1O78A

Biotin carboxyl carrier domain of transcarboxylase (1.3s) [10-48] deletion mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
84
structure length
84
Chain Sequence
MKLKVTVNGAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIOTIN CARBOXYL CARRIER PROTEIN OF METHYLMALONYL-COA CARBOXY
publication title NMR Studies on the Solution Structure of a Deletion Mutant of the Transcarboxylase Biotin Carrier Subunit
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
molecule tags Carrier protein
total genus 6
structure length 84
sequence length 84
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2002-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1o78A00
2E76C 3AB9A 1OXSC 3PUXA 1Y8NB 2O5IC 4DNTB 3W3AA 1OXXK 2NN6I 2YYZA 4KN7C 1DCZA 2EVBA 4KI0A 2Q8IB 2BE5C 3TZUA 3M4YA 2LMCB 3N6RA 5JEAG 4IQZA 2K33A 3A7AB 2A6ED 1IW7D 1HCZA 3EQLC 3T51B 2B8GA 1Y69U 3VR6A 4IFDH 1H9SA 3ND8A 2A6EC 1IW7C 2F1MA 3KLRA 4KKUA 1LABA 1ZKOA 4XTCS 3RLFA 5C0XG 1Q1EA 3DXJC 3I72A 3CRLC 4JBWA 1GUGA 4TQUS 4KHZA 1OXUA 3PUWA 5BN3A 3PV0A 3FMCA 1ONLA 4G7OC 5KNDA 2JEBI 3IFTA 1CTMA 3BDOA 4DK1A 4G7ZC 4OO1G 1GHKA 2BE5D 1B9MA 1VCIA 2E74C 2V4DA 3MFYA 1G291 1H9SB 2A6HD 3BG3A 3OOCA 5BN5A 3MXUA 1E2WA 1H9RA 1H9KA 3D4RA 2ZT9C 4KKSA 5JEAH 1CI3M 2KCCA 2A6HC 4PV1C 4G7HC 1O78A 3A8JE 1Z7TA 5A35A 3VR3A 1H9JA 2JXMB 1PMRA 3NE5B 5BN4A 1E2VA 2B8FA 1VF7A 4H44C 4OGQC 5C0XH 5K36G 1I6VC 1Q12A 1GUNA 2BA1A 2A69D 2AWOA 2K7VA 3T53B 4KMUC 1GUSA 1DXMA 2A69C 2DNCA 3GQBA 3D31A 4TKOB 4BA1I 1GJXA 2PNRC 3HGBA 3M85A 2PPBC 4GZYC 3A8KE 2O5JC 3QG1A 2AUKA 4H0LC 2E75C 3VR5A 3WDNA 3VR2A 1VDZA 1ZYRC 2EJMA 3H94A 1E2ZA 3GD7A 2NN6G 3LNNA 1A6XA 1TKWB 1CFMA 3M7NA 2BA0A 2L5TA 3ND9A 3VR4A 5KNCA 3LWUA 4DK0A 1Q90A 2BDOA 4LK1C 3U9SA 1EWHA 3I73A 1OXVA 1SMYC 2JEAI 1Y8PB 1B9NA 1TU2B 3SDZA 2EDGA 3FPPA 3QJYA 1OXTA 4L8JA 1VF5C 2D62A 3P20A 3PUZA 1IYVA 1HQMC 2QF7A 1GHJA 1V8QA 2DNEA 2R6GA 3QIAA 4JK1C 1DD2A 4RCNA 4I7ZC 1Y8OB 2A68D 4BA2I 1Q1BA 1V43A 2DN8A 2IT1A 4HR7B 4OO1H 2EJFC 4XIGS 3PUYA 4LJZC 2AUJD 1HTPA 3A8IE 2EJGC 4KN4C 1O7LA 2A68C 2KA7A 1K8OA 1BDOA 2NN6H 1FYCA 1QJOA 3T56B 3PUVA 4KKTA 3L7ZC 1Z6HA 3A7LA 3VA7A 4DNRB 5KNBA 2K32A 2CW0C 3CRKC 4IFDG 3IKJA 4H13C 1K8MA 3SE0A 1FR3A 1IYUA 3OW7A 1T5EA 1H9MA 2JE6I 3I4LA 5K36H 1GUOA 2D2CC 2D5DA 1YNJC 3OPOA 1HPCA 2PCFB 1LACA 1YNNC 1GUTA
chains in the Genus database with same CATH superfamily
3AB9A 3DWPA 1KAAA 4A3CH 4X3SA 4DNTB 2NVXH 3R3OA 4LFBQ 4HJAA 4A3DB 4OELB 4LF6L 1KNAA 3JC66 3F8TA 4WRDA 3M9BA 4Z9CB 2NZ1D 4CBVA 1PH3A 5D14A 5C4JH 3S17H 2XIWA 1PH7A 4YCWA 1EIHA 2CWAA 3CRLC 4A3KG 3HP3A 2JQOA 3KUPA 2L55A 1EY5A 5IYDG 4G7OC 1PRTD 3GTLB 4OEMB 1N33L 4DK1A 3KBXA 5LMNQ 4OO1G 2V4DA 1J5EL 2WFWA 3BG3A 4IALA 3TN2A 3TP8A 2A6HC 4FF1A 4DV2L 2L0CA 2IW3A 4R4IA 5DEHA 5M3FB 1WI5A 2E2DC 3NQTA 2YTXA 3PO3H 3KLSA 4QMGA 5CBEE 1J9OA 5CORA 3E3XA 1ILPA 3FEWX 1STEA 1UE7A 2CQAA 4P72A 1VQ5A 1Y1VG 1G2TA 4TKOB 2F0JA 3PF5A 4KY5A 3KF8B 1STNA 2VS1A 3CMEA 5FLXL 4HIKA 5BR8Q 3N52A 5J39A 3C2PA 1VS0A 1SLJA 4U68A 1Q86C 1CHPD 2NN6G 1K0SA 1A6XA 4RAUC 5IP9G 4JG2A 3J7YW 3ND9A 5DLQE 3OHXC 4YY3L 4IUVA 1WD0A 1I3QB 5M3FG 1Y8PB 4K8JA 3SK5A 2IX1A 4GLAC 3WOEA 1V8QA 2UXBQ 2IHEA 2ZXPA 5FJ8H 3S16H 1YNXA 2IT1A 1XPOA 3A8IE 3KLSX 4C2MH 3W5OA 2KA7A 1SYCA 1KC8C 5EBDA 3PUVA 2EYLA 2KCMA 1KNEA 1T5EA 1VQLA 4ZQ3A 1GUOA 4JI6L 1GVPA 3V2TA 4KK7A 1M4VA 1GUTA 3S1NH 1D6EC 3K0XA 1PH2A 2HQEA 1ASYA 4LF4L 5DNFA 2WKDA 1I4HA 4DA2A 2M00A 5C5MA 3H91A 3K58A 1KLGD 1B44D 1X3GA 4X66L 2JYOA 2YU9B 4C1NI 4HIMA 1D2BA 1B8AA 2B2TC 1T9HA 1CQVA 4RHSA 3FMCA 1NSNS 1JOOA 5C3EB 1K3RA 4ODGA 1H9SB 1PTOD 3MXUA 1E2WA 3D3RA 1I4XA 4KHVA 3TS0A 4FP5D 5LMNW 2K1BA 1B50A 3CD6A 3S2DB 4J1MA 3BDCA 4U673 3Q22A 3Q8DA 3DWQA 1AFPA 3K5LA 4L6TB 2MNAA 4B3MQ 3H3VH 1STGA 2VUMH 1GUNA 1BCPD 1TWFH 2F0HA 2NVQH 1Z9FA 4BY1H 1STBA 2RCFA 3DEOA 4LUZA 4DUYQ 3RN2A 1Y14B 4RMFA 4LF9L 1X54A 2KENA 3QG1A 3GP7A 3HOWH 1XMQL 4KHPQ 2E75C 3VR5A 3K5OA 2KHJA 2PMZB 4A93H 4RKBA 2I07B 1KLUD 1X3QA 5C3EG 3TP6A 3LX0A 1LTLA 2HD3A 3WWVA 1VQOA 3FPUB 1FGBD 2RBMA 4R1JA 5KNCA 4IOAA 4DK0A 1Q90A 4LK1C 1VQKA 2KOLA 4A3MB 1OXVA 1SMYC 4XQJA 1M1KC 1LTBD 3FPPA 3J80c 1VF5C 2OWOA 3IL8A 3QIAA 1DD2A 3BZKA 2EYHA 2OEOA 2NVXB 3S24A 4AQYL 1HA5A 2EJFC 1NE3A 1S5FD 1L2FA 3VYRA 2XNAC 2R7ZH 1K8OA 1G6ZA 1SNCA 1R4PB 1WD1A 3OWFA 3A7LA 5C4JB 3S17B 2K50A 4DV1Q 2XWJB 1IKMA 2MP1A 2Z4HA 4A3MG 1FNWA 4C3HH 4E6IA 4QY7A 4A3JG 4K5XA 1STYA 1ENCA 1L1OC 4KN7C 2Q8IB 3P1HA 3I4NG 4DR6Q 2K5QA 3N6RA 1UAPA 1BBWA 3DWAA 2HHHQ 3GV3A 3HG9A 5CYUA 5DAUA 5JVG3 1BO0A 1HCZA 2H1EA 1Y69U 3PO3B 2B2VA 2VB2X 4UY8C 1C7YA 4N9PA 1SE8A 3TEHB 4V190 1YI2A 4LFCQ 3EN2A 2DY8A 4ZUIA 5KNDA 5IGGA 4JW0A 1QB5D 5D65A 1PH5A 1DOKA 2GVBA 3NWSA 5C0XJ 1BKBA 5IYBH 1X9NA 4ME5A 4LFAQ 1WCMH 3J81i 2UXDL 5C0XH 1KIXA 5IP7G 1KRSA 5CV8A 5KIXA 4DR2L 1ICWA 2F3WA 2J4XA 3IFDA 4JC0A 1N34Q 1K8AC 3E0EA 4ZYSA 5C3WA 3I70A 3MXNA 1HR0L 1E7ZA 3F2DA 1HJPA 1E2ZA 2CFMA 3CF5A 5EJWA 4O1NA 2IY5B 1PVOA 1CKOA 2SOBA 4A3FG 2WKCA 1IYVA 2HQLA 2IPKD 4JK1C 3S1NB 4B3SQ 1Q82C 4K6DA 4HR7B 1S3OA 2C9OA 5F2DA 3A56A 3JAME 1VQCA 4KD3A 4JVZA 4A3EH 1MJCA 1V1PA 5J1ZA 1FYCA 3CCEA 2E2IH 2D0OA 1PTOH 1SN8A 2P5ZX 5IGFA 1PFSA 4UDUC 2JN4A 3MWYW 1R9TB 1HNXL 1D1IA 2B3GA 3HKZE 1LT3D 3OPOA 1VQGA 2DY7A 1B3QA 1JWSD 3J81E 3EFXD 1WTHA 3GTGH 4B3RQ 4OIJA 2I5MX 1L1OB 4DN4M 1AEXA 4ME3A 5CV9A 5HY6A 3M4YA 3VYTA 5IODA 1F9RA 4JBKA 2GA4B 2B2WA 1SBBB 2Z6KC 4ZAIA 3OYYA 1V1QA 3VR6A 1V9PA 1E1OA 5CV4A 1YITA 2UUAQ 2Q2TA 1IBMQ 3IAYA 2CHBD 1ZKOA 1DOLA 2NVQB 4BY1B 2EE1A 3TMEA 1F77A 4QIWE 4QUCA 3L9AX 1ESFA 4LMQD 3Q23A 2BE5D 3M4OB 1A63A 3A55A 2A6HD 3STBC 1JB3A 2B2UA 4WJ3M 3F2BA 2NVTH 2A5HA 2Z0SA 4IUUA 4N8FA 4DAYB 3V05A 1H9JA 1RTNA 4A3BB 1LO5D 4MTNA 2KUMA 1U5KA 3FP9A 5BN4A 2JA7B 4OGQC 3J80i 1RTOA 1SE4A 3H0GH 4A3KH 1QWYA 4WORA 4FF3A 4Y7NH 3I4MB 4NKLA 2J0TD 2L9HA 3M85A 4JOIA 2L4NA 1UNSA 3CCLA 3BYYB 1I94Q 3M4QA 4IUTA 3UE1A 1VDZA 1V1OA 5E4XA 3EJIA 4A3DH 3EA6A 5KYLA 4JI5Q 3T1HQ 2FMCA 2KBNA 1HNZL 3VR4A 5NUCA 3ICEA 1P8LA 4EQOA 2Z1CA 1D1KA 1Y1VH 4L8JA 4DV6Q 1OXTA 4MHEA 4A3BG 4X6AH 2JA7G 1HTLD 3E9HA 2CQOA 3SR1A 3ERQA 1Q1BA 4YIJA 3I4MG 4XIGS 1S72A 1DONA 1MD2D 1PFNA 4AYBE 3CCVA 2NN6H 5IP9H 3T56B 4K0KQ 1GD7A 3BVMA 1JOKA 3NHHA 1X3FA 2GVAA 5M3FH 5JOBA 3K80C 4N9TA 4DR1L 2MO1A 3I4LA 4DR7L 1Y1WB 4JYAQ 1I50H 4J15A 5K36H 1A2UA 4RHRA 4KY6A 2PCFB 3HFZB 3QR8A 1L0XB 3HOXB 1CA5A 3AU7A 4HMIA 5TSSA 4JI1Q 1OXSC 3J80E 5GAEC 5C6AA 4UP7A 1LYLA 2YYZA 1W3SA 2YTYA 5JEAG 2ZTCA 3NTIA 3H15A 2OCEA 4C3JB 4HN7A 1HFGA 3CPWA 4UPAA 5EQ0A 1BVSA 2A6EC 2VXWA 4LNQA 3QOLA 1WTVA 1LABA 1PXUA 2IX0A 1Q1EA 4DV4Q 4JI2L 2JA8B 5IT9c 1I3QH 2BH8A 3OIQA 5FK9C 1Y1WG 4HMJA 1HZAA 2JEBI 3CPFA 1IXRA 1TVXA 2UUBQ 1VCIA 1IBKQ 5A2QE 3D4RA 3UDIA 3BYTB 1E1TA 1PZKD 3U4VA 1L0YB 3X3NA 4QUFA 3S1RB 4O0AA 4FVMA 4C3JG 1E2VA 3SHLA 1LT5D 4I65A 2K75A 3R93A 1JJGA 1O80A 1K28A 4ALPA 2PPBC 2JA8G 1EYDA 5FLXc 4A3EB 2D9UA 5FOBB 1ZYRC 1SNDA 4R4CA 4JI6Q 4FDBA 1QOHA 3CCMA 1PTOB 4K8IA 3MEHA 3A5UA 4HAEA 4MZ9A 4CDFC 1SMYD 4DXFA 1HNWL 4LF6Q 3EIVA 1VQHA 5AJ3L 1NY4A 1DOMA 5JJLA 3RZOH 2YU9H 1TU2B 1X56A 2EDGA 1X65A 4OO1I 4RGTA 2E5LL 5I6YA 4IPHA 4R8IA 4FXKC 4RFBA 1EY4A 1IL2A 5C3EH 1YVCA 4KKTA 1N33Q 4A3IG 2FHTA 1J5EQ 4OX9L 3S2DH 1II3A 3K7AB 1QNUA 2AQ2B 4GNXA 4X64L 4LWCA 2E2JB 3AFQA 1NBWA 4DV2Q 4ZRZA 1JQYD 1YNJC 5FO7B 1EY8A 1YNNC 3QOJA 3GTQB 1YZ6A 2WAQG 4LF8L 3OTOL 4X65L 2MPMA 1SNPA 2NN6I 2NVTB 4ZUJA 1U4RA 4GKKL 1ASZA 3HOUB 1CUKA 4DPGA 4BXXG 4R4QA 3VYUA 3KJOA 1YJNA 4A76A 4KKUA 2ATWA 5AFWA 2VNUD 3G7LA 4A3KB 4XT1B 3GO5A 4I7AA 4DU9A 4Y7NB 4A3MH 5EKIA 2CH4W 4TQUS 2ID0A 4IUPA 2KECA 4YY3Q 3NBHA 3HOVG 3UE0A 3IFTA 4ZKCB 1QVFA 3QO2A 3I4NH 2JA6G 2ZT9C 4A3LG 4L5SA 4RGOS 2EZVA 3NEMA 3HOUG 2F0NA 4BY7B 4B3TQ 1O7ZA 2IWHA 1Y1VB 1VQ9A 2K7VA 3VYSA 4UP8A 3G71A 1D5ZC 5T1GA 1GUSA 3RMHA 5IT9L 1MKHA 4HJ9A 1O7YA 1BNZA 1GKHA 3ZJYC 3HS0C 4IJLA 4O42A 1EL0A 3K5NA 2IX3A 2F0SA 3GD7A 2QKIC 2JA5B 4R4TA 1K9MC 4R4OA 3RD4A 3M7NA 4FO2A 1JB7A 4TVAB 4LF4Q 2K01A 1I50B 1VQNA 5IP7H 3PMFA 3KK7A 5G3LF 3P75A 4BY7G 1HQMC 2R6GA 4X66Q 5M5WH 1YEZA 2DN8A 5CC4A 4KN4C 1LT4D 5M5XB 1QG7A 1CM9A 3W2DA 2PQAA 4HCSA 1F2YA 2K5DA 3J7AV 1D5XC 4DR5L 3CRKC 4A3FH 2JA5G 1JT8A 1IYUA 2D2CC 4RH6A 2UXCQ 1OO9B 1PV4A 3KF6A 1M90C 4OWXB 1F9PA 4ILWA 3MEFA 2F0WA 4BBRG 2RDHA 1B4OA 4IUQA 2N3SA 2VB3X 4DAMA 4IO9A 4LF9Q 4JI0L 1JJCB 4RG1A 1XMQQ 1CK1A 2B8GA 3DHQA 1CSPA 1YHBA 5HGTA 3UI2A 5EGTA 1U4LA 3CC7A 3HOZB 4XTCS 3I72A 3I56A 2ZXOA 2NVYB 1T5XD 2FMMA 2ZM6L 1KRTA 3PV0A 1J8IA 3IRBA 5JPNC 