA 4JBWA 4EQ5A 3J7ZC 5C44G 2ENBA 2JEAI 5JEAJ 5J22A 5IYDG 2UXDL 4I7AA 3H09A 5I4DA 1I50H 1XPUA 1Q81C 2B2VC 4K5WA 1CFMA 3SXHA 1SYBA 1PHJA 1UE1A 3VYSA 2RDHA 3OPOA 1I4HA 4A3JH 2F52A 4MTNA 4K14A 3FVQA 1A62A 4EQOA 1EWCA 2R7ZH 3S9WA 1IL2A 3FKIB 5KIXA 2HIXA 2B8GA 4JI7L 4ULLA 4KTAA 5C3WA 3HG9A 5C4ZA 3TP6A 1R4PB 2XGTA 2CKZB 5EJWA 2K5VA 2IL8A 2YU9H 2EYPA 1LLRD 2R7DA 2JA5G 2D0OA 1B7YB 4JVZA 2PNRC 4IJLA 2AWNA 2F0OA 1VQMA 3S2DH 1H9JA 1EWIA 1Z7TA 1WTRA 2EYLA 2Y0SB 3CF5A 3OWEB 3N6RA 3S15B 4ZAIA 4DV5L 2MNAA 1N36Q 4UAIA 4C3IB 1W6KA 3CD6A 4R9WA 3T1HQ 3K7UC 5BR8L 1WTXA 1HNWQ 1UAPA 2QF7A 4LFCQ 3RZOB 2UUAL 5DNFA 4JI4Q 3I4NG 4G4KA 2F0TA 1B2TA 4LAAA 2F0MA 3T1HL 5IT9E 2NVYB 2A1AA 1TWFH 5M5XH 2BA0A 5EBDA 3HRZC 2PNHA 5GADC 2L1BA 4IQZA 1FNVA 1IYJB 4UPAA 1K0SA 5M3FG 3KDFB 3KLSX 2AUJD 1SMYC 4L5QA 4G7OC 5I9PA 1EYDA 1EY8A 4IFDH 5D14A 4K6DA 2XIWA 4DV0L 2ASBA 1TS4A 1V8QA 4LF9L 5KYIA 2CHBD 2RA4A 1F9RA 3BYYB 4ME3A 2B2TC 4GLAC 5E4WC 3PMFA 4DUZQ 3IRBA 4BY1G 4B9XA 4A3DG 2EY1A 4IUQA 3L2PA 1HFNA 3LWEA 3NXWA 2KVMA 3KFUA 2B2WC 2L4NA 1T5EA 1QE6A 5EKKA 1L0WA 5IE8A 5LMUQ 1F2MA 4CKCA 3S1MH 2DGYA 1DYQA 3R2IA 3GTKH 1Q3LA 3JAML 1VQ5A 5C0XG 1WD0A 1WTVA 3A8JE 1SNOA 1U4LA 2JQOA 4CDCC 3TRZA 3BJUA 3I73A 2VW9A 1ML0D 2A19A 4CDEC 3J7AV 1KHIA 5JPNC 3PO2H 2B2TA 2L15A 2WACA 2A74C 5I6WA 1SNPA 1I6VC 4MHEA 1D6EC 3IL8A 4A3FH 2IPKD 3HOWH 3M4QA 1CKMA 1QZGA 1JR0D 4HIMA 4IPHA 2UXCQ 1VS0A 2E2IH 5JVG3 4GZYC 1FNWA 1KDBA 3AFPA 3OW7A 2PMZB 1VF7A 3I4OA 5KNCA 2K5WA 1DONA 3OMCA 1BF4A 3CC2A 3E3XA 1KQSA 3HOWG 1VQ7A 1JC7A 2V4DA 1Y69U 4QUFA 3FMCA 4LF8L 2I07B 4OEMB 4HJ7A 2JA8G 3NE5B 1TXYA 4RHRA 5FO8B 4X3TA 2CFMA 2OTJA 5LMNW 4A3DB 1CA5A 4RWSC 2R3ZA 3PGZA 1GHJA 4X62L 5CR3A 3TQYA 2BDOA 4JI0L 3S16H 2KECA 2PZWA 5D65A 4DNIA 4JI6L 4GN3B 4A3EG 3L9AX 2RDGA 5I2XA 1XPRA 3B6YA 3W1GA 4NKLA 3G4SA 2C9OA 1UWVA 4QL5A 3RZDB 1UE6A 2K28A 4HR7B 1L1OC 2RQXA 1IHZA 3M7NA 2JN4A 3HOYG 1E2ZA 1K3BC 2A68D 2FMMA 4OIKA 4A3MB 1VQIA 1K73C 1KLUD 3CCUA 2B29A 3NBHB 2JA7H 1C0AA 1B8AA 2PW7A 1XTDA 2ATWA 2O4XA 1SYDA 4YY3Q 5IP9H 1A2UA 5M9OA 1KIXA 1I3QB 4B08A 1EL0A 1P8LA 3ERSX 4NMZA 4KJOA 1VCIA 1ZEQX 2E5LQ 2LS01 4F87A 4HCEA 1HA6A 3T4AC 5KGUA 3PO2B 1MBYA 2K03A 1V1PB 4CJ1B 3SK8A 2FMCA 1SYFA 4OHJA 2HHHL 1VMPA 2IX1A 3NQIA 1C4QA 1U4MA 1ENAA 3LWUA 1Q7YC 1N9WA 4ZUJA 3A7LA 3J7A5 1XNQQ 3TDQA 1OO9B 5JOBA 4AQYQ 4ZK9B 2IY5B 3HOUG 3NEMA 4JPBW 1VQAA 3FP9A 3NBHA 2E2HB 1QOHA 2UXBL 4IOAA 3GTJB 1EIFA 3CP0A 1QVFA 2DJGC 2PPBC 1Y1WB 1PLFA 1E3PA
chains in the Genus database with same CATH topology
3S16B 2DNCA 5ELFA 3P1HA 1TU2B 4IUVA 2GA4B 3K5MA 2E74C 2R7ZB 2NTTA 4IUUA 5EPLA 2MUYA 4KK7A 1GUGA 5CV4A 4FYDA 5CBEE 1O7ZA 2WB1B 4IN3A 4X3KA 5IOCA 3MWYW 2J0TD 2A6ED 1R9TB 4WJWA 3ONAB 3KUPA 1Z6HA 3D31A 1ENCA 4OL7A 3C2PA 1EEID 4RGTA 5LHY1 1M8AA 1S5BD 1UEAB 4BY7B 2NN6H 3KK7A 2IX0A 3NTKA 3TMEA 1VDZA 2ZT9C 2OXPA 5C3XA 2F0JA 1R4QB 3VA7A 3K5OA 1DD2A 1EU3A 3CRLC 2AQ2B 2TSSA 1DOMA 2EYJA 4L6TB 1SNMA 2VXWA 3AB9A 4RAUC 1CHQD 5K5PA 2QCPX 1VF5C 4N9PA 1LTSD 5C0XH 3JAME 1HRJA 3Q22A 5FKAC 2EJGC 2ICIA 1DCZA 1STBA 2SDFA 3D4RA 3K5LA 1YNJC 1PTOH 3DHQA 5G3LF 1BUVT 3GV6A 1DXMA 1WTPA 1TWHB 2FHTA 1B9NA 2B2YC 3PIO3 1O7YA 1EY0A 2Z1CA 1Q12A 1G2TA 3G7LA 1IW7C 1SNQA 1EOTA 2NUCA 4KHZA 4CBVA 3M4YA 4UDUC 5C4HA 4G7ZC 1AZQA 2A6HC 4QIWB 4RFBA 4HCSA 5C0XJ 4XYQA 5EKIA 1L0XB 3D4WA 3QO2A 1STNA 3VR4A 1U4RA 3NQTA 4FF3A 2NWGA 5DAUA 3HKZB 3BG3A 5IGFA 3S2HB 4G57A 4U68A 1PTOF 1RCVD 2H1EA 2R93B 2JP1A 3DWQA 4V190 1CQVA 4A93B 5EKLA 3TP8A 1G291 3F2UA 2HUGA 3WDNA 4A3IB 1OXSC 5E4XA 2BE5C 4H7BA 3HOXB 1PTOD 1Y8PB 4KY5A 3EQLC 3GTLB 1GHKA 3MFYA 2OF1A 4DAVA 1F2LA 5KYLA 2B63B 3I4NB 3NTHA 2KCCA 1H9SB 4Q0FA 4C3HB 2DY8A 2B2VA 3SEBA 1XTCD 2EXZA 2BCOA 3I70A 3KLRA 1V1OA 4DXGA 1T5XD 5EBCA 1ESFA 2XVSA 2F0LA 2F0IA 2E2IB 1LTGD 3MA2B 5LL6X 2RKSA 3C1EA 4NW2A 3GP7A 1KNAA 1PTOB 1DZ1A 2VB2X 5BN4A 3GTOB 2RBMA 2MHVA 3PUVA 2SOBA 2XWJB 3H91A 1PYWD 2O5JC 3MXNA 1XYIA 3I3CA 2K05A 1E2WA 1ILQA 2AQ1B 3PIP3 4XTCS 1TR5A 2WINB 4RGMA 2JA7B 3K0YA 1YNND 2QDBA 1DJRD 4QCLA 3HZXA 4ZQ3A 3GTPB 4EQNA 3GQBA 4XT1B 3RLFA 2KJXA 4ODGA 3VYRA 2MJ8A 3FEWX 1E2VA 1CM9A 4ILWA 2WV6D 3K57A 3VR6A 4DNTB 5JEAG 3H3VC 3S17B 3AU7A 1OXXK 3U9SA 4ZLTF 1WTQA 3PO3B 2J4XA 5IIFA 3Q23A 3TP5A 4ZRZA 4KV6A 1A3VA 1IKLA 1STGA 3VYTA 3SK6A 2M9VA 1EY7A 1PFBA 3MFGA 4X3UA 4EVOA 4XQQA 3GTGB 4TKOB 4A3FB 2O5IC 1TT2A 2WP8J 2NZ1D 2JA5B 1WD1A 3OSOA 1HXYD 1LTBD 2Q8TA 4IALA 4DN4M 1QNKA 1BXTA 2VNUD 4FP5D 5A2QL 4ZYSA 1BCPB 1D2BA 5CV6A 3V2TA 3QWNA 4J8QA 4KKUA 3HOWB 1B53A 3S1RB 1EY6A 1LTAD 1OXUA 1SMYD 1RF2D 1D5ZC 4KD4A 4K8IA 4C3HG 5CGKA 5LL6S 1I4QA 1SJED 1GUTA 1HFGA 2H4OA 1Y8OB 1EZ6A 2K5QA 4K2KA 1RKNA 1TY2A 5E1FA 3DXJC 1RJTA 4HAEA 3QOLA 1QG7A 4WRDA 1Q8IA 2MP1A 1GUWA 4ME5A 2CW0D 1KDCA 3CKIB 4DFAA 1A6XA 4I65A 2YYZA 3QG1A 2VUMB 2L0CA 1BCPD 5IGEA 3I4LA 2CVRA 3SVMA 5JVH3 3OIQA 5CBAE 4F7XA 2K33A 5AFWA 2PW5A 4DXFA 4CGYB 1TQOA 1Y1VB 3E6ZX 1LV9A 2F0HA 1GOZA 1SDFA 2NB0A 4J1MA 2KEEA 1H9MA 1FR3A 1BNZA 3FDTA 1PZJD 1GUSA 4Y7NB 2B2UA 4KY7A 3BVMA 1V1PA 1KLGD 2PCFB 2HCCA 2NN6G 3CHBD 2X6LA 1PRTF 1BR9A 4A3JB 5M3MB 2L12A 1S5ED 4PMWA 1B9MA 1VMCA 3C46A 3D8GA 5JAVA 2RSNA 3M7GA 4RGNA 3M3YB 2F0VA 3BDCA 1S5DD 3HOUB 5I9OA 3ND9A 1TWCB 3O13A 1O80A 1JCKB 3DEPA 2F0EA 1CZGA 1F77A 4R8IA 4DAPA 3BS1A 1BOSA 4J6HA 4LJZC 2WAQB 5HURA 3L7ZC 4BA2I 3J80E 1TS2A 1BCPF 1IYVA 1AEXA 2F0WA 5HGTA 5KEEA 1NR2A 1HHVA 3OHXC 1B1ZA 2EYFA 3NWTA 4BBRB 2N88A 2Z8LA 3EJIA 2A6EC 2F3WA 2LY7A 5M3FB 1PFNA 1RTNA 2F0QA 2EJFC 2EY2A 1BDOA 1H9RA 1KABA 1NSNS 4QUCA 2PO4A 3CU7A 4M1UB 3BVZA 2D62A 1U9RA 2G9DA 2PZUA 1F2YA 1WCMB 3T51B 5DEHA 1SBBB 3T56B 3K5NA 1EU4A 3A7AB 4M8AA 1SYCA 2YU9B 1I4RA 1LT3D 5C5LA 4JK1C 5IGBA 2Z4IA 1DOKA 1SXTA 4TSSA 4DAYA 2HCIA 1PRTB 4XT3B 5C6AA 2R6GA 5CMDA 1D5XC 5DM63 3QIAA 1KAAA 3MXPA 5C44B 3L3OC 2IJ0A 1SAPA 2F0PA 2TMPA 2A68C 1KTKA 5M5WB 2KHSA 1PRTC 4DNRB 2O2LD 2AQ3B 5ISRA 4KKSA 3P75A 1TIID 2K1BA 1LTRD 1BO0A 1JB3A 2A69C 2B2YA 5I2YA 3TZDA 1JWMD 3GTMB 3I90A 2IX3A 4IUTA 5D3DA 3IFTA 1EYCA 1QILA 4I7ZC 3RUZA 2F3VA 4OGQC 5FO9B 1K8MA 4ABNA 4HN7A 4L63B 4RCOA 4F88A 4IUNA 2PYKA 1EIHA 4BS9A 4ZKBB 3SHLA 1B3AA 5BN3A 1F9QA 1JOOA 4KN7C 4C3JG 1K8OA 2MPMA 1HTPA 4KHVA 2BDNA 4MN3A 3NUCA 3J81E 4IUPA 4X3SA 2A6HD 4IZ8A 3D4DA 1EYAA 3IAYA 1NAPA 1CT1D 2D9UA 4XIGS 1II3A 2EE1A 2EDGA 3BVGA 5EQ0A 1H9SA 2K01A 1ZKOA 5IGDA 2QILA 3M4OB 5KNDA 4DK1A 1A15A 1CQFA 1X3QA 2KQ3A 2XNAC 1SE4A 3GD7A 1QNUA 2E75C 4A3KB 3I72A 4IURA 2A73B 1JORA 4RH6A 1H9KA 3VR5A 1JOQA 2L5TA 3Q0AA 4DU9A 5J1ZA 3SK5A 1I4GA 4CKEA 1MSHA 