1O78A

Biotin carboxyl carrier domain of transcarboxylase (1.3s) [10-48] deletion mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
84
structure length
84
Chain Sequence
b'MKLKVTVNGAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIKIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIOTIN CARBOXYL CARRIER PROTEIN OF METHYLMALONYL-COA CARBOXY
publication title NMR Studies on the Solution Structure of a Deletion Mutant of the Transcarboxylase Biotin Carrier Subunit
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
molecule tags Carrier protein
total genus 6
structure length 84
sequence length 84
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2002-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1o78A00
2LMCB 5KNBA 2QF7A 3L7ZC 4DK1A 4BA2I 3MFYA 1TKWB 2K7VA 3I72A 3P20A 5C0XG 2BA1A 5BN4A 3FPPA 1E2WA 2E74C 2K33A 4XIGS 1H9MA 1B9NA 2EVBA 3IFTA 4H44C 1H9RA 2AUKA 1E2ZA 1BDOA 2BA0A 2E75C 2EJFC 3SDZA 3VR3A 3I4LA 3A8IE 1VF7A 4KN7C 4OO1H 1CFMA 1V8QA 1GUTA 2PCFB 2BE5D 1B9MA 3QG1A 3BG3A 4KHZA 2BE5C 4LK1C 1CTMA 3PV0A 5KNDA 2KCCA 2A6HD 3T56B 1DXMA 2JEAI 2ZT9C 1O7LA 1GUOA 2EJMA 1EWHA 1K8OA 1O78A 3M7NA 4IQZA 2A68D 3TZUA 5K36H 2A68C 3KLRA 4XTCS 3BDOA 4L8JA 5A35A 1Q1EA 1GHJA 1H9SB 2E76C 3T53B 2A6EC 4TKOB 3VR2A 1Q1BA 1LACA 4BA1I 1K8MA 3RLFA 3MXUA 4RCNA 1Y69U 1TU2B 1DCZA 2O5JC 3HGBA 1FR3A 2DN8A 5KNCA 3D31A 1VCIA 4G7OC 1Z7TA 1H9JA 2YYZA 2JE6I 2NN6I 2PPBC 1OXTA 3I73A 3PUVA 1OXUA 3VA7A 5K36G 2B8GA 4DNTB 3FMCA 3NE5B 3IKJA 1H9SA 2AWOA 1GJXA 3VR6A 1H9KA 1Q12A 1SMYC 1Q90A 3CRKC 4H13C 2KA7A 3PUXA 4LJZC 1HQMC 3A8KE 4HR7B 2Q8IB 2A6ED 1IW7C 1HCZA 1T5EA 1ONLA 2DNEA 1DD2A 4G7HC 1YNJC 1GUGA 4OGQC 4JK1C 4IFDH 3QJYA 1YNNC 3A7LA 2A69D 3W3AA 1IYVA 1OXXK 3GQBA 2D5DA 1VF5C 2NN6H 1I6VC 1ZKOA 2A69C 3VR4A 4DNRB 3M4YA 4KI0A 3T51B 5JEAH 1V43A 1OXVA 3OW7A 4G7ZC 2R6GA 3ND8A 3LNNA 2O5IC 1ZYRC 2D2CC 1G291 1HTPA 1GUSA 3EQLC 3H94A 3A7AB 1GUNA 2L5TA 3SE0A 4PV1C 1PMRA 4KKTA 1FYCA 3D4RA 1LABA 1VDZA 2CW0C 1IYUA 3CRLC 1Z6HA 3QIAA 3OOCA 3GD7A 3PUZA 5BN5A 4I7ZC 3ND9A 3DXJC 3PUWA 5BN3A 2D62A 3M85A 1A6XA 3N6RA 2V4DA 1E2VA 2DNCA 2JEBI 4KMUC 2B8FA 1Y8OB 4IFDG 3VR5A 2F1MA 2IT1A 4JBWA 1IW7D 2AUJD 1Y8PB 2EDGA 4KKSA 5C0XH 2NN6G 3OPOA 2EJGC 4GZYC 4TQUS 5JEAG 1GHKA 4DK0A 4H0LC 1QJOA 2JXMB 4KKUA 2K32A 4KN4C 3AB9A 1CI3M 2PNRC 3U9SA 3LWUA 1OXSC 1HPCA 2BDOA 4OO1G 3WDNA 3A8JE 3PUYA 2A6HC 1Y8NB
chains in the Genus database with same CATH superfamily
2NVXB 2K04A 1X32A 4YWMA 3E5SA 2EE1A 3WOFA 1TS5A 3K7UC 2K7VA 4KY7A 3U50C 3HOVG 4C3JH 1V1PA 3D0FA 4XDXA 4DUZL 3CQZB 1HR0L 4DN4M 1GOZA 4OWWB 1F2MA 5IYDG 3I91A 3AQQA 2QKIC 1QZHA 1K8AC 1XMQQ 4KTAA 2AUKA 3SDZA 2B29A 1T9HA 4MNOA 2E2IH 4IFDI 3OW2A 1KRTA 4ABNA 2BE5C 4A3CH 2I46A 3QOLA 5IGCA 1PFBA 2EYJA 2A6HD 3D4DA 5K5PA 2ZT9C 4OHJA 5JOBA 4A3KH 3J81E 1WCMG 1PH1A 4QJFA 1J5EQ 3KLRA 1Q1EA 1WTRA 1UNSA 2E76C 3NTHA 1GUWA 4EQPA 1WTPA 3EBEA 2ZJPA 1TU2B 1S3OA 3BZDB 2NTTA 1Q82C 4A75A 1VQAA 2YTXA 1D8LA 3ULLA 1QZGA 2AWOA 3CW2C 5C4JH 1E3PA 4IUTA 3S1RH 3KOJA 1PYBA 5IGGA 2RVLA 1IW7C 1UWVA 3MHBA 5LMNW 1WI5A 2HCIA 5G3LD 5I2YA 1W3SA 1STNA 2RSOA 2D5DA 2XRQD 2B3GA 3VR4A 3X3MA 5JEAH 4A3IB 4DV2L 1QCBD 3HKZB 1ZYRC 4BBRG 1GUNA 3NWSA 1C48A 3GTKH 4JG2A 4A3BG 3CP0A 3S2HB 2D62A 4LF5L 1PVOA 1BCPF 3MEFA 3J81c 5IP9H 4K0KQ 2WB1B 1QNUA 4IALA 4A4IA 2PQEA 1TY0A 4C2MH 1KL9A 2WKDA 3R8BA 2DJGC 2E2HB 5M3FB 3UDXA 4EVOA 1W2BA 1PTOC 3HOZG 1PXUA 2KJXA 1AE2A 3FP9A 5LHY1 1BXTA 2BDOA 1II3A 4F7XA 4GNXC 4J1MA 2IWHA 1SRUA 2HQEA 2NVYB 2CHBD 2L12A 3G71A 4FF1A 1PZKD 4A3JB 2ATWA 1E2WA 2JA5H 4JI0L 4GNXB 4A3EB 3A55A 1XNQQ 4DR7Q 1CHPD 2MFIA 2KQ3A 3RLOA 1S4ZA 3I4LA 4KN7C 1KAWA 3NXWA 3NQTA 1CTMA 4MTNA 4HEDA 1C9OA 3S17H 1F77A 1A2TA 1KDBA 2K28A 1DZ1A 4UHVA 3SXHA 2BH8A 4JI6Q 4IQZA 3GTJH 4AYBE 4PMBA 1GHJA 2HUGA 3C1FA 1JOOA 3H0GB 1Q1BA 2JA6B 4IUQA 1HQRD 5CV8A 4QB4A 1VQGA 4PZ6A 4UP8A 1FR3A 4RGNA 2K5DA 2HIXA 2QILA 3U4ZA 1H9JA 2EXDA 4LUVA 3ITPA 2F0NA 5AJ3L 4DR4L 4JI5L 1YBYA 2HQLA 4L5TA 5M5WH 4A3DB 1Y1WB 4X6AH 1I4HA 5DM73 3TP5A 4PZ7A 2NYZD 4GNXA 1Q12A 1HZAA 4MHEA 3PO3B 4BBSB 4LF8Q 1ET9A 1YNJC 3GTLB 1ILQA 1GUGA 1VQOA 1VQJA 5D3IB 3HOYH 4JV5Q 3BVMA 2RKSA 1FD7D 4WRDA 3H94A 4CJ2C 4X65L 2HHHQ 1ICFB 5EPLA 2B63H 4QGUA 3QIAA 5KEEA 2TSSA 3OOCA 4K2LA 1JB3A 4DV1Q 4DV7L 1SYDA 1E2VA 1CK1A 2B8FA 5C6AA 2EDGA 2F0FA 1I4GA 5JPMC 5FLMG 4ODGA 4X66L 3S1QB 1M8AA 1XXGA 3S14H 2YTVA 3I4OA 3MZ5A 3NP8A 1N32Q 3KF6B 2K32A 2F0WA 3OWEB 2PNRC 5GADC 3STBD 2A6HC 2F0LA 4YCUA 1A3UA 4IOAA 4LF4Q 3L7ZC 1YHBA 4JVZA 1DOLA 4A3IG 3S16H 3SEBA 3HKZG 1JQYD 4CDCC 3AFQA 4IPGA 4ZCKA 2XSCA 1K3RA 2B2UC 2IX1A 4KJNA 2EXZA 1SYEA 3VDYA 1SNDA 3A8IE 4RHRA 1E22A 5I6YA 2QEJC 1G2TA 2WB1G 4X62L 2EZVA 1HTLD 1SE3A 4CKEA 2MGSA 1LTAD 3Q6SA 1O7LA 4QL5A 5FO9B 1AEXA 5M3FG 1CSQA 2SOBA 5M3MB 3GDEA 4BS9A 4FO2A 2SNMA 3CCQA 4P72A 5C0XJ 1F2ZA 4C3IH 1O7IA 1PZJD 4Z9CB 1HJPA 3KF6A 4A3JG 3MVVA 1G6ZA 2ZM6L 4A3EG 1G6PA 1C4QA 2EY6A 5IGBA 2B2WC 3A74A 3P75A 1NR2A 3PUVA 4DR1Q 3T1YL 1KLGD 2DY7A 3K80C 1MSHA 5GQOA 3TREA 1N34L 3S15H 1I3QH 4IURA 4DV5L 1HQMC 2QDBA 2Q8IB 1SFOB 3E9IA 3K58A 3QJYA 3A54A 2K4KA 5IP7H 2NN6H 2NZHA 3JAML 4A93H 4IUVA 2GVAA 2A1AA 1Q46A 4X64Q 1HTPA 3H0GG 2JA6G 3PQIA 2F4VL 1DONA 1RF2D 4PQXA 3CRLC 1IBML 2ZTDA 3AU7A 1FJGQ 4DGZA 5CYUA 1JOKA 3BDCA 4AYBB 5CGKA 2IT1A 4JBWA 2XNAC 1BR9A 2VQFQ 1F9PA 4A3DG 1Y1WG 4GOPB 2UXDQ 4K8JA 4ID6A 1YITA 3H3VH 3PO3G 1EU4A 4LFAQ 4XQJA 3F2BA 2L15A 4BBSG 3ICEA 2JN4A 4L5RC 5CV7A 1WOCA 2RCFA 3MFYA 3KDFB 1TQOA 2E5LQ 2SEBD 3DM1A 4DV3L 2E74C 5FOBB 1PLFA 2F03A 1HNXL 3E0EA 2PZTA 1X56A 2MHVA 2Z4IA 4TRDA 3DWPA 1EQTA 4A3FB 2JP1A 1E2ZA 2F0QA 1XPOA 4J15A 2WAQE 2BOSA 5EBCA 3BYTB 5LL6X 3FPUB 1B7YB 1ML0D 2A74C 1LV9A 3I4MB 2EJMA 1PFSA 4FP5D 1O78A 2RDGA 3HS0C 2F52A 4TVAB 5C5LA 3H15A 1TS3A 2UUCL 3O13A 1WYDA 4B3TQ 1H9SB 4N9PA 4GOPA 3KK7A 3MTSA 3R93A 1STAA 1TWAB 1O7YA 4G7OC 1SAPA 2YYZA 1NAPA 2RSNA 1A0IA 3E9HA 4JW0A 4DV6L 3KDFA 4WFN3 1SN8A 3RUZA 3HG9A 4O1NA 1SDFA 3JAMc 3KLSA 5D3DA 2F0VA 3NELA 4Y52H 4CJ0B 1EUJA 4H13C 5D65A 1SMYC 1TWHH 2LKVA 4YCVA 2AWNA 4JI1Q 1ONLA 2D9UA 4HTHA 3QOJA 5M3MG 3D4WA 4DNRB 2KECA 3GTOH 1TS2A 3V2TA 2G5DA 1YIJA 3SE0A 1EWIA 4NXNL 1VQ6A 1JWSD 3S2DH 4ZUIA 1LABA 1VDZA 1ZEQX 1IYUA 3GD7A 4MZ9A 3HOXB 4JCVE 1SROA 4GS3A 3AMUA 4IFDG 3VR5A 1HNWQ 5C0XH 3OPOA 3OIPA 1X3EA 3OYYA 1SJED 5CV6A 1Q8KA 1W6JA 3I55A 3RZDH 1XNRQ 2ZTEA 3CMAA 3S1NH 2D0PA 5HGTA 1HFNA 1JMCA 5FLXL 4M8AA 4OX9Q 1HA6A 1PDQA 5I9PA 2N55A 3OHXC 2OQKA 4HJ7A 4QUCA 1DGSA 4UP7A 5BN4A 3G6EA 2NVQB 2AMCB 1STGA 2R7ZB 2R3ZA 3IAYA 3Q23A 1SE8A 4ZUJA 5T1IA 1JE4A 2Q8TA 4AYBG 1SE4A 3I70A 5M5YH 3CAMA 2F0GA 2ICEC 1CQVA 4LK1C 3I4NH 3PV0A 3QO2A 3T56B 2DJFC 3BDLA 3HEJA 2L4NA 1I6HB 4BY1B 3M7NA 2XRSD 1EQQA 3TN2A 4YHHL 3U58A 1J9OA 2F0UA 2FHTA 4KY6A 1G91A 3B6YA 4TKOB 3VR2A 2IJ0A 1K8MA 3CD6A 5JEAJ 3BZCA 