1I6HB 2Q8TA 3STBD 3BDOA 4CDEC 1WTRA 1BR9A 2PNHA 2E2HB 2B2WC 2DJGC 3OOCA 3CQZB 1CI3M 4IZ8A 1SAPA 3RN5A 1O78A 1S5BD 2HCCA 1Z7TA 4AQYQ 2SEBD 2QCPX 4YHHL 3KYHC 5HURA 4DV7L 3RZOB 2CKZB 4FYDA 1CKNB 4XT3B 1Q12A 2F0VA 1R9TH 1AP0A 1VQDA 3AYHB 1QZGA 2B2UC 2A69C 4HTHA 3VDYA 3HOZG 2OQKA 5EKKA 3E9IA 2PZTA 1JC7A 2EYPA 2OTJA 4GKJL 4OL7A 3R8BA 4HJ7A 1LTSD 5GROA 3NELA 1PH9A 4C56C 4A4IA 2NTTA 1D5MC 1E22A 1G8ZD 3TBIB 1XWEA 1EQQA 1B9NA 4JOIC 1RODA 5GQOA 1EY7A 3SDZA 2R61A 5IY0A 3MXNB 1FL0A 3PUZA 4R8NA 1LTRD 2LY7A 2VQFL 4FF2A 3F2CA 1Z47A 3M4PA 4POFA 3BS1A 2HIVA 5IGCA 1SNMA 2KQ3A 3M4OH 4DR3L 2KHSA 2CWPA 5FLXE 4DV0L 3ITPA 2Z6BA 5KRUA 2ZJRA 1KDBA 3IKJA 3FHWA 4GOPA 3HOYB 1AN8A 4A3BH 2F4IA 3NBIA 3TDQA 5HGQA 2JA7H 1D7QA 1PRTF 4WJ4A 3CP0A 4A3JB 1V1PB 4NDXA 1TWGB 4DK6C 2UXDQ 2L11A 4G57A 5ISRA 3I4MH 3I4NB 2ZJPA 4DR2Q 3KJPA 1N36L 1RJTA 1QUQA 1FNVA 1CA6A 4CGYB 2F0FA 1N32Q 1RF2D 2A6ED 2PMZE 1ZEQX 2ASBA 2SDFA 1N9WA 1HR0Q 1IW7C 2F1MA 3BVZA 3MAQA 1LLRD 2KCTA 1SROA 1TWHB 1XMOL 1S5CD 3HOYG 2HDMA 1OXUA 3MTSA 1C8CA 3MZ5A 3JAML 1SNOA 2EY2A 2R92B 4P2CB 1BUVT 2G9DA 2XRSD 4PZ7A 2E74C 1WTXA 2AQ3B 1FJGL 5JEAH 1A3TA 5ELDA 4PV1C 1XXGA 4G7HC 3VR3A 2MJ8A 4NXMQ 3G6EA 1QVCA 1EYCA 2YV5A 2K5WA 2OT2A 4H7BA 1A8VA 1E24A 1EQVA 4K6LA 1Y1WH 2MFIA 5IOCA 5M5WB 1HNXQ 3HOXH 4A3CG 3KDFA 2QA4A 1ZYRD 1ENFA 4JI3L 1S5DD 2R92G 3MVVA 5EPLA 3ONAB 5H1SE 4J8QA 1PHJA 4LF5L 4A3FB 1B70B 2EY6A 3BZDB 4DUYL 4C3JH 2XWBB 1MJEA 4H02A 2N55A 4ZLTF 2BDNA 1VQMA 3I4OA 1HFNA 2Q2IA 1EWCA 1S5ED 1W6KA 2QF7A 4L5TA 2JA8H 3AEVA 4UAIA 2RSOA 4BA2I 5I6WA 1VQ6A 2R7FA 3J7AF 2PZWA 5M5YB 3NPPA 3KOJA 1BDOA 2B63G 3AMUA 4QL5A 3L7ZC 2VQEL 3VA7A 4F87A 2WACA 3UDFA 4HSVA 1YNJD 2Y0SB 3S1RH 2A1AA 1YNND 3FDTA 3SK8A 3EBEA 5I4DA 3C3LA 5K5PA 3NTHA 1JWMD 4K5VA 1PTOF 1ICFB 4OWTB 3GTJH 5FLMG 3TZUA 4IFDI 2LMCB 3SXHA 4GNXC 2KCNA 1PH4A 2SNSA 2F0GA 5E7NA 2B2YA 4A3IH 1W6JA 2MUYA 3C46A 2MGSA 4RKLA 3DM1A 3ULLA 3ND8A 3TP5A 2MO0A 5COYA 1BCPF 1P16A 3RLFA 2EYFA 2F0UA 1HR0W 3PIPA 1FNUA 2Y0SG 1HNZQ 1EQRA 2QGQA 3H6MA 4DV3L 1A15A 5I2XA 4GN5A 1ML0D 1BF4A 2ES2A 1ET6A 1I4QA 4QQBX 1B9MA 3MFYA 2F3IA 5KEEA 1H9RA 4JBMA 3CMAA 1UUPA 4PG3A 1SFOH 2RCNA 1S40A 4BXXH 5A35A 2Z8LA 3RUZA 2B8FA 2FFKB 2LXJA 4EQPA 3PO2G 3K7AH 2JA9A 3S2HB 2E2JH 1I4GA 2D0PA 1PLFA 2K03A 1GJXA 1EIGA 1NMGA 3S15B 4DR7Q 1WVLA 4DR1Q 3GTQH 2O5JC 3S9WA 3PCOB 3W1GA 1GUWA 5GAHC 4P75A 5JPMC 3V96A 3S14B 3H94A 4CKBA 3DM3A 1VQ4A 3PIOA 3M3YH 2NTSA 2F0EA 4PZ6A 3HOUH 4QJFA 1X6OA 1Q8KA 2CVRA 5ELNA 1XPUA 1N34L 2I46A 2F0KA 1RL2A 2K52A 1DJRD 1EY0A 2ICIA 2WB1E 2ICEC 5A2QL 4IN3A 5IYDH 3NWTA 4I7ZC 3OSOA 4OO1H 1V43A 3I8ZA 4JI2Q 1MSHA 2AUJD 1CQFA 5E3FA 4QB4A 4JI8L 2F0MA 2F4VL 2EQSA 1HRJA 1NMFA 1XTCD 4IFDG 1JR0D 1WFQA 4IUNA 4KD4A 4BY7H 2ALYB 2D5DA 1HPCA 4TRDA 5IGDA 3U9OA 4DUZL 1E0BA 3OW2A 1DZ1A 1CT1D 2K4KA 2LKVA 1BBXC 3CCSA 4DR4L 3J7A5 3Q6SA 4GNXB 5CBAE 2R7DA 4YWMA 1A62A 3D8GA 2K05A 4EX5A 4P73A 4LUVA 1KL9A 2JA5H 3K0YA 3KLRA 4PZ8A 2C35B 1DM0B 3HEJA 4NXNL 2BOSA 1TWAB 2Q2UA 1K0RA 4HCEA 1SRUA 3GTKB 2AWNA 3CC2A 2FXQA 1HNWQ 5C44G 5AJ3Q 1RIPA 5ELEA 2KEEA 1GHKA 2XN9C 2KEDA 3FVQA 4QCLA 4UP9A 1PFMA 1ZXTA 1EZ6A 3NXWA 2E5LQ 1AH9A 2EYOA 4C1NK 2K6AA 1QZHA 4XDXA 5M5XH 1HQRD 4RWSC 4JV5L 5C4ZA 4A3GB 2ZTEA 3NBHB 1VF7A 1KQSA 2A69D 5CV6A 2BA1A 5IWAL 4KMUC 1VQFA 4BA1I 4OX9Q 3D31A 1BOSA 2GN5A 2PNRC 4X64Q 4FF4A 3A8KE 1HHVA 4JCVE 2O2LD 3CAMA 4DFAA 3TRZA 1ENAA 3ULJA 4DXGA 4LF8Q 3D6CA 3LNNA 3SK6A 3OTOQ 4X65Q 1FD7D 1XNRL 3NK9A 5LL6X 4X3UA 2BA0A 1XX8A 2BDOA 1EWHA 2RKSA 3I73A 4GKKQ 1Q46A 4AIMA 1EWIA 5LMUL 2ZXRA 1RHPA 4X62L 4KV6A 4A3GG 2AMCB 3HOZH 4ZKBB 1GHJA 1X32A 2PI2E 2NVYH 3GTJB 3M7GA 2N78A 1I6HH 1STHA 4LJZC 4ZCKA 5C3XA 2JEAI 2A68C 1EOVA 5J3BA 4DV5L 4L63B 1NR2A 2E2HH 1A3UA 2LFNA 4A3IB 1G6PA 3CQZH 4DV6L 1SYGA 4JI4L 1SE3A 1OTCA 4NW2A 3QB3A 4B9XA 2IL8A 1BQQT 2DUDA 3KBGA 2QILA 2WAQB 4CKCA 5ELFA 3QWNA 4IJHA 2PQAB 2PW5A 3H09A 5T1IA 2VL6A 2EVBA 1YJ9A 4JI7L 1SFOB 4KLKA 4IQZA 2F0QA 1YHAA 4GOPC 3KFUA 1IW7D 3EQLC 3L3OC 1HXYD 3CHBD 3KF6B 1H95A 1IBLL 5IGBA 4JPBW 2J7ZA 4NPSA 3TZDA 5GAGC 2RHQB 1VQPA 1N8RC 3ERSX 4FXDA 4Y52H 3I91A 4PQXA 3FRPB 4K14A 3HOVB 1HUMA 1MIUA 3PUWA 1XNQL 3NENA 4LF7L 2LSSA 4MN3A 2JA6B 2FJ2A 5ELOA 3D0FA 2EXZA 2WV6D 4NP5A 3M3YB 1TT2A 3UDGA 4F88A 1PZJD 2QDLA 1PMRA 4Q0FA 1UE1A 2OF1A 5I9PA 2JK8A 5IYCG 3E0JA 2ENBA 1WTQA 3HOYH 4K5WA 3MXGA 3RZDH 3GQBA 4DR5Q 3GTOH 4A3JH 1WJJA 3DEPA 3PSIA 1TWGH 3WDNA 3VR2A 3T1YL 1PZID 2EJMA 3CKIB 2B2VC 1EOTA 2HIXA 1A0IA 5JAVA 1LUZA 3AQQA 5ELBA 3ULPA 3U9SA 1JICA 4B9WA 1VMPA 3KLWA 4JI0Q 2Q8RE 2M9VA 4KJOA 1TWHH 3L0OA 1JOQA 2DNEA 3S1MB 1K83B 1TS5A 4A75A 1SNQA 4RCNA 1RDPD 2PI2A 1J6QA 1NCVA 3K6OA 3SEBA 2R92H 2EJGC 1TY2A 4APVA 2ZM6Q 1LT6D 2Q2HA 3GTMH 1QJOA 4IPCA 1Z6HA 4R9WA 4MIUA 4BBSG 3UDXA 4H13C 1FGUA 1YHQA 3B6YA 3H0GG 4YHHQ 1KXLA 4DV7Q 3F2UA 1U9RA 1Y8NB 2F0PA 3GTPH 3P7JA 4BBRB 3CCRA 4OIKA 1MGSA 1DCZA 2BE5C 2RQXA 2M2LA 1SEBD 4GOPB 4HIDA 4LAAA 2CCZA 2B63H 2A8VA 4A3DG 3A7AB 2PYKA 3T51B 2V1CC 4GKJQ 2UUCL 1EZ8A 2RSNA 3DXJC 4LW1A 1W2BA 1QUQB 3CCQA 5BN3A 3JAMc 1F9QA 1ONLA 4CDDC 1EQTA 2R93B 4G7ZC 2B2YC 4ABNA 5FLMH 2L1BA 3HKSA 1G291 1STAA 1H9KA 2VQFQ 2EOTA 2KCCA 5M5YH 3CCJA 3T16A 2UU9L 4KTAA 1PDQA 5M3MB 1EUJA 3J7ZC 4POGA 1VQAA 3NSWA 2E8GA 4DR3Q 1EYGA 2I5LX 3J81c 4N8X1 5K36G 4DV0Q 1I6VC 4RCOA 4C3IB 3T53B 4LFBL 1AE2A 1KDCA 4ZK9B 3S1QB 1NTGA 4CJ0B 1TWCH 1PA6A 1Q81C 5L37A 3Q24A 3TP7A 4DNIA 4B3TL 1LTGD 2R93G 2WP8J 2EXDA 2DGYA 2JJQA 1N36Q 3NUCA 5M3MG 2PZUA 3PO2H 3NQIA 1XJVA 3OMCA 3U58A 3KDFB 1IYJB 3R2TA 5LMNL 2D62A 4CDCC 2VZAA 4XXEA 3G6JB 1JE4A 2HT1A 1B1ZA 1UEBA 4RGNA 4C3IG 2IHFA 1XMOQ 5C4XB 5IT9E 1NAPA 1VQBA 4WJWA 2JP1A 4EVOA 1WYDA 1ET9A 2LXKA 2K28A 3AFPA 1WTOA 2RDFA 1G51A 1LTID 4DNRB 4QF4A 1SJED 2NUCA 1FJGQ 5EBCA 1K8MA 3MHBA 1YJWA 1ILQA 2XSCA 5BR8L 3FKIB 3PGZA 1B7YB 3S2HH 3TREA 1KAWA 3C1EA 3PUXA 2LS01 1AE3A 3W3AA 5E4WC 1HUNA 2YTVA 2DJFC 3S15H 3MC0B 3J81j 4IFDJ 4P74A 5C4XG 3TSSA 1SJHD 3NTKA 1EU4A 2RA4A 4HSPA 1I4PA 3S14H 2UXCL 4JI3Q 1HZBA 4IFDH 1RCVD 3PQIA 2B39A 5I2YA 2CH4A 4G4KA 1JCKB 5CV5A 2UXBL 5FO9B 1NNXA 1KD1C 3RZDB 3A54A 2K14A 4LF5Q 1RD9D 1NR4A 3GTOB 1Q3LA 2AKWB 2RHSB 3FKIG 5CGKA 3K8AA 1QNKA 5D3DA 1PYWD 3C1FA 5CR3A 2G9HD 3RNUA 1C0AA 3A8JE 4EQ5A 3KF8A 1JORA 2OTLA 2EYMA 2FINB 1AW7A 1A3VA 1LTAD 2VQEQ 5C44H 2DNCA 2F0LA 2N88A 3DMUA 1NUCA 1ESRA 5JEAJ 5JJIA 4GZYC 2PO4A 3TS2A 1CSQA 5GADC 3GTMB 1EFID 1AZPA 1LM0A 4J6HA 1YIJA 1BXTA 4IPDA 1CFMA 4HJ8A 4GLVB 1E3PA 1UE5A 2I0QA 2A73B 2Z4IA 2F0TA 3J81L 1PH6A 3RLOA 1IKLA 1TWAH 3P20A 3GTKH 3GTPB 2K5HA 1IL8A 4DK3C 2A68D 1DGSA 1HA6A 2WIIB 5JJZA 3A0JA 4B08A 2B63B 4DV3Q 4B3ML 1I5FA 2VY3A 1SYDA 2NBFA 2RF4A 4L5QA 1TS2A 1VQJA 4DAVA 5KNBA 2K32A 4GN3B 3H3VC 2QDBA 2CW0C 4EGVA 1S4ZA 2EY5A 1EY6A 1FR3A 3OW7A 2ZJQA 2VW9A 4A3GH 4KHPL 1GOZA 3JAMi 5C5LA 2ZTDA 3U50C 1MBYA 1EIYB 1CKNA 1UWVA 3MFGA 1HH2P 4XYOA 1EIFA 1WTWA 4YWLA 3A74A 4DGZA 4LUOA 4MTKA 3ZYYX 2F0IA 1PH8A 3T4AC 1U4MA 2K33A 1HZ9A 1H9SA 1U4PA 1XPRA 1X55A 3PO3G 2C5CA 3ER0A 3K57A 1HZCA 2RVLA 3S16B 1N32L 1D8LA 1MSGA 2TMPA 1TWCB 4PNYA 4C2MB 1CTMA 3LGJA 1PRTC 1TIID 5JJKA 3GV6A 4KKSA 3H3VI 4DV1L 3I7FA 3HRZC 3PIP3 1C9OA 3HKZB 1QE6A 3PO2B 2JXMB 4RA8A 4JI8Q 2F4VQ 3L2PA 3MA2B 3URYA 4HIOA 2G5DA 1SYBA 1DXMA 4DR6L 2PQEA 1B53A 2Y0SE 3Q0AA 2HHHL 3HGBA 5FO8B 5FJ8G 4HEDA 4NXML 4DKAC 4X3TA 4DUZQ 4S3SA 4XQQA 2F52A 4LFCL 1EY9A 2EIFA 4DR4Q 2L5TA 1XYIA 1TR5A 1CHQD 3BJUA 2X6GA 4QIWB 1K3BC 2TSSA 4EQNA 3F1ZA 5IYCH 3HKZG 1U0LA 1SYEA 3TQYA 5I9OA 3J80L 1K73C 2OXPA 2AHOB 5J22A 4M8AA 4HJ5A 1L0WA 3PIO3 1M8AA 1QCBD 4NXNQ 3HOVH 1Y8OB 5IE8A 1TS3A 4CJ1B 1UEAB 5DM63 2JA6H 1YBYA 4LFAL 4KJNA 4A3LH 5D3IB 1F2MA 3EROA 1EEID 1TS4A 1GO3E 1SR3A 2WB1B 1Q7YC 2VUMB 4JBJA 3SE0A 1TWFB 2RDGA 4PMCA 1F2ZA 1IZ6A 1XTDA 2BCOA 4JV5Q 1SYFA 4QGUA 3OIPA 3HOWB 2O4XA 2N8NA 2XRQD 2O5IC 4A93B 5IWAQ 1OXXK 2I5HA 2B2TA 2R3ZA 3BZCA 3LWEA 1C4QA 1BBUA 4NMZA 1WOCA 1VQIA 4BWGB 4BBSH 4GLXA 1EFWA 3I3CA 1A2TA 1VMCA 3DUZA 1LTTD 4B3SL 4YCUA 2XVSA 5CV7A 2WB1G 5C44B 2VUMG 1XNRQ 4BY1G 3WOFA 1LV9A 2X6LA 1SMXA 2L15A 2NWGA 2IJ0A 4O2DA 4AYBB 5LMUQ 3S1MH 1PRTB 2R7ZB 1K83H 2QEJC 4X62Q 3HOWG 2WINB 4A93G 1KTKA 1KABA 3RLNA 1PTOC 2QW7A 2K5VA 4F7XA 5JVH3 4UHVA 2EPBA 5C0XI 2JSOA 2KHIA 5LL6S 4ID6A 2F03A 3OWEB 4GN4B 4DV5Q 5EPJA 3SVMA 2HCIA 1EYAA 4B3RL 4CHTB 4C3HB 1PYBA 4JI4Q 1JE5A 2AQ1B 5EPKA 1BCPC 4MNOA 2L12A 2F3VA 3EVQA 2PW7A 4V0BA 3BVGA 1PFBA 4H0LC 3GTLH 4F8MA 4BBRH 2UUAL 4AYBG 1JMCA 2OQ0A 2R7ZG 5E1FA 1QVGA 1IBML 1MI2A 3D4DA 4JI7Q 3VA5A 3E5SA 1RKNA 1TQOA 2K5NA 3D6WA 3QJYA 3I90A 