3D3RA 5IODA 2LFNA 3MZ5A 3BDOA 2DNEA 1LO5D 1I4PA 3NPPA 4R8NA 3OIPA 1GUNA 2NVXB 4K6LA 1STEA 3K7AB 2F03A 2JXMB 3GO5A 1XWEA 1MD2D 3DWAA 1ENFA 3S1MB 2KCNA 3UI2A 4BY1B 4U673 1J9OA 5DM73 2EVBA 1CA6A 4Q5VA 4RA8A 2EYMA 3AMUA 4F8MA 1AP0A 4RKLA 3GV3A 1EQTA 1SJHD 3NTIA 4OO1G 3T53B 1RDPD 3EVQA 3S1QB 1BBXC 1UNSA 2K32A 1YNNC 2L11A 3W3AA 5CC4A 2BA1A 3MTSA 4C3JB 2RDFA 5G3LD 4OIJA 5NUCA 3QOJA 1B4OA 1ILPA 3RMHA 5CORA 1PZKD 3LNNA 2Q8RE 2M2LA 3EROA 1S5CD 2A5HA 4HTHA 2ID0A 4NDXA 3OOCA 1XXGA 5IGGA 5T1GA 3IFDA 1EQVA 3BYTB 2E76C 1ESRA 5IGCA 1EWHA 4E6IA 5EPJA 2I46A 1Z47A 3ZYYX 2B39A 4K5XA 5C4JB 3MVVA 1PTOC 1Q1EA 1SNCA 3ND8A 4EGVA 2NVTB 4DF7A 2AWOA 3CRKC 4PNYA 2C5CA 3H6MA 4QMGA 2JA8B 3URYA 3R8BA 4C1NI 1PDQA 2R92B 4DA2A 2EZVA 4BA1I 1EY9A 5JPMC 5FLXL 1TWAB 2WKCA 2N55A 2JSOA 4H0LC 4K8JA 2EYHA 1CZWA 5M5YB 3HOVB 1FGBD 2VB3X 2KUMA 5CV8A 5EPKA 1A3TA 2B8FA 4ID6A 1O7LA 2NBFA 1SE2A 3OWFA 1AFPA 5C3EB 3RD4A 4N9TA 3P7JA 3QB3A 3OMGA 4LK1C 3A8IE 3M85A 4MIUA 3A55A 2L9HA 1IYUA 1KNEA 5K36H 2NVQB 1HTLD 2X69A 4FO2A 1OXVA 4PMBA 5ELEA 4RCNA 4KN4C 5CV7A 4NP5A 4QF4A 2CW0C 5BN5A 2E2DC 1JQYD 5TSSA 3KF8A 5JEAH 5K36G 4XDXA 2ZXOA 3VYUA 3KBXA 1FNUA 5CV9A 5ELBA 1HQRD 3HGBA 1E0BA 2B2UC 2EY6A 3I91A 4AYBB 1PMRA 3X3MA 1QJOA 4RGOS 1EEFD 5C0XI 3SDZA 4HSVA 2EOTA 3K59A 2HDMA 2K7VA 5C5MA 1STYA 2JA6B 2FINB 4WFN3 2F1MA 2JEBI 3A54A 3GTKB 2Q8IB 1CHPD 3PV0A 1TS5A 3NSWA 3A56A 4IFDJ 2XN9C 5FLXE 2PZTA 2L55A 2CQAA 4V0BA 3NK9A 1LABA 1ONLA 5A35A 1Q1BA 1HA5A 1U4PA 4IFDG 1PFMA 3DMUA 2EYOA 3K58A 2F0DA 5CV5A 1GJXA 3V05A 1BQQT 4FF4A 1V43A 1JWSD 2LMCB 3I4MB 1MSGA 1LTTD 1I4XA 3TSSA 3R3OA 1TY0A 4C1NK 2SNMA 1G6ZA 4FXKC 5E3FA 2AUKA 3P20A 3DUZA 1IKMA 1LTID 2ICEC 1L0YB 3TBIB 4KD3A 1UUPA 1QB5D 1G2SA 1HQMC 5FK9C 3C3LA 5IT9L 1A2TA 2FFKB 4EQPA 4K5VA 1WTWA 3C1FA 2K5DA 5C4XB 2PQEA 4HMJA 2KEDA 3S2DB 2DN8A 3VR2A 2NTSA 1EIGA 2B2WA 3V96A 2R61A 3R93A 2KOLA 3DWPA 1JWUD 3HP3A 2QKIC 2ZXRA 2F0SA 2K04A 2OEOA 1BCPC 2DY7A 3EFXD 4XXEA 3WOEA 1NCVA 1NUCA 4OO1I 1F9PA 5T1IA 3DEOA 1SNDA 1HUNA 4HEDA 1DOLA 2WIIB 1C48A 2K6AA 1B44D 3MEHA 2LKVA 1AN8A 2F4IA 4FNFA 4HSPA 3MAQA 4FXGC 1DM0B 1TWGB 3S1NB 1HCZA 2WKDA 1HPCA 1TKWB 4C56C 3TP7A 2E2JB 3FPPA 3ITPA 1YNJD 1GXDC 1ZYRD 2EJMA 1J8IA 4DGZA 1CTMA 1SYGA 1LT5D 4XQJA 1S4ZA 3CQZB 1PRTD 3H0GB 2QEJC 3H94A 1PXUA 1LT6D 3HOYB 1NR4A 2XSCA 2RVLA 3EA6A 1TWFB 4FVMA 3ERQA 1IL8A 4A3EB 1WVLA 1X32A 1AZPA 3MXGA 1D1IA 4PQXA 2G9HD 1FYCA 1EFID 3GTQB 1PZID 3PUZA 3NBIA 1O78A 4S3SA 3PUYA 5CYUA 4DK0A 4CJ0B 4BWGB 2NN6I 3IKJA 1W6JA 5ELDA 2F0GA 1EY5A 3TZUA 2F0NA 2IW3A 4G7HC 3BDLA 2D5DA 3NWSA 3KBGA 4B9WA 2XRSD 3PUWA 3SE0A 4ZUIA 3FRPB 1ICWA 4OO1H 1OXTA 3MHBA 1WTOA 4KY6A 2RSOA 1MI2A 4C2MB 5FO7B 3BZDB 1RTOA 2M00A 3FPUB 1C8CA 1RHPA 3Q6SA 1JICA 1I50B 1QWYA 1TS3A 5D3IB 3SR1A 1STAA 1TVXA 3G6JB 3LX0A 1CI3M 1M4VA 5FOBB 1LACA 5KNBA 4LMQD 4RHSA 3I8ZA 5JJZA 1EY4A 1HUMA 4RKBA 4KMUC 4FF1A 5I6YA 4PMCA 4IFDI 2D2CC 4A3BB 1STHA 2X6GA 2BE5D 3WOFA 1F9SA 3T13A 4KI0A 3T16A 4PV1C 2HDLA 1I6HB 3W2DA 3HEJA 1MGSA 1F2ZA 2KA7A 1QCBD 3J81L 3A8KE 4K2LA 2A69D 1Q90A 2XWBB 2JE6I 3DM1A 3U9OA 1EZ8A 3SK4A 3NHHA 3D6WA 4WORA 2F0FA 4TQUS 1ZYRC 1ET6A 5KRUA 2XRQD 1D1KA 1SE3A 3Q24A 3J7AF 4H13C 2SEBD 2F0UA 4QB4A 3D6CA 1SFOB 1RD9D 1Y8NB 3HS0C 3NP8A 1ZXTA 5F2DA 3X3NA 2HQEA 1S5FD 4O42A 2ZXPA 4TRDA 1CK1A 1FD7D 1A3UA 4L8JA 3R2TA 4KJNA 1SYEA 2NYZD 1ET9A 4H44C 1GUOA 1D5MC 2MGSA 2EY5A 3J7YW 2OT2A 3MC0B 3S14B 1SEBD 2BOSA 3J80L 1XX8A 1K83B 4KKTA 2FJ2A 1IW7D 3E5SA 3VR3A 4XYOA 3QJYA 4O1NA 1JOKA 3E0JA 1X3PA 5EGTA 4CHTB 1KDAA 3N52A 2F0KA 2EPBA 4CKBA 4P2CB 4ZKCB 1RODA 2J7ZA 5M5XB 1LT4D 2IT1A 5A2QE 4XQNA 1G8ZD 1G91A 5COYA 4BBSB 4A3GB 4FF2A 3PUXA 1SSOA 3K6OA 3HOZB 4Z9CB 1B50A 3MXUA 2IWHA 1AW7A 4C3IG 4YIJA 5ELCA 3TN2A 1JE4A 4FXDA 2JYOA 4HMIA 2SNSA 2Z4HA 4CJ2C 3KLSA 3VA5A 5J39A 4JBWA 2ENBA 2JEAI 5JEAJ 5J22A 3H09A 5I4DA 2B2VC 4K5WA 1CFMA 3SXHA 1SYBA 3VYSA 2RDHA 3OPOA 1I4HA 4K14A 3FVQA 4EQOA 1EWCA 3S9WA 3FKIB 5KIXA 2B8GA 4ULLA 4KTAA 5C3WA 3HG9A 5C4ZA 3TP6A 1R4PB 5EJWA 2IL8A 2EYPA 1LLRD 2PNRC 2AWNA 2F0OA 1H9JA 1Z7TA 1WTRA 2EYLA 2Y0SB 3OWEB 3N6RA 3S15B 4ZAIA 4UAIA 4C3IB 1W6KA 4R9WA 1WTXA 1UAPA 2QF7A 3RZOB 5DNFA 4G4KA 2F0TA 1B2TA 4LAAA 2F0MA 5IT9E 2NVYB 2BA0A 5EBDA 3HRZC 2L1BA 4IQZA 1FNVA 3KLSX 2AUJD 1SMYC 4G7OC 5I9PA 1EYDA 1EY8A 4IFDH 5D14A 4K6DA 2XIWA 1TS4A 1V8QA 5KYIA 2CHBD 2RA4A 1F9RA 3BYYB 2B2TC 5E4WC 3PMFA 4B9XA 2EY1A 4IUQA 1HFNA 3LWEA 3NXWA 2KVMA 2B2WC 2L4NA 1T5EA 1QE6A 5EKKA 1F2MA 4CKCA 1DYQA 3R2IA 1Q3LA 3JAML 5C0XG 1WD0A 1WTVA 3A8JE 1SNOA 1U4LA 3I73A 1ML0D 3J7AV 5JPNC 2B2TA 2WACA 2A74C 5I6WA 1SNPA 1I6VC 4MHEA 1D6EC 3IL8A 2IPKD 1JR0D 5JVG3 4GZYC 1FNWA 1KDBA 3OW7A 2PMZB 1VF7A 5KNCA 2K5WA 1DONA 3OMCA 1BF4A 1JC7A 2V4DA 1Y69U 4QUFA 3FMCA 2I07B 3NE5B 4RHRA 5FO8B 4X3TA 4A3DB 1CA5A 4RWSC 2R3ZA 1GHJA 5CR3A 2BDOA 2KECA 2PZWA 5D65A 3L9AX 2RDGA 5I2XA 4NKLA 2C9OA 3RZDB 2K28A 4HR7B 2RQXA 1IHZA 3M7NA 1E2ZA 2A68D 2FMMA 4OIKA 4A3MB 1KLUD 2PW7A 2O4XA 1SYDA 1A2UA 5M9OA 1I3QB 4B08A 1EL0A 4NMZA 4KJOA 1VCIA 1ZEQX 2LS01 4F87A 4HCEA 1HA6A 3T4AC 5KGUA 3PO2B 1MBYA 2K03A 1V1PB 4CJ1B 3SK8A 2FMCA 1SYFA 4OHJA 2IX1A 1VMPA 3NQIA 1C4QA 1U4MA 1ENAA 3LWUA 4ZUJA 3A7LA 3TDQA 1OO9B 5JOBA 4ZK9B 3NBHA 2E2HB 1QOHA 3GTJB 2PPBC 1Y1WB 1PLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWO A;  2EJF C;  3CRK C;  2V4D A;  4DK0 A;  2KCC A;  1Y69 U;  1GUN A;  2DNC A;  3SDZ A;  1BDO A;  1H9R A;  1H9S B;  1K8M A;  3FMC A;  1TU2 B;  2K7V A;  3PUX A;  3NE5 B;  3TZU A;  2JXM B;  4TQU S;  1ZYR C;  2E74 C;  2F1M A;  2JEB I;  4G7H C;  2Q8I B;  4BA1 I;  2D5D A;  2BA0 A;  3PV0 A;  1DXM A;  3MXU A;  1H9M A;  2D62 A;  3PUW A;  3SE0 A;  4IQZ A;  1FR3 A;  1GHJ A;  2BDO A;  4H0L C;  4TKO B;  2O5I C;  3KLR A;  4OO1 H;  1B9N A;  3T51 B;  4H13 C;  1GUS A;  1OXT A;  2AUJ D;  1SMY C;  4G7O C;  1GUG A;  3T56 B;  1Y8N B;  2EVB A;  1LAB A;  4IFD H;  1ONL A;  1Q12 A;  5A35 A;  2PCF B;  1Q1B A;  3A7A B;  5BN3 A;  4KN7 C;  1V8Q A;  4IFD G;  2NN6 G;  1IW7 C;  4JBW A;  1K8O A;  2A6E D;  4JK1 C;  1HTP A;  4HR7 B;  4KHZ A;  2JEA I;  2B8F A;  1GJX A;  1B9M A;  3M4Y A;  3M7N A;  1E2Z A;  1O7L A;  1V43 A;  1HCZ A;  1Z6H A;  2A68 D;  3D31 A;  5BN4 A;  1HPC A;  4G7Z C;  2A6H D;  2LMC B;  1TKW B;  2A6H C;  3PUV A;  4OO1 G;  3T53 B;  2R6G A;  2O5J C;  1CFM A;  4L8J A;  3FPP A;  4KKU A;  1CI3 M;  1T5E A;  2EJM A;  2K32 A;  3QIA A;  4XIG S;  1YNN C;  3W3A A;  1CTM A;  4H44 C;  1OXU A;  2NN6 H;  3OPO A;  4LK1 C;  3A8I E;  1E2W A;  1LAC A;  1GUO A;  2EDG A;  5KNB A;  