2ZJQA 4L5QA 5CV4A 1C0AA 1WD0A 2UXBL 1MI2A 1RJTA 2JE6I 4DUYQ 1ESFA 1GD7A 1U4MA 4A3FG 3VYRA 4HJ8A 2JA9A 4PZ8A 1E24A 1S5ED 2EPBA 2ZTCA 1AE3A 1FVIA 4POGA 3VYSA 4A3GH 4G57A 4KHPQ 1A63A 4X3UA 1Z9FA 3BVZA 4RCOA 4IO9A 3I4MG 3A7LA 1EY0A 1XMOL 1BCPD 4APVA 3A5UA 3TS0A 3VYUA 2CWAA 1Q81C 4N8FA 2WAQB 5KGUA 4C3HH 1UAPA 4RG1A 3CPWA 1JJGA 4DUZQ 1Z6HA 1HR0Q 1PRTB 1QB5D 1VQHA 4S3SA 3CPFA 4KKSA 1TWFB 1V1PB 3RZOB 2ALYB 5M9OA 3U9OA 2Z1CA 2F0HA 2EIFA 3GTPH 1NR4A 4KKUA 4AQYQ 1WTVA 1W6KA 4QIWE 3CC2A 5CBAE 1SSOA 1VQDA 3K5NA 4HCSA 5EQ0A 5IYCH 2NVTB 4OEMB 3NTIA 1KAAA 2I5LX 5KYIA 1PYWD 3T16A 3ER0A 4XIGS 2PW5A 2R93B 1A15A 2N49A 4XT3B 5KYLA 2K5HA 3IFTA 1KDAA 1XYIA 2ID0A 5JVH3 3VR3A 3HOXG 1IBLL 4DV0L 4P74A 1GUTA 1LT4D 2PCFB 3VA5A 3ULPA 4HJAA 3ERQA 1SBBB 2F3WA 2Q2HA 1LTRD 2JEAI 1XTDA 2WACA 3KBXA 3EROA 5IODA 1UUPA 1D5ZC 4PG3A 2FFKB 4KHVA 4B9WA 2A68D 2NZOA 5K36H 4RA8A 1P16A 4OO1I 4K5WA 4L8JA 2A8VA 1B8AA 2NUCA 4Y7NH 3L9AX 4DV2Q 3PIOA 5EJWA 3LGJA 3HGBA 2FJ2A 5HY6A 2R7ZG 1NCVA 3T1HL 2E8GA 1QE6A 4LF5Q 3SHLA 4ZRZA 3FMCA 1RTNA 3NE5B 1HXYD 4B08A 1IKMA 3EIVA 4P73A 5E1FA 2KA7A 2I07B 3PUXA 1KD1C 4GKKL 4HSPA 1EZ6A 3Q0AA 4DKAC 2M2LA 1YNND 2BDNA 1RTOA 3DM3A 4Q0FA 4DR2L 1IYVA 2A69D 4BY1G 2JYOA 1OXXK 3J7AF 2VXWA 4KI0A 1MIUA 3NBHB 1IZ6A 3DMUA 2FMCA 3RD4A 1XX8A 2OXPA 4PV1C 1CHQD 5FJ8G 3S1MH 2CW0D 2UXCL 5FK9C 1F2LA 1PH8A 2XWJB 3D6CA 3PUZA 4JI0Q 2VUMB 3N6RA 2PO4A 4IPCA 3HOVH 2EYPA 3F1ZA 3V05A 2HIVA 3EVQA 4IUNA 4K2KA 4EGVA 2KHSA 4DR3L 1G51A 1VQMA 4DK0A 3DEPA 1X55A 4LF9L 2G9HD 2YU9B 5IYDH 1O7ZA 3PSIA 2WP8J 2CFMA 4KY5A 4WJWA 1S72A 1L0YB 1PH4A 2MPMA 2VY3A 3D3RA 1QILA 2HD3A 2AQ1B 1I4QA 4JPBW 5KNBA 3ULJA 4I7AA 2JA8B 4BA2I 4UY8C 4NXML 2XWBB 2BA1A 1BBUA 3S24A 2WAQG 3W5OA 1H9MA 1WCMH 2MQHA 2GN5A 2KUMA 3M4OB 2E2JB 4H44C 3Q22A 2Q2IA 1K8GA 3NBHA 2AQ2B 5GAHC 1VF7A 1Y14B 1LT5D 4CHTB 4CKBA 4R8IA 5AJ3Q 4JI5Q 4DR4Q 1RD9D 3BG3A 1HR0W 4XT1B 2UUBL 2EYHA 1NE3A 4LFBL 1PTOB 2N8NA 3HOUH 4LFCL 1J5EL 3QWNA 3CF5A 4JI4L 2OCEA 3RLFA 1HHVA 1QNKA 1N33L 3H3VC 2JSOA 4X65Q 2ASBA 3BS1A 1K28A 4B3SL 1FNWA 2R93G 4DV7Q 2EYOA 2KCTA 4QIWB 1HUNA 1SLJA 1JJCB 1RCVD 4BBRH 1DOKA 3AFPA 4L6TB 3WWVA 4HMIA 2I5MX 4X66Q 3GTMB 2FXQA 4A3BH 4XYOA 4LJZC 1UE6A 1YHQA 2VQEL 3SK4A 4POFA 1FGBD 1AW7A 1D5XC 3A56A 1X65A 5DEHA 3ZJYC 1L2FA 1L1OC 4YY3Q 3HOZH 5L37A 1B1ZA 3GTQH 2F0EA 4C1NI 4PMWA 5BN5A 3DXJC 3M3YH 3MXNA 3ONAB 2R61A 3DUZA 2QA4A 4RMFA 1F9QA 1J8IA 1JC7A 5LMUL 4K0KL 3Q24A 4UP9A 4X62Q 1MSGA 4X3TA 1CKNB 3GTGB 2OT2A 1EY9A 3AYHB 5EBDA 5JJZA 1VF5C 2X69A 3FVQA 5EPKA 3RMHA 5EKLA 1XPUA 5CBEE 4JBMA 3P20A 4B3ML 4H7BA 3L2PA 2IW3A 4RH6A 1EYGA 1K83B 3J7AV 2VUMG 5C3WA 1B4OA 2NVXH 1EYAA 2OTLA 4DR7L 1NY4A 1I50B 3T1YQ 1E1OA 4ME5A 3CQZH 2E2DC 1N34Q 4BY7B 1PZID 4IPHA 1BF4A 3A5ZB 4DV5Q 1NMGA 2J4XA 1CQFA 2RA4A 1JWUD 1GO3E 4E6IA 5HURA 4QUFA 4GLXA 1U4PA 2JA8G 1DCZA 1CKNA 3F8TA 2F4VQ 4CKCA 3I56A 1IBMQ 2KCNA 2B39A 3D8GA 1KIXA 1N36L 1B70B 2HCCA 4DNTB 4DAYB 5ISRA 3FRPB 4GKJL 2X6LA 5J22A 4DV4L 3HRZC 5C5MA 1KDCA 2DNEA 2ES2A 3KYHC 5CC4A 4ILWA 2NB0A 4JK1C 3W3AA 1PH3A 1IL8A 4LNQA 3GQBA 5C44B 5FLMH 3M4YA 1MGSA 2KCMA 2Q8RE 3T51B 1OXVA 1D1IA 4K6LA 4G7ZC 4RWSC 1MHWC 4HJ9A 1K9MC 1VQBA 1G291 5M5XB 2F0PA 1V9PA 1TWCB 1NTGA 2KBNA 1VQ7A 1TWGB 1VMCA 2HHHL 4DV3Q 1A6XA 4I7ZC 3ND9A 1HNXQ 1IKLA 3X3NA 3CXCA 2Z6BA 1JT8A 3NSWA 4NPSA 2AUJD 4A3IH 1U5KA 3FKIB 1TIID 1KHIA 2R92B 1R9TB 1GHKA 1Y1VB 1NNXA 3P1HA 1IBKL 4IUPA 1LO5D 1TVXA 2QCPX 1SEBD 1WTXA 4DNIA 2JA7B 5A2QE 4LF7L 4IOCA 1NJIC 3S2HH 5GAEC 3CKIB 3CCLA 1ENFA 2B2UA 1HPCA 4TSSA 1RDPD 4DAYA 3TP7A 4DK6C 2B2VC 5E4XA 4OWXB 4J6HA 5DM63 2UUCQ 2XVSA 1B44D 3K7AB 4MTKA 4BWGB 2RBMA 1HZBA 2E2HH 5CORA 5M3FH 2K33A 2DY8A 4IFDJ 1ASZA 2KVMA 1STYA 1EWCA 4FNFA 2PQAB 2BA0A 1BDOA 1G2SA 2C9OA 1CFMA 4DV6Q 5FKAC 3CCUA 1B9MA 2JK8A 2CH4W 2NVYH 1JE5A 4JOIC 4A3JH 4DR5L 1CUKA 3K57A 1HZ9A 4GN4B 4DR6L 1EQVA 3PO2B 1MKHA 3JAME 4A3EH 1EWHA 2RF4A 2AHOB 2OEOA 3HOWB 3SK8A 1X3QA 3NEMA 4JI8L 5C4XB 1JWMD 4X3SA 2B2WA 3CC7A 3CMEA 4A3MB 1HRJA 1T5XD 4XYQA 1SR3A 1D6EC 1LACA 1PRTD 2KOLA 3MA2B 4H02A 1EEID 3NQIA 3CCEA 1FNUA 1PHJA 5KNCA 4FDBA 4C1NK 2H4OA 3M7GA 3A0JA 2EOTA 2QEXA 1QVGA 3G7LA 3H0GH 1EY8A 2JA6H 4BXXG 1MJEA 3BJUA 3W1GA 5C3EB 2CQAA 3Q8DA 1WD1A 1CKMA 1Q90A 2B2VA 3CRKC 2OTJA 3A8KE 3K8AA 5IYBG 2PQAA 2UU9L 4FF4A 3KFUA 4YWLA 2B2YC 4BY7G 4OGQC 3OMCA 3DHQA 4V0BA 5C4ZA 4A3DH 1Y1WH 3PIPA 2I5HA 3KJOA 3EQLC 3F2CA 3NBIA 4Q5VA 1A3TA 2YTYA 3PO3H 4BBSH 3KF8B 4JOIA 4JI7L 3GTLH 5IT9L 3RR5A 2QGQA 1QWYA 3UDIA 3K5MA 1PA6A 3UDGA 3PGZA 3LX0A 3FDTA 4FXKC 1AZQA 1EOTA 4UPAA 4HAEA 4C3JB 2N78A 1U4LA 2VS1A 1RL2A 3RLNA 1LTLA 3U9SA 2JQOA 3BZKA 4OXPA 1QUQB 4YCWA 4OO1G 3J80L 1QG7A 1CSPA 3STBC 4DAMA 1Y8NB 2LMCB 1K3BC 3OSOA 2E2IB 5C44G 2K6AA 3S1QH 5ELEA 4YHHQ 1TKWB 1ZXTA 1KRSA 4UAIA 3ZYYX 4A3LG 4ZLTF 1PH9A 3GO5A 3I3CA 2XIWA 2QW7A 4A3KB 3IL8A 2L0CA 1TS4A 5IIFA 2UXBQ 2E75C 1P8LA 5FO8B 1AN8A 2B2YA 2BE5D 1PYSB 3RN2A 5IGEA 2IX0A 4A76A 1TR5A 1XPRA 2L11A 3FKIG 2R92G 3KF8A 1B53A 2Y0SE 3HZXA 1Y1VG 3PMFA 4QF4A 1S5DD 4AIMA 2JA7G 1VQ4A 5IWAQ 1VQ5A 1EQRA 3K5LA 5IGFA 3L0OA 2OF1A 1AZPA 1K73C 3J80i 3MXUA 5C4JB 3S1RB 3FEWX 3CHBD 1QUQA 4FXDA 2K5QA 3KUPA 1PV4A 5M3MH 5DNFA 1BUVT 5EGTA 3MWYW 4UDUC 1X3GA 2TMPA 3DWQA 3PF5A 1PH2A 1OXUA 4AH6A 4CGYB 5FLXE 3CCJA 1STHA 2Z0SA 1IL2A 1FNVA 1E0BA 3GTKB 3PO2G 1O80A 1DD2A 3M4QA 4JI2L 1UEBA 2CH4A 3F2DA 4IFDH 1CZWA 3HOWG 2IHFA 4GLVB 4OWTB 1I6VC 1EY7A 1F9RA 5C4XG 4ZK9B 1ZYRD 2HDLA 5AFWA 3MAQA 3LNNA 4C2MB 2O5IC 3M9BA 4A3MG 2B2TC 2L5TA 4JYAL 4KKTA 3VYTA 4I65A 1SFOH 2R7DA 1UE1A 4DXFA 2I0QA 3NENA 3QR8A 1PRTF 2JEBI 1YI2A 5CMDA 1IBLQ 1HNZL 4GZYC 3UE1A 3MEHA 1G8ZD 1BNZA 3KJPA 1R4PB 1LTID 1C7YA 3C3LA 2F0DA 2JA5B 5C3EG 1M1KC 2WKCA 1OO9B 5IGDA 3PIO3 4LUZA 1MJCA 4LUOA 2LXJA 3WDNA 4RGTA 2WFWA 4DK3C 4X3KA 4ME3A 2OWOA 3C2PA 1N9WA 1EY6A 1WTWA 3I72A 2BCOA 5FLXc 2WIIB 3S17B 2EY2A 3OTOL 4LAAA 2UUAL 1IYJB 3GTJB 1V8QA 1FGUA 1UE5A 4C3JG 4CDDC 2KEDA 3KBGA 2B2TA 4GKKQ 4A3FH 1H95A 4HIKA 3NPPA 4DR2Q 5M5WB 1RHPA 3W1BA 3PCOB 1ICWA 4A3CG 3H6MA 2VW9A 3I4MH 2PYKA 2F0JA 1VCIA 2UXCQ 1D1KA 4FXGC 1Z7TA 2VL6A 3RN5A 3S9WA 4A3KG 5BR8L 5JJKA 4O0AA 5LMNL 3I73A 4F87A 1I94L 4L63B 3HOYB 5ELFA 4WJ4A 1LLRD 2QDLA 4OONA 1KQSA 1GJXA 3VR6A 4HR7B 4HIDA 4LF9Q 2B63B 1TWAH 4K14A 4G7HC 1LT3D 3HKSA 3UI2A 4IJHA 4GN5A 1R4QB 3J81L 5F2DA 3IRBA 4R4TA 4DAPA 3CCMA 3S14B 4LF6L 4NXMQ 4ZKBB 4K5XA 1YVCA 2Y0SB 1QVFA 1U4RA 1VS0A 3G48A 2F0SA 1F9SA 2MO0A 3NUCA 3TDQA 4IUUA 4JI3L 3T4AC 1AH9A 1SYBA 4TQUS 4GLAC 5JEAG 3SR1A 4HJ5A 5I9OA 1MD2D 3S16B 2H1EA 4NKLA 4HCEA 1YJ9A 3EJIA 5ELOA 4KN4C 4CDEC 2UUBQ 5H1SE 1M90C 3LWUA 3HOXH 1WTHA 4LFBQ 1Q3LA 2OQ0A 4AQYL 4EQNA 4F8MA 4K6DA 1RIPA 5EKIA 1I4PA 5NUCA 2K05A 4DK1A 5IP9G 4LFCQ 2ZXPA 1KNAA 1NUCA 2PMZE 1KTKA 4JI4Q 3H09A 1BBWA 4OELB 3J81i 1N33Q 1JICA 1PH6A 3K5OA 4FF3A 3SK6A 2EVBA 1JR0D 1YZ6A 4B3SQ 1EY5A 