5EAYA 5ELCA 1MHWC 4K2KA 1IBLQ 4C3HG 2NZHA 1AZQA 4IPGA 5KGUA 4OONA 3PUYA 1HTPA 4OXPA 4TSSA 3W1BA 1O7LA 5M9OA 2R93H 1XNQQ 3HZXA 4K2LA 2NB0A 5FKAC 4LF7Q 1Q8IA 2QEXA 4XQNA 1FVIA 3D4WA 1L1OA 1WCMB 2KJXA 4OHJA 5M3MH 2B29A 1TXYA 2A19A 2EYJA 2X69A 1H9MA 2JE6I 4X3KA 1I94L 3K7UC 4BS9A 1LACA 5G3LD 5IIFA 1X3EA 3DLLA 2E76C 4C3IH 3HOXG 1SXTA 4JI5L 3SK4A 3T1HL 3S1QH 1VQEA 1DYQA 4KI0A 1UE6A 3X3MA 4Q5VA 3K5MA 2N49A 1WTPA 1F2LA 3GDEA 4GS3A 3T1YQ 5IYBG 2F0DA 4YWKA 1F9SA 1WCMG 4YCVA 4DAYA 5C0XG 4JBWA 1GUGA 4KHZA 1B3AA 4PMBA 4RGMA 3SGIA 1KHIA 3T13A 4K0KL 4WFN3 1CKMA 4CJ2C 5BN5A 5C4XH 2E2IB 3MXPA 5IGEA 4DAPA 2KVMA 3CC4A 4JYAL 4L5RC 2F0OA 4ULLA 2H5XA 1TY0A 3NE5B 4CKEA 4JI1L 2K04A 4H44C 1VQ8A 4M1UB 2AWOA 2H4OA 1PH1A 5CMDA 3E6ZX 1BCPB 3GTGB 4DF7A 3CCUA 1QILA 4IURA 3FKIH 2WAQE 3NP8A 3PF4A 2AUKA 1G2SA 3OMGA 2SNMA 4PMWA 3G4SA 3G48A 4P71A 4A3EG 1I4RA 1EEFD 1TKWB 4DV4L 1KDAA 2NZOA 1CZGA 2HDLA 1JWUD 3LWUA 5DM73 5LHY1 3CU7A 3A5ZB 1EU3A 3K59A 1VQ7A 1O7IA 2UUBL 5EKLA 1IBKL 4NB3A 3U4ZA 3CXCA 1JJ2A 2HUGA 4FNFA 2Z9HA 5KYIA 2UUCQ 1B2TA 4KY7A 2XTIA 3CW2C 2XGTA 2A74C 3BDLA 1CZWA 1SSOA 4FXGC 3K81C 3I55A 4BBSB 1R4QB 2CW0D 1GXDC 1K8GA 3BU2A 5C4HA 3H0GB 1SDFA 1PYSB 2MQHA 4OWWB 3O13A 2EY1A 4XYQA 1IHZA 1C48A 2NYZD 2UU9Q 1G91A 1NJIC 3RR5A 2BH2A 4AH6A 4IOCA 2Z6KA 1GM5A 3I2ZA 3R2IA 1X3PA 2MHVA 1SE2A
chains in the Genus database with same CATH topology
3AB9A 3DWPA 1KAAA 4X3SA 4DNTB 3R3OA 4A3DB 1KNAA 4WRDA 4Z9CB 2NZ1D 4CBVA 5D14A 2XIWA 1EIHA 3CRLC 3HP3A 3KUPA 2L55A 1EY5A 4G7OC 1PRTD 3GTLB 4DK1A 3KBXA 4OO1G 2V4DA 3BG3A 4IALA 3TN2A 3TP8A 2A6HC 4FF1A 2L0CA 2IW3A 5DEHA 5M3FB 2E2DC 3NQTA 3KLSA 4QMGA 5CBEE 1J9OA 5CORA 1ILPA 3FEWX 1STEA 2CQAA 1G2TA 4TKOB 2F0JA 4KY5A 1STNA 5FLXL 3N52A 5J39A 3C2PA 4U68A 1CHPD 2NN6G 1A6XA 4RAUC 3J7YW 3ND9A 3OHXC 4IUVA 1WD0A 1I3QB 1Y8PB 4K8JA 3SK5A 2IX1A 3WOEA 1V8QA 2ZXPA 2IT1A 3A8IE 3KLSX 2KA7A 1SYCA 5EBDA 3PUVA 2EYLA 1KNEA 1T5EA 4ZQ3A 1GUOA 3V2TA 4KK7A 1M4VA 1GUTA 1D6EC 2HQEA 5DNFA 2WKDA 1I4HA 4DA2A 2M00A 5C5MA 3H91A 3K58A 1KLGD 1B44D 2YU9B 2JYOA 4C1NI 1D2BA 2B2TC 1CQVA 4RHSA 3FMCA 1NSNS 1JOOA 5C3EB 4ODGA 1H9SB 1PTOD 3MXUA 1E2WA 3D3RA 1I4XA 4KHVA 4FP5D 2K1BA 1B50A 3S2DB 4J1MA 3BDCA 4U673 3Q22A 1AFPA 3DWQA 3K5LA 4L6TB 1STGA 1GUNA 1BCPD 2F0HA 1STBA 3DEOA 3QG1A 3GP7A 2E75C 3VR5A 3K5OA 2PMZB 4RKBA 2I07B 1KLUD 1X3QA 3TP6A 3LX0A 3FPUB 1FGBD 2RBMA 5KNCA 4DK0A 1Q90A 4LK1C 2KOLA 4A3MB 1OXVA 1SMYC 4XQJA 1LTBD 3FPPA 1VF5C 3IL8A 3QIAA 1DD2A 2EYHA 2OEOA 2NVXB 1HA5A 2EJFC 1S5FD 3VYRA 2XNAC 1K8OA 1G6ZA 1SNCA 1R4PB 1WD1A 3OWFA 3A7LA 5C4JB 3S17B 2XWJB 1IKMA 2MP1A 2Z4HA 1FNWA 4E6IA 4K5XA 1STYA 1ENCA 4KN7C 2Q8IB 3P1HA 2K5QA 3N6RA 1UAPA 3DWAA 3GV3A 3HG9A 5CYUA 5DAUA 5JVG3 1BO0A 1HCZA 2H1EA 1Y69U 3PO3B 2B2VA 2VB2X 4N9PA 4V190 2DY8A 4ZUIA 5KNDA 5IGGA 1QB5D 5D65A 1DOKA 3NWSA 5C0XJ 4ME5A 5C0XH 5CV8A 5KIXA 1ICWA 2F3WA 2J4XA 3IFDA 4ZYSA 5C3WA 3I70A 3MXNA 1E2ZA 5EJWA 4O1NA 2SOBA 2WKCA 1IYVA 2IPKD 4JK1C 3S1NB 4K6DA 4HR7B 2C9OA 5F2DA 3A56A 3JAME 4KD3A 1V1PA 5J1ZA 1FYCA 1PTOH 5IGFA 4UDUC 3MWYW 1R9TB 1D1IA 1LT3D 3OPOA 2DY7A 1JWSD 3J81E 3EFXD 4OIJA 4DN4M 1AEXA 5CV9A 3VYTA 3M4YA 5IODA 1F9RA 2GA4B 2B2WA 1SBBB 4ZAIA 3VR6A 5CV4A 3IAYA 2CHBD 1ZKOA 1DOLA 2NVQB 4BY1B 2EE1A 3TMEA 1F77A 4QUCA 3L9AX 1ESFA 4LMQD 3Q23A 2BE5D 3M4OB 3A55A 2A6HD 1JB3A 2B2UA 2A5HA 4IUUA 3V05A 1H9JA 1RTNA 4A3BB 1LO5D 5BN4A 2KUMA 2JA7B 4OGQC 1RTOA 1SE4A 1QWYA 4WORA 4FF3A 3I4MB 4NKLA 2J0TD 2L9HA 3M85A 2L4NA 1UNSA 3BYYB 4IUTA 1VDZA 1V1OA 5E4XA 3EJIA 3EA6A 5KYLA 2FMCA 3VR4A 5NUCA 4EQOA 2Z1CA 1D1KA 4L8JA 1OXTA 4MHEA 1HTLD 3SR1A 3ERQA 1Q1BA 4YIJA 4XIGS 1DONA 1MD2D 1PFNA 2NN6H 3T56B 3BVMA 1JOKA 3NHHA 5JOBA 4N9TA 3I4LA 1Y1WB 5K36H 1A2UA 4RHRA 4KY6A 2PCFB 1L0XB 3HOXB 1CA5A 3AU7A 4HMIA 5TSSA 1OXSC 3J80E 5C6AA 2YYZA 5JEAG 3NTIA 4C3JB 4HN7A 1HFGA 5EQ0A 2VXWA 2A6EC 3QOLA 1WTVA 1LABA 1PXUA 2IX0A 1Q1EA 2JA8B 3OIQA 5FK9C 4HMJA 2JEBI 1TVXA 1VCIA 5A2QE 3D4RA 3BYTB 1PZKD 1L0YB 3X3NA 4QUFA 3S1RB 4FVMA 4C3JG 1E2VA 3SHLA 1LT5D 4I65A 3R93A 1O80A 2PPBC 1EYDA 4A3EB 2D9UA 5FOBB 1ZYRC 1SNDA 1QOHA 1PTOB 4K8IA 3MEHA 4HAEA 1SMYD 4DXFA 1DOMA 1TU2B 2EDGA 4OO1I 4RGTA 5I6YA 4R8IA 4FXKC 4RFBA 1EY4A 4KKTA 2FHTA 1II3A 3K7AB 1QNUA 2AQ2B 2E2JB 4ZRZA 1JQYD 1YNJC 5FO7B 1EY8A 1YNNC 3QOJA 3GTQB 2MPMA 1SNPA 2NN6I 2NVTB 4ZUJA 1U4RA 3HOUB 3VYUA 4KKUA 5AFWA 2VNUD 3G7LA 4A3KB 4XT1B 3GO5A 4DU9A 4Y7NB 5EKIA 4TQUS 2ID0A 4IUPA 2KECA 3NBHA 3IFTA 4ZKCB 3QO2A 2ZT9C 4RGOS 2EZVA 2F0NA 4BY7B 1O7ZA 2IWHA 1Y1VB 2K7VA 3VYSA 1D5ZC 3RMHA 1GUSA 5T1GA 5IT9L 1O7YA 1BNZA 3HS0C 1EL0A 4O42A 3K5NA 2IX3A 2F0SA 3GD7A 2QKIC 2JA5B 3RD4A 3M7NA 4FO2A 2K01A 1I50B 3PMFA 3KK7A 5G3LF 3P75A 1HQMC 2R6GA 2DN8A 5CC4A 4KN4C 1LT4D 5M5XB 1QG7A 1CM9A 3W2DA 4HCSA 1F2YA 2K5DA 3J7AV 1D5XC 3CRKC 1IYUA 2D2CC 4RH6A 1OO9B 1F9PA 4ILWA 2F0WA 2RDHA 1B4OA 4IUQA 2VB3X 1CK1A 2B8GA 3DHQA 5HGTA 3UI2A 5EGTA 1U4LA 3HOZB 4XTCS 3I72A 2ZXOA 2NVYB 1T5XD 2FMMA 3PV0A 1J8IA 5JPNC 1I6HB 2Q8TA 3BDOA 1WTRA 1BR9A 2E2HB 2B2WC 3OOCA 3CQZB 1CI3M 4IZ8A 1SAPA 1O78A 1S5BD 2HCCA 1Z7TA 2SEBD 2QCPX 5HURA 3RZOB 4FYDA 4XT3B 1Q12A 2F0VA 1AP0A 2B2UC 2A69C 4HTHA 5EKKA 2PZTA 1JC7A 2EYPA 4OL7A 3R8BA 1LTSD 4C56C 2NTTA 1D5MC 1G8ZD 3TBIB 1XWEA 1B9NA 1RODA 3SDZA 1EY7A 2R61A 3PUZA 4R8NA 1LTRD 2LY7A 4FF2A 1Z47A 3BS1A 5IGCA 1SNMA 2KQ3A 2KHSA 5FLXE 3ITPA 5KRUA 1KDBA 3IKJA 3HOYB 1AN8A 2F4IA 3NBIA 3TDQA 1PRTF 4A3JB 1V1PB 4NDXA 1TWGB 2L11A 4G57A 5ISRA 3I4NB 1RJTA 1FNVA 1CA6A 4CGYB 2F0FA 1RF2D 2A6ED 1ZEQX 2SDFA 1IW7C 2F1MA 3BVZA 3MAQA 1LLRD 1TWHB 1S5CD 2HDMA 1OXUA 3MTSA 1C8CA 3MZ5A 3JAML 1SNOA 2EY2A 2R92B 4P2CB 1BUVT 2G9DA 2XRSD 2E74C 1WTXA 2AQ3B 5JEAH 1A3TA 5ELDA 4PV1C 1XXGA 4G7HC 3VR3A 2MJ8A 1EYCA 2K5WA 2OT2A 4H7BA 1EQVA 4K6LA 5IOCA 5M5WB 1ZYRD 1ENFA 1S5DD 3MVVA 5EPLA 3ONAB 4J8QA 4A3FB 2EY6A 3BZDB 2XWBB 2N55A 4ZLTF 2BDNA 1HFNA 1EWCA 1S5ED 1W6KA 2QF7A 4UAIA 2RSOA 4BA2I 5I6WA 3J7AF 2PZWA 5M5YB 3NPPA 1BDOA 3AMUA 3L7ZC 3VA7A 4F87A 2WACA 4HSVA 1YNJD 2Y0SB 1YNND 3FDTA 3SK8A 5I4DA 3C3LA 5K5PA 3NTHA 1JWMD 4K5VA 1PTOF 3TZUA 4IFDI 2LMCB 3SXHA 2KCNA 2SNSA 2F0GA 2B2YA 1W6JA 2MUYA 3C46A 2MGSA 4RKLA 3DM1A 3ND8A 3TP5A 5COYA 1BCPF 3RLFA 2EYFA 2F0UA 1FNUA 3H6MA 1A15A 5I2XA 1ML0D 1BF4A 1ET6A 1I4QA 1B9MA 3MFYA 5KEEA 1H9RA 1UUPA 5A35A 2Z8LA 3RUZA 2B8FA 2FFKB 4EQPA 3S2HB 1I4GA 1PLFA 2K03A 1GJXA 1EIGA 3S15B 1WVLA 2O5JC 3S9WA 1GUWA 5JPMC 3V96A 3S14B 3H94A 4CKBA 2NTSA 2F0EA 2CVRA 2I46A 2F0KA 1DJRD 1EY0A 2ICIA 2ICEC 5A2QL 4IN3A 3NWTA 4I7ZC 3OSOA 4OO1H 1V43A 3I8ZA 1MSHA 2AUJD 1CQFA 5E3FA 4QB4A 2F0MA 1HRJA 1XTCD 4IFDG 1JR0D 4IUNA 4KD4A 2D5DA 1HPCA 4TRDA 5IGDA 3U9OA 1E0BA 1DZ1A 1CT1D 2LKVA 1BBXC 3Q6SA 5CBAE 3D8GA 2K05A 3K0YA 3KLRA 3HEJA 1DM0B 2BOSA 1TWAB 4HCEA 3GTKB 2AWNA 5ELEA 2KEEA 1GHKA 2XN9C 2KEDA 3FVQA 4QCLA 1PFMA 1ZXTA 1EZ6A 3NXWA 2EYOA 4C1NK 2K6AA 4XDXA 1HQRD 4RWSC 5C4ZA 4A3GB 1VF7A 2A69D 5CV6A 2BA1A 4KMUC 4BA1I 3D31A 1BOSA 2PNRC 4FF4A 3A8KE 1HHVA 2O2LD 4DFAA 1ENAA 4DXGA 3D6CA 3LNNA 3SK6A 1FD7D 3NK9A 5LL6X 4X3UA 2BA0A 1XX8A 2BDOA 1EWHA 2RKSA 3I73A 2ZXRA 1RHPA 4KV6A 4ZKBB 1GHJA 1X32A 3GTJB 3M7GA 1STHA 4LJZC 5C3XA 2JEAI 2A68C 4L63B 1NR2A 1A3UA 2LFNA 4A3IB 1SYGA 1SE3A 4NW2A 3QB3A 4B9XA 2IL8A 1BQQT 3KBGA 2QILA 2WAQB 4CKCA 5ELFA 3QWNA 2PW5A 3H09A 5T1IA 2EVBA 1SFOB 4IQZA 2F0QA 1IW7D 3EQLC 3L3OC 1HXYD 3CHBD 5IGBA 2J7ZA 3TZDA 4FXDA 3I91A 4PQXA 3FRPB 4K14A 3HOVB 1HUMA 3PUWA 4MN3A 2JA6B 2FJ2A 2EXZA 2WV6D 4NP5A 3M3YB 1TT2A 4F88A 1PZJD 1PMRA 4Q0FA 2OF1A 5I9PA 3E0JA 2ENBA 1WTQA 4K5WA 3MXGA 3GQBA 3DEPA 3WDNA 3VR2A 1PZID 2EJMA 3CKIB 2B2VC 1EOTA 5JAVA 5ELBA 3U9SA 1JICA 4B9WA 1VMPA 2Q8RE 2M9VA 4KJOA 1JOQA 2DNEA 3S1MB 1K83B 1TS5A 1SNQA 4RCNA 1RDPD 1NCVA 3K6OA 3SEBA 2EJGC 1TY2A 1LT6D 1QJOA 1Z6HA 4R9WA 4MIUA 4H13C 3F2UA 1U9RA 1Y8NB 2F0PA 3P7JA 4BBRB 4OIKA 1MGSA 1DCZA 2BE5C 2RQXA 2M2LA 1SEBD 4LAAA 3A7AB 2PYKA 3T51B 1EZ8A 2RSNA 3DXJC 5BN3A 1F9QA 1ONLA 1EQTA 2R93B 4G7ZC 2B2YC 4ABNA 2L1BA 1G291 1STAA 1H9KA 2EOTA 2KCCA 3T16A 4KTAA 1PDQA 5M3MB 3NSWA 5K36G 1I6VC 4RCOA 4C3IB 3T53B 1KDCA 4ZK9B 3S1QB 4CJ0B 3Q24A 3TP7A 1LTGD 2WP8J 3NUCA 2PZUA 3NQIA 3OMCA 3R2TA 2D62A 4XXEA 3G6JB 1JE4A 1B1ZA 4RGNA 4C3IG 5C4XB 5IT9E 1NAPA 4WJWA 2JP1A 4EVOA 1ET9A 2K28A 1WTOA 2RDFA 1LTID 4DNRB 4QF4A 1SJED 2NUCA 5EBCA 1K8MA 3MHBA 1ILQA 2XSCA 3FKIB 3C1EA 3PUXA 2LS01 1HUNA 3W3AA 5E4WC 3MC0B 4IFDJ 3TSSA 1SJHD 3NTKA 1EU4A 2RA4A 4HSPA 1I4PA 4IFDH 5I2YA 1RCVD 2B39A 4G4KA 1JCKB 5CV5A 5FO9B 3RZDB 3A54A 1RD9D 1NR4A 3GTOB 1Q3LA 5CGKA 1QNKA 5D3DA 1PYWD 3C1FA 5CR3A 2G9HD 