3M85 A;  3VR4 A;  2AUK A;  3P20 A;  2BA1 A;  3ND9 A;  1H9S A;  4XTC S;  3H94 A;  1VDZ A;  3BG3 A;  2ZT9 C;  1ZKO A;  5C0X G;  1IYU A;  3A8J E;  2A68 C;  1VCI A;  3VA7 A;  4KMU C;  1GUT A;  2B8G A;  5KND A;  1HQM C;  1Y8O B;  4DK1 A;  5K36 H;  1DD2 A;  1OXV A;  2D2C C;  4DNR B;  4KKT A;  3I73 A;  4RCN A;  4KN4 C;  3GQB A;  3CRL C;  3DXJ C;  4LJZ C;  3RLF A;  4KKS A;  1IW7 D;  3GD7 A;  2BE5 D;  3VR3 A;  1E2V A;  3L7Z C;  2E75 C;  2CW0 C;  3QJY A;  3LNN A;  4KI0 A;  4BA2 I;  3I72 A;  5BN5 A;  2A69 C;  4PV1 C;  1G29 1;  1IYV A;  5JEA H;  1I6V C;  5K36 G;  3OOC A;  3WDN A;  1H9K A;  1OXS C;  2PNR C;  2JE6 I;  3AB9 A;  3VR6 A;  3VR5 A;  1FYC A;  2L5T A;  2BE5 C;  3LWU A;  4DNT B;  1A6X A;  1H9J A;  2DN8 A;  1Y8P B;  1Z7T A;  1VF5 C;  2E76 C;  3A7L A;  3HGB A;  3VR2 A;  2YYZ A;  3IFT A;  3QG1 A;  5JEA G;  3EQL C;  4I7Z C;  5C0X H;  3PUZ A;  3N6R A;  1O78 A;  2KA7 A;  1EWH A;  3PUY A;  1GHK A;  3MFY A;  4GZY C;  1OXX K;  2A6E C;  3I4L A;  2EJG C;  3OW7 A;  1VF7 A;  3U9S A;  1DCZ A;  3A8K E;  3D4R A;  4OGQ C;  2NN6 I;  1PMR A;  2IT1 A;  5KNC A;  1Q1E A;  3BDO A;  3IKJ A;  3ND8 A;  1YNJ C;  2A69 D;  1Q90 A;  1QJO A;  2K33 A;  2PPB C;  2DNE A;  2QF7 A; 
#chains in the Genus database with same CATH topology
 3S16 B;  2ZTE A;  4LF4 Q;  1VQN A;  2DNC A;  5ELF A;  3P1H A;  1TU2 B;  2K5H A;  2GA4 B;  4IUV A;  1VQ4 A;  4GKK Q;  1SN8 A;  4OON A;  3K5M A;  2E74 C;  2R7Z B;  3KDF A;  2NTT A;  3J81 i;  4IUU A;  5EPL A;  3J80 c;  2MUY A;  1X3G A;  4KK7 A;  4LFB L;  1GUG A;  5CV4 A;  4FYD A;  5CBE E;  1O7Z A;  2WB1 B;  1IBK Q;  4JI8 Q;  4K0K L;  4IN3 A;  4X3K A;  5IOC A;  3MWY W;  5M3M G;  2J0T D;  4IJH A;  1Y1V G;  2A6E D;  1JB7 A;  3OYY A;  1R9T B;  4WJW A;  3ONA B;  3KUP A;  2KHI A;  2JA9 A;  1Z6H A;  2PI2 A;  3D31 A;  4GKJ Q;  1ENC A;  2JA8 H;  3MXN B;  4LWC A;  4OL7 A;  3C2P A;  1EEI D;  1HZB A;  4RGT A;  5LHY 1;  1M8A A;  2WB1 G;  3HOX H;  1S5B D;  1JT8 A;  1UEA B;  4BY7 B;  4AIM A;  2NN6 H;  1PH7 A;  2CWP A;  4HJ5 A;  3KK7 A;  3CQZ H;  2IX0 A;  3UE0 A;  4B3T Q;  3NTK A;  3TME A;  1VDZ A;  4DR6 L;  2ZT9 C;  2OXP A;  5C3X A;  2F0J A;  3PO3 H;  3HOV H;  1R4Q B;  5IWA L;  3VA7 A;  3K5O A;  1HR0 L;  1YHB A;  1IBM L;  4GNX C;  1DD2 A;  2ZM6 L;  1EU3 A;  5IYC G;  3CRL C;  2RCF A;  3CMA A;  2MO1 A;  4HJ8 A;  2AQ2 B;  2TSS A;  2UUB L;  2F4V L;  2LXJ A;  3HOV G;  1DOM A;  2EYJ A;  4L6T B;  1SNM A;  3CXC A;  1I6H H;  2RF4 A;  2VXW A;  2VY3 A;  3AB9 A;  1XNR L;  1Q86 C;  4RAU C;  1CHQ D;  2PQA B;  4CDD C;  1N8R C;  5K5P A;  2QCP X;  1VF5 C;  4N9P A;  5JJL A;  1LTS D;  5C0X H;  1OTC A;  2ZTD A;  3JAM E;  1SLJ A;  2XTI A;  4MNO A;  4N8F A;  1HRJ A;  3Q22 A;  2WAQ G;  5FKA C;  4A3L G;  2EJG C;  4DV3 Q;  2ICI A;  1DCZ A;  1STB A;  2SDF A;  3BZK A;  3D4R A;  3K5L A;  1YNJ C;  2ZJP A;  1PTO H;  3DHQ A;  4UHV A;  1XMO Q;  4MTK A;  4GS3 A;  5G3L F;  4YWM A;  5GAG C;  1BUV T;  3GV6 A;  1IBL Q;  3ZJY C;  3J81 j;  1DXM A;  4DV2 L;  1CSP A;  1WTP A;  1TWH B;  1QUQ B;  1V1Q A;  4A93 G;  2FHT A;  2Q2H A;  1B9N A;  2B2Y C;  4JG2 A;  4NXN L;  3PIO 3;  2Z0S A;  4RG1 A;  1O7Y A;  3TS0 A;  4EX5 A;  1EY0 A;  2Z1C A;  1Q12 A;  4DR7 L;  1G2T A;  1HZA A;  3G7L A;  4A3J G;  1IW7 C;  4R4C A;  1SNQ A;  1EOT A;  2NUC A;  4KHZ A;  4A93 H;  1KL9 A;  2K14 A;  4CBV A;  3M4Y A;  4JI5 L;  1HR0 W;  4UDU C;  5C4H A;  5L37 A;  4G7Z C;  1GVP A;  4DKA C;  1AZQ A;  2A6H C;  4QIW B;  4RFB A;  4HCS A;  4B3R Q;  5C0X J;  2Z6B A;  4XYQ A;  5EKI A;  4JI1 L;  1L0X B;  3D4W A;  3QO2 A;  3J81 c;  1STN A;  1U4R A;  3NQT A;  2IHE A;  3VR4 A;  4FF3 A;  1VQG A;  2NWG A;  5DAU A;  2GVB A;  3HKZ B;  3BG3 A;  5IGF A;  3S2H B;  4G57 A;  5IYB G;  4U68 A;  1PTO F;  1HZ9 A;  1RCV D;  2ALY B;  2H1E A;  2R93 B;  2JP1 A;  1YBY A;  3DWQ A;  4NB3 A;  1Q82 C;  4V19 0;  4LFA L;  1CQV A;  4A93 B;  5EKL A;  3TP8 A;  1CKO A;  1K9M C;  1PH2 A;  1G29 1;  3F2U A;  1K8G A;  2HUG A;  3WDN A;  4A3I B;  1OXS C;  3I4N H;  5E4X A;  2BE5 C;  4H7B A;  3HOX B;  2AMC B;  2JJQ A;  1PTO D;  1Y8P B;  4KY5 A;  3EQL C;  3GTL H;  3GTL B;  1N32 Q;  1GHK A;  1S3O A;  3MFY A;  4IPG A;  1HR0 Q;  1IBM Q;  2OF1 A;  4DAV A;  1F2L A;  5KYL A;  2B63 B;  4BY7 G;  3I4N B;  2N3S A;  4B3T L;  3NTH A;  2KCC A;  1E24 A;  1H9S B;  4Q0F A;  4C3H B;  3G6E A;  2Z9H A;  2DY8 A;  2B2V A;  4JI6 Q;  3SEB A;  1XTC D;  3CPF A;  3FKI G;  2EXZ A;  1YJ9 A;  4AYB G;  2BCO A;  1SMX A;  3I70 A;  3PO2 G;  4JI2 Q;  3CAM A;  3KLR A;  1V1O A;  2PMZ E;  4DXG A;  1T5X D;  5EBC A;  1ESF A;  2XVS A;  2F0L A;  2F0I A;  2E2I B;  2VZA A;  1LTG D;  4DUY Q;  4O2D A;  3MA2 B;  2EIF A;  4MZ9 A;  1BBU A;  5LL6 X;  2RKS A;  1VQB A;  3C1E A;  4IOC A;  1PH4 A;  4NW2 A;  5H1S E;  3GP7 A;  1KNA A;  1PTO B;  1DZ1 A;  1B3Q A;  1EUJ A;  2VB2 X;  2RBM A;  5BN4 A;  5M5Y H;  3GTO B;  2MHV A;  3PUV A;  2SOB A;  4LF5 Q;  2XWJ B;  1NBW A;  3H91 A;  4X64 Q;  1PYW D;  4GKJ L;  2O5J C;  3T1Y L;  3MXN A;  1XYI A;  1K28 A;  3I3C A;  1N33 L;  2K05 A;  1E2W A;  2MO0 A;  1ILQ A;  2AQ1 B;  4LW1 A;  3PIP 3;  4XTC S;  1TR5 A;  2WIN B;  4RGM A;  1IBK L;  1D8L A;  2JA7 B;  2Z6K C;  3S14 H;  3K0Y A;  4LFB Q;  1BKB A;  1YNN D;  2QDB A;  1DJR D;  1VQE A;  2HD3 A;  4QCL A;  3HZX A;  4ZQ3 A;  3F2C A;  3GTP B;  4EQN A;  3GQB A;  4XT1 B;  3RLF A;  2KJX A;  4ODG A;  4A3E H;  3RZD H;  3VYR A;  1R9T H;  2MJ8 A;  3FEW X;  1D7Q A;  1E2V A;  3UDI A;  1CM9 A;  4ILW A;  2WV6 D;  4UP7 A;  2UUC Q;  1L1O A;  2D0P A;  1JJ2 A;  4LF4 L;  5M5W H;  3K57 A;  1VQP A;  3U4Z A;  3VR6 A;  4DNT B;  4A3I G;  3WWV A;  5JEA G;  3H3V C;  3S17 B;  3AU7 A;  4DV2 Q;  3I2Z A;  1OXX K;  2GVA A;  3U9S A;  4ZLT F;  1WTQ A;  3PO3 B;  1IBL L;  1FJG Q;  2J4X A;  5IIF A;  3Q23 A;  1KXL A;  3TP5 A;  2LXK A;  5HGQ A;  4ZRZ A;  3ULP A;  4KV6 A;  1A3V A;  1IKL A;  1STG A;  3HKS A;  3VYT A;  3SK6 A;  2KEN A;  2M9V A;  1EY7 A;  1PFB A;  3MFG A;  3OTO L;  2E2H H;  4X3U A;  4EVO A;  5FLX c;  1HH2 P;  4XQQ A;  3CME A;  3GTG B;  4TKO B;  4A3F B;  3G71 A;  2Q2U A;  2O5I C;  1TT2 A;  1GD7 A;  1IZ6 A;  1K0R A;  2WP8 J;  2NZ1 D;  2JA5 B;  3E0E A;  4P74 A;  4OXP A;  1WD1 A;  2K75 A;  3OSO A;  1HXY D;  1LTB D;  3BZC A;  2F3I A;  4DV1 Q;  2JA6 G;  2Q8T A;  2UUB Q;  1MIU A;  1PFS A;  4IAL A;  4DN4 M;  1QNK A;  1BXT A;  4BY1 H;  4FP5 D;  4R4T A;  2VNU D;  5A2Q L;  4ZYS A;  1BCP B;  1D2B A;  1N36 L;  5CV6 A;  3V2T A;  1PYS B;  3QWN A;  1QZH A;  4J8Q A;  3PF4 A;  2ZJQ A;  