4QY7A 4B3RL 3CU7A 4ZAIA 1ENCA 4C3IB 1U9RA 5ELBA 1TXYA 2BH2A 1RKNA 1LUZA 3TSSA 1EIYB 4NDXA 3P7JA 2NVQH 1ILPA 1D7QA 1I5FA 2R7ZH 2GVBA 3HOUG 2PNHA 1E7ZA 2JA5G 5GROA 3TZUA 1BQQT 2VQEQ 1PTOF 3T53B 4P2CB 2NTSA 2Z8LA 1Y69U 1OTCA 3S15B 3OWFA 1I3QB 4L5SA 5KRUA 1XMQL 1I6HH 4BY1H 2A73B 1TT2A 1KLUD 1JORA 1KXLA 2DUDA 4PNYA 2F3IA 3BYYB 1RODA 4P71A 4A93B 2Z4HA 4NP5A 5FJ8H 3IKJA 5I6WA 1VQKA 1YJWA 1NMFA 1SE2A 5LMUQ 3R3OA 2A6ED 3MXNB 4N9TA 4ALPA 1EFWA 1X6OA 2KENA 1BCPC 2CKZB 4DU9A 5JJIA 2D2CC 3A7AB 1UEAB 1B3AA 1LTTD 1FYCA 4B3MQ 1NBWA 3TMEA 4NW2A 1BCPB 1FL0A 3UE0A 2NBFA 4IPDA 2L55A 4WORA 2F1MA 4IN3A 2L1BA 1S40A 2EJGC 4HN7A 1LTBD 3HOYG 3OIQA 3CCVA 1DJRD 3J81j 5I4DA 1Q7YC 2EYLA 2MO1A 4R4IA 4LWCA 2B63G 4FVMA 1BBXC 1OXSC 2F0KA 1TWFH 1GKHA 3E3XA 3I90A 4KD3A 2HT1A 3RZOH 2F3VA 3FPPA 4J8QA 2LFNA 1HA5A 2MNAA 1L1OB 4U673 1TY2A 2Y0SG 1QVCA 1M4VA 5CV9A 3TP8A 4JC0A 1LM0A 2EQSA 4FF2A 4M1UB 1YHAA 4OIKA 1BOSA 1N36Q 2NVTH 4QCLA 2PZWA 1NSNS 5EAYA 1DXMA 4XQNA 4GKJQ 2L9HA 2R93H 3CCSA 1B3QA 4ZYSA 4RGOS 4DV4Q 1CA6A 1YEZA 1ESRA 1SXTA 2A68C 2SNSA 1PH5A 2M9VA 2ZXOA 3UDFA 3ERSX 1Q8IA 1STEA 3R2IA 1SNMA 2O4XA 2A19A 1VQ8A 1K0RA 1S5BD 1SMXA 1TWHB 1SNQA 2ZM6Q 1EL0A 3QB3A 1XNQL 4YIJA 2PZUA 4RFBA 1A2UA 2O2LD 5FO7B 3GTOB 3VA7A 4LW1A 2RCNA 2K52A 4C3IG 1SMYD 1L1OA 3DEOA 4V190 2PMZB 5EKKA 3S2DB 4JI6L 3W2DA 1IBKQ 2PI2E 4KK7A 1SJHD 2D0OA 1YNNC 1BO0A 4LF7Q 2A69C 1ZKOA 1JOQA 1DOMA 3ND8A 2VB3X 1AFPA 3RZDB 1PFMA 3S1NB 1B2TA 2CW0C 4YY3L 2FINB 1Q86C 3DLLA 5G3LF 2DNCA 2ZJRA 1Y8OB 2MP1A 4RHSA 1JJ2A 1HH2P 1Y8PB 5IP7G 2NN6G 1KABA 1DM0B 4A93G 3R2TA 4F88A 2HDMA 1JCKB 2LY7A 2VB2X 4DR5Q 4LF8L 1QJOA 2CWPA 4DR6Q 3AB9A 1CI3M 3TP6A 2VUMH 2PW7A 4RGMA 4JV5L 4DPGA 1HZCA 4JI8Q 2QF7A 5M5YB 2SDFA 4HIMA 4FYDA 3I4NB 1B50A 2F4IA 2YU9H 2EYMA 5A2QL 1E1TA 3GV6A 5CV5A 1KNEA 5ELNA 4DV1L 3K0YA 4P75A 3NWTA 3URYA 2KEEA 5COYA 2LS01 5E7NA 1GVPA 1BKBA 2Q2UA 2JA8H 2V1CC 3TBIB 1S5FD 4KLKA 5KNDA 4U68A 1N32L 2WINB 5J1ZA 3PIP3 1X3PA 1MBYA 3M4OH 2E2JH 1EFID 4XXEA 5IE8A 2UU9Q 4DAVA 1I4RA 4LF4L 5CR3A 3WOEA 4O2DA 2CCZA 2XN9C 4IJLA 2A6EC 4HSVA 3G6JB 4BA1I 3KLSX 1IHZA 5GAGC 2EY5A 2NZ1D 5JAVA 4A3GB 2O5JC 1L0XB 2CVRA 3D31A 1SYGA 1EU3A 4KD4A 1PTOH 5ELCA 2PPBC 2F0TA 4G4KA 4JI7Q 1A62A 2XTIA 3TEHB 1VQNA 1D2BA 4GOPC 3NTKA 2RQXA 1SNOA 2H5XA 2K14A 3BVGA 4C3HB 4GN3B 1EOVA 2Z6KC 1SYFA 1HCZA 1WFQA 5C3XA 4DF7A 1S5CD 5E4WC 3K59A 1CZGA 1PH7A 1EYCA 2N3SA 4B9XA 4DFAA 4NXNQ 1EZ8A 2J7ZA 1GUSA 1SYCA 2A5HA 3GTMH 1PMRA 2Q2TA 4WJ3M 4CJ1B 3GTPB 5BN3A 2ENBA 1CT1D 4DR1L 3JAMi 1YJNA 1A8VA 1V1OA 3E6ZX 2Z9HA 3KLWA 1LT6D 4R4CA 3GP7A 2RHSB 5HGQA 2IY5B 3NHHA 1VQ9A 2C35B 1XJVA 2ZXRA 3K0XA 3J7YW 1EYDA 4X64L 4R4QA 1EIFA 5C0XG 2RDHA 2X6GA 1FJGL 4RKBA 3GTGH 1B9NA 5D14A 3TS2A 3NK9A 2NWGA 3U4VA 2K5NA 3E0JA 1H9RA 2Z6KA 1EIGA 1ASYA 2VQFL 2IL8A 2K01A 4EQ5A 4PMCA 2UXDL 3MXPA 3QG1A 1A3VA 4KHZA 4Y7NB 2IPKD 5I2XA 3CCRA 2KCCA 3HP3A 1LYLA 1F2YA 1K83H 2RDFA 4LFAL 3RNUA 1VQFA 4NB3A 2F0MA 4JI2Q 2MUYA 1LTSD 3I8ZA 4XTCS 3BDOA 1I4XA 2DGYA 4ULLA 2E5LL 4BXXH 5T1GA 2K75A 2VZAA 1I50H 2M00A 5IT9E 1IXRA 4N8X1 3CC4A 5IYBH 3F2UA 3I4NG 4BY7H 4QMGA 2DN8A 3MXGA 4K8IA 4JYAQ 2YV5A 2VNUD 2NN6I 1L0WA 1GM5A 4XQQA 3H91A 1ENAA 3AEVA 1EEFD 5JPNC 2B8GA 5TSSA 4C56C 4CBVA 1H9SA 1WTOA 3GV3A 1HNZQ 1H9KA 1XWEA 3S1MB 3J80E 1V1QA 2PI2A 4R4OA 1T5EA 1XMOQ 3I7FA 1SNCA 4B3TL 2EYFA 3EFXD 1VQEA 1ET6A 3I2ZA 1VMPA 3HOVB 3K6OA 1V43A 4O42A 1PFNA 2R6GA 2CQOA 1VQPA 4OIJA 3L3OC 1YNXA 3D4RA 3H3VI 4A3GG 4OO1H 3M85A 4OL7A 3V96A 1VQCA 3OTOQ 2UUAQ 4MIUA 4KMUC 5C44H 4A3LH 1J6QA 1IW7D 2K1BA 5DLQE 2XGTA 1GXDC 5EPJA 1D5MC 5M5XH 1TWCH 4JI1L 2WV6D 1X54A 5ELDA 4C3HG 1TWGH 5IT9c 3HFZB 1WCMB 5LL6S 2K5WA 1CM9A 3BU2A 5J3BA 2J0TD 1CA5A 3SVMA 2K5VA 1WTQA 3T13A 3FKIH 1CKOA 5JVG3 1HFGA 2R92H 1R9TH 1QOHA 3EA6A 1Y1VH 1WJJA 4EX5A 2JA7H 1XTCD 1BVSA 5J39A 3J80c 3IFDA 4HMJA 4DV0Q 1VQLA 4YWKA 4ZKCB 2LSSA 1HNWL 2EJFC 2JJQA 3TZDA 4LMQD 5BR8Q 5LMNQ 1PTOD 3HOUB 1I94Q 3HKZE 2N88A 3K7AH 1VQIA 1XNRL 3DWAA 3FHWA 5IYCG 3C46A 2GA4B 1KC8C 4OX9L 1GUOA 3MFGA 1Z47A 2FMMA 1K8OA 3M4PA 1AP0A 2K50A 4KJOA 2K03A 1C8CA 3SK5A 2EY1A 2AQ3B 4DA2A 2WB1E 3LWEA 3TQYA 5A35A 1WVLA 5IWAL 1EY4A 4BBRB 3N52A 3K81C 3D6WA 4RCNA 3PO2H 4DXGA 4A3BB 1PRTC 3T1HQ 1X3FA 4JBJA 4LF6Q 1DYQA 2KHIA 3HOWH 4JBKA 2P5ZX 4IZ8A 5DAUA 1OXTA 2IHEA 1UE7A 5C4XH 2G9DA 4QQBX 4ZQ3A 5KIXA 5K36G 2IX3A 4A3MH 1N8RC 4JI3Q 4R9WA 3SGIA 5IY0A 1SNPA 3C1EA 4HIOA 2KHJA 2C5CA 3HOZB 3EN2A 3GTQB 2LXKA 5E3FA 4R1JA 2R7FA 1X9NA 3TRZA 3G4SA 1STBA 3M3YB 2F0IA 1JB7A 4RAUC 5C0XI 3J7A5 4NMZA 3OW7A 3OMGA 2RHQB 5C3EH 4MN3A 3J7ZC 2AKWB 1EIHA 4CDFC 1HUMA 4DUYL 3PUWA 2F0OA 4RKLA 2V4DA 1LTGD 2ICIA 5C4HA 4DR3Q 3JC66 1YNJD 4B3RQ 4K5VA 4KHPL 4H0LC 2MJ8A 4EQOA 3PF4A 2JXMB 4R8NA 3MC0B 1K0SA 5JJLA 5IOCA 1U0LA 3A8JE 4KV6A 3PUYA
chains in the Genus database with same CATH topology
2NVXB 2K04A 1X32A 3E5SA 2EE1A 3WOFA 1TS5A 4KY7A 2K7VA 1V1PA 4XDXA 3CQZB 4DN4M 1GOZA 1F2MA 3I91A 2QKIC 4KTAA 2AUKA 3SDZA 4IFDI 4ABNA 2BE5C 2I46A 3QOLA 5IGCA 1PFBA 2EYJA 2A6HD 3D4DA 5K5PA 2ZT9C 4OHJA 5JOBA 3J81E 3KLRA 1Q1EA 1WTRA 1UNSA 2E76C 3NTHA 1GUWA 4EQPA 1WTPA 1TU2B 3BZDB 2NTTA 2AWOA 4IUTA 5IGGA 2RVLA 1IW7C 3MHBA 2HCIA 5G3LD 5I2YA 1STNA 2RSOA 2D5DA 2XRQD 3VR4A 3X3MA 5JEAH 4A3IB 1QCBD 3HKZB 1ZYRC 1GUNA 3NWSA 1C48A 3S2HB 2D62A 1BCPF 2WB1B 1QNUA 4IALA 2PQEA 1TY0A 2WKDA 3R8BA 2E2HB 5M3FB 4EVOA 1PTOC 1PXUA 2KJXA 5LHY1 1BXTA 2BDOA 1II3A 4F7XA 4J1MA 2IWHA 2HQEA 2NVYB 2CHBD 2L12A 4FF1A 1PZKD 4A3JB 1E2WA 4A3EB 3A55A 1CHPD 2KQ3A 1S4ZA 3I4LA 4KN7C 3NXWA 3NQTA 1CTMA 4HEDA 1F77A 1A2TA 1KDBA 2K28A 1DZ1A 3SXHA 4IQZA 4PMBA 1GHJA 2HUGA 3C1FA 1JOOA 3H0GB 1Q1BA 2JA6B 4IUQA 1HQRD 5CV8A 4QB4A 1FR3A 4RGNA 2K5DA 2QILA 1H9JA 3ITPA 2F0NA 4A3DB 1Y1WB 1I4HA 5DM73 3TP5A 2NYZD 1Q12A 4MHEA 3PO3B 4BBSB 1ET9A 1YNJC 3GTLB 1ILQA 1GUGA 5D3IB 3BVMA 2RKSA 1FD7D 4WRDA 3H94A 4CJ2C 5EPLA 3QIAA 5KEEA 2TSSA 3OOCA 4K2LA 1JB3A 1SYDA 1E2VA 1CK1A 2B8FA 5C6AA 2EDGA 2F0FA 1I4GA 5JPMC 4ODGA 3S1QB 1M8AA 1XXGA 3MZ5A 3NP8A 2K32A 2F0WA 3OWEB 2PNRC 2A6HC 2F0LA 1A3UA 3L7ZC 1DOLA 3SEBA 1JQYD 2XSCA 2B2UC 2IX1A 4KJNA 2EXZA 1SYEA 1SNDA 3A8IE 4RHRA 5I6YA 2QEJC 1G2TA 2EZVA 1HTLD 1SE3A 4CKEA 2MGSA 1LTAD 3Q6SA 1O7LA 5FO9B 1AEXA 2SOBA 5M3MB 4BS9A 4FO2A 2SNMA 5C0XJ 1F2ZA 1PZJD 4Z9CB 3MVVA 1G6ZA 1C4QA 2EY6A 5IGBA 2B2WC 3PUVA 3P75A 1NR2A 1KLGD 2DY7A 1MSHA 4IURA 1HQMC 2QDBA 2Q8IB 1SFOB 3K58A 3QJYA 3A54A 2NN6H 3JAML 4IUVA 1HTPA 1DONA 1RF2D 4PQXA 3CRLC 3AU7A 4DGZA 5CYUA 1JOKA 3BDCA 4AYBB 5CGKA 2IT1A 4JBWA 2XNAC 1BR9A 1F9PA 4K8JA 4ID6A 1EU4A 4XQJA 5CV7A 3MFYA 1TQOA 2SEBD 3DM1A 2E74C 5FOBB 1PLFA 2F03A 2PZTA 2MHVA 2Z4IA 4TRDA 3DWPA 1EQTA 4A3FB 2JP1A 1E2ZA 2F0QA 2BOSA 5EBCA 3BYTB 5LL6X 3FPUB 1ML0D 2A74C 1LV9A 3I4MB 2EJMA 4FP5D 1O78A 2RDGA 3HS0C 5C5LA 1TS3A 3O13A 1H9SB 4N9PA 3KK7A 3MTSA 3R93A 1STAA 1TWAB 1O7YA 4G7OC 