3A8JE 3KF8A 1JORA 2EYMA 2FINB 1AW7A 1A3VA 1LTAD 2DNCA 2F0LA 2N88A 3DMUA 1NUCA 1ESRA 5JEAJ 4GZYC 2PO4A 3GTMB 1EFID 1AZPA 4J6HA 1BXTA 1CFMA 2A73B 2Z4IA 2F0TA 3J81L 1IKLA 3P20A 3GTPB 1IL8A 2A68D 1HA6A 2WIIB 5JJZA 4B08A 2B63B 1SYDA 2NBFA 1TS2A 4DAVA 5KNBA 2K32A 3H3VC 2QDBA 2CW0C 4EGVA 1S4ZA 2EY5A 1EY6A 1FR3A 3OW7A 1GOZA 5C5LA 1MBYA 3MFGA 4XYOA 1WTWA 4DGZA 3ZYYX 2F0IA 3T4AC 1U4MA 2K33A 1H9SA 1U4PA 2C5CA 3K57A 2RVLA 3S16B 1MSGA 2TMPA 1TWCB 4PNYA 4C2MB 1CTMA 1PRTC 1TIID 3GV6A 4KKSA 3HRZC 3PIP3 3HKZB 1QE6A 3PO2B 2JXMB 4RA8A 3MA2B 3URYA 1SYBA 1DXMA 2PQEA 1B53A 3Q0AA 3HGBA 5FO8B 4HEDA 4X3TA 4S3SA 4XQQA 1EY9A 2L5TA 1XYIA 1TR5A 1CHQD 4EQNA 2X6GA 4QIWB 2TSSA 1SYEA 5I9OA 3J80L 2OXPA 5J22A 4M8AA 3PIO3 1M8AA 1QCBD 1Y8OB 1TS3A 4CJ1B 1UEAB 5DM63 4KJNA 5D3IB 1F2MA 3EROA 1EEID 1TS4A 2WB1B 2VUMB 3SE0A 1TWFB 2RDGA 4PMCA 1F2ZA 2BCOA 1SYFA 3OIPA 3HOWB 2O4XA 2XRQD 2O5IC 4A93B 1OXXK 2R3ZA 2B2TA 3LWEA 1C4QA 4NMZA 4BWGB 3I3CA 1A2TA 1VMCA 3DUZA 1LTTD 2XVSA 5CV7A 5C44B 3WOFA 1LV9A 2X6LA 2NWGA 2IJ0A 4AYBB 1PRTB 2R7ZB 2QEJC 2WINB 1KTKA 1KABA 1PTOC 4F7XA 5JVH3 5C0XI 2EPBA 2JSOA 5LL6S 4ID6A 2F03A 3OWEB 5EPJA 3SVMA 2HCIA 1EYAA 4CHTB 4C3HB 2AQ1B 5EPKA 1BCPC 2L12A 2F3VA 3EVQA 2PW7A 4V0BA 3BVGA 1PFBA 4H0LC 4F8MA 5E1FA 1MI2A 3D4DA 3VA5A 3E5SA 1RKNA 1TQOA 3D6WA 3QJYA 3I90A 5ELCA 4K2KA 4C3HG 1AZQA 5KGUA 3PUYA 1HTPA 4TSSA 5M9OA 1O7LA 3HZXA 4K2LA 2NB0A 5FKAC 1Q8IA 4XQNA 3D4WA 1WCMB 2KJXA 4OHJA 2EYJA 2X69A 1H9MA 2JE6I 4X3KA 4BS9A 1LACA 5G3LD 5IIFA 2E76C 1SXTA 3SK4A 1DYQA 4KI0A 3X3MA 4Q5VA 3K5MA 1WTPA 1F2LA 2F0DA 1F9SA 4DAYA 5C0XG 4JBWA 1GUGA 4KHZA 1B3AA 4PMBA 4RGMA 3T13A 4WFN3 4CJ2C 5BN5A 2E2IB 3MXPA 5IGEA 4DAPA 2KVMA 2F0OA 4ULLA 1TY0A 3NE5B 4CKEA 2K04A 4H44C 4M1UB 2AWOA 2H4OA 5CMDA 3E6ZX 1BCPB 3GTGB 4DF7A 1QILA 4IURA 3NP8A 2AUKA 1G2SA 3OMGA 2SNMA 4PMWA 1I4RA 1EEFD 1TKWB 1KDAA 1CZGA 2HDLA 1JWUD 3LWUA 5DM73 5LHY1 3CU7A 1EU3A 3K59A 5EKLA 2HUGA 4FNFA 5KYIA 1B2TA 4KY7A 2A74C 3BDLA 1CZWA 1SSOA 4FXGC 4BBSB 1R4QB 2CW0D 1GXDC 5C4HA 3H0GB 1SDFA 4XYQA 2EY1A 3O13A 1IHZA 1C48A 2NYZD 1G91A 3R2IA 1X3PA 2MHVA 1SE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E76 C;  3AB9 A;  1OXS C;  3PUX A;  1Y8N B;  2O5I C;  4DNT B;  3W3A A;  1OXX K;  2NN6 I;  2YYZ A;  4KN7 C;  1DCZ A;  2EVB A;  4KI0 A;  2Q8I B;  2BE5 C;  3TZU A;  3M4Y A;  2LMC B;  3N6R A;  5JEA G;  4IQZ A;  2K33 A;  3A7A B;  2A6E D;  1IW7 D;  1HCZ A;  3EQL C;  3T51 B;  2B8G A;  1Y69 U;  3VR6 A;  4IFD H;  1H9S A;  3ND8 A;  2A6E C;  1IW7 C;  2F1M A;  3KLR A;  4KKU A;  1LAB A;  1ZKO A;  4XTC S;  3RLF A;  5C0X G;  1Q1E A;  3DXJ C;  3I72 A;  3CRL C;  4JBW A;  1GUG A;  4TQU S;  4KHZ A;  1OXU A;  3PUW A;  5BN3 A;  3PV0 A;  3FMC A;  1ONL A;  4G7O C;  5KND A;  2JEB I;  3IFT A;  1CTM A;  3BDO A;  4DK1 A;  4G7Z C;  4OO1 G;  1GHK A;  2BE5 D;  1B9M A;  1VCI A;  2E74 C;  2V4D A;  3MFY A;  1G29 1;  1H9S B;  2A6H D;  3BG3 A;  3OOC A;  5BN5 A;  3MXU A;  1E2W A;  1H9R A;  1H9K A;  3D4R A;  2ZT9 C;  4KKS A;  5JEA H;  1CI3 M;  2KCC A;  2A6H C;  4PV1 C;  4G7H C;  1O78 A;  3A8J E;  1Z7T A;  5A35 A;  3VR3 A;  1H9J A;  2JXM B;  1PMR A;  3NE5 B;  5BN4 A;  1E2V A;  2B8F A;  1VF7 A;  4H44 C;  4OGQ C;  5C0X H;  5K36 G;  1I6V C;  1Q12 A;  1GUN A;  2BA1 A;  2A69 D;  2AWO A;  2K7V A;  3T53 B;  4KMU C;  1GUS A;  1DXM A;  2A69 C;  2DNC A;  3GQB A;  3D31 A;  4TKO B;  4BA1 I;  1GJX A;  2PNR C;  3HGB A;  3M85 A;  2PPB C;  4GZY C;  3A8K E;  2O5J C;  3QG1 A;  2AUK A;  4H0L C;  2E75 C;  3VR5 A;  3WDN A;  3VR2 A;  1VDZ A;  1ZYR C;  2EJM A;  3H94 A;  1E2Z A;  3GD7 A;  2NN6 G;  3LNN A;  1A6X A;  1TKW B;  1CFM A;  3M7N A;  2BA0 A;  2L5T A;  3ND9 A;  3VR4 A;  5KNC A;  3LWU A;  4DK0 A;  1Q90 A;  2BDO A;  4LK1 C;  3U9S A;  1EWH A;  3I73 A;  1OXV A;  1SMY C;  2JEA I;  1Y8P B;  1B9N A;  1TU2 B;  3SDZ A;  2EDG A;  3FPP A;  3QJY A;  1OXT A;  4L8J A;  1VF5 C;  2D62 A;  3P20 A;  3PUZ A;  1IYV A;  1HQM C;  2QF7 A;  1GHJ A;  1V8Q A;  2DNE A;  2R6G A;  3QIA A;  4JK1 C;  1DD2 A;  4RCN A;  4I7Z C;  1Y8O B;  2A68 D;  4BA2 I;  1Q1B A;  1V43 A;  2DN8 A;  2IT1 A;  4HR7 B;  4OO1 H;  2EJF C;  4XIG S;  3PUY A;  4LJZ C;  2AUJ D;  1HTP A;  3A8I E;  2EJG C;  4KN4 C;  1O7L A;  2A68 C;  2KA7 A;  1K8O A;  1BDO A;  2NN6 H;  1FYC A;  1QJO A;  3T56 B;  3PUV A;  4KKT A;  3L7Z C;  1Z6H A;  3A7L A;  3VA7 A;  4DNR B;  5KNB A;  2K32 A;  2CW0 C;  3CRK C;  4IFD G;  3IKJ A;  4H13 C;  1K8M A;  3SE0 A;  1FR3 A;  1IYU A;  3OW7 A;  1T5E A;  1H9M A;  2JE6 I;  3I4L A;  5K36 H;  1GUO A;  2D2C C;  2D5D A;  1YNJ C;  3OPO A;  1HPC A;  2PCF B;  1LAC A;  1YNN C;  1GUT A; 
#chains in the Genus database with same CATH topology
 3AB9 A;  3DWP A;  1KAA A;  4A3C H;  4X3S A;  4DNT B;  2NVX H;  3R3O A;  4LFB Q;  4HJA A;  4A3D B;  4OEL B;  4LF6 L;  1KNA A;  3JC6 6;  3F8T A;  4WRD A;  3M9B A;  4Z9C B;  2NZ1 D;  4CBV A;  1PH3 A;  5D14 A;  5C4J H;  3S17 H;  2XIW A;  1PH7 A;  4YCW A;  1EIH A;  2CWA A;  3CRL C;  4A3K G;  3HP3 A;  2JQO A;  3KUP A;  2L55 A;  1EY5 A;  5IYD G;  4G7O C;  1PRT D;  3GTL B;  4OEM B;  1N33 L;  4DK1 A;  3KBX A;  5LMN Q;  4OO1 G;  2V4D A;  1J5E L;  2WFW A;  3BG3 A;  4IAL A;  3TN2 A;  3TP8 A;  2A6H C;  4FF1 A;  4DV2 L;  2L0C A;  2IW3 A;  4R4I A;  5DEH A;  5M3F B;  1WI5 A;  2E2D C;  3NQT A;  2YTX A;  3PO3 H;  3KLS A;  4QMG A;  5CBE E;  1J9O A;  5COR A;  3E3X A;  1ILP A;  3FEW X;  1STE A;  1UE7 A;  2CQA A;  4P72 A;  1VQ5 A;  1Y1V G;  1G2T A;  4TKO B;  2F0J A;  3PF5 A;  4KY5 A;  3KF8 B;  1STN A;  2VS1 A;  3CME A;  5FLX L;  4HIK A;  5BR8 Q;  3N52 A;  5J39 A;  3C2P A;  1VS0 A;  1SLJ A;  4U68 A;  1Q86 C;  1CHP D;  2NN6 G;  1K0S A;  1A6X A;  4RAU C;  5IP9 G;  4JG2 A;  3J7Y W;  3ND9 A;  5DLQ E;  3OHX C;  4YY3 L;  4IUV A;  1WD0 A;  1I3Q B;  5M3F G;  1Y8P B;  4K8J A;  3SK5 A;  2IX1 A;  4GLA C;  3WOE A;  1V8Q A;  2UXB Q;  2IHE A;  2ZXP A;  5FJ8 H;  3S16 H;  1YNX A;  2IT1 A;  1XPO A;  3A8I E;  3KLS X;  4C2M H;  3W5O A;  2KA7 A;  1SYC A;  1KC8 C;  5EBD A;  3PUV A;  2EYL A;  2KCM A;  1KNE A;  1T5E A;  1VQL A;  4ZQ3 A;  1GUO A;  4JI6 L;  1GVP A;  3V2T A;  4KK7 A;  1M4V A;  1GUT A;  3S1N H;  1D6E C;  3K0X A;  1PH2 A;  2HQE A;  1ASY A;  4LF4 L;  5DNF A;  2WKD A;  1I4H A;  4DA2 A;  2M00 A;  5C5M A;  3H91 A;  3K58 A;  1KLG D;  1B44 D;  1X3G A;  4X66 L;  2JYO A;  2YU9 B;  4C1N I;  4HIM A;  1D2B A;  1B8A A;  2B2T C;  1T9H A;  1CQV A;  4RHS A;  3FMC A;  1NSN S;  1JOO A;  5C3E B;  1K3R A;  4ODG A;  1H9S B;  1PTO D;  3MXU A;  1E2W A;  3D3R A;  1I4X A;  4KHV A;  3TS0 A;  4FP5 D;  5LMN W;  2K1B A;  1B50 A;  3CD6 A;  3S2D B;  4J1M A;  3BDC A;  4U67 3;  3Q22 A;  3Q8D A;  3DWQ A;  1AFP A;  3K5L A;  4L6T B;  2MNA A;  4B3M Q;  3H3V H;  1STG A;  2VUM H;  1GUN A;  1BCP D;  1TWF H;  2F0H A;  2NVQ H;  1Z9F A;  4BY1 H;  1STB A;  2RCF A;  3DEO A;  4LUZ A;  4DUY Q;  3RN2 A;  1Y14 B;  4RMF A;  4LF9 L;  1X54 A;  2KEN A;  3QG1 A;  3GP7 A;  3HOW H;  1XMQ L;  4KHP Q;  2E75 C;  3VR5 A;  3K5O A;  2KHJ A;  2PMZ B;  4A93 H;  4RKB A;  2I07 B;  1KLU D;  1X3Q A;  5C3E G;  3TP6 A;  3LX0 A;  1LTL A;  2HD3 A;  3WWV A;  1VQO A;  3FPU B;  1FGB D;  2RBM A;  4R1J A;  5KNC A;  4IOA A;  4DK0 A;  1Q90 A;  4LK1 C;  1VQK A;  2KOL A;  4A3M B;  1OXV A;  1SMY C;  4XQJ A;  1M1K C;  1LTB D;  3FPP A;  3J80 c;  1VF5 C;  2OWO A;  3IL8 A;  3QIA A;  1DD2 A;  3BZK A;  2EYH A;  2OEO A;  2NVX B;  3S24 A;  4AQY L;  1HA5 A;  2EJF C;  1NE3 A;  1S5F D;  1L2F A;  3VYR A;  2XNA C;  2R7Z H;  1K8O A;  1G6Z A;  1SNC A;  1R4P B;  1WD1 A;  3OWF A;  3A7L A;  5C4J B;  3S17 B;  2K50 A;  4DV1 Q;  2XWJ B;  1IKM A;  2MP1 A;  2Z4H A;  4A3M G;  1FNW A;  4C3H H;  4E6I A;  4QY7 A;  4A3J G;  4K5X A;  1STY A;  1ENC A;  1L1O C;  4KN7 C;  2Q8I B;  3P1H A;  3I4N G;  4DR6 Q;  2K5Q A;  3N6R A;  1UAP A;  1BBW A;  3DWA A;  2HHH Q;  3GV3 A;  3HG9 A;  5CYU A;  5DAU A;  5JVG 3;  1BO0 A;  1HCZ A;  2H1E A;  1Y69 U;  3PO3 B;  2B2V A;  2VB2 X;  4UY8 C;  1C7Y A;  4N9P A;  1SE8 A;  3TEH B;  4V19 0;  1YI2 A;  4LFC Q;  3EN2 A;  2DY8 A;  4ZUI A;  5KND A;  5IGG A;  4JW0 A;  1QB5 D;  5D65 A;  1PH5 A;  1DOK A;  2GVB A;  3NWS A;  5C0X J;  1BKB A;  5IYB H;  1X9N A;  4ME5 A;  4LFA Q;  1WCM H;  3J81 i;  2UXD L;  5C0X H;  1KIX A;  5IP7 G;  1KRS A;  5CV8 A;  5KIX A;  4DR2 L;  1ICW A;  2F3W A;  2J4X A;  3IFD A;  4JC0 A;  1N34 Q;  1K8A C;  3E0E A;  4ZYS A;  5C3W A;  3I70 A;  3MXN A;  1HR0 L;  1E7Z A;  3F2D A;  1HJP A;  1E2Z A;  2CFM A;  3CF5 A;  5EJW A;  4O1N A;  