4KKU A;  3HOW B;  1B53 A;  3S1R B;  1EY6 A;  1LTA D;  1OXU A;  1SMY D;  1X9N A;  1RF2 D;  1D5Z C;  2MFI A;  4KD4 A;  2K4K A;  4K8I A;  4CDF C;  1CSQ A;  4L5T A;  4C3H G;  3KF6 A;  2Y0S E;  5CGK A;  5LL6 S;  1I4Q A;  1SJE D;  1GUT A;  1HFG A;  2H4O A;  3TRE A;  1Y8O B;  1EZ6 A;  2K5Q A;  4K2K A;  2UXC L;  4DR2 L;  1RKN A;  1TY2 A;  5E1F A;  2JA5 H;  3DXJ C;  1I94 L;  3STB D;  3U4V A;  1RJT A;  1U0L A;  4TVA B;  2UU9 Q;  1X3F A;  4HAE A;  3GTG H;  1Y14 B;  3QOL A;  1QG7 A;  4WRD A;  1Q8I A;  2MP1 A;  4B3S L;  1GUW A;  4JYA Q;  3RZO H;  4ME5 A;  1SRU A;  1QVC A;  1KDC A;  2CW0 D;  3CKI B;  4DFA A;  1A6X A;  4I65 A;  4YHH Q;  2YYZ A;  3QG1 A;  3A0J A;  1PA6 A;  2VUM B;  2L0C A;  1BCP D;  3H0G H;  5IGE A;  2VUM G;  3BU2 A;  4IO9 A;  3I4L A;  2CVR A;  3SVM A;  5JVH 3;  3A74 A;  3OIQ A;  5CBA E;  5E7N A;  5C3E G;  4F7X A;  1MJE A;  1BVS A;  2K33 A;  1KAW A;  2PW5 A;  5AFW A;  2QA4 A;  4DXF A;  4CGY B;  4YCU A;  4O0A A;  4LNQ A;  1TQO A;  2EQS A;  5LMN L;  1Y1V B;  3E6Z X;  2NVX H;  1LV9 A;  2F0H A;  3S17 H;  4GNX A;  1GOZ A;  2UXB Q;  1SDF A;  2N78 A;  2NB0 A;  5IYC H;  4J1M A;  2KEE A;  4AQY L;  1H9M A;  1SE8 A;  3I55 A;  1FR3 A;  1BNZ A;  1VQ8 A;  3FDT A;  1PZJ D;  1C9O A;  1GUS A;  4Y7N B;  2B2U A;  4KY7 A;  3H3V H;  4LF9 Q;  2NZH A;  3BVM A;  1L2F A;  1V1P A;  2YTY A;  4JI3 Q;  1KLG D;  1XMQ L;  1HNX Q;  2PCF B;  4DV7 Q;  2HCC A;  2NN6 G;  1YJN A;  3CHB D;  2X6L A;  1PRT F;  1BR9 A;  4GOP A;  4A3J B;  5M3M B;  2L12 A;  4LF7 L;  1S5E D;  4PMW A;  4R4Q A;  1B9M A;  1VMC A;  3C46 A;  3D8G A;  4JC0 A;  5JAV A;  2RSN A;  4JBJ A;  4A3L H;  2Q2I A;  3M7G A;  4RGN A;  3M3Y B;  2F0V A;  3FKI H;  3BDC A;  1S5D D;  2EXD A;  3HOU B;  5I9O A;  1HZC A;  3FHW A;  2QGQ A;  4JI4 L;  4A3C G;  1TWH H;  1TWC H;  4B3M L;  3ND9 A;  1TWC B;  5AJ3 L;  3O13 A;  1O80 A;  1JCK B;  3TS2 A;  3DEP A;  3U50 C;  2F0E A;  1CZG A;  1F77 A;  4R8I A;  4DAP A;  3ULL A;  1CKN B;  1UE5 A;  3BS1 A;  1BOS A;  4J6H A;  4LJZ C;  2WAQ B;  5HUR A;  4LF6 L;  3L7Z C;  1S40 A;  4BA2 I;  3J80 E;  1TS2 A;  4DK6 C;  3VDY A;  1NJI C;  1BCP F;  1IYV A;  1AEX A;  2F0W A;  3K80 C;  5ELN A;  5HY6 A;  5HGT A;  5KEE A;  1NR2 A;  3CC7 A;  1ASZ A;  1HHV A;  1Q46 A;  3OHX C;  4X66 Q;  3LGJ A;  3KOJ A;  1B1Z A;  2EYF A;  3I56 A;  3NWT A;  4BBR B;  2N88 A;  2QDL A;  2Z8L A;  3EJI A;  2A6E C;  3S1R H;  3K81 C;  2F3W A;  3F8T A;  2E8G A;  4LF7 Q;  2LY7 A;  5M3F B;  1PFN A;  1RTN A;  2F0Q A;  2EJF C;  2EY2 A;  3AYH B;  1BDO A;  1H9R A;  1KAB A;  4DV7 L;  1NSN S;  4QUC A;  5IYB H;  2KHJ A;  2PO4 A;  2QW7 A;  1HJP A;  3CU7 A;  4M1U B;  3BVZ A;  2D62 A;  1U9R A;  2UXD Q;  2G9D A;  2PZU A;  1F2Y A;  3TEH B;  1WCM B;  3T51 B;  5DEH A;  1SBB B;  1PH1 A;  3T56 B;  3UDX A;  3K5N A;  3GTM H;  1EU4 A;  3A7A B;  4M8A A;  1SYC A;  2P5Z X;  1I4R A;  5C5L A;  1LT3 D;  2YU9 B;  4JK1 C;  4QGU A;  5IGB A;  2Z4I A;  1DOK A;  1SXT A;  3EIV A;  4TSS A;  4DAY A;  2HCI A;  5GRO A;  1PRT B;  2OQ0 A;  4XT3 B;  5C6A A;  3RNU A;  2R6G A;  5CMD A;  1S72 A;  3S15 H;  1D5X C;  5DM6 3;  3QIA A;  3NEL A;  5J3B A;  1W3S A;  3KF6 B;  1TWA H;  1KAA A;  3PIP A;  3MXP A;  5C44 B;  5LMU L;  3L3O C;  2IJ0 A;  1WCM H;  1SAP A;  2VQE Q;  2F0P A;  2TMP A;  2UU9 L;  2A68 C;  1JJG A;  5M3F H;  1FL0 A;  1KTK A;  5M5W B;  1VQJ A;  2KHS A;  1PRT C;  4DNR B;  2O2L D;  2AQ3 B;  4JOI C;  5ISR A;  4KKS A;  3P75 A;  1VQD A;  1TII D;  2NVY H;  2K1B A;  4HID A;  1LTR D;  1BO0 A;  1JB3 A;  2A69 C;  5C4J H;  2B2Y A;  5I2Y A;  4A75 A;  1J6Q A;  4OX9 Q;  3TZD A;  1JWM D;  1VQO A;  1K8A C;  3GTM B;  5EAY A;  1J5E L;  3I90 A;  2IX3 A;  1JMC A;  3AEV A;  4IUT A;  3G48 A;  5D3D A;  3IFT A;  1EYC A;  1QIL A;  3K7A H;  4I7Z C;  4P73 A;  3RUZ A;  2BH2 A;  1YIT A;  3CCM A;  3HOZ H;  2ZTC A;  2F3V A;  4OGQ C;  4YCW A;  4X66 L;  2B63 H;  4QJF A;  5FO9 B;  2ES2 A;  4DV1 L;  3CC4 A;  1K8M A;  1HNZ Q;  4ABN A;  4HN7 A;  4L63 B;  4RCO A;  4F88 A;  2KCT A;  1KD1 C;  4IUN A;  2PYK A;  4C3J H;  1EIH A;  4BS9 A;  4ZKB B;  3PF5 A;  4OEL B;  3SHL A;  1B3A A;  4A3B G;  3OTO Q;  1JE5 A;  5IT9 c;  4LUO A;  4GOP B;  2NVQ H;  5BN3 A;  1F9Q A;  4KN7 C;  1JOO A;  4JCV E;  1NE3 A;  3HKZ E;  2NZO A;  1FGU A;  2VS1 A;  4C3J G;  3Q8D A;  1K8O A;  5GAE C;  2MPM A;  1HTP A;  4KHV A;  2BDN A;  2RHQ B;  1A8V A;  4MN3 A;  3NUC A;  3J81 E;  1FJG L;  4IUP A;  3W5O A;  1RL2 A;  4X3S A;  1Z9F A;  2A6H D;  4IZ8 A;  3D4D A;  1B70 B;  1EYA A;  3IAY A;  1NAP A;  1CT1 D;  3PCO B;  5GAH C;  2ZJR A;  1NNX A;  2D9U A;  1QUQ A;  4XIG S;  1II3 A;  5LMN Q;  1Y1W G;  2EE1 A;  2EDG A;  1AH9 A;  3BVG A;  5EQ0 A;  1H9S A;  1VQK A;  2K01 A;  1E7Z A;  1ZKO A;  3CCR A;  5IGD A;  2QIL A;  2OCE A;  1VQH A;  3I7F A;  3M4O B;  5KND A;  3I4M G;  4DK1 A;  4A3I H;  1A15 A;  1CQF A;  1NMF A;  1X3Q A;  2KQ3 A;  2XNA C;  1SE4 A;  3GD7 A;  1PVO A;  4JYA L;  1QNU A;  3KF8 B;  2E75 C;  3E9I A;  1KC8 C;  4A3K B;  3I72 A;  4IUR A;  4B3S Q;  4DR4 Q;  4DR5 L;  2A73 B;  1JOR A;  4X65 Q;  4RH6 A;  1VQ9 A;  1H9K A;  3VR5 A;  1MHW C;  1TWG H;  5FJ8 G;  1JOQ A;  2L5T A;  3Q0A A;  4DU9 A;  5J1Z A;  4WJ4 A;  1X54 A;  3SK5 A;  1CUK A;  1I4G A;  4CKE A;  4DV4 Q;  5IP9 G;  1MSH A;  2VQF Q;  2I5M X;  3D3R A;  5IOD A;  2LFN A;  3MZ5 A;  3BDO A;  5C4X G;  1JJC B;  1LM0 A;  5FJ8 H;  2DNE A;  1LO5 D;  1I4P A;  3NPP A;  4R8N A;  3DM3 A;  3OIP A;  1GUN A;  2NVX B;  4K6L A;  1STE A;  4C3H H;  3K7A B;  2F03 A;  2G5D A;  2JXM B;  3GO5 A;  1FVI A;  1XWE A;  3M4P A;  4A3M G;  1I94 Q;  1MD2 D;  3DWA A;  4JI2 L;  4BXX H;  1ENF A;  4GN5 A;  4QIW E;  1G51 A;  2PI2 E;  3S1M B;  2KCN A;  4DR2 Q;  4IPD A;  1K83 H;  3UI2 A;  4BY1 B;  4U67 3;  1J9O A;  5DM7 3;  2EVB A;  1CA6 A;  4JOI A;  4Q5V A;  3AFQ A;  1MKH A;  2RHS B;  4RA8 A;  2EYM A;  3AMU A;  4F8M A;  4LF6 Q;  1AP0 A;  4DAM A;  4RKL A;  3QR8 A;  3RN2 A;  3GV3 A;  4P71 A;  1EQT A;  1SJH D;  3NTI A;  1N32 L;  2KBN A;  4DR1 L;  4OO1 G;  3T53 B;  1RDP D;  1U5K A;  3EVQ A;  3S1Q B;  1BBX C;  3S1Q H;  3F2B A;  1UNS A;  3GTQ H;  2K32 A;  5AJ3 Q;  4A76 A;  1YNN C;  2L11 A;  3W3A A;  1EQQ A;  5CC4 A;  3CW2 C;  2BA1 A;  3MTS A;  4C3J B;  2RDF A;  1WTH A;  3PQI A;  4OIJ A;  5G3L D;  2AHO B;  4LFA Q;  5NUC A;  4P72 A;  3QOJ A;  1B4O A;  2R7Z G;  4GOP C;  4KLK A;  1E1T A;  1ILP A;  1RIP A;  3RMH A;  5COR A;  1PZK D;  3K8A A;  3LNN A;  2Q8R E;  2YTV A;  2M2L A;  1YVC A;  3ERO A;  1XMQ Q;  1S5C D;  2A5H A;  4HTH