1SAPA 2YYZA 1NAPA 2RSNA 4WFN3 3RUZA 3HG9A 4O1NA 1SDFA 3KLSA 5D3DA 2F0VA 4CJ0B 4H13C 5D65A 1SMYC 2LKVA 2AWNA 1ONLA 2D9UA 4HTHA 3QOJA 3D4WA 4DNRB 2KECA 1TS2A 3V2TA 3SE0A 1JWSD 4ZUIA 1LABA 1VDZA 1ZEQX 1IYUA 3GD7A 3HOXB 3AMUA 4IFDG 3VR5A 5C0XH 3OPOA 3OIPA 5CV6A 1SJED 1W6JA 5HGTA 1HFNA 5FLXL 4M8AA 1HA6A 1PDQA 5I9PA 2N55A 3OHXC 4QUCA 5BN4A 2NVQB 1STGA 2R7ZB 2R3ZA 3IAYA 3Q23A 4ZUJA 5T1IA 1JE4A 2Q8TA 1SE4A 3I70A 2F0GA 2ICEC 1CQVA 4LK1C 3PV0A 3QO2A 3T56B 3BDLA 3HEJA 2L4NA 1I6HB 4BY1B 3M7NA 2XRSD 3TN2A 1J9OA 2F0UA 2FHTA 4KY6A 1G91A 4TKOB 3VR2A 2IJ0A 1K8MA 5JEAJ 5CV4A 1WD0A 1MI2A 1RJTA 2JE6I 1ESFA 1U4MA 3VYRA 1S5ED 2EPBA 3VYSA 4G57A 4X3UA 3BVZA 4RCOA 3A7LA 1EY0A 1BCPD 3VYUA 2WAQB 5KGUA 1UAPA 1Z6HA 1PRTB 1QB5D 4S3SA 4KKSA 1TWFB 1V1PB 3RZOB 5M9OA 3U9OA 2Z1CA 2F0HA 1NR4A 4KKUA 1WTVA 1W6KA 5CBAE 1SSOA 3K5NA 4HCSA 5EQ0A 2NVTB 3NTIA 1KAAA 5KYIA 1PYWD 3T16A 4XIGS 2PW5A 2R93B 1A15A 4XT3B 5KYLA 3IFTA 1KDAA 1XYIA 2ID0A 5JVH3 3VR3A 1GUTA 1LT4D 2PCFB 3VA5A 3ERQA 1SBBB 2F3WA 1LTRD 2JEAI 2WACA 3KBXA 3EROA 5IODA 1UUPA 1D5ZC 2FFKB 4KHVA 4B9WA 2A68D 5K36H 4RA8A 4OO1I 4K5WA 4L8JA 2NUCA 3L9AX 5EJWA 3HGBA 2FJ2A 1NCVA 1QE6A 3SHLA 4ZRZA 3FMCA 1RTNA 3NE5B 1HXYD 4B08A 1IKMA 5E1FA 2KA7A 2I07B 3PUXA 4HSPA 1EZ6A 3Q0AA 2M2LA 1YNND 2BDNA 1RTOA 4Q0FA 1IYVA 2A69D 2JYOA 1OXXK 3J7AF 2VXWA 4KI0A 3DMUA 2FMCA 3RD4A 1XX8A 2OXPA 4PV1C 1CHQD 2CW0D 5FK9C 1F2LA 2XWJB 3D6CA 3PUZA 2VUMB 3N6RA 2PO4A 2EYPA 3V05A 3EVQA 4K2KA 4IUNA 4EGVA 2KHSA 4DK0A 3DEPA 2G9HD 2YU9B 1O7ZA 2WP8J 4KY5A 4WJWA 1L0YB 2MPMA 3D3RA 1QILA 2AQ1B 1I4QA 5KNBA 2JA8B 4BA2I 2XWBB 2BA1A 1H9MA 3M4OB 2KUMA 2E2JB 4H44C 3Q22A 3NBHA 2AQ2B 1VF7A 4CHTB 1LT5D 4CKBA 4R8IA 1RD9D 3BG3A 4XT1B 2EYHA 1PTOB 3QWNA 3RLFA 1HHVA 1QNKA 3H3VC 2JSOA 3BS1A 1FNWA 2EYOA 4QIWB 1HUNA 1RCVD 1DOKA 4L6TB 4HMIA 3GTMB 4XYOA 4LJZC 3SK4A 1FGBD 1AW7A 1D5XC 3A56A 5DEHA 1B1ZA 2F0EA 4C1NI 4PMWA 5BN5A 3DXJC 3MXNA 3ONAB 2R61A 3DUZA 1F9QA 1J8IA 1JC7A 3Q24A 1MSGA 4X3TA 3GTGB 2OT2A 1EY9A 5EBDA 5JJZA 1VF5C 2X69A 3FVQA 5EPKA 3RMHA 5EKLA 5CBEE 3P20A 4H7BA 2IW3A 4RH6A 1K83B 3J7AV 5C3WA 1B4OA 1EYAA 1I50B 4ME5A 2E2DC 4BY7B 1PZID 1BF4A 2J4XA 1CQFA 2RA4A 1JWUD 4E6IA 5HURA 4QUFA 1U4PA 1DCZA 4CKCA 2KCNA 2B39A 3D8GA 2HCCA 4DNTB 5ISRA 3FRPB 2X6LA 5J22A 3HRZC 5C5MA 1KDCA 2DNEA 5CC4A 4ILWA 2NB0A 4JK1C 3W3AA 1IL8A 3GQBA 5C44B 3M4YA 1MGSA 3T51B 2Q8RE 1OXVA 1D1IA 4K6LA 4G7ZC 4RWSC 1G291 5M5XB 2F0PA 1TWCB 1TWGB 1VMCA 1A6XA 4I7ZC 3ND9A 1IKLA 3X3NA 3NSWA 2AUJD 3FKIB 1TIID 2R92B 1R9TB 1GHKA 1Y1VB 3P1HA 4IUPA 1LO5D 1TVXA 2QCPX 1SEBD 1WTXA 2JA7B 5A2QE 3CKIB 1ENFA 2B2UA 1HPCA 4TSSA 4DAYA 1RDPD 3TP7A 2B2VC 5E4XA 4J6HA 5DM63 2XVSA 1B44D 3K7AB 4BWGB 2RBMA 5CORA 2K33A 2DY8A 4IFDJ 2KVMA 1STYA 1EWCA 4FNFA 2BA0A 1BDOA 1G2SA 2C9OA 1CFMA 5FKAC 1B9MA 3K57A 3PO2B 1EQVA 3JAME 1EWHA 2OEOA 3HOWB 3SK8A 1X3QA 5C4XB 1JWMD 4X3SA 2B2WA 4A3MB 1HRJA 1T5XD 4XYQA 1D6EC 1LACA 1PRTD 2KOLA 3MA2B 1EEID 3NQIA 1FNUA 5KNCA 4C1NK 2H4OA 3M7GA 2EOTA 3G7LA 1EY8A 5C3EB 2CQAA 1WD1A 2B2VA 1Q90A 3CRKC 3A8KE 4FF4A 2B2YC 4OGQC 3OMCA 3DHQA 4V0BA 5C4ZA 3EQLC 3NBIA 4Q5VA 1A3TA 5IT9L 1QWYA 3K5MA 3LX0A 3FDTA 4FXKC 1AZQA 1EOTA 4HAEA 4C3JB 1U4LA 3U9SA 4OO1G 3J80L 1QG7A 1Y8NB 2LMCB 3OSOA 2E2IB 2K6AA 5ELEA 1TKWB 1ZXTA 4UAIA 3ZYYX 4ZLTF 3GO5A 3I3CA 2XIWA 4A3KB 3IL8A 2L0CA 1TS4A 5IIFA 2E75C 5FO8B 1AN8A 2B2YA 2BE5D 5IGEA 2IX0A 1TR5A 2L11A 3KF8A 1B53A 3HZXA 3PMFA 4QF4A 1S5DD 3K5LA 5IGFA 2OF1A 1AZPA 3MXUA 5C4JB 3S1RB 3FEWX 3CHBD 4FXDA 2K5QA 3KUPA 5DNFA 1BUVT 5EGTA 3MWYW 4UDUC 2TMPA 3DWQA 1OXUA 4CGYB 5FLXE 1STHA 1FNVA 1E0BA 3GTKB 1O80A 1DD2A 4IFDH 1CZWA 1I6VC 1EY7A 1F9RA 4ZK9B 1ZYRD 2HDLA 5AFWA 3MAQA 3LNNA 4C2MB 2O5IC 2B2TC 2L5TA 4KKTA 3VYTA 4I65A 4DXFA 1PRTF 2JEBI 5CMDA 4GZYC 3MEHA 1G8ZD 1BNZA 1R4PB 1LTID 3C3LA 2F0DA 2JA5B 2WKCA 1OO9B 5IGDA 3PIO3 3WDNA 4RGTA 4X3KA 3C2PA 1EY6A 1WTWA 3I72A 2BCOA 2WIIB 3S17B 2EY2A 4LAAA 3GTJB 1V8QA 4C3JG 2KEDA 3KBGA 2B2TA 3NPPA 5M5WB 1RHPA 1ICWA 3H6MA 2PYKA 2F0JA 1VCIA 1D1KA 4FXGC 1Z7TA 3S9WA 3I73A 4F87A 4L63B 3HOYB 5ELFA 1LLRD 1GJXA 3VR6A 4HR7B 2B63B 4K14A 4G7HC 1LT3D 3UI2A 1R4QB 3J81L 5F2DA 4DAPA 3S14B 4ZKBB 4K5XA 2Y0SB 1U4RA 2F0SA 1F9SA 3NUCA 3TDQA 4IUUA 3T4AC 1SYBA 4TQUS 5JEAG 3SR1A 5I9OA 1MD2D 3S16B 2H1EA 4NKLA 4HCEA 3EJIA 4KN4C 3LWUA 1Q3LA 4EQNA 4F8MA 4K6DA 5EKIA 1I4PA 5NUCA 2K05A 4DK1A 2ZXPA 1KNAA 1NUCA 1KTKA 3H09A 1JICA 3K5OA 4FF3A 3SK6A 2EVBA 1JR0D 1EY5A 3CU7A 4ZAIA 1ENCA 4C3IB 1U9RA 5ELBA 1RKNA 3TSSA 4NDXA 3P7JA 1ILPA 3TZUA 1BQQT 1PTOF 3T53B 4P2CB 2NTSA 2Z8LA 1Y69U 3S15B 3OWFA 1I3QB 5KRUA 2A73B 1TT2A 1KLUD 1JORA 4PNYA 3BYYB 1RODA 4A93B 2Z4HA 4NP5A 3IKJA 5I6WA 1SE2A 3R3OA 2A6ED 4N9TA 1BCPC 4DU9A 2D2CC 3A7AB 1UEAB 1B3AA 1LTTD 1FYCA 3TMEA 4NW2A 1BCPB 2NBFA 2L55A 4WORA 2F1MA 4IN3A 2L1BA 2EJGC 4HN7A 1LTBD 3OIQA 1DJRD 5I4DA 2EYLA 4FVMA 1BBXC 1OXSC 2F0KA 3I90A 4KD3A 2F3VA 3FPPA 4J8QA 2LFNA 1HA5A 4U673 1TY2A 1M4VA 5CV9A 3TP8A 4FF2A 4M1UB 4OIKA 1BOSA 4QCLA 2PZWA 1NSNS 1DXMA 4XQNA 2L9HA 4ZYSA 4RGOS 1CA6A 1ESRA 1SXTA 2A68C 2SNSA 2M9VA 2ZXOA 1Q8IA 1STEA 3R2IA 1SNMA 2O4XA 1S5BD 1TWHB 1SNQA 1EL0A 3QB3A 4YIJA 2PZUA 4RFBA 1A2UA 2O2LD 5FO7B 3GTOB 3VA7A 4C3IG 1SMYD 3DEOA 4V190 2PMZB 5EKKA 3S2DB 3W2DA 4KK7A 1SJHD 1YNNC 1BO0A 2A69C 1ZKOA 1JOQA 1DOMA 3ND8A 2VB3X 1AFPA 3RZDB 1PFMA 3S1NB 1B2TA 2CW0C 2FINB 5G3LF 2DNCA 1Y8OB 2MP1A 4RHSA 1Y8PB 2NN6G 1KABA 1DM0B 3R2TA 4F88A 2HDMA 1JCKB 2LY7A 2VB2X 1QJOA 3AB9A 1CI3M 3TP6A 2PW7A 4RGMA 5M5YB 2QF7A 2SDFA 4FYDA 3I4NB 1B50A 2F4IA 2EYMA 5A2QL 3GV6A 5CV5A 1KNEA 3K0YA 3NWTA 3URYA 2KEEA 5COYA 2LS01 3TBIB 1S5FD 5KNDA 4U68A 2WINB 5J1ZA 3PIP3 1X3PA 1MBYA 1EFID 4XXEA 4DAVA 1I4RA 5CR3A 3WOEA 2XN9C 2A6EC 4HSVA 3G6JB 4BA1I 3KLSX 1IHZA 2EY5A 2NZ1D 5JAVA 4A3GB 2O5JC 1L0XB 2CVRA 3D31A 1SYGA 1EU3A 4KD4A 1PTOH 5ELCA 2PPBC 2F0TA 4G4KA 1D2BA 3NTKA 2RQXA 1SNOA 3BVGA 4C3HB 1SYFA 1HCZA 5C3XA 4DF7A 1S5CD 5E4WC 3K59A 1CZGA 1EYCA 4B9XA 4DFAA 1EZ8A 2J7ZA 1GUSA 1SYCA 2A5HA 1PMRA 4CJ1B 3GTPB 5BN3A 2ENBA 1CT1D 1V1OA 3E6ZX 1LT6D 3GP7A 3NHHA 2ZXRA 3J7YW 1EYDA 5C0XG 2RDHA 2X6GA 4RKBA 1B9NA 5D14A 3NK9A 2NWGA 3E0JA 1H9RA 1EIGA 2IL8A 2K01A 4PMCA 3MXPA 3QG1A 1A3VA 4KHZA 4Y7NB 2IPKD 5I2XA 2KCCA 3HP3A 1F2YA 2RDFA 2F0MA 2MUYA 1LTSD 3I8ZA 4XTCS 3BDOA 1I4XA 4ULLA 5T1GA 2M00A 5IT9E 3F2UA 4QMGA 2DN8A 3MXGA 4K8IA 2VNUD 2NN6I 4XQQA 3H91A 1ENAA 1EEFD 5JPNC 2B8GA 5TSSA 4C56C 4CBVA 1H9SA 1WTOA 3GV3A 1H9KA 1XWEA 3S1MB 3J80E 1T5EA 1SNCA 2EYFA 3EFXD 1ET6A 1VMPA 3HOVB 3K6OA 1V43A 4O42A 1PFNA 2R6GA 4OIJA 3L3OC 3D4RA 4OO1H 3M85A 4OL7A 3V96A 4MIUA 4KMUC 1IW7D 2K1BA 1GXDC 5EPJA 1D5MC 2WV6D 5ELDA 4C3HG 1WCMB 5LL6S 2K5WA 1CM9A 2J0TD 1CA5A 3SVMA 1WTQA 3T13A 5JVG3 1HFGA 1QOHA 3EA6A 1XTCD 5J39A 3IFDA 4HMJA 4ZKCB 2EJFC 3TZDA 4LMQD 1PTOD 3HOUB 2N88A 3DWAA 3C46A 2GA4B 1GUOA 3MFGA 1Z47A 2FMMA 1K8OA 1AP0A 4KJOA 