2IY5 B;  1PVO A;  1CKO A;  2SOB A;  4A3F G;  2WKC A;  1IYV A;  2HQL A;  2IPK D;  4JK1 C;  3S1N B;  4B3S Q;  1Q82 C;  4K6D A;  4HR7 B;  1S3O A;  2C9O A;  5F2D A;  3A56 A;  3JAM E;  1VQC A;  4KD3 A;  4JVZ A;  4A3E H;  1MJC A;  1V1P A;  5J1Z A;  1FYC A;  3CCE A;  2E2I H;  2D0O A;  1PTO H;  1SN8 A;  2P5Z X;  5IGF A;  1PFS A;  4UDU C;  2JN4 A;  3MWY W;  1R9T B;  1HNX L;  1D1I A;  2B3G A;  3HKZ E;  1LT3 D;  3OPO A;  1VQG A;  2DY7 A;  1B3Q A;  1JWS D;  3J81 E;  3EFX D;  1WTH A;  3GTG H;  4B3R Q;  4OIJ A;  2I5M X;  1L1O B;  4DN4 M;  1AEX A;  4ME3 A;  5CV9 A;  5HY6 A;  3M4Y A;  3VYT A;  5IOD A;  1F9R A;  4JBK A;  2GA4 B;  2B2W A;  1SBB B;  2Z6K C;  4ZAI A;  3OYY A;  1V1Q A;  3VR6 A;  1V9P A;  1E1O A;  5CV4 A;  1YIT A;  2UUA Q;  2Q2T A;  1IBM Q;  3IAY A;  2CHB D;  1ZKO A;  1DOL A;  2NVQ B;  4BY1 B;  2EE1 A;  3TME A;  1F77 A;  4QIW E;  4QUC A;  3L9A X;  1ESF A;  4LMQ D;  3Q23 A;  2BE5 D;  3M4O B;  1A63 A;  3A55 A;  2A6H D;  3STB C;  1JB3 A;  2B2U A;  4WJ3 M;  3F2B A;  2NVT H;  2A5H A;  2Z0S A;  4IUU A;  4N8F A;  4DAY B;  3V05 A;  1H9J A;  1RTN A;  4A3B B;  1LO5 D;  4MTN A;  2KUM A;  1U5K A;  3FP9 A;  5BN4 A;  2JA7 B;  4OGQ C;  3J80 i;  1RTO A;  1SE4 A;  3H0G H;  4A3K H;  1QWY A;  4WOR A;  4FF3 A;  4Y7N H;  3I4M B;  4NKL A;  2J0T D;  2L9H A;  3M85 A;  4JOI A;  2L4N A;  1UNS A;  3CCL A;  3BYY B;  1I94 Q;  3M4Q A;  4IUT A;  3UE1 A;  1VDZ A;  1V1O A;  5E4X A;  3EJI A;  4A3D H;  3EA6 A;  5KYL A;  4JI5 Q;  3T1H Q;  2FMC A;  2KBN A;  1HNZ L;  3VR4 A;  5NUC A;  3ICE A;  1P8L A;  4EQO A;  2Z1C A;  1D1K A;  1Y1V H;  4L8J A;  4DV6 Q;  1OXT A;  4MHE A;  4A3B G;  4X6A H;  2JA7 G;  1HTL D;  3E9H A;  2CQO A;  3SR1 A;  3ERQ A;  1Q1B A;  4YIJ A;  3I4M G;  4XIG S;  1S72 A;  1DON A;  1MD2 D;  1PFN A;  4AYB E;  3CCV A;  2NN6 H;  5IP9 H;  3T56 B;  4K0K Q;  1GD7 A;  3BVM A;  1JOK A;  3NHH A;  1X3F A;  2GVA A;  5M3F H;  5JOB A;  3K80 C;  4N9T A;  4DR1 L;  2MO1 A;  3I4L A;  4DR7 L;  1Y1W B;  4JYA Q;  1I50 H;  4J15 A;  5K36 H;  1A2U A;  4RHR A;  4KY6 A;  2PCF B;  3HFZ B;  3QR8 A;  1L0X B;  3HOX B;  1CA5 A;  3AU7 A;  4HMI A;  5TSS A;  4JI1 Q;  1OXS C;  3J80 E;  5GAE C;  5C6A A;  4UP7 A;  1LYL A;  2YYZ A;  1W3S A;  2YTY A;  5JEA G;  2ZTC A;  3NTI A;  3H15 A;  2OCE A;  4C3J B;  4HN7 A;  1HFG A;  3CPW A;  4UPA A;  5EQ0 A;  1BVS A;  2A6E C;  2VXW A;  4LNQ A;  3QOL A;  1WTV A;  1LAB A;  1PXU A;  2IX0 A;  1Q1E A;  4DV4 Q;  4JI2 L;  2JA8 B;  5IT9 c;  1I3Q H;  2BH8 A;  3OIQ A;  5FK9 C;  1Y1W G;  4HMJ A;  1HZA A;  2JEB I;  3CPF A;  1IXR A;  1TVX A;  2UUB Q;  1VCI A;  1IBK Q;  5A2Q E;  3D4R A;  3UDI A;  3BYT B;  1E1T A;  1PZK D;  3U4V A;  1L0Y B;  3X3N A;  4QUF A;  3S1R B;  4O0A A;  4FVM A;  4C3J G;  1E2V A;  3SHL A;  1LT5 D;  4I65 A;  2K75 A;  3R93 A;  1JJG A;  1O80 A;  1K28 A;  4ALP A;  2PPB C;  2JA8 G;  1EYD A;  5FLX c;  4A3E B;  2D9U A;  5FOB B;  1ZYR C;  1SND A;  4R4C A;  4JI6 Q;  4FDB A;  1QOH A;  3CCM A;  1PTO B;  4K8I A;  3MEH A;  3A5U A;  4HAE A;  4MZ9 A;  4CDF C;  1SMY D;  4DXF A;  1HNW L;  4LF6 Q;  3EIV A;  1VQH A;  5AJ3 L;  1NY4 A;  1DOM A;  5JJL A;  3RZO H;  2YU9 H;  1TU2 B;  1X56 A;  2EDG A;  1X65 A;  4OO1 I;  4RGT A;  2E5L L;  5I6Y A;  4IPH A;  4R8I A;  4FXK C;  4RFB A;  1EY4 A;  1IL2 A;  5C3E H;  1YVC A;  4KKT A;  1N33 Q;  4A3I G;  2FHT A;  1J5E Q;  4OX9 L;  3S2D H;  1II3 A;  3K7A B;  1QNU A;  2AQ2 B;  4GNX A;  4X64 L;  4LWC A;  2E2J B;  3AFQ A;  1NBW A;  4DV2 Q;  4ZRZ A;  1JQY D;  1YNJ C;  5FO7 B;  1EY8 A;  1YNN C;  3QOJ A;  3GTQ B;  1YZ6 A;  2WAQ G;  4LF8 L;  3OTO L;  4X65 L;  2MPM A;  1SNP A;  2NN6 I;  2NVT B;  4ZUJ A;  1U4R A;  4GKK L;  1ASZ A;  3HOU B;  1CUK A;  4DPG A;  4BXX G;  4R4Q A;  3VYU A;  3KJO A;  1YJN A;  4A76 A;  4KKU A;  2ATW A;  5AFW A;  2VNU D;  3G7L A;  4A3K B;  4XT1 B;  3GO5 A;  4I7A A;  4DU9 A;  4Y7N B;  4A3M H;  5EKI A;  2CH4 W;  4TQU S;  2ID0 A;  4IUP A;  2KEC A;  4YY3 Q;  3NBH A;  3HOV G;  3UE0 A;  3IFT A;  4ZKC B;  1QVF A;  3QO2 A;  3I4N H;  2JA6 G;  2ZT9 C;  4A3L G;  4L5S A;  4RGO S;  2EZV A;  3NEM A;  3HOU G;  2F0N A;  4BY7 B;  4B3T Q;  1O7Z A;  2IWH A;  1Y1V B;  1VQ9 A;  2K7V A;  3VYS A;  4UP8 A;  3G71 A;  1D5Z C;  5T1G A;  1GUS A;  3RMH A;  5IT9 L;  1MKH A;  4HJ9 A;  1O7Y A;  1BNZ A;  1GKH A;  3ZJY C;  3HS0 C;  4IJL A;  4O42 A;  1EL0 A;  3K5N A;  2IX3 A;  2F0S A;  3GD7 A;  2QKI C;  2JA5 B;  4R4T A;  1K9M C;  4R4O A;  3RD4 A;  3M7N A;  4FO2 A;  1JB7 A;  4TVA B;  4LF4 Q;  2K01 A;  1I50 B;  1VQN A;  5IP7 H;  3PMF A;  3KK7 A;  5G3L F;  3P75 A;  4BY7 G;  1HQM C;  2R6G A;  4X66 Q;  5M5W H;  1YEZ A;  2DN8 A;  5CC4 A;  4KN4 C;  1LT4 D;  5M5X B;  1QG7 A;  1CM9 A;  3W2D A;  2PQA A;  4HCS A;  1F2Y A;  2K5D A;  3J7A V;  1D5X C;  4DR5 L;  3CRK C;  4A3F H;  2JA5 G;  1JT8 A;  1IYU A;  2D2C C;  4RH6 A;  2UXC Q;  1OO9 B;  1PV4 A;  3KF6 A;  1M90 C;  4OWX B;  1F9P A;  4ILW A;  3MEF A;  2F0W A;  4BBR G;  2RDH A;  1B4O A;  4IUQ A;  2N3S A;  2VB3 X;  4DAM A;  4IO9 A;  4LF9 Q;  4JI0 L;  1JJC B;  4RG1 A;  1XMQ Q;  1CK1 A;  2B8G A;  3DHQ A;  1CSP A;  1YHB A;  5HGT A;  3UI2 A;  5EGT A;  1U4L A;  3CC7 A;  3HOZ B;  4XTC S;  3I72 A;  3I56 A;  2ZXO A;  2NVY B;  1T5X D;  2FMM A;  2ZM6 L;  1KRT A;  3PV0 A;  1J8I A;  3IRB A;  5JPN C;  1I6H B;  2Q8T A;  3STB D;  3BDO A;  4CDE C;  1WTR A;  1BR9 A;  2PNH A;  2E2H B;  2B2W C;  2DJG C;  3OOC A;  3CQZ B;  1CI3 M;  4IZ8 A;  1SAP A;  3RN5 A;  1O78 A;  1S5B D;  2HCC A;  1Z7T A;  4AQY Q;  2SEB D;  2QCP X;  4YHH L;  3KYH C;  5HUR A;  4DV7 L;  3RZO B;  2CKZ B;  4FYD A;  1CKN B;  4XT3 B;  1Q12 A;  2F0V A;  1R9T H;  1AP0 A;  1VQD A;  3AYH B;  1QZG A;  2B2U C;  2A69 C;  4HTH A;  3VDY A;  3HOZ G;  2OQK A;  5EKK A;  3E9I A;  2PZT A;  1JC7 A;  2EYP A;  2OTJ A;  4GKJ L;  4OL7 A;  3R8B A;  4HJ7 A;  1LTS D;  5GRO A;  3NEL A;  1PH9 A;  4C56 C;  4A4I A;  2NTT A;  1D5M C;  1E22 A;  1G8Z D;  3TBI B;  1XWE A;  1EQQ A;  1B9N A;  4JOI C;  1ROD A;  5GQO A;  1EY7 A;  3SDZ A;  2R61 A;  5IY0 A;  3MXN B;  1FL0 A;  3PUZ A;  4R8N A;  1LTR D;  2LY7 A;  2VQF L;  4FF2 A;  3F2C A;  1Z47 A;  3M4P A;  4POF A;  3BS1 A;  2HIV A;  5IGC A;  1SNM A;  2KQ3 A;  3M4O H;  4DR3 L;  2KHS A;  2CWP A;  5FLX E;  4DV0 L;  3ITP A;  2Z6B A;  5KRU A;  2ZJR A;  1KDB A;  3IKJ A;  3FHW A;  4GOP A;  3HOY B;  1AN8 A;  4A3B H;  2F4I A;  3NBI A;  3TDQ A;  5HGQ A;  2JA7 H;  1D7Q A;  1PRT F;  4WJ4 A;  3CP0 A;  4A3J B;  1V1P B;  4NDX A;  1TWG B;  4DK6 C;  2UXD Q;  2L11 A;  4G57 A;  5ISR A;  3I4M H;  3I4N B;  2ZJP A;  4DR2 Q;  3KJP A;  1N36 L;  1RJT A;  1QUQ A;  1FNV A;  1CA6 A;  4CGY B;  2F0F A;  1N32 Q;  1RF2 D;  2A6E D;  2PMZ E;  1ZEQ X;  2ASB A;  2SDF A;  1N9W A;  1HR0 Q;  1IW7 C;  2F1M A;  3BVZ A;  3MAQ A;  1LLR D;  2KCT A;  1SRO A;  1TWH B;  1XMO L;  1S5C D;  3HOY G;  2HDM A;  1OXU A;  3MTS A;  1C8C A;  3MZ5 A;  3JAM L;  1SNO A;  2EY2 A;  2R92 B;  4P2C B;  1BUV T;  2G9D A;  2XRS D;  4PZ7 A;  2E74 C;  1WTX A;  2AQ3 B;  1FJG L;  5JEA H;  1A3T A;  5ELD A;  4PV1 C;  1XXG A;  4G7H C;  3VR3 A;  2MJ8 A;  4NXM Q;  3G6E A;  1QVC A;  1EYC A;  2YV5 A;  2K5W A;  2OT2 A;  4H7B A;  1A8V A;  1E24 A;  1EQV A;  4K6L A;  1Y1W H;  2MFI A;  5IOC A;  5M5W B;  1HNX Q;  3HOX H;  4A3C G;  3KDF A;  2QA4 A;  1ZYR D;  1ENF A;  4JI3 L;  1S5D D;  2R92 G;  3MVV A;  5EPL A;  3ONA B;  5H1S E;  4J8Q A;  1PHJ A;  4LF5 L;  4A3F B;  1B70 B;  2EY6 A;  3BZD B;  4DUY L;  4C3J H;  2XWB B;  1MJE A;  4H02 A;  2N55 A;  4ZLT F;  2BDN A;  1VQM A;  3I4O A;  1HFN A;  2Q2I A;  1EWC A;  1S5E D;  1W6K A;  2QF7 A;  4L5T A;  2JA8 H;  3AEV A;  4UAI A;  2RSO A;  4BA2 I;  5I6W A;  1VQ6 A;  2R7F A;  3J7A F;  2PZW A;  5M5Y B;  3NPP A;  3KOJ A;  1BDO A;  2B63 G;  3AMU A;  4QL5 A;  3L7Z C;  2VQE L;  3VA7 A;  4F87 A;  2WAC A;  3UDF A;  4HSV A;  1YNJ D;  2Y0S B;  3S1R H;  2A1A A;  1YNN D;  3FDT A;  3SK8 A;  3EBE A;  5I4D A;  3C3L A;  5K5P A;  3NTH A;  1JWM D;  4K5V A;  1PTO F;  1ICF B;  4OWT B;  3GTJ H;  5FLM G;  3TZU A;  4IFD I;  2LMC B;  3SXH A;  4GNX C;  2KCN A;  1PH4 A;  2SNS A;  2F0G A;  5E7N A;  2B2Y A;  4A3I H;  1W6J A;  2MUY A;  3C46 A;  2MGS A;  4RKL A;  3DM1 A;  3ULL A;  3ND8 A;  3TP5 A;  2MO0 A;  5COY A;  1BCP F;  1P16 A;  3RLF A;  2EYF A;  2F0U A;  1HR0 W;  3PIP A;  1FNU A;  2Y0S G;  1HNZ Q;  1EQR A;  2QGQ A;  3H6M A;  4DV3 L;  1A15 A;  5I2X A;  4GN5 A;  1ML0 D;  1BF4 A;  2ES2 A;  1ET6 A;  1I4Q A;  4QQB X;  1B9M A;  3MFY A;  2F3I A;  5KEE A;  1H9R A;  