A;  2ID0 A;  4NDX A;  3OOC A;  1XXG A;  5IGG A;  2I5L X;  5T1G A;  2OQK A;  3IFD A;  1EQV A;  1EOV A;  3BYT B;  1YIJ A;  2E76 C;  4HIO A;  3EN2 A;  1ESR A;  5IGC A;  4B3R L;  1P16 A;  1EWH A;  4E6I A;  5EPJ A;  2I46 A;  3UDF A;  1Z47 A;  3ZYY X;  2B39 A;  4K5X A;  5C4J B;  3MVV A;  1PTO C;  1Q1E A;  1SNC A;  3ND8 A;  4NXM Q;  4EGV A;  2NVT B;  4DF7 A;  2AWO A;  3CRK C;  4PNY A;  2C5C A;  3H6M A;  4GLV B;  4QMG A;  2JA8 B;  3URY A;  3R8B A;  4C1N I;  1PDQ A;  1O7I A;  4IPC A;  4JV5 L;  4PG3 A;  2R92 B;  1L1O B;  4HIK A;  1I3Q H;  2R7F A;  4DA2 A;  3T1Y Q;  2EZV A;  4BA1 I;  1EY9 A;  5JPM C;  5FLX L;  1WYD A;  4DR3 Q;  1TWA B;  2WKC A;  2N55 A;  4YHH L;  2JSO A;  4H0L C;  4K8J A;  1N34 Q;  2EYH A;  1CZW A;  5M5Y B;  3HOV B;  1FGB D;  2VB3 X;  2I0Q A;  2KUM A;  4PZ6 A;  5CV8 A;  3PSI A;  4GNX B;  5EPK A;  2H5X A;  1A3T A;  2GN5 A;  1LUZ A;  2B8F A;  4ID6 A;  1ICF B;  4LUZ A;  1O7L A;  3J80 i;  4DV3 L;  2NBF A;  1SE2 A;  3OWF A;  4PZ7 A;  4YCV A;  1AFP A;  5C3E B;  3RD4 A;  4N9T A;  3P7J A;  2C35 B;  3QB3 A;  3OMG A;  1VQC A;  4A3B H;  4LK1 C;  4A3D H;  3A8I E;  2QEX A;  3M85 A;  4MIU A;  3A55 A;  4A3G G;  2L9H A;  1IYU A;  1KNE A;  3KYH C;  5K36 H;  2NVQ B;  1HTL D;  3RR5 A;  2X69 A;  2Y0S G;  4FO2 A;  1OXV A;  5GQO A;  4PMB A;  5ELE A;  4RCN A;  4KN4 C;  1ASY A;  5CV7 A;  4NP5 A;  4QF4 A;  4DPG A;  2CW0 C;  4DK3 C;  5BN5 A;  2E2D C;  1JQY D;  1KRS A;  5TSS A;  3KF8 A;  5JEA H;  3MEF A;  3F2D A;  4XDX A;  5K36 G;  1Y1W H;  3JC6 6;  2ZXO A;  2RCN A;  3KBX A;  3VYU A;  5IP7 H;  1FNU A;  5CV9 A;  5ELB A;  1HQR D;  3HGB A;  1E0B A;  2B2U C;  2EY6 A;  4OWT B;  4QQB X;  4KHP Q;  3I91 A;  4A3F G;  4AYB B;  1PMR A;  3X3M A;  1QJO A;  4JBM A;  4RGO S;  4ZCK A;  1EEF D;  3S2H H;  5C0X I;  3GDE A;  4HSV A;  3SDZ A;  4K0K Q;  4Y52 H;  2EOT A;  3K59 A;  2HDM A;  4JI8 L;  2K7V A;  5C5M A;  1STY A;  2E2J H;  2JA6 B;  2FIN B;  4WFN 3;  2F1M A;  2JEB I;  3A54 A;  1V9P A;  3GTK B;  2Q8I B;  3A5U A;  1CHP D;  3E9H A;  1N34 L;  1YEZ A;  3PV0 A;  1TS5 A;  3NSW A;  3PO3 G;  3A56 A;  2V1C C;  2N8N A;  4IFD J;  2XN9 C;  5FLX E;  2HT1 A;  2PZT A;  2L55 A;  1YJW A;  1AE2 A;  2CQA A;  4V0B A;  3NK9 A;  1MJC A;  1LAB A;  1ONL A;  1X55 A;  3NEN A;  1YHA A;  5A35 A;  1Q1B A;  2UUC L;  1HA5 A;  1U4P A;  1WI5 A;  3KJP A;  4IFD G;  1PFM A;  3DMU A;  2EYO A;  3K58 A;  2F0D A;  3DLL A;  5CV5 A;  3JAM c;  1GJX A;  3V05 A;  1BQQ T;  4FF4 A;  4BBR G;  1V43 A;  2N49 A;  1JWS D;  3HOZ G;  2LMC B;  4A3M H;  1MSG A;  3I4M B;  1LTT D;  4BXX G;  4WJ3 M;  1I4X A;  3TSS A;  3R3O A;  2B63 G;  1TY0 A;  2CQO A;  4C1N K;  3A5Z B;  2SNM A;  1G6Z A;  4DV6 L;  1GO3 E;  4ALP A;  4FXK C;  5E3F A;  4BBR H;  2AUK A;  3P20 A;  1N33 Q;  2NVT H;  3DUZ A;  1IKM A;  1LTI D;  2ICE C;  1L0Y B;  3TBI B;  5IYD H;  4KD3 A;  1UUP A;  4JBK A;  1QB5 D;  1G2S A;  1WFQ A;  4JW0 A;  1HQM C;  4X64 L;  5FK9 C;  4LF5 L;  3C3L A;  5IT9 L;  4AYB E;  2JK8 A;  3RLN A;  1A2T A;  1E22 A;  3CCV A;  2FFK B;  4P75 A;  4EQP A;  4K5V A;  4QY7 A;  4R4O A;  1WTW A;  4C3I H;  3C1F A;  2K5D A;  5C4X B;  4DUY L;  4BBS G;  3CCS A;  3KJO A;  1XMO L;  2PQE A;  4HMJ A;  2KED A;  3H0G G;  3S1N H;  3S2D B;  3HKZ G;  4AH6 A;  2DN8 A;  3VR2 A;  4DAY B;  2NTS A;  5C3E H;  1EIG A;  4DR1 Q;  2B2W A;  3V96 A;  2R61 A;  3R93 A;  1UE7 A;  2KOL A;  3DWP A;  1JWU D;  1EFW A;  4DR6 Q;  3HP3 A;  2HIV A;  2QKI C;  3HOU H;  2ZXR A;  2F0S A;  2K04 A;  4R4I A;  2OEO A;  2OTL A;  1BCP C;  2DY7 A;  3ICE A;  3EFX D;  4XXE A;  3WOE A;  1NCV A;  1NUC A;  3W1B A;  4OO1 I;  1F9P A;  5T1I A;  3DEO A;  3STB C;  5JJI A;  2R92 G;  4UP8 A;  4UP9 A;  2ZM6 Q;  1SND A;  1HUN A;  4HED A;  1DOL A;  1M90 C;  2WII B;  5FLM G;  4Y7N H;  1YZ6 A;  3UE1 A;  1C48 A;  1SR3 A;  2K6A A;  1B44 D;  2Z6K A;  3MEH A;  2LKV A;  1AN8 A;  2F4I A;  4FNF A;  4HSP A;  3MAQ A;  4FXG C;  3JAM i;  3GTJ H;  1DM0 B;  1TWG B;  3S1N B;  3UDG A;  1HCZ A;  2WKD A;  4A4I A;  1A63 A;  1HPC A;  1Y1V H;  1TKW B;  3I4M H;  3S24 A;  4C56 C;  3TP7 A;  2E2J B;  3FPP A;  3ITP A;  1YNJ D;  3SGI A;  4GKK L;  1GXD C;  1ZYR D;  2EJM A;  4JV5 Q;  4J15 A;  1J8I A;  4DGZ A;  1CTM A;  1SYG A;  1LT5 D;  4XQJ A;  1S4Z A;  1XJV A;  3CQZ B;  1PRT D;  3H0G B;  4DV6 Q;  2QEJ C;  4DR5 Q;  4JI1 Q;  3HOX G;  3H94 A;  4NXM L;  1PXU A;  1LT6 D;  3HOY B;  1NR4 A;  2WFW A;  5DLQ E;  4YWL A;  2XSC A;  2RVL A;  2MQH A;  3CCQ A;  2R93 H;  3EA6 A;  4DR3 L;  4N8X 1;  4JI5 Q;  1TWF B;  4FVM A;  3ERQ A;  1IL8 A;  2OWO A;  4OWX B;  4A3E B;  1WVL A;  2JA6 H;  2DUD A;  1X32 A;  1AZP A;  3MXG A;  1D1I A;  2K50 A;  4H02 A;  4PQX A;  4DR7 Q;  4FDB A;  2G9H D;  2KCM A;  4R1J A;  1FYC A;  1EFI D;  4NXN Q;  3GTQ B;  4HJ9 A;  2YTX A;  1PZI D;  3PUZ A;  3NBI A;  1O78 A;  1M1K C;  4S3S A;  4L5R C;  3PUY A;  3RN5 A;  1PH6 A;  2E5L L;  1E1O A;  5CYU A;  4DK0 A;  4CJ0 B;  4BWG B;  2NN6 I;  1GKH A;  3IKJ A;  1W6J A;  1PYB A;  1PH5 A;  5ELD A;  2F0G A;  2HHH Q;  1EY5 A;  3GTP H;  3RLO A;  2I5H A;  3TZU A;  3U58 A;  2F0N A;  2IW3 A;  1EQR A;  4G7H C;  3BDL A;  2D5D A;  3NWS A;  3KBG A;  4B9W A;  2XRS D;  4KHP L;  3PUW A;  3SE0 A;  2CH4 W;  3EBE A;  4ZUI A;  1YHQ A;  3FRP B;  1ICW A;  4OO1 H;  1OXT A;  1XNR Q;  2VL6 A;  3MHB A;  1WTO A;  4KY6 A;  2RSO A;  1LYL A;  1MI2 A;  2Q2T A;  1I5F A;  1HNZ L;  4A3K H;  4C2M B;  1PH8 A;  5FO7 B;  4RMF A;  3BZD B;  1EYG A;  2F4V Q;  1RTO A;  1X56 A;  2VUM H;  2M00 A;  3FPU B;  1C8C A;  4YY3 L;  1KRT A;  5M3M H;  5JJK A;  1CKN A;  1RHP A;  3Q6S A;  1JIC A;  1I50 B;  1QWY A;  1TS3 A;  2DJF C;  2K5N A;  5D3I B;  4DV5 Q;  3K0X A;  3SR1 A;  5IWA Q;  2R92 H;  4A3K G;  1X3E A;  3D0F A;  1STA A;  1TVX A;  3G6J B;  3LX0 A;  3M9B A;  1CI3 M;  1M4V A;  5FOB B;  1LAC A;  2WB1 E;  5KNB A;  1W2B A;  4LMQ D;  1AE3 A;  2PQA A;  5FLM H;  4RHS A;  1VQF A;  2FXQ A;  3I8Z A;  5JJZ A;  1XPO A;  1EY4 A;  3HOY H;  1HUM A;  4RKB A;  4KMU C;  4LUV A;  2VQF L;  1YI2 A;  4FF1 A;  5I6Y A;  4PMC A;  4IFD I;  2D2C C;  4OWW B;  4A3B B;  3CCJ A;  1STH A;  2X6G A;  1H95 A;  2BE5 D;  3WOF A;  1F9S A;  3T13 A;  4KI0 A;  3T16 A;  1YNX A;  4X65 L;  3OW2 A;  4PV1 C;  2HDL A;  1I6H B;  4NPS A;  1WJJ A;  3W2D A;  1Q8K A;  1PV4 A;  3CPW A;  2CCZ A;  3H3V I;  3HEJ A;  1MGS A;  4PZ8 A;  1F2Z A;  1UEB A;  1SRO A;  2KA7 A;  1QCB D;  5C4X H;  3J81 L;  4A3C H;  1NTG A;  3A8K E;  2BH8 A;  4K2L A;  2A69 D;  1Q90 A;  2WAQ E;  2XWB B;  2JE6 I;  3DM1 A;  