2K03A 1C8CA 3SK5A 2EY1A 2AQ3B 4DA2A 3LWEA 5A35A 1WVLA 1EY4A 4BBRB 3N52A 3D6WA 4RCNA 4DXGA 4A3BB 1PRTC 1DYQA 4IZ8A 5DAUA 1OXTA 2G9DA 4ZQ3A 5KIXA 5K36G 2IX3A 4R9WA 1SNPA 3C1EA 2C5CA 3HOZB 3GTQB 5E3FA 1STBA 3M3YB 2F0IA 4RAUC 5C0XI 4NMZA 3OW7A 3OMGA 4MN3A 1EIHA 1HUMA 3PUWA 2F0OA 4RKLA 2V4DA 1LTGD 2ICIA 5C4HA 1YNJD 4K5VA 4H0LC 2MJ8A 4EQOA 2JXMB 4R8NA 3MC0B 5IOCA 3A8JE 4KV6A 3PUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMC B;  5KNB A;  2QF7 A;  3L7Z C;  4DK1 A;  4BA2 I;  3MFY A;  1TKW B;  2K7V A;  3I72 A;  3P20 A;  5C0X G;  2BA1 A;  5BN4 A;  3FPP A;  1E2W A;  2E74 C;  2K33 A;  4XIG S;  1H9M A;  1B9N A;  2EVB A;  3IFT A;  4H44 C;  1H9R A;  2AUK A;  1E2Z A;  1BDO A;  2BA0 A;  2E75 C;  2EJF C;  3SDZ A;  3VR3 A;  3I4L A;  3A8I E;  1VF7 A;  4KN7 C;  4OO1 H;  1CFM A;  1V8Q A;  1GUT A;  2PCF B;  2BE5 D;  1B9M A;  3QG1 A;  3BG3 A;  4KHZ A;  2BE5 C;  4LK1 C;  1CTM A;  3PV0 A;  5KND A;  2KCC A;  2A6H D;  3T56 B;  1DXM A;  2JEA I;  2ZT9 C;  1O7L A;  1GUO A;  2EJM A;  1EWH A;  1K8O A;  1O78 A;  3M7N A;  4IQZ A;  2A68 D;  3TZU A;  5K36 H;  2A68 C;  3KLR A;  4XTC S;  3BDO A;  4L8J A;  5A35 A;  1Q1E A;  1GHJ A;  1H9S B;  2E76 C;  3T53 B;  2A6E C;  4TKO B;  3VR2 A;  1Q1B A;  1LAC A;  4BA1 I;  1K8M A;  3RLF A;  3MXU A;  4RCN A;  1Y69 U;  1TU2 B;  1DCZ A;  2O5J C;  3HGB A;  1FR3 A;  2DN8 A;  5KNC A;  3D31 A;  1VCI A;  4G7O C;  1Z7T A;  1H9J A;  2YYZ A;  2JE6 I;  2NN6 I;  2PPB C;  1OXT A;  3I73 A;  3PUV A;  1OXU A;  3VA7 A;  5K36 G;  2B8G A;  4DNT B;  3FMC A;  3NE5 B;  3IKJ A;  1H9S A;  2AWO A;  1GJX A;  3VR6 A;  1H9K A;  1Q12 A;  1SMY C;  1Q90 A;  3CRK C;  4H13 C;  2KA7 A;  3PUX A;  4LJZ C;  1HQM C;  3A8K E;  4HR7 B;  2Q8I B;  2A6E D;  1IW7 C;  1HCZ A;  1T5E A;  1ONL A;  2DNE A;  1DD2 A;  4G7H C;  1YNJ C;  1GUG A;  4OGQ C;  4JK1 C;  4IFD H;  3QJY A;  1YNN C;  3A7L A;  2A69 D;  3W3A A;  1IYV A;  1OXX K;  3GQB A;  2D5D A;  1VF5 C;  2NN6 H;  1I6V C;  1ZKO A;  2A69 C;  3VR4 A;  4DNR B;  3M4Y A;  4KI0 A;  3T51 B;  5JEA H;  1V43 A;  1OXV A;  3OW7 A;  4G7Z C;  2R6G A;  3ND8 A;  3LNN A;  2O5I C;  1ZYR C;  2D2C C;  1G29 1;  1HTP A;  1GUS A;  3EQL C;  3H94 A;  3A7A B;  1GUN A;  2L5T A;  3SE0 A;  4PV1 C;  1PMR A;  4KKT A;  1FYC A;  3D4R A;  1LAB A;  1VDZ A;  2CW0 C;  1IYU A;  3CRL C;  1Z6H A;  3QIA A;  3OOC A;  3GD7 A;  3PUZ A;  5BN5 A;  4I7Z C;  3ND9 A;  3DXJ C;  3PUW A;  5BN3 A;  2D62 A;  3M85 A;  1A6X A;  3N6R A;  2V4D A;  1E2V A;  2DNC A;  2JEB I;  4KMU C;  2B8F A;  1Y8O B;  4IFD G;  3VR5 A;  2F1M A;  2IT1 A;  4JBW A;  1IW7 D;  2AUJ D;  1Y8P B;  2EDG A;  4KKS A;  5C0X H;  2NN6 G;  3OPO A;  2EJG C;  4GZY C;  4TQU S;  5JEA G;  1GHK A;  4DK0 A;  4H0L C;  1QJO A;  2JXM B;  4KKU A;  2K32 A;  4KN4 C;  3AB9 A;  1CI3 M;  2PNR C;  3U9S A;  3LWU A;  1OXS C;  1HPC A;  2BDO A;  4OO1 G;  3WDN A;  3A8J E;  3PUY A;  2A6H C;  1Y8N B; 
#chains in the Genus database with same CATH topology
 2NVX B;  2K04 A;  1X32 A;  4YWM A;  3E5S A;  2EE1 A;  3WOF A;  1TS5 A;  3K7U C;  2K7V A;  4KY7 A;  3U50 C;  3HOV G;  4C3J H;  1V1P A;  3D0F A;  4XDX A;  4DUZ L;  3CQZ B;  1HR0 L;  4DN4 M;  1GOZ A;  4OWW B;  1F2M A;  5IYD G;  3I91 A;  3AQQ A;  2QKI C;  1QZH A;  1K8A C;  1XMQ Q;  4KTA A;  2AUK A;  3SDZ A;  2B29 A;  1T9H A;  4MNO A;  2E2I H;  4IFD I;  3OW2 A;  1KRT A;  4ABN A;  2BE5 C;  4A3C H;  2I46 A;  3QOL A;  5IGC A;  1PFB A;  2EYJ A;  2A6H D;  3D4D A;  5K5P A;  2ZT9 C;  4OHJ A;  5JOB A;  4A3K H;  3J81 E;  1WCM G;  1PH1 A;  4QJF A;  1J5E Q;  3KLR A;  1Q1E A;  1WTR A;  1UNS A;  2E76 C;  3NTH A;  1GUW A;  4EQP A;  1WTP A;  3EBE A;  2ZJP A;  1TU2 B;  1S3O A;  3BZD B;  2NTT A;  1Q82 C;  4A75 A;  1VQA A;  2YTX A;  1D8L A;  3ULL A;  1QZG A;  2AWO A;  3CW2 C;  5C4J H;  1E3P A;  4IUT A;  3S1R H;  3KOJ A;  1PYB A;  5IGG A;  2RVL A;  1IW7 C;  1UWV A;  3MHB A;  5LMN W;  1WI5 A;  2HCI A;  5G3L D;  5I2Y A;  1W3S A;  1STN A;  2RSO A;  2D5D A;  2XRQ D;  2B3G A;  3VR4 A;  3X3M A;  5JEA H;  4A3I B;  4DV2 L;  1QCB D;  3HKZ B;  1ZYR C;  4BBR G;  1GUN A;  3NWS A;  1C48 A;  3GTK H;  4JG2 A;  4A3B G;  3CP0 A;  3S2H B;  2D62 A;  4LF5 L;  1PVO A;  1BCP F;  3MEF A;  3J81 c;  5IP9 H;  4K0K Q;  2WB1 B;  1QNU A;  4IAL A;  4A4I A;  2PQE A;  1TY0 A;  4C2M H;  1KL9 A;  2WKD A;  3R8B A;  2DJG C;  2E2H B;  5M3F B;  3UDX A;  4EVO A;  1W2B A;  1PTO C;  3HOZ G;  1PXU A;  2KJX A;  1AE2 A;  3FP9 A;  5LHY 1;  1BXT A;  2BDO A;  1II3 A;  4F7X A;  4GNX C;  4J1M A;  2IWH A;  1SRU A;  2HQE A;  2NVY B;  2CHB D;  2L12 A;  3G71 A;  4FF1 A;  1PZK D;  4A3J B;  2ATW A;  1E2W A;  2JA5 H;  4JI0 L;  4GNX B;  4A3E B;  3A55 A;  1XNQ Q;  4DR7 Q;  1CHP D;  2MFI A;  2KQ3 A;  3RLO A;  1S4Z A;  3I4L A;  4KN7 C;  1KAW A;  3NXW A;  3NQT A;  1CTM A;  4MTN A;  4HED A;  1C9O A;  3S17 H;  1F77 A;  1A2T A;  1KDB A;  2K28 A;  1DZ1 A;  4UHV A;  3SXH A;  2BH8 A;  4JI6 Q;  4IQZ A;  3GTJ H;  4AYB E;  4PMB A;  1GHJ A;  2HUG A;  3C1F A;  1JOO A;  3H0G B;  1Q1B A;  2JA6 B;  4IUQ A;  1HQR D;  5CV8 A;  4QB4 A;  1VQG A;  4PZ6 A;  4UP8 A;  1FR3 A;  4RGN A;  2K5D A;  2HIX A;  2QIL A;  3U4Z A;  1H9J A;  2EXD A;  4LUV A;  3ITP A;  2F0N A;  5AJ3 L;  4DR4 L;  4JI5 L;  1YBY A;  2HQL A;  4L5T A;  5M5W H;  4A3D B;  1Y1W B;  4X6A H;  1I4H A;  5DM7 3;  3TP5 A;  4PZ7 A;  2NYZ D;  4GNX A;  1Q12 A;  1HZA A;  4MHE A;  3PO3 B;  4BBS B;  4LF8 Q;  1ET9 A;  1YNJ C;  3GTL B;  1ILQ A;  1GUG A;  1VQO A;  1VQJ A;  5D3I B;  3HOY H;  4JV5 Q;  3BVM A;  2RKS A;  1FD7 D;  4WRD A;  3H94 A;  4CJ2 C;  4X65 L;  2HHH Q;  1ICF B;  5EPL A;  2B63 H;  4QGU A;  3QIA A;  5KEE A;  2TSS A;  3OOC A;  4K2L A;  1JB3 A;  4DV1 Q;  4DV7 L;  1SYD A;  1E2V A;  1CK1 A;  2B8F A;  5C6A A;  2EDG A;  2F0F A;  1I4G A;  5JPM C;  5FLM G;  4ODG A;  4X66 L;  3S1Q B;  1M8A A;  1XXG A;  3S14 H;  2YTV A;  3I4O A;  3MZ5 A;  3NP8 A;  1N32 Q;  3KF6 B;  2K32 A;  2F0W A;  3OWE B;  2PNR C;  5GAD C;  3STB D;  2A6H C;  2F0L A;  4YCU A;  1A3U A;  4IOA A;  4LF4 Q;  3L7Z C;  1YHB A;  4JVZ A;  1DOL A;  4A3I G;  3S16 H;  3SEB A;  3HKZ G;  1JQY D;  4CDC C;  3AFQ A;  4IPG A;  4ZCK A;  2XSC A;  1K3R A;  2B2U C;  2IX1 A;  4KJN A;  2EXZ A;  1SYE A;  3VDY A;  1SND A;  3A8I E;  4RHR A;  1E22 A;  5I6Y A;  2QEJ C;  1G2T A;  2WB1 G;  4X62 L;  2EZV A;  1HTL D;  1SE3 A;  4CKE A;  2MGS A;  1LTA D;  3Q6S A;  1O7L A;  4QL5 A;  5FO9 B;  1AEX A;  5M3F G;  1CSQ A;  2SOB A;  5M3M B;  3GDE A;  4BS9 A;  4FO2 A;  2SNM A;  3CCQ A;  4P72 A;  5C0X J;  1F2Z A;  4C3I H;  1O7I A;  1PZJ D;  4Z9C B;  1HJP A;  3KF6 A;  4A3J G;  3MVV A;  1G6Z A;  2ZM6 L;  4A3E G;  1G6P A;  1C4Q A;  2EY6 A;  5IGB A;  2B2W C;  3A74 A;  3P75 A;  1NR2 A;  3PUV A;  4DR1 Q;  3T1Y L;  1KLG D;  2DY7 A;  3K80 C;  1MSH A;  5GQO A;  3TRE A;  1N34 L;  3S15 H;  1I3Q