4JBM A;  3CMA A;  1UUP A;  4PG3 A;  1SFO H;  2RCN A;  1S40 A;  4BXX H;  5A35 A;  2Z8L A;  3RUZ A;  2B8F A;  2FFK B;  2LXJ A;  4EQP A;  3PO2 G;  3K7A H;  2JA9 A;  3S2H B;  2E2J H;  1I4G A;  2D0P A;  1PLF A;  2K03 A;  1GJX A;  1EIG A;  1NMG A;  3S15 B;  4DR7 Q;  1WVL A;  4DR1 Q;  3GTQ H;  2O5J C;  3S9W A;  3PCO B;  3W1G A;  1GUW A;  5GAH C;  4P75 A;  5JPM C;  3V96 A;  3S14 B;  3H94 A;  4CKB A;  3DM3 A;  1VQ4 A;  3PIO A;  3M3Y H;  2NTS A;  2F0E A;  4PZ6 A;  3HOU H;  4QJF A;  1X6O A;  1Q8K A;  2CVR A;  5ELN A;  1XPU A;  1N34 L;  2I46 A;  2F0K A;  1RL2 A;  2K52 A;  1DJR D;  1EY0 A;  2ICI A;  2WB1 E;  2ICE C;  5A2Q L;  4IN3 A;  5IYD H;  3NWT A;  4I7Z C;  3OSO A;  4OO1 H;  1V43 A;  3I8Z A;  4JI2 Q;  1MSH A;  2AUJ D;  1CQF A;  5E3F A;  4QB4 A;  4JI8 L;  2F0M A;  2F4V L;  2EQS A;  1HRJ A;  1NMF A;  1XTC D;  4IFD G;  1JR0 D;  1WFQ A;  4IUN A;  4KD4 A;  4BY7 H;  2ALY B;  2D5D A;  1HPC A;  4TRD A;  5IGD A;  3U9O A;  4DUZ L;  1E0B A;  3OW2 A;  1DZ1 A;  1CT1 D;  2K4K A;  2LKV A;  1BBX C;  3CCS A;  4DR4 L;  3J7A 5;  3Q6S A;  4GNX B;  5CBA E;  2R7D A;  4YWM A;  1A62 A;  3D8G A;  2K05 A;  4EX5 A;  4P73 A;  4LUV A;  1KL9 A;  2JA5 H;  3K0Y A;  3KLR A;  4PZ8 A;  2C35 B;  1DM0 B;  3HEJ A;  4NXN L;  2BOS A;  1TWA B;  2Q2U A;  1K0R A;  4HCE A;  1SRU A;  3GTK B;  2AWN A;  3CC2 A;  2FXQ A;  1HNW Q;  5C44 G;  5AJ3 Q;  1RIP A;  5ELE A;  2KEE A;  1GHK A;  2XN9 C;  2KED A;  3FVQ A;  4QCL A;  4UP9 A;  1PFM A;  1ZXT A;  1EZ6 A;  3NXW A;  2E5L Q;  1AH9 A;  2EYO A;  4C1N K;  2K6A A;  1QZH A;  4XDX A;  5M5X H;  1HQR D;  4RWS C;  4JV5 L;  5C4Z A;  4A3G B;  2ZTE A;  3NBH B;  1VF7 A;  1KQS A;  2A69 D;  5CV6 A;  2BA1 A;  5IWA L;  4KMU C;  1VQF A;  4BA1 I;  4OX9 Q;  3D31 A;  1BOS A;  2GN5 A;  2PNR C;  4X64 Q;  4FF4 A;  3A8K E;  1HHV A;  4JCV E;  2O2L D;  3CAM A;  4DFA A;  3TRZ A;  1ENA A;  3ULJ A;  4DXG A;  4LF8 Q;  3D6C A;  3LNN A;  3SK6 A;  3OTO Q;  4X65 Q;  1FD7 D;  1XNR L;  3NK9 A;  5LL6 X;  4X3U A;  2BA0 A;  1XX8 A;  2BDO A;  1EWH A;  2RKS A;  3I73 A;  4GKK Q;  1Q46 A;  4AIM A;  1EWI A;  5LMU L;  2ZXR A;  1RHP A;  4X62 L;  4KV6 A;  4A3G G;  2AMC B;  3HOZ H;  4ZKB B;  1GHJ A;  1X32 A;  2PI2 E;  2NVY H;  3GTJ B;  3M7G A;  2N78 A;  1I6H H;  1STH A;  4LJZ C;  4ZCK A;  5C3X A;  2JEA I;  2A68 C;  1EOV A;  5J3B A;  4DV5 L;  4L63 B;  1NR2 A;  2E2H H;  1A3U A;  2LFN A;  4A3I B;  1G6P A;  3CQZ H;  4DV6 L;  1SYG A;  4JI4 L;  1SE3 A;  1OTC A;  4NW2 A;  3QB3 A;  4B9X A;  2IL8 A;  1BQQ T;  2DUD A;  3KBG A;  2QIL A;  2WAQ B;  4CKC A;  5ELF A;  3QWN A;  4IJH A;  2PQA B;  2PW5 A;  3H09 A;  5T1I A;  2VL6 A;  2EVB A;  1YJ9 A;  4JI7 L;  1SFO B;  4KLK A;  4IQZ A;  2F0Q A;  1YHA A;  4GOP C;  3KFU A;  1IW7 D;  3EQL C;  3L3O C;  1HXY D;  3CHB D;  3KF6 B;  1H95 A;  1IBL L;  5IGB A;  4JPB W;  2J7Z A;  4NPS A;  3TZD A;  5GAG C;  2RHQ B;  1VQP A;  1N8R C;  3ERS X;  4FXD A;  4Y52 H;  3I91 A;  4PQX A;  3FRP B;  4K14 A;  3HOV B;  1HUM A;  1MIU A;  3PUW A;  1XNQ L;  3NEN A;  4LF7 L;  2LSS A;  4MN3 A;  2JA6 B;  2FJ2 A;  5ELO A;  3D0F A;  2EXZ A;  2WV6 D;  4NP5 A;  3M3Y B;  1TT2 A;  3UDG A;  4F88 A;  1PZJ D;  2QDL A;  1PMR A;  4Q0F A;  1UE1 A;  2OF1 A;  5I9P A;  2JK8 A;  5IYC G;  3E0J A;  2ENB A;  1WTQ A;  3HOY H;  4K5W A;  3MXG A;  3RZD H;  3GQB A;  4DR5 Q;  3GTO H;  4A3J H;  1WJJ A;  3DEP A;  3PSI A;  1TWG H;  3WDN A;  3VR2 A;  3T1Y L;  1PZI D;  2EJM A;  3CKI B;  2B2V C;  1EOT A;  2HIX A;  1A0I A;  5JAV A;  1LUZ A;  3AQQ A;  5ELB A;  3ULP A;  3U9S A;  1JIC A;  4B9W A;  1VMP A;  3KLW A;  4JI0 Q;  2Q8R E;  2M9V A;  4KJO A;  1TWH H;  3L0O A;  1JOQ A;  2DNE A;  3S1M B;  1K83 B;  1TS5 A;  4A75 A;  1SNQ A;  4RCN A;  1RDP D;  2PI2 A;  1J6Q A;  1NCV A;  3K6O A;  3SEB A;  2R92 H;  2EJG C;  1TY2 A;  4APV A;  2ZM6 Q;  1LT6 D;  2Q2H A;  3GTM H;  1QJO A;  4IPC A;  1Z6H A;  4R9W A;  4MIU A;  4BBS G;  3UDX A;  4H13 C;  1FGU A;  1YHQ A;  3B6Y A;  3H0G G;  4YHH Q;  1KXL A;  4DV7 Q;  3F2U A;  1U9R A;  1Y8N B;  2F0P A;  3GTP H;  3P7J A;  4BBR B;  3CCR A;  4OIK A;  1MGS A;  1DCZ A;  2BE5 C;  2RQX A;  2M2L A;  1SEB D;  4GOP B;  4HID A;  4LAA A;  2CCZ A;  2B63 H;  2A8V A;  4A3D G;  3A7A B;  2PYK A;  3T51 B;  2V1C C;  4GKJ Q;  2UUC L;  1EZ8 A;  2RSN A;  3DXJ C;  4LW1 A;  1W2B A;  1QUQ B;  3CCQ A;  5BN3 A;  3JAM c;  1F9Q A;  1ONL A;  4CDD C;  1EQT A;  2R93 B;  4G7Z C;  2B2Y C;  4ABN A;  5FLM H;  2L1B A;  3HKS A;  1G29 1;  1STA A;  1H9K A;  2VQF Q;  2EOT A;  2KCC A;  5M5Y H;  3CCJ A;  3T16 A;  2UU9 L;  4KTA A;  1PDQ A;  5M3M B;  1EUJ A;  3J7Z C;  4POG A;  1VQA A;  3NSW A;  2E8G A;  4DR3 Q;  1EYG A;  2I5L X;  3J81 c;  4N8X 1;  5K36 G;  4DV0 Q;  1I6V C;  4RCO A;  4C3I B;  3T53 B;  4LFB L;  1AE2 A;  1KDC A;  4ZK9 B;  3S1Q B;  1NTG A;  4CJ0 B;  1TWC H;  1PA6 A;  1Q81 C;  5L37 A;  3Q24 A;  3TP7 A;  4DNI A;  4B3T L;  1LTG D;  2R93 G;  2WP8 J;  2EXD A;  2DGY A;  2JJQ A;  1N36 Q;  3NUC A;  5M3M G;  2PZU A;  3PO2 H;  3NQI A;  1XJV A;  3OMC A;  3U58 A;  3KDF B;  1IYJ B;  3R2T A;  5LMN L;  2D62 A;  4CDC C;  2VZA A;  4XXE A;  3G6J B;  1JE4 A;  2HT1 A;  1B1Z A;  1UEB A;  4RGN A;  4C3I G;  2IHF A;  1XMO Q;  5C4X B;  5IT9 E;  1NAP A;  1VQB A;  4WJW A;  2JP1 A;  4EVO A;  1WYD A;  1ET9 A;  2LXK A;  2K28 A;  3AFP A;  1WTO A;  2RDF A;  1G51 A;  1LTI D;  4DNR B;  4QF4 A;  1SJE D;  2NUC A;  1FJG Q;  5EBC A;  1K8M A;  3MHB A;  1YJW A;  1ILQ A;  2XSC A;  5BR8 L;  3FKI B;  3PGZ A;  1B7Y B;  3S2H H;  3TRE A;  1KAW A;  3C1E A;  3PUX A;  2LS0 1;  1AE3 A;  3W3A A;  5E4W C;  1HUN A;  2YTV A;  2DJF C;  3S15 H;  3MC0 B;  3J81 j;  4IFD J;  4P74 A;  5C4X G;  3TSS A;  1SJH D;  3NTK A;  1EU4 A;  2RA4 A;  4HSP A;  1I4P A;  3S14 H;  2UXC L;  4JI3 Q;  1HZB A;  4IFD H;  1RCV D;  3PQI A;  2B39 A;  5I2Y A;  2CH4 A;  4G4K A;  1JCK B;  5CV5 A;  2UXB L;  5FO9 B;  1NNX A;  1KD1 C;  3RZD B;  3A54 A;  2K14 A;  4LF5 Q;  1RD9 D;  1NR4 A;  3GTO B;  1Q3L A;  2AKW B;  2RHS B;  3FKI G;  5CGK A;  3K8A A;  1QNK A;  5D3D A;  1PYW D;  3C1F A;  5CR3 A;  2G9H D;  3RNU A;  1C0A A;  3A8J E;  4EQ5 A;  3KF8 A;  1JOR A;  2OTL A;  2EYM A;  2FIN B;  1AW7 A;  1A3V A;  1LTA D;  2VQE Q;  5C44 H;  2DNC A;  2F0L A;  2N88 A;  3DMU A;  1NUC A;  1ESR A;  5JEA J;  5JJI A;  4GZY C;  2PO4 A;  3TS2 A;  1CSQ A;  5GAD C;  3GTM B;  1EFI D;  1AZP A;  1LM0 A;  4J6H A;  1YIJ A;  1BXT A;  4IPD A;  1CFM A;  4HJ8 A;  4GLV B;  1E3P A;  1UE5 A;  2I0Q A;  2A73 B;  2Z4I A;  2F0T A;  3J81 L;  1PH6 A;  3RLO A;  1IKL A;  1TWA H;  3P20 A;  3GTK H;  3GTP B;  2K5H A;  1IL8 A;  4DK3 C;  2A68 D;  1DGS A;  1HA6 A;  2WII B;  5JJZ A;  3A0J A;  4B08 A;  2B63 B;  4DV3 Q;  4B3M L;  1I5F A;  2VY3 A;  1SYD A;  2NBF A;  2RF4 A;  4L5Q A;  1TS2 A;  1VQJ A;  4DAV A;  5KNB A;  2K32 A;  4GN3 B;  3H3V C;  2QDB A;  2CW0 C;  4EGV A;  1S4Z A;  2EY5 A;  1EY6 A;  1FR3 A;  3OW7 A;  2ZJQ A;  2VW9 A;  4A3G H;  4KHP L;  1GOZ A;  3JAM i;  5C5L A;  2ZTD A;  3U50 C;  1MBY A;  1EIY B;  1CKN A;  1UWV A;  3MFG A;  1HH2 P;  4XYO A;  1EIF A;  1WTW A;  4YWL A;  3A74 A;  4DGZ A;  4LUO A;  4MTK A;  3ZYY X;  2F0I A;  1PH8 A;  3T4A C;  1U4M A;  2K33 A;  1HZ9 A;  1H9S A;  1U4P A;  1XPR A;  1X55 A;  3PO3 G;  2C5C A;  3ER0 A;  3K57 A;  1HZC A;  2RVL A;  3S16 B;  1N32 L;  1D8L A;  1MSG A;  2TMP A;  1TWC B;  4PNY A;  4C2M B;  1CTM A;  3LGJ A;  1PRT C;  1TII D;  5JJK A;  3GV6 A;  4KKS A;  3H3V I;  4DV1 L;  3I7F A;  3HRZ C;  3PIP 3;  1C9O A;  3HKZ B;  1QE6 A;  3PO2 B;  2JXM B;  4RA8 A;  4JI8 Q;  2F4V Q;  3L2P A;  3MA2 B;  3URY A;  4HIO A;  2G5D A;  1SYB A;  1DXM A;  4DR6 L;  2PQE A;  1B53 A;  2Y0S E;  3Q0A A;  2HHH L;  3HGB A;  5FO8 B;  5FJ8 G;  4HED A;  4NXM L;  4DKA C;  4X3T A;  4DUZ Q;  4S3S A;  4XQQ A;  2F52 A;  4LFC L;  1EY9 A;  2EIF A;  4DR4 Q;  2L5T A;  1XYI A;  1TR5 A;  1CHQ D;  3BJU A;  2X6G A;  4QIW B;  1K3B C;  2TSS A;  4EQN A;  3F1Z A;  5IYC H;  3HKZ G;  1U0L A;  1SYE A;  3TQY A;  5I9O A;  3J80 L;  1K73 C;  2OXP A;  2AHO B;  5J22 A;  4M8A A;  4HJ5 A;  1L0W A;  3PIO 3;  1M8A A;  1QCB D;  4NXN Q;  3HOV H;  1Y8O B;  5IE8 A;  1TS3 A;  4CJ1 B;  1UEA B;  5DM6 3;  2JA6 H;  1YBY A;  4LFA L;  4KJN A;  4A3L H;  5D3I B;  1F2M A;  3ERO A;  1EEI D;  1TS4 A;  1GO3 E;  1SR3 A;  2WB1 B;  1Q7Y C;  2VUM B;  4JBJ A;  3SE0 A;  1TWF B;  2RDG A;  4PMC A;  1F2Z A;  1IZ6 A;  1XTD A;  2BCO A;  4JV5 Q;  1SYF A;  4QGU A;  3OIP A;  3HOW B;  2O4X A;  2N8N A;  2XRQ D;  2O5I C;  4A93 B;  5IWA Q;  1OXX K;  