5C44 H;  1DGS A;  3U9O A;  1EZ8 A;  3SK4 A;  3NHH A;  1NMG A;  4A3G H;  4BBS H;  3D6W A;  4WOR A;  4BY7 H;  2F0F A;  4TQU S;  1ZYR C;  1ET6 A;  5KRU A;  2XRQ D;  1D1K A;  1SE3 A;  3Q24 A;  1XNQ L;  3J7A F;  4H13 C;  2SEB D;  1K3R A;  2F0U A;  4QB4 A;  3D6C A;  1SFO B;  1RD9 D;  1LTL A;  4POG A;  1Y8N B;  4DV0 Q;  2AKW B;  1BBW A;  3HS0 C;  3ULJ A;  4UY8 C;  5IP7 G;  3NP8 A;  1ZXT A;  5F2D A;  3X3N A;  2HQE A;  1VQ6 A;  1S5F D;  4O42 A;  2ZXP A;  4TRD A;  1CK1 A;  1FD7 D;  4DUZ L;  3PIO A;  3M4O H;  1A3U A;  4L8J A;  3R2T A;  4KJN A;  1SYE A;  2NYZ D;  3HFZ B;  3H15 A;  2K52 A;  1ET9 A;  3AQQ A;  4H44 C;  2UUA Q;  1GUO A;  3CCE A;  1D5M C;  2MGS A;  4LFC L;  5BR8 Q;  2EY5 A;  3J7Y W;  1HNW L;  2OT2 A;  3MC0 B;  3S14 B;  1SEB D;  2BOS A;  3J80 L;  1PH9 A;  1XX8 A;  1K83 B;  1T9H A;  4C2M H;  4KKT A;  2FJ2 A;  3KLW A;  4POF A;  1X65 A;  4GN4 B;  2CH4 A;  4X6A H;  1IW7 D;  1QVG A;  2HQL A;  3E5S A;  3VR3 A;  1EIY B;  1VQL A;  5ELO A;  4XYO A;  3QJY A;  4HJA A;  2YV5 A;  4O1N A;  5IY0 A;  1JOK A;  3M3Y H;  3E0J A;  2IHF A;  4B3M Q;  1X3P A;  5EGT A;  4APV A;  4CHT B;  2CWA A;  1PH3 A;  1KDA A;  3N52 A;  1G6P A;  2F0K A;  3GTO H;  2LSS A;  2EPB A;  3L0O A;  4P2C B;  4CKB A;  4ZKC B;  1ROD A;  2A8V A;  1SFO H;  4X62 Q;  4JI0 Q;  1C7Y A;  2J7Z A;  2R93 G;  4JI7 Q;  5M5X B;  1WOC A;  4YWK A;  1LT4 D;  2IT1 A;  2VQE L;  5A2Q E;  1WCM G;  4XQN A;  1G8Z D;  1J5E Q;  4LF8 Q;  4OX9 L;  1G91 A;  3F1Z A;  5COY A;  1GM5 A;  4L5S A;  4BBS B;  1HNX L;  4A3G B;  4GLX A;  4FF2 A;  3ER0 A;  4JI3 L;  3PUX A;  1IXR A;  1SSO A;  3K6O A;  1NY4 A;  3HOZ B;  4Z9C B;  3CCL A;  2JA7 G;  4DV4 L;  1B50 A;  3MXU A;  2IWH A;  1A0I A;  1AW7 A;  4C3I G;  4YIJ A;  5ELC A;  3TN2 A;  1JE4 A;  4FXD A;  2JYO A;  4HMI A;  2SNS A;  2B3G A;  2Z4H A;  4CJ2 C;  3KLS A;  4DR4 L;  3VA5 A;  5J39 A;  1X6O A;  4JBW A;  4EQ5 A;  3J7Z C;  5C44 G;  2ENB A;  2JEA I;  5JEA J;  5J22 A;  5IYD G;  2UXD L;  4I7A A;  3H09 A;  5I4D A;  1I50 H;  1XPU A;  1Q81 C;  2B2V C;  4K5W A;  1CFM A;  3SXH A;  1SYB A;  1PHJ A;  1UE1 A;  3VYS A;  2RDH A;  3OPO A;  1I4H A;  4A3J H;  2F52 A;  4MTN A;  4K14 A;  3FVQ A;  1A62 A;  4EQO A;  1EWC A;  2R7Z H;  3S9W A;  1IL2 A;  3FKI B;  5KIX A;  2HIX A;  2B8G A;  4JI7 L;  4ULL A;  4KTA A;  5C3W A;  3HG9 A;  5C4Z A;  3TP6 A;  1R4P B;  2XGT A;  2CKZ B;  5EJW A;  2K5V A;  2IL8 A;  2YU9 H;  2EYP A;  1LLR D;  2R7D A;  2JA5 G;  2D0O A;  1B7Y B;  4JVZ A;  2PNR C;  4IJL A;  2AWN A;  2F0O A;  1VQM A;  3S2D H;  1H9J A;  1EWI A;  1Z7T A;  1WTR A;  2EYL A;  2Y0S B;  3CF5 A;  3OWE B;  3N6R A;  3S15 B;  4ZAI A;  4DV5 L;  2MNA A;  1N36 Q;  4UAI A;  4C3I B;  1W6K A;  3CD6 A;  4R9W A;  3T1H Q;  3K7U C;  5BR8 L;  1WTX A;  1HNW Q;  1UAP A;  2QF7 A;  4LFC Q;  3RZO B;  2UUA L;  5DNF A;  4JI4 Q;  3I4N G;  4G4K A;  2F0T A;  1B2T A;  4LAA A;  2F0M A;  3T1H L;  5IT9 E;  2NVY B;  2A1A A;  1TWF H;  5M5X H;  2BA0 A;  5EBD A;  3HRZ C;  2PNH A;  5GAD C;  2L1B A;  4IQZ A;  1FNV A;  1IYJ B;  4UPA A;  1K0S A;  5M3F G;  3KDF B;  3KLS X;  2AUJ D;  1SMY C;  4L5Q A;  4G7O C;  5I9P A;  1EYD A;  1EY8 A;  4IFD H;  5D14 A;  4K6D A;  2XIW A;  4DV0 L;  2ASB A;  1TS4 A;  1V8Q A;  4LF9 L;  5KYI A;  2CHB D;  2RA4 A;  1F9R A;  3BYY B;  4ME3 A;  2B2T C;  4GLA C;  5E4W C;  3PMF A;  4DUZ Q;  3IRB A;  4BY1 G;  4B9X A;  4A3D G;  2EY1 A;  4IUQ A;  3L2P A;  1HFN A;  3LWE A;  3NXW A;  2KVM A;  3KFU A;  2B2W C;  2L4N A;  1T5E A;  1QE6 A;  5EKK A;  1L0W A;  5IE8 A;  5LMU Q;  1F2M A;  4CKC A;  3S1M H;  2DGY A;  1DYQ A;  3R2I A;  3GTK H;  1Q3L A;  3JAM L;  1VQ5 A;  5C0X G;  1WD0 A;  1WTV A;  3A8J E;  1SNO A;  1U4L A;  2JQO A;  4CDC C;  3TRZ A;  3BJU A;  3I73 A;  2VW9 A;  1ML0 D;  2A19 A;  4CDE C;  3J7A V;  1KHI A;  5JPN C;  3PO2 H;  2B2T A;  2L15 A;  2WAC A;  2A74 C;  5I6W A;  1SNP A;  1I6V C;  4MHE A;  1D6E C;  3IL8 A;  4A3F H;  2IPK D;  3HOW H;  3M4Q A;  1CKM A;  1QZG A;  1JR0 D;  4HIM A;  4IPH A;  2UXC Q;  1VS0 A;  2E2I H;  5JVG 3;  4GZY C;  1FNW A;  1KDB A;  3AFP A;  3OW7 A;  2PMZ B;  1VF7 A;  3I4O A;  5KNC A;  2K5W A;  1DON A;  3OMC A;  1BF4 A;  3CC2 A;  3E3X A;  1KQS A;  3HOW G;  1VQ7 A;  1JC7 A;  2V4D A;  1Y69 U;  4QUF A;  3FMC A;  4LF8 L;  2I07 B;  4OEM B;  4HJ7 A;  2JA8 G;  3NE5 B;  1TXY A;  4RHR A;  5FO8 B;  4X3T A;  2CFM A;  2OTJ A;  5LMN W;  4A3D B;  1CA5 A;  4RWS C;  2R3Z A;  3PGZ A;  1GHJ A;  4X62 L;  5CR3 A;  3TQY A;  2BDO A;  4JI0 L;  3S16 H;  2KEC A;  2PZW A;  5D65 A;  4DNI A;  4JI6 L;  4GN3 B;  4A3E G;  3L9A X;  2RDG A;  5I2X A;  1XPR A;  3B6Y A;  3W1G A;  4NKL A;  3G4S A;  2C9O A;  1UWV A;  4QL5 A;  3RZD B;  1UE6 A;  2K28 A;  4HR7 B;  1L1O C;  2RQX A;  1IHZ A;  3M7N A;  2JN4 A;  3HOY G;  1E2Z A;  1K3B C;  2A68 D;  2FMM A;  4OIK A;  4A3M B;  1VQI A;  1K73 C;  1KLU D;  3CCU A;  2B29 A;  3NBH B;  2JA7 H;  1C0A A;  1B8A A;  2PW7 A;  1XTD A;  2ATW A;  2O4X A;  1SYD A;  4YY3 Q;  5IP9 H;  1A2U A;  5M9O A;  1KIX A;  1I3Q B;  4B08 A;  1EL0 A;  1P8L A;  3ERS X;  4NMZ A;  4KJO A;  1VCI A;  1ZEQ X;  2E5L Q;  2LS0 1;  4F87 A;  4HCE A;  1HA6 A;  3T4A C;  5KGU A;  3PO2 B;  1MBY A;  2K03 A;  1V1P B;  4CJ1 B;  3SK8 A;  2FMC A;  1SYF A;  4OHJ A;  2HHH L;  1VMP A;  2IX1 A;  3NQI A;  1C4Q A;  1U4M A;  1ENA A;  3LWU A;  1Q7Y C;  1N9W A;  4ZUJ A;  3A7L A;  3J7A 5;  1XNQ Q;  3TDQ A;  1OO9 B;  5JOB A;  4AQY Q;  4ZK9 B;  2IY5 B;  3HOU G;  3NEM A;  4JPB W;  1VQA A;  3FP9 A;  3NBH A;  2E2H B;  1QOH A;  2UXB L;  4IOA A;  3GTJ B;  1EIF A;  3CP0 A;  1QVF A;  2DJG C;  2PPB C;  1Y1W B;  1PLF A;  1E3P A; 
#chains in the Genus database with same CATH homology