H;  4IUR A;  4DV5 L;  1HQM C;  2QDB A;  2Q8I B;  1SFO B;  3E9I A;  3K58 A;  3QJY A;  3A54 A;  2K4K A;  5IP7 H;  2NN6 H;  2NZH A;  3JAM L;  4A93 H;  4IUV A;  2GVA A;  2A1A A;  1Q46 A;  4X64 Q;  1HTP A;  3H0G G;  2JA6 G;  3PQI A;  2F4V L;  1DON A;  1RF2 D;  4PQX A;  3CRL C;  1IBM L;  2ZTD A;  3AU7 A;  1FJG Q;  4DGZ A;  5CYU A;  1JOK A;  3BDC A;  4AYB B;  5CGK A;  2IT1 A;  4JBW A;  2XNA C;  1BR9 A;  2VQF Q;  1F9P A;  4A3D G;  1Y1W G;  4GOP B;  2UXD Q;  4K8J A;  4ID6 A;  1YIT A;  3H3V H;  3PO3 G;  1EU4 A;  4LFA Q;  4XQJ A;  3F2B A;  2L15 A;  4BBS G;  3ICE A;  2JN4 A;  4L5R C;  5CV7 A;  1WOC A;  2RCF A;  3MFY A;  3KDF B;  1TQO A;  2E5L Q;  2SEB D;  3DM1 A;  4DV3 L;  2E74 C;  5FOB B;  1PLF A;  2F03 A;  1HNX L;  3E0E A;  2PZT A;  1X56 A;  2MHV A;  2Z4I A;  4TRD A;  3DWP A;  1EQT A;  4A3F B;  2JP1 A;  1E2Z A;  2F0Q A;  1XPO A;  4J15 A;  2WAQ E;  2BOS A;  5EBC A;  3BYT B;  5LL6 X;  3FPU B;  1B7Y B;  1ML0 D;  2A74 C;  1LV9 A;  3I4M B;  2EJM A;  1PFS A;  4FP5 D;  1O78 A;  2RDG A;  3HS0 C;  2F52 A;  4TVA B;  5C5L A;  3H15 A;  1TS3 A;  2UUC L;  3O13 A;  1WYD A;  4B3T Q;  1H9S B;  4N9P A;  4GOP A;  3KK7 A;  3MTS A;  3R93 A;  1STA A;  1TWA B;  1O7Y A;  4G7O C;  1SAP A;  2YYZ A;  1NAP A;  2RSN A;  1A0I A;  3E9H A;  4JW0 A;  4DV6 L;  3KDF A;  4WFN 3;  1SN8 A;  3RUZ A;  3HG9 A;  4O1N A;  1SDF A;  3JAM c;  3KLS A;  5D3D A;  2F0V A;  3NEL A;  4Y52 H;  4CJ0 B;  1EUJ A;  4H13 C;  5D65 A;  1SMY C;  1TWH H;  2LKV A;  4YCV A;  2AWN A;  4JI1 Q;  1ONL A;  2D9U A;  4HTH A;  3QOJ A;  5M3M G;  3D4W A;  4DNR B;  2KEC A;  3GTO H;  1TS2 A;  3V2T A;  2G5D A;  1YIJ A;  3SE0 A;  1EWI A;  4NXN L;  1VQ6 A;  1JWS D;  3S2D H;  4ZUI A;  1LAB A;  1VDZ A;  1ZEQ X;  1IYU A;  3GD7 A;  4MZ9 A;  3HOX B;  4JCV E;  1SRO A;  4GS3 A;  3AMU A;  4IFD G;  3VR5 A;  1HNW Q;  5C0X H;  3OPO A;  3OIP A;  1X3E A;  3OYY A;  1SJE D;  5CV6 A;  1Q8K A;  1W6J A;  3I55 A;  3RZD H;  1XNR Q;  2ZTE A;  3CMA A;  3S1N H;  2D0P A;  5HGT A;  1HFN A;  1JMC A;  5FLX L;  4M8A A;  4OX9 Q;  1HA6 A;  1PDQ A;  5I9P A;  2N55 A;  3OHX C;  2OQK A;  4HJ7 A;  4QUC A;  1DGS A;  4UP7 A;  5BN4 A;  3G6E A;  2NVQ B;  2AMC B;  1STG A;  2R7Z B;  2R3Z A;  3IAY A;  3Q23 A;  1SE8 A;  4ZUJ A;  5T1I A;  1JE4 A;  2Q8T A;  4AYB G;  1SE4 A;  3I70 A;  5M5Y H;  3CAM A;  2F0G A;  2ICE C;  1CQV A;  4LK1 C;  3I4N H;  3PV0 A;  3QO2 A;  3T56 B;  2DJF C;  3BDL A;  3HEJ A;  2L4N A;  1I6H B;  4BY1 B;  3M7N A;  2XRS D;  1EQQ A;  3TN2 A;  4YHH L;  3U58 A;  1J9O A;  2F0U A;  2FHT A;  4KY6 A;  1G91 A;  3B6Y A;  4TKO B;  3VR2 A;  2IJ0 A;  1K8M A;  3CD6 A;  5JEA J;  3BZC A;  2ZJQ A;  4L5Q A;  5CV4 A;  1C0A A;  1WD0 A;  2UXB L;  1MI2 A;  1RJT A;  2JE6 I;  4DUY Q;  1ESF A;  1GD7 A;  1U4M A;  4A3F G;  3VYR A;  4HJ8 A;  2JA9 A;  4PZ8 A;  1E24 A;  1S5E D;  2EPB A;  2ZTC A;  1AE3 A;  1FVI A;  4POG A;  3VYS A;  4A3G H;  4G57 A;  4KHP Q;  1A63 A;  4X3U A;  1Z9F A;  3BVZ A;  4RCO A;  4IO9 A;  3I4M G;  3A7L A;  1EY0 A;  1XMO L;  1BCP D;  4APV A;  3A5U A;  3TS0 A;  3VYU A;  2CWA A;  1Q81 C;  4N8F A;  2WAQ B;  5KGU A;  4C3H H;  1UAP A;  4RG1 A;  3CPW A;  1JJG A;  4DUZ Q;  1Z6H A;  1HR0 Q;  1PRT B;  1QB5 D;  1VQH A;  4S3S A;  3CPF A;  4KKS A;  1TWF B;  1V1P B;  3RZO B;  2ALY B;  5M9O A;  3U9O A;  2Z1C A;  2F0H A;  2EIF A;  3GTP H;  1NR4 A;  4KKU A;  4AQY Q;  1WTV A;  1W6K A;  4QIW E;  3CC2 A;  5CBA E;  1SSO A;  1VQD A;  3K5N A;  4HCS A;  5EQ0 A;  5IYC H;  2NVT B;  4OEM B;  3NTI A;  1KAA A;  2I5L X;  5KYI A;  1PYW D;  3T16 A;  3ER0 A;  4XIG S;  2PW5 A;  2R93 B;  1A15 A;  2N49 A;  4XT3 B;  5KYL A;  2K5H A;  3IFT A;  1KDA A;  1XYI A;  2ID0 A;  5JVH 3;  3VR3 A;  3HOX G;  1IBL L;  4DV0 L;  4P74 A;  1GUT A;  1LT4 D;  2PCF B;  3VA5 A;  3ULP A;  4HJA A;  3ERQ A;  1SBB B;  2F3W A;  2Q2H A;  1LTR D;  2JEA I;  1XTD A;  2WAC A;  3KBX A;  3ERO A;  5IOD A;  1UUP A;  1D5Z C;  4PG3 A;  2FFK B;  4KHV A;  4B9W A;  2A68 D;  2NZO A;  5K36 H;  4RA8 A;  1P16 A;  4OO1 I;  4K5W A;  4L8J A;  2A8V A;  1B8A A;  2NUC A;  4Y7N H;  3L9A X;  4DV2 Q;  3PIO A;  5EJW A;  3LGJ A;  3HGB A;  2FJ2 A;  5HY6 A;  2R7Z G;  1NCV A;  3T1H L;  2E8G A;  1QE6 A;  4LF5 Q;  3SHL A;  4ZRZ A;  3FMC A;  1RTN A;  3NE5 B;  1HXY D;  4B08 A;  1IKM A;  3EIV A;  4P73 A;  5E1F A;  2KA7 A;  2I07 B;  3PUX A;  1KD1 C;  4GKK L;  4HSP A;  1EZ6 A;  3Q0A A;  4DKA C;  2M2L A;  1YNN D;  2BDN A;  1RTO A;  3DM3 A;  4Q0F A;  4DR2 L;  1IYV A;  2A69 D;  4BY1 G;  2JYO A;  1OXX K;  3J7A F;  2VXW A;  4KI0 A;  1MIU A;  3NBH B;  1IZ6 A;  3DMU A;  2FMC A;  3RD4 A;  1XX8 A;  2OXP A;  4PV1 C;  1CHQ D;  5FJ8 G;  3S1M H;  2CW0 D;  2UXC L;  5FK9 C;  1F2L A;  1PH8 A;  2XWJ B;  3D6C A;  3PUZ A;  4JI0 Q;  2VUM B;  3N6R A;  2PO4 A;  4IPC A;  3HOV H;  2EYP A;  3F1Z A;  3V05 A;  2HIV A;  3EVQ A;  4IUN A;  4K2K A;  4EGV A;  2KHS A;  4DR3 L;  1G51 A;  1VQM A;  4DK0 A;  3DEP A;  1X55 A;  4LF9 L;  2G9H D;  2YU9 B;  5IYD H;  1O7Z A;  3PSI A;  2WP8 J;  2CFM A;  4KY5 A;  4WJW A;  1S72 A;  1L0Y B;  1PH4 A;  2MPM A;  2VY3 A;  3D3R A;  1QIL A;  2HD3 A;  2AQ1 B;  1I4Q A;  4JPB W;  5KNB A;  3ULJ A;  4I7A A;  2JA8 B;  4BA2 I;  4UY8 C;  4NXM L;  2XWB B;  2BA1 A;  1BBU A;  3S24 A;  2WAQ G;  3W5O A;  1H9M A;  1WCM H;  2MQH A;  2GN5 A;  2KUM A;  3M4O B;  2E2J B;  4H44 C;  3Q22 A;  2Q2I A;  1K8G A;  3NBH A;  2AQ2 B;  5GAH C;  1VF7 A;  1Y14 B;  1LT5 D;  4CHT B;  4CKB A;  4R8I A;  5AJ3 Q;  4JI5 Q;  4DR4 Q;  1RD9 D;  3BG3 A;  1HR0 W;  4XT1 B;  2UUB L;  2EYH A;  1NE3 A;  4LFB L;  1PTO B;  2N8N A;  3HOU H;  4LFC L;  1J5E L;  3QWN A;  3CF5 A;  4JI4 L;  2OCE A;  3RLF A;  1HHV A;  1QNK A;  1N33 L;  3H3V C;  2JSO A;  4X65 Q;  2ASB A;  3BS1 A;  1K28 A;  4B3S L;  1FNW A;  2R93 G;  4DV7 Q;  2EYO A;  2KCT A;  4QIW B;  1HUN A;  1SLJ A;  1JJC B;  1RCV D;  4BBR H;  1DOK A;  3AFP A;  4L6T B;  3WWV A;  4HMI A;  2I5M X;  4X66 Q;  3GTM B;  2FXQ A;  4A3B H;  4XYO A;  4LJZ C;  1UE6 A;  1YHQ A;  2VQE L;  3SK4 A;  4POF A;  1FGB D;  1AW7 A;  1D5X C;  3A56 A;  1X65 A;  5DEH A;  3ZJY C;  1L2F A;  1L1O C;  4YY3 Q;  3HOZ H;  5L37 A;  1B1Z A;  3GTQ H;  2F0E A;  4C1N I;  4PMW A;  5BN5 A;  3DXJ C;  3M3Y H;  3MXN A;  3ONA B;  2R61 A;  3DUZ A;  2QA4 A;  4RMF A;  1F9Q A;  1J8I A;  1JC7 A;  5LMU L;  4K0K L;  3Q24 A;  4UP9 A;  4X62 Q;  1MSG A;  4X3T A;  1CKN B;  3GTG B;  2OT2 A;  1EY9 A;  3AYH B;  5EBD A;  5JJZ A;  1VF5 C;  2X69 A;  3FVQ A;  5EPK A;  3RMH A;  5EKL A;  1XPU A;  5CBE E;  4JBM A;  3P20 A;  4B3M L;  4H7B A;  3L2P A;  2IW3 A;  4RH6 A;  1EYG A;  1K83 B;  3J7A V;  2VUM G;  5C3W A;  1B4O A;  2NVX H;  1EYA A;  2OTL A;  4DR7 L;  1NY4 A;  1I50 B;  3T1Y Q;  1E1O A;  4ME5 A;  3CQZ H;  2E2D C;  1N34 Q;  4BY7 B;  1PZI D;  4IPH A;  1BF4 A;  3A5Z B;  4DV5 Q;  1NMG A;  2J4X