2I5H A;  2B2T A;  2R3Z A;  3BZC A;  3LWE A;  1C4Q A;  1BBU A;  4NMZ A;  1WOC A;  1VQI A;  4BWG B;  4BBS H;  4GLX A;  1EFW A;  3I3C A;  1A2T A;  1VMC A;  3DUZ A;  1LTT D;  4B3S L;  4YCU A;  2XVS A;  5CV7 A;  2WB1 G;  5C44 B;  2VUM G;  1XNR Q;  4BY1 G;  3WOF A;  1LV9 A;  2X6L A;  1SMX A;  2L15 A;  2NWG A;  2IJ0 A;  4O2D A;  4AYB B;  5LMU Q;  3S1M H;  1PRT B;  2R7Z B;  1K83 H;  2QEJ C;  4X62 Q;  3HOW G;  2WIN B;  4A93 G;  1KTK A;  1KAB A;  3RLN A;  1PTO C;  2QW7 A;  2K5V A;  4F7X A;  5JVH 3;  4UHV A;  2EPB A;  5C0X I;  2JSO A;  2KHI A;  5LL6 S;  4ID6 A;  2F03 A;  3OWE B;  4GN4 B;  4DV5 Q;  5EPJ A;  3SVM A;  2HCI A;  1EYA A;  4B3R L;  4CHT B;  4C3H B;  1PYB A;  4JI4 Q;  1JE5 A;  2AQ1 B;  5EPK A;  1BCP C;  4MNO A;  2L12 A;  2F3V A;  3EVQ A;  2PW7 A;  4V0B A;  3BVG A;  1PFB A;  4H0L C;  3GTL H;  4F8M A;  4BBR H;  2UUA L;  4AYB G;  1JMC A;  2OQ0 A;  2R7Z G;  5E1F A;  1QVG A;  1IBM L;  1MI2 A;  3D4D A;  4JI7 Q;  3VA5 A;  3E5S A;  1RKN A;  1TQO A;  2K5N A;  3D6W A;  3QJY A;  3I90 A;  5EAY A;  5ELC A;  1MHW C;  4K2K A;  1IBL Q;  4C3H G;  2NZH A;  1AZQ A;  4IPG A;  5KGU A;  4OON A;  3PUY A;  1HTP A;  4OXP A;  4TSS A;  3W1B A;  1O7L A;  5M9O A;  2R93 H;  1XNQ Q;  3HZX A;  4K2L A;  2NB0 A;  5FKA C;  4LF7 Q;  1Q8I A;  2QEX A;  4XQN A;  1FVI A;  3D4W A;  1L1O A;  1WCM B;  2KJX A;  4OHJ A;  5M3M H;  2B29 A;  1TXY A;  2A19 A;  2EYJ A;  2X69 A;  1H9M A;  2JE6 I;  4X3K A;  1I94 L;  3K7U C;  4BS9 A;  1LAC A;  5G3L D;  5IIF A;  1X3E A;  3DLL A;  2E76 C;  4C3I H;  3HOX G;  1SXT A;  4JI5 L;  3SK4 A;  3T1H L;  3S1Q H;  1VQE A;  1DYQ A;  4KI0 A;  1UE6 A;  3X3M A;  4Q5V A;  3K5M A;  2N49 A;  1WTP A;  1F2L A;  3GDE A;  4GS3 A;  3T1Y Q;  5IYB G;  2F0D A;  4YWK A;  1F9S A;  1WCM G;  4YCV A;  4DAY A;  5C0X G;  4JBW A;  1GUG A;  4KHZ A;  1B3A A;  4PMB A;  4RGM A;  3SGI A;  1KHI A;  3T13 A;  4K0K L;  4WFN 3;  1CKM A;  4CJ2 C;  5BN5 A;  5C4X H;  2E2I B;  3MXP A;  5IGE A;  4DAP A;  2KVM A;  3CC4 A;  4JYA L;  4L5R C;  2F0O A;  4ULL A;  2H5X A;  1TY0 A;  3NE5 B;  4CKE A;  4JI1 L;  2K04 A;  4H44 C;  1VQ8 A;  4M1U B;  2AWO A;  2H4O A;  1PH1 A;  5CMD A;  3E6Z X;  1BCP B;  3GTG B;  4DF7 A;  3CCU A;  1QIL A;  4IUR A;  3FKI H;  2WAQ E;  3NP8 A;  3PF4 A;  2AUK A;  1G2S A;  3OMG A;  2SNM A;  4PMW A;  3G4S A;  3G48 A;  4P71 A;  4A3E G;  1I4R A;  1EEF D;  1TKW B;  4DV4 L;  1KDA A;  2NZO A;  1CZG A;  2HDL A;  1JWU D;  3LWU A;  5DM7 3;  5LHY 1;  3CU7 A;  3A5Z B;  1EU3 A;  3K59 A;  1VQ7 A;  1O7I A;  2UUB L;  5EKL A;  1IBK L;  4NB3 A;  3U4Z A;  3CXC A;  1JJ2 A;  2HUG A;  4FNF A;  2Z9H A;  5KYI A;  2UUC Q;  1B2T A;  4KY7 A;  2XTI A;  3CW2 C;  2XGT A;  2A74 C;  3BDL A;  1CZW A;  1SSO A;  4FXG C;  3K81 C;  3I55 A;  4BBS B;  1R4Q B;  2CW0 D;  1GXD C;  1K8G A;  3BU2 A;  5C4H A;  3H0G B;  1SDF A;  1PYS B;  2MQH A;  4OWW B;  3O13 A;  2EY1 A;  4XYQ A;  1IHZ A;  1C48 A;  2NYZ D;  2UU9 Q;  1G91 A;  1NJI C;  3RR5 A;  2BH2 A;  4AH6 A;  4IOC A;  2Z6K A;  1GM5 A;  3I2Z A;  3R2I A;  1X3P A;  2MHV A;  1SE2 A; 
#chains in the Genus database with same CATH homology
 3AB9 A;  3DWP A;  1KAA A;  4X3S A;  4DNT B;  3R3O A;  4A3D B;  1KNA A;  4WRD A;  4Z9C B;  2NZ1 D;  4CBV A;  5D14 A;  2XIW A;  1EIH A;  3CRL C;  3HP3 A;  3KUP A;  2L55 A;  1EY5 A;  4G7O C;  1PRT D;  3GTL B;  4DK1 A;  3KBX A;  4OO1 G;  2V4D A;  3BG3 A;  4IAL A;  3TN2 A;  3TP8 A;  2A6H C;  4FF1 A;  2L0C A;  2IW3 A;  5DEH A;  5M3F B;  2E2D C;  3NQT A;  3KLS A;  4QMG A;  5CBE E;  1J9O A;  5COR A;  1ILP A;  3FEW X;  1STE A;  2CQA A;  1G2T A;  4TKO B;  2F0J A;  4KY5 A;  1STN A;  5FLX L;  3N52 A;  5J39 A;  3C2P A;  4U68 A;  1CHP D;  2NN6 G;  1A6X A;  4RAU C;  3J7Y W;  3ND9 A;  3OHX C;  4IUV A;  1WD0 A;  1I3Q B;  1Y8P B;  4K8J A;  3SK5 A;  2IX1 A;  3WOE A;  1V8Q A;  2ZXP A;  2IT1 A;  3A8I E;  3KLS X;  2KA7 A;  1SYC A;  5EBD A;  3PUV A;  2EYL A;  1KNE A;  1T5E A;  4ZQ3 A;  1GUO A;  3V2T A;  4KK7 A;  1M4V A;  1GUT A;  1D6E C;  2HQE A;  5DNF A;  2WKD A;  1I4H A;  4DA2 A;  2M00 A;  5C5M A;  3H91 A;  3K58 A;  1KLG D;  1B44 D;  2YU9 B;  2JYO A;  4C1N I;  1D2B A;  2B2T C;  1CQV A;  4RHS A;  3FMC A;  1NSN S;  1JOO A;  5C3E B;  4ODG A;  1H9S B;  1PTO D;  3MXU A;  1E2W A;  3D3R A;  1I4X A;  4KHV A;  4FP5 D;  2K1B A;  1B50 A;  3S2D B;  4J1M A;  3BDC A;  4U67 3;  3Q22 A;  1AFP A;  3DWQ A;  3K5L A;  4L6T B;  1STG A;  1GUN A;  1BCP D;  2F0H A;  1STB A;  3DEO A;  3QG1 A;  3GP7 A;  2E75 C;  3VR5 A;  3K5O A;  2PMZ B;  4RKB A;  2I07 B;  1KLU D;  1X3Q A;  3TP6 A;  3LX0 A;  3FPU B;  1FGB D;  2RBM A;  5KNC A;  4DK0 A;  1Q90 A;  4LK1 C;  2KOL A;  4A3M B;  1OXV A;  1SMY C;  4XQJ A;  1LTB D;  3FPP A;  1VF5 C;  3IL8 A;  3QIA A;  1DD2 A;  2EYH A;  2OEO A;  2NVX B;  1HA5 A;  2EJF C;  1S5F D;  3VYR A;  2XNA C;  1K8O A;  1G6Z A;  1SNC A;  1R4P B;  1WD1 A;  3OWF A;  3A7L A;  5C4J B;  3S17 B;  2XWJ B;  1IKM A;  2MP1 A;  2Z4H A;  1FNW A;  4E6I A;  4K5X A;  1STY A;  1ENC A;  4KN7 C;  2Q8I B;  3P1H A;  2K5Q A;  3N6R A;  1UAP A;  3DWA A;  3GV3 A;  3HG9 A;  5CYU A;  5DAU A;  5JVG 3;  1BO0 A;  1HCZ A;  2H1E A;  1Y69 U;  3PO3 B;  2B2V A;  2VB2 X;  4N9P A;  4V19 0;  2DY8 A;  4ZUI A;  5KND A;  5IGG A;  1QB5 D;  5D65 A;  1DOK A;  3NWS A;  5C0X J;  4ME5 A;  5C0X H;  5CV8 A;  5KIX A;  1ICW A;  2F3W A;  2J4X A;  3IFD A;  4ZYS A;  5C3W A;  3I70 A;  3MXN A;  1E2Z A;  5EJW A;  4O1N A;  2SOB A;  2WKC A;  1IYV A;  2IPK D;  4JK1 C;  3S1N B;  4K6D A;  4HR7 B;  2C9O A;  5F2D A;  3A56 A;  3JAM E;  4KD3 A;  1V1P A;  5J1Z A;  1FYC A;  1PTO H;  5IGF A;  4UDU C;  3MWY W;  1R9T B;  1D1I A;  1LT3 D;  3OPO A;  2DY7 A;  1JWS D;  3J81 E;  3EFX D;  4OIJ A;  4DN4 M;  1AEX A;  5CV9 A;  3VYT A;  3M4Y A;  5IOD A;  1F9R A;  2GA4 B;  2B2W A;  1SBB B;  4ZAI A;  3VR6 A;  5CV4 A;  3IAY A;  2CHB D;  1ZKO A;  1DOL A;  2NVQ B;  4BY1 B;  2EE1 A;  3TME A;  1F77 A;  4QUC A;  3L9A X;  1ESF A;  4LMQ D;  3Q23 A;  2BE5 D;  3M4O B;  3A55 A;  2A6H D;  1JB3 A;  2B2U A;  2A5H A;  4IUU A;  3V05 A;  1H9J A;  1RTN A;  4A3B B;  1LO5 D;  5BN4 A;  2KUM A;  2JA7 B;  4OGQ C;  1RTO A;  1SE4 A;  1QWY A;  4WOR A;  4FF3 A;  3I4M B;  4NKL A;  2J0T D;  2L9H A;  3M85 A;  2L4N A;  1UNS A;  3BYY B;  4IUT A;  1VDZ A;  1V1O A;  5E4X A;  3EJI A;  3EA6 A;  5KYL A;  2FMC A;  3VR4 A;  5NUC A;  4EQO A;  2Z1C A;  1D1K A;  4L8J A;  1OXT A;  4MHE A;  1HTL D;  3SR1 A;  3ERQ A;  1Q1B A;  4YIJ A;  4XIG S;  1DON A;  1MD2 D;  1PFN A;  2NN6 H;  3T56 B;  3BVM A;  1JOK A;  3NHH A;  5JOB A;  4N9T A;  3I4L A;  1Y1W B;  5K36 H;  1A2U A;  4RHR A;  4KY6 A;  2PCF B;  1L0X B;  3HOX B;  1CA5 A;  3AU7 A;  4HMI A;  5TSS A;  1OXS C;  3J80 E;  5C6A A;  2YYZ A;  5JEA G;  3NTI A;  4C3J B;  4HN7 A;  1HFG A;  5EQ0 A;  2VXW A;  2A6E C;  3QOL A;  1WTV A;  1LAB A;  1PXU A;  2IX0 A;  1Q1E A;  2JA8 B;  3OIQ A;  5FK9 C;  4HMJ A;  2JEB I;  1TVX A;  1VCI A;  5A2Q E;  3D4R A;  3BYT B;  1PZK D;  1L0Y B;  3X3N A;  4QUF A;  3S1R B;  4FVM A;  4C3J G;  1E2V A;  3SHL A;  1LT5 D;  4I65 A;  3R93 A;  1O80 A;  2PPB C;  1EYD A;  4A3E B;  2D9U A;  5FOB B;  1ZYR C;  1SND A;  1QOH A;  1PTO B;  4K8I A;  3MEH A;  4HAE A;  1SMY D;  4DXF A;  1DOM A;  1TU2 B;  2EDG A;  4OO1 I;  4RGT A;  5I6Y A;  4R8I A;  4FXK C;  4RFB A;  1EY4 A;  4KKT A;  2FHT A;  1II3 A;  3K7A B;  1QNU A;  2AQ2 B;  2E2J B;  4ZRZ A;  1JQY D;  1YNJ C;  5FO7 B;  1EY8 A;  1YNN C;  3QOJ A;  3GTQ B;  2MPM A;  1SNP A;  2NN6 I;  2NVT B;  4ZUJ A;  1U4R A;  3HOU B;  3VYU A;  4KKU A;  5AFW A;  2VNU D;  3G7L A;  4A3K B;  4XT1 B;  3GO5 A;  4DU9 A;  4Y7N B;  5EKI A;  4TQU S;  2ID0 A;  4IUP A;  2KEC A;  3NBH A;  3IFT A;  4ZKC B;  3QO2 A;  2ZT9 C;  4RGO S;  2EZV A;  2F0N A;  4BY7 B;  1O7Z A;  2IWH A;  1Y1V B;  2K7V A;  3VYS A;  1D5Z C;  3RMH A;  1GUS A;  5T1G A;  5IT9 L;  1O7Y A;  1BNZ A;  3HS0 C;  1EL0 A;  4O42 A;  3K5N A;  2IX3 A;  2F0S A;  3GD7 A;  2QKI C;  2JA5 B;  3RD4 A;  3M7N A;  4FO2 A;  2K01 A;  1I50 B;  3PMF A;  3KK7 A;  5G3L F;  3P75 A;  1HQM C;  2R6G A;  2DN8 A;  5CC4 A;  4KN4 C;  1LT4 D;  5M5X B;  1QG7 A;  1CM9 A;  3W2D A;  4HCS A;  1F2Y A;  2K5D A;  3J7A V;  1D5X C;  3CRK C;  1IYU A;  2D2C C;  4RH6 A;  1OO9 B;  1F9P A;  4ILW A;  2F0W A;  2RDH A;  1B4O A;  4IUQ A;  2VB3 X;  1CK1 A;  2B8G A;  3DHQ A;  5HGT A;  3UI2 A;  5EGT A;  1U4L A;  3HOZ B;  4XTC S;  3I72 A;  2ZXO A;  2NVY B;  1T5X D;  2FMM A;  3PV0 A;  1J8I A;  5JPN C;  1I6H B;  2Q8T A;  3BDO A;  1WTR A;  1BR9 