 3S16 B;  2DNC A;  5ELF A;  3P1H A;  1TU2 B;  4IUV A;  2GA4 B;  3K5M A;  2E74 C;  2R7Z B;  2NTT A;  4IUU A;  5EPL A;  2MUY A;  4KK7 A;  1GUG A;  5CV4 A;  4FYD A;  5CBE E;  1O7Z A;  2WB1 B;  4IN3 A;  4X3K A;  5IOC A;  3MWY W;  2J0T D;  2A6E D;  1R9T B;  4WJW A;  3ONA B;  3KUP A;  1Z6H A;  3D31 A;  1ENC A;  4OL7 A;  3C2P A;  1EEI D;  4RGT A;  5LHY 1;  1M8A A;  1S5B D;  1UEA B;  4BY7 B;  2NN6 H;  3KK7 A;  2IX0 A;  3NTK A;  3TME A;  1VDZ A;  2ZT9 C;  2OXP A;  5C3X A;  2F0J A;  1R4Q B;  3VA7 A;  3K5O A;  1DD2 A;  1EU3 A;  3CRL C;  2AQ2 B;  2TSS A;  1DOM A;  2EYJ A;  4L6T B;  1SNM A;  2VXW A;  3AB9 A;  4RAU C;  1CHQ D;  5K5P A;  2QCP X;  1VF5 C;  4N9P A;  1LTS D;  5C0X H;  3JAM E;  1HRJ A;  3Q22 A;  5FKA C;  2EJG C;  2ICI A;  1DCZ A;  1STB A;  2SDF A;  3D4R A;  3K5L A;  1YNJ C;  1PTO H;  3DHQ A;  5G3L F;  1BUV T;  3GV6 A;  1DXM A;  1WTP A;  1TWH B;  2FHT A;  1B9N A;  2B2Y C;  3PIO 3;  1O7Y A;  1EY0 A;  2Z1C A;  1Q12 A;  1G2T A;  3G7L A;  1IW7 C;  1SNQ A;  1EOT A;  2NUC A;  4KHZ A;  4CBV A;  3M4Y A;  4UDU C;  5C4H A;  4G7Z C;  1AZQ A;  2A6H C;  4QIW B;  4RFB A;  4HCS A;  5C0X J;  4XYQ A;  5EKI A;  1L0X B;  3D4W A;  3QO2 A;  1STN A;  3VR4 A;  1U4R A;  3NQT A;  4FF3 A;  2NWG A;  5DAU A;  3HKZ B;  3BG3 A;  5IGF A;  3S2H B;  4G57 A;  4U68 A;  1PTO F;  1RCV D;  2H1E A;  2R93 B;  2JP1 A;  3DWQ A;  4V19 0;  1CQV A;  4A93 B;  5EKL A;  3TP8 A;  1G29 1;  3F2U A;  2HUG A;  3WDN A;  4A3I B;  1OXS C;  5E4X A;  2BE5 C;  4H7B A;  3HOX B;  1PTO D;  1Y8P B;  4KY5 A;  3EQL C;  3GTL B;  1GHK A;  3MFY A;  2OF1 A;  4DAV A;  1F2L A;  5KYL A;  2B63 B;  3I4N B;  3NTH A;  2KCC A;  1H9S B;  4Q0F A;  4C3H B;  2DY8 A;  2B2V A;  3SEB A;  1XTC D;  2EXZ A;  2BCO A;  3I70 A;  3KLR A;  1V1O A;  4DXG A;  1T5X D;  5EBC A;  1ESF A;  2XVS A;  2F0L A;  2F0I A;  2E2I B;  1LTG D;  3MA2 B;  5LL6 X;  2RKS A;  3C1E A;  4NW2 A;  3GP7 A;  1KNA A;  1PTO B;  1DZ1 A;  2VB2 X;  5BN4 A;  3GTO B;  2RBM A;  2MHV A;  3PUV A;  2SOB A;  2XWJ B;  3H91 A;  1PYW D;  2O5J C;  3MXN A;  1XYI A;  3I3C A;  2K05 A;  1E2W A;  1ILQ A;  2AQ1 B;  3PIP 3;  4XTC S;  1TR5 A;  2WIN B;  4RGM A;  2JA7 B;  3K0Y A;  1YNN D;  2QDB A;  1DJR D;  4QCL A;  3HZX A;  4ZQ3 A;  3GTP B;  4EQN A;  3GQB A;  4XT1 B;  3RLF A;  2KJX A;  4ODG A;  3VYR A;  2MJ8 A;  3FEW X;  1E2V A;  1CM9 A;  4ILW A;  2WV6 D;  3K57 A;  3VR6 A;  4DNT B;  5JEA G;  3H3V C;  3S17 B;  3AU7 A;  1OXX K;  3U9S A;  4ZLT F;  1WTQ A;  3PO3 B;  2J4X A;  5IIF A;  3Q23 A;  3TP5 A;  4ZRZ A;  4KV6 A;  1A3V A;  1IKL A;  1STG A;  3VYT A;  3SK6 A;  2M9V A;  1EY7 A;  1PFB A;  3MFG A;  4X3U A;  4EVO A;  4XQQ A;  3GTG B;  4TKO B;  4A3F B;  2O5I C;  1TT2 A;  2WP8 J;  2NZ1 D;  2JA5 B;  1WD1 A;  3OSO A;  1HXY D;  1LTB D;  2Q8T A;  4IAL A;  4DN4 M;  1QNK A;  1BXT A;  2VNU D;  4FP5 D;  5A2Q L;  4ZYS A;  1BCP B;  1D2B A;  5CV6 A;  3V2T A;  3QWN A;  4J8Q A;  4KKU A;  3HOW B;  1B53 A;  3S1R B;  1EY6 A;  1LTA D;  1OXU A;  1SMY D;  1RF2 D;  1D5Z C;  4KD4 A;  4K8I A;  4C3H G;  5CGK A;  5LL6 S;  1I4Q A;  1SJE D;  1GUT A;  1HFG A;  2H4O A;  1Y8O B;  1EZ6 A;  2K5Q A;  4K2K A;  1RKN A;  1TY2 A;  5E1F A;  3DXJ C;  1RJT A;  4HAE A;  3QOL A;  1QG7 A;  4WRD A;  1Q8I A;  2MP1 A;  1GUW A;  4ME5 A;  2CW0 D;  1KDC A;  3CKI B;  4DFA A;  1A6X A;  4I65 A;  2YYZ A;  3QG1 A;  2VUM B;  2L0C A;  1BCP D;  5IGE A;  3I4L A;  2CVR A;  3SVM A;  5JVH 3;  3OIQ A;  5CBA E;  4F7X A;  2K33 A;  5AFW A;  2PW5 A;  4DXF A;  4CGY B;  1TQO A;  1Y1V B;  3E6Z X;  1LV9 A;  2F0H A;  1GOZ A;  1SDF A;  2NB0 A;  4J1M A;  2KEE A;  1H9M A;  1FR3 A;  1BNZ A;  3FDT A;  1PZJ D;  1GUS A;  4Y7N B;  2B2U A;  4KY7 A;  3BVM A;  1V1P A;  1KLG D;  2PCF B;  2HCC A;  2NN6 G;  3CHB D;  2X6L A;  1PRT F;  1BR9 A;  4A3J B;  5M3M B;  2L12 A;  1S5E D;  4PMW A;  1B9M A;  1VMC A;  3C46 A;  3D8G A;  5JAV A;  2RSN A;  3M7G A;  4RGN A;  3M3Y B;  2F0V A;  3BDC A;  1S5D D;  3HOU B;  5I9O A;  3ND9 A;  1TWC B;  3O13 A;  1O80 A;  1JCK B;  3DEP A;  2F0E A;  1CZG A;  1F77 A;  4R8I A;  4DAP A;  3BS1 A;  1BOS A;  4J6H A;  4LJZ C;  2WAQ B;  5HUR A;  3L7Z C;  4BA2 I;  3J80 E;  1TS2 A;  1BCP F;  1IYV A;  1AEX A;  2F0W A;  5HGT A;  5KEE A;  1NR2 A;  1HHV A;  3OHX C;  1B1Z A;  2EYF A;  3NWT A;  4BBR B;  2N88 A;  2Z8L A;  3EJI A;  2A6E C;  2F3W A;  2LY7 A;  5M3F B;  1PFN A;  1RTN A;  2F0Q A;  2EJF C;  2EY2 A;  1BDO A;  1H9R A;  1KAB A;  1NSN S;  4QUC A;  2PO4 A;  3CU7 A;  4M1U B;  3BVZ A;  2D62 A;  1U9R A;  2G9D A;  2PZU A;  1F2Y A;  1WCM B;  3T51 B;  5DEH A;  1SBB B;  3T56 B;  3K5N A;  1EU4 A;  3A7A B;  4M8A A;  1SYC A;  2YU9 B;  1I4R A;  1LT3 D;  5C5L A;  4JK1 C;  5IGB A;  2Z4I A;  1DOK A;  1SXT A;  4TSS A;  4DAY A;  2HCI A;  1PRT B;  4XT3 B;  5C6A A;  2R6G A;  5CMD A;  1D5X C;  5DM6 3;  3QIA A;  1KAA A;  3MXP A;  5C44 B;  3L3O C;  2IJ0 A;  1SAP A;  2F0P A;  2TMP A;  2A68 C;  1KTK A;  5M5W B;  2KHS A;  1PRT C;  4DNR B;  2O2L D;  2AQ3 B;  5ISR A;  4KKS A;  3P75 A;  1TII D;  2K1B A;  1LTR D;  1BO0 A;  1JB3 A;  2A69 C;  2B2Y A;  5I2Y A;  3TZD A;  1JWM D;  3GTM B;  3I90 A;  2IX3 A;  4IUT A;  5D3D A;  3IFT A;  1EYC A;  1QIL A;  4I7Z C;  3RUZ A;  2F3V A;  4OGQ C;  5FO9 B;  1K8M A;  4ABN A;  4HN7 A;  4L63 B;  4RCO A;  4F88 A;  4IUN A;  2PYK A;  1EIH A;  4BS9 A;  4ZKB B;  3SHL A;  1B3A A;  5BN3 A;  1F9Q A;  1JOO A;  4KN7 C;  4C3J G;  1K8O A;  2MPM A;  1HTP A;  4KHV A;  2BDN A;  4MN3 A;  3NUC A;  3J81 E;  4IUP A;  4X3S A;  2A6H D;  4IZ8 A;  3D4D A;  1EYA A;  3IAY A;  1NAP A;  1CT1 D;  2D9U A;  4XIG S;  1II3 A;  2EE1 A;  2EDG A;  3BVG A;  5EQ0 A;  1H9S A;  2K01 A;  1ZKO A;  5IGD A;  2QIL A;  3M4O B;  5KND A;  4DK1 A;  1A15 A;  1CQF A;  1X3Q A;  2KQ3 A;  2XNA C;  1SE4 A;  3GD7 A;  1QNU A;  2E75 C;  4A3K B;  3I72 A;  4IUR A;  2A73 B;  1JOR A;  4RH6 A;  1H9K A;  3VR5 A;  1JOQ A;  2L5T A;  3Q0A A;  4DU9 A;  5J1Z A;  3SK5 A;  1I4G A;  4CKE A;  1MSH A;  3D3R A;  5IOD A;  2LFN A;  3MZ5 A;  3BDO A;  2DNE A;  1LO5 D;  1I4P A;  3NPP A;  4R8N A;  3OIP A;  1GUN A;  2NVX B;  4K6L A;  1STE A;  3K7A B;  2F03 A;  2JXM B;  3GO5 A;  1XWE A;  1MD2 D;  3DWA A;  1ENF A;  3S1M B;  2KCN A;  3UI2 A;  4BY1 B;  4U67 3;  1J9O A;  5DM7 3;  2EVB A;  1CA6 A;  4Q5V A;  4RA8 A;  2EYM A;  3AMU A;  4F8M A;  1AP0 A;  4RKL A;  3GV3 A;  1EQT A;  1SJH D;  3NTI A;  4OO1 G;  3T53 B;  1RDP D;  3EVQ A;  3S1Q B;  1BBX C;  1UNS A;  2K32 A;  1YNN C;  2L11 A;  3W3A A;  5CC4 A;  2BA1 A;  3MTS A;  4C3J B;  2RDF A;  5G3L D;  4OIJ A;  5NUC A;  3QOJ A;  1B4O A;  1ILP A;  3RMH A;  5COR A;  1PZK D;  3LNN A;  2Q8R E;  2M2L A;  3ERO A;  1S5C D;  2A5H A;  4HTH A;  2ID0 A;  4NDX A;  3OOC A;  1XXG A;  5IGG A;  5T1G A;  3IFD A;  1EQV A;  3BYT B;  2E76 C;  1ESR A;  5IGC A;  1EWH A;  4E6I A;  5EPJ A;  2I46 A;  1Z47 A;  3ZYY X;  2B39 A;  4K5X A;  5C4J B;  3MVV A;  1PTO C;  1Q1E A;  1SNC A;  3ND8 A;  4EGV A;  2NVT B;  4DF7 A;  2AWO A;  3CRK C;  4PNY A;  2C5C A;  3H6M A;  4QMG A;  2JA8 B;  3URY A;  3R8B A;  4C1N I;  1PDQ A;  2R92 B;  4DA2 A;  2EZV A;  4BA1 I;  1EY9 A;  5JPM C;  5FLX L;  1TWA B;  2WKC A;  2N55 A;  2JSO A;  4H0L C;  4K8J A;  2EYH A;  1CZW A;  5M5Y B;  3HOV B;  1FGB D;  2VB3 X;  2KUM A;  5CV8 A;  5EPK A;  1A3T A;  2B8F A;  4ID6 A;  1O7L A;  2NBF A;  1SE2 A;  3OWF A;  1AFP A;  