A;  1CQF A;  2RA4 A;  1JWU D;  1GO3 E;  4E6I A;  5HUR A;  4QUF A;  4GLX A;  1U4P A;  2JA8 G;  1DCZ A;  1CKN A;  3F8T A;  2F4V Q;  4CKC A;  3I56 A;  1IBM Q;  2KCN A;  2B39 A;  3D8G A;  1KIX A;  1N36 L;  1B70 B;  2HCC A;  4DNT B;  4DAY B;  5ISR A;  3FRP B;  4GKJ L;  2X6L A;  5J22 A;  4DV4 L;  3HRZ C;  5C5M A;  1KDC A;  2DNE A;  2ES2 A;  3KYH C;  5CC4 A;  4ILW A;  2NB0 A;  4JK1 C;  3W3A A;  1PH3 A;  1IL8 A;  4LNQ A;  3GQB A;  5C44 B;  5FLM H;  3M4Y A;  1MGS A;  2KCM A;  2Q8R E;  3T51 B;  1OXV A;  1D1I A;  4K6L A;  4G7Z C;  4RWS C;  1MHW C;  4HJ9 A;  1K9M C;  1VQB A;  1G29 1;  5M5X B;  2F0P A;  1V9P A;  1TWC B;  1NTG A;  2KBN A;  1VQ7 A;  1TWG B;  1VMC A;  2HHH L;  4DV3 Q;  1A6X A;  4I7Z C;  3ND9 A;  1HNX Q;  1IKL A;  3X3N A;  3CXC A;  2Z6B A;  1JT8 A;  3NSW A;  4NPS A;  2AUJ D;  4A3I H;  1U5K A;  3FKI B;  1TII D;  1KHI A;  2R92 B;  1R9T B;  1GHK A;  1Y1V B;  1NNX A;  3P1H A;  1IBK L;  4IUP A;  1LO5 D;  1TVX A;  2QCP X;  1SEB D;  1WTX A;  4DNI A;  2JA7 B;  5A2Q E;  4LF7 L;  4IOC A;  1NJI C;  3S2H H;  5GAE C;  3CKI B;  3CCL A;  1ENF A;  2B2U A;  1HPC A;  4TSS A;  1RDP D;  4DAY A;  3TP7 A;  4DK6 C;  2B2V C;  5E4X A;  4OWX B;  4J6H A;  5DM6 3;  2UUC Q;  2XVS A;  1B44 D;  3K7A B;  4MTK A;  4BWG B;  2RBM A;  1HZB A;  2E2H H;  5COR A;  5M3F H;  2K33 A;  2DY8 A;  4IFD J;  1ASZ A;  2KVM A;  1STY A;  1EWC A;  4FNF A;  2PQA B;  2BA0 A;  1BDO A;  1G2S A;  2C9O A;  1CFM A;  4DV6 Q;  5FKA C;  3CCU A;  1B9M A;  2JK8 A;  2CH4 W;  2NVY H;  1JE5 A;  4JOI C;  4A3J H;  4DR5 L;  1CUK A;  3K57 A;  1HZ9 A;  4GN4 B;  4DR6 L;  1EQV A;  3PO2 B;  1MKH A;  3JAM E;  4A3E H;  1EWH A;  2RF4 A;  2AHO B;  2OEO A;  3HOW B;  3SK8 A;  1X3Q A;  3NEM A;  4JI8 L;  5C4X B;  1JWM D;  4X3S A;  2B2W A;  3CC7 A;  3CME A;  4A3M B;  1HRJ A;  1T5X D;  4XYQ A;  1SR3 A;  1D6E C;  1LAC A;  1PRT D;  2KOL A;  3MA2 B;  4H02 A;  1EEI D;  3NQI A;  3CCE A;  1FNU A;  1PHJ A;  5KNC A;  4FDB A;  4C1N K;  2H4O A;  3M7G A;  3A0J A;  2EOT A;  2QEX A;  1QVG A;  3G7L A;  3H0G H;  1EY8 A;  2JA6 H;  4BXX G;  1MJE A;  3BJU A;  3W1G A;  5C3E B;  2CQA A;  3Q8D A;  1WD1 A;  1CKM A;  1Q90 A;  2B2V A;  3CRK C;  2OTJ A;  3A8K E;  3K8A A;  5IYB G;  2PQA A;  2UU9 L;  4FF4 A;  3KFU A;  4YWL A;  2B2Y C;  4BY7 G;  4OGQ C;  3OMC A;  3DHQ A;  4V0B A;  5C4Z A;  4A3D H;  1Y1W H;  3PIP A;  2I5H A;  3KJO A;  3EQL C;  3F2C A;  3NBI A;  4Q5V A;  1A3T A;  2YTY A;  3PO3 H;  4BBS H;  3KF8 B;  4JOI A;  4JI7 L;  3GTL H;  5IT9 L;  3RR5 A;  2QGQ A;  1QWY A;  3UDI A;  3K5M A;  1PA6 A;  3UDG A;  3PGZ A;  3LX0 A;  3FDT A;  4FXK C;  1AZQ A;  1EOT A;  4UPA A;  4HAE A;  4C3J B;  2N78 A;  1U4L A;  2VS1 A;  1RL2 A;  3RLN A;  1LTL A;  3U9S A;  2JQO A;  3BZK A;  4OXP A;  1QUQ B;  4YCW A;  4OO1 G;  3J80 L;  1QG7 A;  1CSP A;  3STB C;  4DAM A;  1Y8N B;  2LMC B;  1K3B C;  3OSO A;  2E2I B;  5C44 G;  2K6A A;  3S1Q H;  5ELE A;  4YHH Q;  1TKW B;  1ZXT A;  1KRS A;  4UAI A;  3ZYY X;  4A3L G;  4ZLT F;  1PH9 A;  3GO5 A;  3I3C A;  2XIW A;  2QW7 A;  4A3K B;  3IL8 A;  2L0C A;  1TS4 A;  5IIF A;  2UXB Q;  2E75 C;  1P8L A;  5FO8 B;  1AN8 A;  2B2Y A;  2BE5 D;  1PYS B;  3RN2 A;  5IGE A;  2IX0 A;  4A76 A;  1TR5 A;  1XPR A;  2L11 A;  3FKI G;  2R92 G;  3KF8 A;  1B53 A;  2Y0S E;  3HZX A;  1Y1V G;  3PMF A;  4QF4 A;  1S5D D;  4AIM A;  2JA7 G;  1VQ4 A;  5IWA Q;  1VQ5 A;  1EQR A;  3K5L A;  5IGF A;  3L0O A;  2OF1 A;  1AZP A;  1K73 C;  3J80 i;  3MXU A;  5C4J B;  3S1R B;  3FEW X;  3CHB D;  1QUQ A;  4FXD A;  2K5Q A;  3KUP A;  1PV4 A;  5M3M H;  5DNF A;  1BUV T;  5EGT A;  3MWY W;  4UDU C;  1X3G A;  2TMP A;  3DWQ A;  3PF5 A;  1PH2 A;  1OXU A;  4AH6 A;  4CGY B;  5FLX E;  3CCJ A;  1STH A;  2Z0S A;  1IL2 A;  1FNV A;  1E0B A;  3GTK B;  3PO2 G;  1O80 A;  1DD2 A;  3M4Q A;  4JI2 L;  1UEB A;  2CH4 A;  3F2D A;  4IFD H;  1CZW A;  3HOW G;  2IHF A;  4GLV B;  4OWT B;  1I6V C;  1EY7 A;  1F9R A;  5C4X G;  4ZK9 B;  1ZYR D;  2HDL A;  5AFW A;  3MAQ A;  3LNN A;  4C2M B;  2O5I C;  3M9B A;  4A3M G;  2B2T C;  2L5T A;  4JYA L;  4KKT A;  3VYT A;  4I65 A;  1SFO H;  2R7D A;  1UE1 A;  4DXF A;  2I0Q A;  3NEN A;  3QR8 A;  1PRT F;  2JEB I;  1YI2 A;  5CMD A;  1IBL Q;  1HNZ L;  4GZY C;  3UE1 A;  3MEH A;  1G8Z D;  1BNZ A;  3KJP A;  1R4P B;  1LTI D;  1C7Y A;  3C3L A;  2F0D A;  2JA5 B;  5C3E G;  1M1K C;  2WKC A;  1OO9 B;  5IGD A;  3PIO 3;  4LUZ A;  1MJC A;  4LUO A;  2LXJ A;  3WDN A;  4RGT A;  2WFW A;  4DK3 C;  4X3K A;  4ME3 A;  2OWO A;  3C2P A;  1N9W A;  1EY6 A;  1WTW A;  3I72 A;  2BCO A;  5FLX c;  2WII B;  3S17 B;  2EY2 A;  3OTO L;  4LAA A;  2UUA L;  1IYJ B;  3GTJ B;  1V8Q A;  1FGU A;  1UE5 A;  4C3J G;  4CDD C;  2KED A;  3KBG A;  2B2T A;  4GKK Q;  4A3F H;  1H95 A;  4HIK A;  3NPP A;  4DR2 Q;  5M5W B;  1RHP A;  3W1B A;  3PCO B;  1ICW A;  4A3C G;  3H6M A;  2VW9 A;  3I4M H;  2PYK A;  2F0J A;  1VCI A;  2UXC Q;  1D1K A;  4FXG C;  1Z7T A;  2VL6 A;  3RN5 A;  3S9W A;  4A3K G;  5BR8 L;  5JJK A;  4O0A A;  5LMN L;  3I73 A;  4F87 A;  1I94 L;  4L63 B;  3HOY B;  5ELF A;  4WJ4 A;  1LLR D;  2QDL A;  4OON A;  1KQS A;  1GJX A;  3VR6 A;  4HR7 B;  4HID A;  4LF9 Q;  2B63 B;  1TWA H;  4K14 A;  4G7H C;  1LT3 D;  3HKS A;  3UI2 A;  4IJH A;  4GN5 A;  1R4Q B;  3J81 L;  5F2D A;  3IRB A;  4R4T A;  4DAP A;  3CCM A;  3S14 B;  4LF6 L;  4NXM Q;  4ZKB B;  4K5X A;  1YVC A;  2Y0S B;  1QVF A;  1U4R A;  1VS0 A;  3G48 A;  2F0S A;  1F9S A;  2MO0 A;  3NUC A;  3TDQ A;  4IUU A;  4JI3 L;  3T4A C;  1AH9 A;  1SYB A;  4TQU S;  4GLA C;  5JEA G;  3SR1 A;  4HJ5 A;  5I9O A;  1MD2 D;  3S16 B;  2H1E A;  4NKL A;  4HCE A;  1YJ9 A;  3EJI A;  5ELO A;  4KN4 C;  4CDE C;  2UUB Q;  5H1S E;  1M90 C;  3LWU A;  3HOX H;  1WTH A;  4LFB Q;  1Q3L A;  2OQ0 A;  4AQY L;  4EQN A;  4F8M A;  4K6D A;  1RIP A;  5EKI A;  1I4P A;  5NUC A;  2K05 A;  4DK1 A;  5IP9 G;  4LFC Q;  2ZXP A;  1KNA A;  1NUC A;  2PMZ E;  1KTK A;  4JI4 Q;  3H09 A;  1BBW A;  4OEL B;  3J81 i;  1N33 Q;  1JIC A;  1PH6 A;  3K5O A;  4FF3 A;  3SK6 A;  2EVB A;  1JR0 D;  1YZ6 A;  4B3S Q;  1EY5 A;  4QY7 A;  4B3R L;  3CU7 A;  4ZAI A;  1ENC A;  4C3I B;  1U9R A;  5ELB A;  1TXY A;  2BH2 A;  1RKN A;  1LUZ A;  3TSS A;  1EIY B;  4NDX A;  3P7J A;  2NVQ H;  1ILP A;  1D7Q A;  1I5F A;  2R7Z H;  2GVB A;  3HOU G;  2PNH A;  1E7Z A;  2JA5 G;  5GRO A;  3TZU A;  1BQQ T;  2VQE Q;  1PTO F;  3T53 B;  4P2C B;  2NTS A;  2Z8L A;  1Y69 U;  1OTC A;  3S15 B;  3OWF A;  1I3Q B;  4L5S A;  5KRU A;  1XMQ L;  1I6H H;  4BY1 H;  2A73 B;  1TT2 A;  1KLU D;  1JOR A;  1KXL A;  2DUD A;  4PNY A;  2F3I A;  3BYY B;  1ROD A;  4P71 A;  4A93 B;  2Z4H A;  4NP5 A;  5FJ8 H;  3IKJ A;  5I6W A;  1VQK A;  1YJW A;  1NMF A;  1SE2 A;  5LMU Q;  3R3O A;  2A6E D;  3MXN B;  4N9T A;  4ALP A;  1EFW A;  1X6O A;  2KEN A;  1BCP C;  2CKZ B;  4DU9 A;  5JJI