A;  2E2H B;  2B2W C;  3OOC A;  3CQZ B;  1CI3 M;  4IZ8 A;  1SAP A;  1O78 A;  1S5B D;  2HCC A;  1Z7T A;  2SEB D;  2QCP X;  5HUR A;  3RZO B;  4FYD A;  4XT3 B;  1Q12 A;  2F0V A;  1AP0 A;  2B2U C;  2A69 C;  4HTH A;  5EKK A;  2PZT A;  1JC7 A;  2EYP A;  4OL7 A;  3R8B A;  1LTS D;  4C56 C;  2NTT A;  1D5M C;  1G8Z D;  3TBI B;  1XWE A;  1B9N A;  1ROD A;  3SDZ A;  1EY7 A;  2R61 A;  3PUZ A;  4R8N A;  1LTR D;  2LY7 A;  4FF2 A;  1Z47 A;  3BS1 A;  5IGC A;  1SNM A;  2KQ3 A;  2KHS A;  5FLX E;  3ITP A;  5KRU A;  1KDB A;  3IKJ A;  3HOY B;  1AN8 A;  2F4I A;  3NBI A;  3TDQ A;  1PRT F;  4A3J B;  1V1P B;  4NDX A;  1TWG B;  2L11 A;  4G57 A;  5ISR A;  3I4N B;  1RJT A;  1FNV A;  1CA6 A;  4CGY B;  2F0F A;  1RF2 D;  2A6E D;  1ZEQ X;  2SDF A;  1IW7 C;  2F1M A;  3BVZ A;  3MAQ A;  1LLR D;  1TWH B;  1S5C D;  2HDM A;  1OXU A;  3MTS A;  1C8C A;  3MZ5 A;  3JAM L;  1SNO A;  2EY2 A;  2R92 B;  4P2C B;  1BUV T;  2G9D A;  2XRS D;  2E74 C;  1WTX A;  2AQ3 B;  5JEA H;  1A3T A;  5ELD A;  4PV1 C;  1XXG A;  4G7H C;  3VR3 A;  2MJ8 A;  1EYC A;  2K5W A;  2OT2 A;  4H7B A;  1EQV A;  4K6L A;  5IOC A;  5M5W B;  1ZYR D;  1ENF A;  1S5D D;  3MVV A;  5EPL A;  3ONA B;  4J8Q A;  4A3F B;  2EY6 A;  3BZD B;  2XWB B;  2N55 A;  4ZLT F;  2BDN A;  1HFN A;  1EWC A;  1S5E D;  1W6K A;  2QF7 A;  4UAI A;  2RSO A;  4BA2 I;  5I6W A;  3J7A F;  2PZW A;  5M5Y B;  3NPP A;  1BDO A;  3AMU A;  3L7Z C;  3VA7 A;  4F87 A;  2WAC A;  4HSV A;  1YNJ D;  2Y0S B;  1YNN D;  3FDT A;  3SK8 A;  5I4D A;  3C3L A;  5K5P A;  3NTH A;  1JWM D;  4K5V A;  1PTO F;  3TZU A;  4IFD I;  2LMC B;  3SXH A;  2KCN A;  2SNS A;  2F0G A;  2B2Y A;  1W6J A;  2MUY A;  3C46 A;  2MGS A;  4RKL A;  3DM1 A;  3ND8 A;  3TP5 A;  5COY A;  1BCP F;  3RLF A;  2EYF A;  2F0U A;  1FNU A;  3H6M A;  1A15 A;  5I2X A;  1ML0 D;  1BF4 A;  1ET6 A;  1I4Q A;  1B9M A;  3MFY A;  5KEE A;  1H9R A;  1UUP A;  5A35 A;  2Z8L A;  3RUZ A;  2B8F A;  2FFK B;  4EQP A;  3S2H B;  1I4G A;  1PLF A;  2K03 A;  1GJX A;  1EIG A;  3S15 B;  1WVL A;  2O5J C;  3S9W A;  1GUW A;  5JPM C;  3V96 A;  3S14 B;  3H94 A;  4CKB A;  2NTS A;  2F0E A;  2CVR A;  2I46 A;  2F0K A;  1DJR D;  1EY0 A;  2ICI A;  2ICE C;  5A2Q L;  4IN3 A;  3NWT A;  4I7Z C;  3OSO A;  4OO1 H;  1V43 A;  3I8Z A;  1MSH A;  2AUJ D;  1CQF A;  5E3F A;  4QB4 A;  2F0M A;  1HRJ A;  1XTC D;  4IFD G;  1JR0 D;  4IUN A;  4KD4 A;  2D5D A;  1HPC A;  4TRD A;  5IGD A;  3U9O A;  1E0B A;  1DZ1 A;  1CT1 D;  2LKV A;  1BBX C;  3Q6S A;  5CBA E;  3D8G A;  2K05 A;  3K0Y A;  3KLR A;  3HEJ A;  1DM0 B;  2BOS A;  1TWA B;  4HCE A;  3GTK B;  2AWN A;  5ELE A;  2KEE A;  1GHK A;  2XN9 C;  2KED A;  3FVQ A;  4QCL A;  1PFM A;  1ZXT A;  1EZ6 A;  3NXW A;  2EYO A;  4C1N K;  2K6A A;  4XDX A;  1HQR D;  4RWS C;  5C4Z A;  4A3G B;  1VF7 A;  2A69 D;  5CV6 A;  2BA1 A;  4KMU C;  4BA1 I;  3D31 A;  1BOS A;  2PNR C;  4FF4 A;  3A8K E;  1HHV A;  2O2L D;  4DFA A;  1ENA A;  4DXG A;  3D6C A;  3LNN A;  3SK6 A;  1FD7 D;  3NK9 A;  5LL6 X;  4X3U A;  2BA0 A;  1XX8 A;  2BDO A;  1EWH A;  2RKS A;  3I73 A;  2ZXR A;  1RHP A;  4KV6 A;  4ZKB B;  1GHJ A;  1X32 A;  3GTJ B;  3M7G A;  1STH A;  4LJZ C;  5C3X A;  2JEA I;  2A68 C;  4L63 B;  1NR2 A;  1A3U A;  2LFN A;  4A3I B;  1SYG A;  1SE3 A;  4NW2 A;  3QB3 A;  4B9X A;  2IL8 A;  1BQQ T;  3KBG A;  2QIL A;  2WAQ B;  4CKC A;  5ELF A;  3QWN A;  2PW5 A;  3H09 A;  5T1I A;  2EVB A;  1SFO B;  4IQZ A;  2F0Q A;  1IW7 D;  3EQL C;  3L3O C;  1HXY D;  3CHB D;  5IGB A;  2J7Z A;  3TZD A;  4FXD A;  3I91 A;  4PQX A;  3FRP B;  4K14 A;  3HOV B;  1HUM A;  3PUW A;  4MN3 A;  2JA6 B;  2FJ2 A;  2EXZ A;  2WV6 D;  4NP5 A;  3M3Y B;  1TT2 A;  4F88 A;  1PZJ D;  1PMR A;  4Q0F A;  2OF1 A;  5I9P A;  3E0J A;  2ENB A;  1WTQ A;  4K5W A;  3MXG A;  3GQB A;  3DEP A;  3WDN A;  3VR2 A;  1PZI D;  2EJM A;  3CKI B;  2B2V C;  1EOT A;  5JAV A;  5ELB A;  3U9S A;  1JIC A;  4B9W A;  1VMP A;  2Q8R E;  2M9V A;  4KJO A;  1JOQ A;  2DNE A;  3S1M B;  1K83 B;  1TS5 A;  1SNQ A;  4RCN A;  1RDP D;  1NCV A;  3K6O A;  3SEB A;  2EJG C;  1TY2 A;  1LT6 D;  1QJO A;  1Z6H A;  4R9W A;  4MIU A;  4H13 C;  3F2U A;  1U9R A;  1Y8N B;  2F0P A;  3P7J A;  4BBR B;  4OIK A;  1MGS A;  1DCZ A;  2BE5 C;  2RQX A;  2M2L A;  1SEB D;  4LAA A;  3A7A B;  2PYK A;  3T51 B;  1EZ8 A;  2RSN A;  3DXJ C;  5BN3 A;  1F9Q A;  1ONL A;  1EQT A;  2R93 B;  4G7Z C;  2B2Y C;  4ABN A;  2L1B A;  1G29 1;  1STA A;  1H9K A;  2EOT A;  2KCC A;  3T16 A;  4KTA A;  1PDQ A;  5M3M B;  3NSW A;  5K36 G;  1I6V C;  4RCO A;  4C3I B;  3T53 B;  1KDC A;  4ZK9 B;  3S1Q B;  4CJ0 B;  3Q24 A;  3TP7 A;  1LTG D;  2WP8 J;  3NUC A;  2PZU A;  3NQI A;  3OMC A;  3R2T A;  2D62 A;  4XXE A;  3G6J B;  1JE4 A;  1B1Z A;  4RGN A;  4C3I G;  5C4X B;  5IT9 E;  1NAP A;  4WJW A;  2JP1 A;  4EVO A;  1ET9 A;  2K28 A;  1WTO A;  2RDF A;  1LTI D;  4DNR B;  4QF4 A;  1SJE D;  2NUC A;  5EBC A;  1K8M A;  3MHB A;  1ILQ A;  2XSC A;  3FKI B;  3C1E A;  3PUX A;  2LS0 1;  1HUN A;  3W3A A;  5E4W C;  3MC0 B;  4IFD J;  3TSS A;  1SJH D;  3NTK A;  1EU4 A;  2RA4 A;  4HSP A;  1I4P A;  4IFD H;  5I2Y A;  1RCV D;  2B39 A;  4G4K A;  1JCK B;  5CV5 A;  5FO9 B;  3RZD B;  3A54 A;  1RD9 D;  1NR4 A;  3GTO B;  1Q3L A;  5CGK A;  1QNK A;  5D3D A;  1PYW D;  3C1F A;  5CR3 A;  2G9H D;  3A8J E;  3KF8 A;  1JOR A;  2EYM A;  2FIN B;  1AW7 A;  1A3V A;  1LTA D;  2DNC A;  2F0L A;  2N88 A;  3DMU A;  1NUC A;  1ESR A;  5JEA J;  4GZY C;  2PO4 A;  3GTM B;  1EFI D;  1AZP A;  4J6H A;  1BXT A;  1CFM A;  2A73 B;  2Z4I A;  2F0T A;  3J81 L;  1IKL A;  3P20 A;  3GTP B;  1IL8 A;  2A68 D;  1HA6 A;  2WII B;  5JJZ A;  4B08 A;  2B63 B;  1SYD A;  2NBF A;  1TS2 A;  4DAV A;  5KNB A;  2K32 A;  3H3V C;  2QDB A;  2CW0 C;  4EGV A;  1S4Z A;  2EY5 A;  1EY6 A;  1FR3 A;  3OW7 A;  1GOZ A;  5C5L A;  1MBY A;  3MFG A;  4XYO A;  1WTW A;  4DGZ A;  3ZYY X;  2F0I A;  3T4A C;  1U4M A;  2K33 A;  1H9S A;  1U4P A;  2C5C A;  3K57 A;  2RVL A;  3S16 B;  1MSG A;  2TMP A;  1TWC B;  4PNY A;  4C2M B;  1CTM A;  1PRT C;  1TII D;  3GV6 A;  4KKS A;  3HRZ C;  3PIP 3;  3HKZ B;  1QE6 A;  3PO2 B;  2JXM B;  4RA8 A;  3MA2 B;  3URY A;  1SYB A;  1DXM A;  2PQE A;  1B53 A;  3Q0A A;  3HGB A;  5FO8 B;  4HED A;  4X3T A;  4S3S A;  4XQQ A;  1EY9 A;  2L5T A;  1XYI A;  1TR5 A;  1CHQ D;  4EQN A;  2X6G A;  4QIW B;  2TSS A;  1SYE A;  5I9O A;  3J80 L;  2OXP A;  5J22 A;  4M8A A;  3PIO 3;  1M8A A;  1QCB D;  1Y8O B;  1TS3 A;  4CJ1 B;  1UEA B;  5DM6 3;  4KJN A;  5D3I B;  1F2M A;  3ERO A;  1EEI D;  1TS4 A;  2WB1 B;  2VUM B;  3SE0 A;  1TWF B;  2RDG A;  4PMC A;  1F2Z A;  2BCO A;  1SYF A;  3OIP A;  3HOW B;  2O4X A;  2XRQ D;  2O5I C;  4A93 B;  1OXX K;  2R3Z A;  2B2T A;  3LWE A;  1C4Q A;  4NMZ A;  4BWG B;  3I3C A;  1A2T A;  1VMC A;  3DUZ A;  1LTT D;  2XVS A;  5CV7 A;  5C44 B;  3WOF A;  1LV9 A;  2X6L A;  2NWG A;  2IJ0 A;  4AYB B;  1PRT B;  2R7Z B;  2QEJ C;  2WIN B;  1KTK A;  1KAB A;  1PTO C;  4F7X A;  5JVH 3;  5C0X I;  2EPB A;  2JSO A;  5LL6 S;  4ID6 A;  2F03 A;  3OWE B;  5EPJ A;  3SVM A;  2HCI A;  1EYA A;  4CHT B;  4C3H B;  2AQ1 B;  5EPK A;  1BCP C;  2L12 A;  2F3V A;  3EVQ A;  2PW7 A;  4V0B A;  3BVG A;  1PFB A;  4H0L C;  4F8M A;  5E1F A;  1MI2 A;  3D4D A;  3VA5 A;  3E5S A;  1RKN A;  1TQO A;  3D6W A;  3QJY A;  3I90 A;  5ELC A;  4K2K A;  4C3H G;  1AZQ A;  5KGU A;  3PUY A;  1HTP A;  4TSS A;  5M9O A;  1O7L A;  3HZX A;  4K2L A;  2NB0 A;  5FKA C;  1Q8I A;  4XQN A;  3D4W A;  1WCM B;  2KJX A;  4OHJ A;  2EYJ A;  2X69 A;  1H9M A;  2JE6 I;  4X3K A;  4BS9 A;  1LAC A;  5G3L D;  5IIF A;  2E76 C;  1SXT A;  3SK4 A;  1DYQ A;  4KI0 A;  3X3M A;  4Q5V A;  3K5M A;  1WTP A;  1F2L A;  2F0D A;  1F9S A;  4DAY A;  5C0X G;  4JBW A;  1GUG A;  4KHZ A;  1B3A A;  4PMB A;  4RGM A;  3T13 A;  4WFN 3;  4CJ2 C;  5BN5 A;  2E2I B;  3MXP A;  5IGE A;  4DAP A;  2KVM A;  2F0O A;  4ULL A;  1TY0 A;  3NE5 B;  4CKE A;  2K04 A;  4H44 C;  4M1U B;  2AWO A;  2H4O A;  5CMD A;  3E6Z X;  1BCP B;  3GTG B;  4DF7 A;  1QIL A;  4IUR A;  3NP8 A;  2AUK A;  1G2S A;  3OMG A;  2SNM A;  4PMW A;  1I4R A;  1EEF D;  1TKW B;  1KDA A;  1CZG A;  2HDL A;  1JWU D;  3LWU A;  5DM7 3;  5LHY 1;  3CU7 A;  1EU3 A;  3K59 A;  5EKL A;  2HUG A;  4FNF A;  5KYI A;  1B2T A;  4KY7 A;  2A74 C;  3BDL A;  1CZW A;  1SSO A;  4FXG C;  4BBS B;  1R4Q B;  2CW0 D;  1GXD C;  5C4H A;  3H0G B;  1SDF A;  4XYQ A;  2EY1 A;  3O13 A;  1IHZ A;  1C48 A;  2NYZ D;  1G91 A;  3R2I A;  1X3P A;  2MHV A;  1SE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...