5C3E B;  3RD4 A;  4N9T A;  3P7J A;  3QB3 A;  3OMG A;  4LK1 C;  3A8I E;  3M85 A;  4MIU A;  3A55 A;  2L9H A;  1IYU A;  1KNE A;  5K36 H;  2NVQ B;  1HTL D;  2X69 A;  4FO2 A;  1OXV A;  4PMB A;  5ELE A;  4RCN A;  4KN4 C;  5CV7 A;  4NP5 A;  4QF4 A;  2CW0 C;  5BN5 A;  2E2D C;  1JQY D;  5TSS A;  3KF8 A;  5JEA H;  5K36 G;  4XDX A;  2ZXO A;  3VYU A;  3KBX A;  1FNU A;  5CV9 A;  5ELB A;  1HQR D;  3HGB A;  1E0B A;  2B2U C;  2EY6 A;  3I91 A;  4AYB B;  1PMR A;  3X3M A;  1QJO A;  4RGO S;  1EEF D;  5C0X I;  3SDZ A;  4HSV A;  2EOT A;  3K59 A;  2HDM A;  2K7V A;  5C5M A;  1STY A;  2JA6 B;  2FIN B;  4WFN 3;  2F1M A;  2JEB I;  3A54 A;  3GTK B;  2Q8I B;  1CHP D;  3PV0 A;  1TS5 A;  3NSW A;  3A56 A;  4IFD J;  2XN9 C;  5FLX E;  2PZT A;  2L55 A;  2CQA A;  4V0B A;  3NK9 A;  1LAB A;  1ONL A;  5A35 A;  1Q1B A;  1HA5 A;  1U4P A;  4IFD G;  1PFM A;  3DMU A;  2EYO A;  3K58 A;  2F0D A;  5CV5 A;  1GJX A;  3V05 A;  1BQQ T;  4FF4 A;  1V43 A;  1JWS D;  2LMC B;  3I4M B;  1MSG A;  1LTT D;  1I4X A;  3TSS A;  3R3O A;  1TY0 A;  4C1N K;  2SNM A;  1G6Z A;  4FXK C;  5E3F A;  2AUK A;  3P20 A;  3DUZ A;  1IKM A;  1LTI D;  2ICE C;  1L0Y B;  3TBI B;  4KD3 A;  1UUP A;  1QB5 D;  1G2S A;  1HQM C;  5FK9 C;  3C3L A;  5IT9 L;  1A2T A;  2FFK B;  4EQP A;  4K5V A;  1WTW A;  3C1F A;  2K5D A;  5C4X B;  2PQE A;  4HMJ A;  2KED A;  3S2D B;  2DN8 A;  3VR2 A;  2NTS A;  1EIG A;  2B2W A;  3V96 A;  2R61 A;  3R93 A;  2KOL A;  3DWP A;  1JWU D;  3HP3 A;  2QKI C;  2ZXR A;  2F0S A;  2K04 A;  2OEO A;  1BCP C;  2DY7 A;  3EFX D;  4XXE A;  3WOE A;  1NCV A;  1NUC A;  4OO1 I;  1F9P A;  5T1I A;  3DEO A;  1SND A;  1HUN A;  4HED A;  1DOL A;  2WII B;  1C48 A;  2K6A A;  1B44 D;  3MEH A;  2LKV A;  1AN8 A;  2F4I A;  4FNF A;  4HSP A;  3MAQ A;  4FXG C;  1DM0 B;  1TWG B;  3S1N B;  1HCZ A;  2WKD A;  1HPC A;  1TKW B;  4C56 C;  3TP7 A;  2E2J B;  3FPP A;  3ITP A;  1YNJ D;  1GXD C;  1ZYR D;  2EJM A;  1J8I A;  4DGZ A;  1CTM A;  1SYG A;  1LT5 D;  4XQJ A;  1S4Z A;  3CQZ B;  1PRT D;  3H0G B;  2QEJ C;  3H94 A;  1PXU A;  1LT6 D;  3HOY B;  1NR4 A;  2XSC A;  2RVL A;  3EA6 A;  1TWF B;  4FVM A;  3ERQ A;  1IL8 A;  4A3E B;  1WVL A;  1X32 A;  1AZP A;  3MXG A;  1D1I A;  4PQX A;  2G9H D;  1FYC A;  1EFI D;  3GTQ B;  1PZI D;  3PUZ A;  3NBI A;  1O78 A;  4S3S A;  3PUY A;  5CYU A;  4DK0 A;  4CJ0 B;  4BWG B;  2NN6 I;  3IKJ A;  1W6J A;  5ELD A;  2F0G A;  1EY5 A;  3TZU A;  2F0N A;  2IW3 A;  4G7H C;  3BDL A;  2D5D A;  3NWS A;  3KBG A;  4B9W A;  2XRS D;  3PUW A;  3SE0 A;  4ZUI A;  3FRP B;  1ICW A;  4OO1 H;  1OXT A;  3MHB A;  1WTO A;  4KY6 A;  2RSO A;  1MI2 A;  4C2M B;  5FO7 B;  3BZD B;  1RTO A;  2M00 A;  3FPU B;  1C8C A;  1RHP A;  3Q6S A;  1JIC A;  1I50 B;  1QWY A;  1TS3 A;  5D3I B;  3SR1 A;  1STA A;  1TVX A;  3G6J B;  3LX0 A;  1CI3 M;  1M4V A;  5FOB B;  1LAC A;  5KNB A;  4LMQ D;  4RHS A;  3I8Z A;  5JJZ A;  1EY4 A;  1HUM A;  4RKB A;  4KMU C;  4FF1 A;  5I6Y A;  4PMC A;  4IFD I;  2D2C C;  4A3B B;  1STH A;  2X6G A;  2BE5 D;  3WOF A;  1F9S A;  3T13 A;  4KI0 A;  3T16 A;  4PV1 C;  2HDL A;  1I6H B;  3W2D A;  3HEJ A;  1MGS A;  1F2Z A;  2KA7 A;  1QCB D;  3J81 L;  3A8K E;  4K2L A;  2A69 D;  1Q90 A;  2XWB B;  2JE6 I;  3DM1 A;  3U9O A;  1EZ8 A;  3SK4 A;  3NHH A;  3D6W A;  4WOR A;  2F0F A;  4TQU S;  1ZYR C;  1ET6 A;  5KRU A;  2XRQ D;  1D1K A;  1SE3 A;  3Q24 A;  3J7A F;  4H13 C;  2SEB D;  2F0U A;  4QB4 A;  3D6C A;  1SFO B;  1RD9 D;  1Y8N B;  3HS0 C;  3NP8 A;  1ZXT A;  5F2D A;  3X3N A;  2HQE A;  1S5F D;  4O42 A;  2ZXP A;  4TRD A;  1CK1 A;  1FD7 D;  1A3U A;  4L8J A;  3R2T A;  4KJN A;  1SYE A;  2NYZ D;  1ET9 A;  4H44 C;  1GUO A;  1D5M C;  2MGS A;  2EY5 A;  3J7Y W;  2OT2 A;  3MC0 B;  3S14 B;  1SEB D;  2BOS A;  3J80 L;  1XX8 A;  1K83 B;  4KKT A;  2FJ2 A;  1IW7 D;  3E5S A;  3VR3 A;  4XYO A;  3QJY A;  4O1N A;  1JOK A;  3E0J A;  1X3P A;  5EGT A;  4CHT B;  1KDA A;  3N52 A;  2F0K A;  2EPB A;  4CKB A;  4P2C B;  4ZKC B;  1ROD A;  2J7Z A;  5M5X B;  1LT4 D;  2IT1 A;  5A2Q E;  4XQN A;  1G8Z D;  1G91 A;  5COY A;  4BBS B;  4A3G B;  4FF2 A;  3PUX A;  1SSO A;  3K6O A;  3HOZ B;  4Z9C B;  1B50 A;  3MXU A;  2IWH A;  1AW7 A;  4C3I G;  4YIJ A;  5ELC A;  3TN2 A;  1JE4 A;  4FXD A;  2JYO A;  4HMI A;  2SNS A;  2Z4H A;  4CJ2 C;  3KLS A;  3VA5 A;  5J39 A;  4JBW A;  2ENB A;  2JEA I;  5JEA J;  5J22 A;  3H09 A;  5I4D A;  2B2V C;  4K5W A;  1CFM A;  3SXH A;  1SYB A;  3VYS A;  2RDH A;  3OPO A;  1I4H A;  4K14 A;  3FVQ A;  4EQO A;  1EWC A;  3S9W A;  3FKI B;  5KIX A;  2B8G A;  4ULL A;  4KTA A;  5C3W A;  3HG9 A;  5C4Z A;  3TP6 A;  1R4P B;  5EJW A;  2IL8 A;  2EYP A;  1LLR D;  2PNR C;  2AWN A;  2F0O A;  1H9J A;  1Z7T A;  1WTR A;  2EYL A;  2Y0S B;  3OWE B;  3N6R A;  3S15 B;  4ZAI A;  4UAI A;  4C3I B;  1W6K A;  4R9W A;  1WTX A;  1UAP A;  2QF7 A;  3RZO B;  5DNF A;  4G4K A;  2F0T A;  1B2T A;  4LAA A;  2F0M A;  5IT9 E;  2NVY B;  2BA0 A;  5EBD A;  3HRZ C;  2L1B A;  4IQZ A;  1FNV A;  3KLS X;  2AUJ D;  1SMY C;  4G7O C;  5I9P A;  1EYD A;  1EY8 A;  4IFD H;  5D14 A;  4K6D A;  2XIW A;  1TS4 A;  1V8Q A;  5KYI A;  2CHB D;  2RA4 A;  1F9R A;  3BYY B;  2B2T C;  5E4W C;  3PMF A;  4B9X A;  2EY1 A;  4IUQ A;  1HFN A;  3LWE A;  3NXW A;  2KVM A;  2B2W C;  2L4N A;  1T5E A;  1QE6 A;  5EKK A;  1F2M A;  4CKC A;  1DYQ A;  3R2I A;  1Q3L A;  3JAM L;  5C0X G;  1WD0 A;  1WTV A;  3A8J E;  1SNO A;  1U4L A;  3I73 A;  1ML0 D;  3J7A V;  5JPN C;  2B2T A;  2WAC A;  2A74 C;  5I6W A;  1SNP A;  1I6V C;  4MHE A;  1D6E C;  3IL8 A;  2IPK D;  1JR0 D;  5JVG 3;  4GZY C;  1FNW A;  1KDB A;  3OW7 A;  2PMZ B;  1VF7 A;  5KNC A;  2K5W A;  1DON A;  3OMC A;  1BF4 A;  1JC7 A;  2V4D A;  1Y69 U;  4QUF A;  3FMC A;  2I07 B;  3NE5 B;  4RHR A;  5FO8 B;  4X3T A;  4A3D B;  1CA5 A;  4RWS C;  2R3Z A;  1GHJ A;  5CR3 A;  2BDO A;  2KEC A;  2PZW A;  5D65 A;  3L9A X;  2RDG A;  5I2X A;  4NKL A;  2C9O A;  3RZD B;  2K28 A;  4HR7 B;  2RQX A;  1IHZ A;  3M7N A;  1E2Z A;  2A68 D;  2FMM A;  4OIK A;  4A3M B;  1KLU D;  2PW7 A;  2O4X A;  1SYD A;  1A2U A;  5M9O A;  1I3Q B;  4B08 A;  1EL0 A;  4NMZ A;  4KJO A;  1VCI A;  1ZEQ X;  2LS0 1;  4F87 A;  4HCE A;  1HA6 A;  3T4A C;  5KGU A;  3PO2 B;  1MBY A;  2K03 A;  1V1P B;  4CJ1 B;  3SK8 A;  2FMC A;  1SYF A;  4OHJ A;  2IX1 A;  1VMP A;  3NQI A;  1C4Q A;  1U4M A;  1ENA A;  3LWU A;  4ZUJ A;  3A7L A;  3TDQ A;  1OO9 B;  5JOB A;  4ZK9 B;  3NBH A;  2E2H B;  1QOH A;  3GTJ B;  2PPB C;  1Y1W B;  1PLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...