A;  2D2C C;  3A7A B;  1UEA B;  1B3A A;  1LTT D;  1FYC A;  4B3M Q;  1NBW A;  3TME A;  4NW2 A;  1BCP B;  1FL0 A;  3UE0 A;  2NBF A;  4IPD A;  2L55 A;  4WOR A;  2F1M A;  4IN3 A;  2L1B A;  1S40 A;  2EJG C;  4HN7 A;  1LTB D;  3HOY G;  3OIQ A;  3CCV A;  1DJR D;  3J81 j;  5I4D A;  1Q7Y C;  2EYL A;  2MO1 A;  4R4I A;  4LWC A;  2B63 G;  4FVM A;  1BBX C;  1OXS C;  2F0K A;  1TWF H;  1GKH A;  3E3X A;  3I90 A;  4KD3 A;  2HT1 A;  3RZO H;  2F3V A;  3FPP A;  4J8Q A;  2LFN A;  1HA5 A;  2MNA A;  1L1O B;  4U67 3;  1TY2 A;  2Y0S G;  1QVC A;  1M4V A;  5CV9 A;  3TP8 A;  4JC0 A;  1LM0 A;  2EQS A;  4FF2 A;  4M1U B;  1YHA A;  4OIK A;  1BOS A;  1N36 Q;  2NVT H;  4QCL A;  2PZW A;  1NSN S;  5EAY A;  1DXM A;  4XQN A;  4GKJ Q;  2L9H A;  2R93 H;  3CCS A;  1B3Q A;  4ZYS A;  4RGO S;  4DV4 Q;  1CA6 A;  1YEZ A;  1ESR A;  1SXT A;  2A68 C;  2SNS A;  1PH5 A;  2M9V A;  2ZXO A;  3UDF A;  3ERS X;  1Q8I A;  1STE A;  3R2I A;  1SNM A;  2O4X A;  2A19 A;  1VQ8 A;  1K0R A;  1S5B D;  1SMX A;  1TWH B;  1SNQ A;  2ZM6 Q;  1EL0 A;  3QB3 A;  1XNQ L;  4YIJ A;  2PZU A;  4RFB A;  1A2U A;  2O2L D;  5FO7 B;  3GTO B;  3VA7 A;  4LW1 A;  2RCN A;  2K52 A;  4C3I G;  1SMY D;  1L1O A;  3DEO A;  4V19 0;  2PMZ B;  5EKK A;  3S2D B;  4JI6 L;  3W2D A;  1IBK Q;  2PI2 E;  4KK7 A;  1SJH D;  2D0O A;  1YNN C;  1BO0 A;  4LF7 Q;  2A69 C;  1ZKO A;  1JOQ A;  1DOM A;  3ND8 A;  2VB3 X;  1AFP A;  3RZD B;  1PFM A;  3S1N B;  1B2T A;  2CW0 C;  4YY3 L;  2FIN B;  1Q86 C;  3DLL A;  5G3L F;  2DNC A;  2ZJR A;  1Y8O B;  2MP1 A;  4RHS A;  1JJ2 A;  1HH2 P;  1Y8P B;  5IP7 G;  2NN6 G;  1KAB A;  1DM0 B;  4A93 G;  3R2T A;  4F88 A;  2HDM A;  1JCK B;  2LY7 A;  2VB2 X;  4DR5 Q;  4LF8 L;  1QJO A;  2CWP A;  4DR6 Q;  3AB9 A;  1CI3 M;  3TP6 A;  2VUM H;  2PW7 A;  4RGM A;  4JV5 L;  4DPG A;  1HZC A;  4JI8 Q;  2QF7 A;  5M5Y B;  2SDF A;  4HIM A;  4FYD A;  3I4N B;  1B50 A;  2F4I A;  2YU9 H;  2EYM A;  5A2Q L;  1E1T A;  3GV6 A;  5CV5 A;  1KNE A;  5ELN A;  4DV1 L;  3K0Y A;  4P75 A;  3NWT A;  3URY A;  2KEE A;  5COY A;  2LS0 1;  5E7N A;  1GVP A;  1BKB A;  2Q2U A;  2JA8 H;  2V1C C;  3TBI B;  1S5F D;  4KLK A;  5KND A;  4U68 A;  1N32 L;  2WIN B;  5J1Z A;  3PIP 3;  1X3P A;  1MBY A;  3M4O H;  2E2J H;  1EFI D;  4XXE A;  5IE8 A;  2UU9 Q;  4DAV A;  1I4R A;  4LF4 L;  5CR3 A;  3WOE A;  4O2D A;  2CCZ A;  2XN9 C;  4IJL A;  2A6E C;  4HSV A;  3G6J B;  4BA1 I;  3KLS X;  1IHZ A;  5GAG C;  2EY5 A;  2NZ1 D;  5JAV A;  4A3G B;  2O5J C;  1L0X B;  2CVR A;  3D31 A;  1SYG A;  1EU3 A;  4KD4 A;  1PTO H;  5ELC A;  2PPB C;  2F0T A;  4G4K A;  4JI7 Q;  1A62 A;  2XTI A;  3TEH B;  1VQN A;  1D2B A;  4GOP C;  3NTK A;  2RQX A;  1SNO A;  2H5X A;  2K14 A;  3BVG A;  4C3H B;  4GN3 B;  1EOV A;  2Z6K C;  1SYF A;  1HCZ A;  1WFQ A;  5C3X A;  4DF7 A;  1S5C D;  5E4W C;  3K59 A;  1CZG A;  1PH7 A;  1EYC A;  2N3S A;  4B9X A;  4DFA A;  4NXN Q;  1EZ8 A;  2J7Z A;  1GUS A;  1SYC A;  2A5H A;  3GTM H;  1PMR A;  2Q2T A;  4WJ3 M;  4CJ1 B;  3GTP B;  5BN3 A;  2ENB A;  1CT1 D;  4DR1 L;  3JAM i;  1YJN A;  1A8V A;  1V1O A;  3E6Z X;  2Z9H A;  3KLW A;  1LT6 D;  4R4C A;  3GP7 A;  2RHS B;  5HGQ A;  2IY5 B;  3NHH A;  1VQ9 A;  2C35 B;  1XJV A;  2ZXR A;  3K0X A;  3J7Y W;  1EYD A;  4X64 L;  4R4Q A;  1EIF A;  5C0X G;  2RDH A;  2X6G A;  1FJG L;  4RKB A;  3GTG H;  1B9N A;  5D14 A;  3TS2 A;  3NK9 A;  2NWG A;  3U4V A;  2K5N A;  3E0J A;  1H9R A;  2Z6K A;  1EIG A;  1ASY A;  2VQF L;  2IL8 A;  2K01 A;  4EQ5 A;  4PMC A;  2UXD L;  3MXP A;  3QG1 A;  1A3V A;  4KHZ A;  4Y7N B;  2IPK D;  5I2X A;  3CCR A;  2KCC A;  3HP3 A;  1LYL A;  1F2Y A;  1K83 H;  2RDF A;  4LFA L;  3RNU A;  1VQF A;  4NB3 A;  2F0M A;  4JI2 Q;  2MUY A;  1LTS D;  3I8Z A;  4XTC S;  3BDO A;  1I4X A;  2DGY A;  4ULL A;  2E5L L;  4BXX H;  5T1G A;  2K75 A;  2VZA A;  1I50 H;  2M00 A;  5IT9 E;  1IXR A;  4N8X 1;  3CC4 A;  5IYB H;  3F2U A;  3I4N G;  4BY7 H;  4QMG A;  2DN8 A;  3MXG A;  4K8I A;  4JYA Q;  2YV5 A;  2VNU D;  2NN6 I;  1L0W A;  1GM5 A;  4XQQ A;  3H91 A;  1ENA A;  3AEV A;  1EEF D;  5JPN C;  2B8G A;  5TSS A;  4C56 C;  4CBV A;  1H9S A;  1WTO A;  3GV3 A;  1HNZ Q;  1H9K A;  1XWE A;  3S1M B;  3J80 E;  1V1Q A;  2PI2 A;  4R4O A;  1T5E A;  1XMO Q;  3I7F A;  1SNC A;  4B3T L;  2EYF A;  3EFX D;  1VQE A;  1ET6 A;  3I2Z A;  1VMP A;  3HOV B;  3K6O A;  1V43 A;  4O42 A;  1PFN A;  2R6G A;  2CQO A;  1VQP A;  4OIJ A;  3L3O C;  1YNX A;  3D4R A;  3H3V I;  4A3G G;  4OO1 H;  3M85 A;  4OL7 A;  3V96 A;  1VQC A;  3OTO Q;  2UUA Q;  4MIU A;  4KMU C;  5C44 H;  4A3L H;  1J6Q A;  1IW7 D;  2K1B A;  5DLQ E;  2XGT A;  1GXD C;  5EPJ A;  1D5M C;  5M5X H;  1TWC H;  4JI1 L;  2WV6 D;  1X54 A;  5ELD A;  4C3H G;  1TWG H;  5IT9 c;  3HFZ B;  1WCM B;  5LL6 S;  2K5W A;  1CM9 A;  3BU2 A;  5J3B A;  2J0T D;  1CA5 A;  3SVM A;  2K5V A;  1WTQ A;  3T13 A;  3FKI H;  1CKO A;  5JVG 3;  1HFG A;  2R92 H;  1R9T H;  1QOH A;  3EA6 A;  1Y1V H;  1WJJ A;  4EX5 A;  2JA7 H;  1XTC D;  1BVS A;  5J39 A;  3J80 c;  3IFD A;  4HMJ A;  4DV0 Q;  1VQL A;  4YWK A;  4ZKC B;  2LSS A;  1HNW L;  2EJF C;  2JJQ A;  3TZD A;  4LMQ D;  5BR8 Q;  5LMN Q;  1PTO D;  3HOU B;  1I94 Q;  3HKZ E;  2N88 A;  3K7A H;  1VQI A;  1XNR L;  3DWA A;  3FHW A;  5IYC G;  3C46 A;  2GA4 B;  1KC8 C;  4OX9 L;  1GUO A;  3MFG A;  1Z47 A;  2FMM A;  1K8O A;  3M4P A;  1AP0 A;  2K50 A;  4KJO A;  2K03 A;  1C8C A;  3SK5 A;  2EY1 A;  2AQ3 B;  4DA2 A;  2WB1 E;  3LWE A;  3TQY A;  5A35 A;  1WVL A;  5IWA L;  1EY4 A;  4BBR B;  3N52 A;  3K81 C;  3D6W A;  4RCN A;  3PO2 H;  4DXG A;  4A3B B;  1PRT C;  3T1H Q;  1X3F A;  4JBJ A;  4LF6 Q;  1DYQ A;  2KHI A;  3HOW H;  4JBK A;  2P5Z X;  4IZ8 A;  5DAU A;  1OXT A;  2IHE A;  1UE7 A;  5C4X H;  2G9D A;  4QQB X;  4ZQ3 A;  5KIX A;  5K36 G;  2IX3 A;  4A3M H;  1N8R C;  4JI3 Q;  4R9W A;  3SGI A;  5IY0 A;  1SNP A;  3C1E A;  4HIO A;  2KHJ A;  2C5C A;  3HOZ B;  3EN2 A;  3GTQ B;  2LXK A;  5E3F A;  4R1J A;  2R7F A;  1X9N A;  3TRZ A;  3G4S A;  1STB A;  3M3Y B;  2F0I A;  1JB7 A;  4RAU C;  5C0X I;  3J7A 5;  4NMZ A;  3OW7 A;  3OMG A;  2RHQ B;  5C3E H;  4MN3 A;  3J7Z C;  2AKW B;  1EIH A;  4CDF C;  1HUM A;  4DUY L;  3PUW A;  2F0O A;  4RKL A;  2V4D A;  1LTG D;  2ICI A;  5C4H A;  4DR3 Q;  3JC6 6;  1YNJ D;  4B3R Q;  4K5V A;  4KHP L;  4H0L C;  2MJ8 A;  4EQO A;  3PF4 A;  2JXM B;  4R8N A;  3MC0 B;  1K0S A;  5JJL A;  5IOC A;  1U0L A;  3A8J E;  4KV6 A;  3PUY A; 
#chains in the Genus database with same CATH homology
 2NVX B;  2K04 A;  1X32 A;  3E5S A;  2EE1 A;  3WOF A;  1TS5 A;  4KY7 A;  2K7V A;  1V1P A;  4XDX A;  3CQZ B;  4DN4 M;  1GOZ A;  1F2M A;  3I91 A;  2QKI C;  4KTA A;  2AUK A;  3SDZ A;  4IFD I;  4ABN A;  2BE5 C;  2I46 A;  3QOL A;  5IGC A;  1PFB A;  2EYJ A;  2A6H D;  3D4D A;  5K5P A;  2ZT9 C;  4OHJ A;  5JOB A;  3J81 E;  3KLR A;  1Q1E A;  1WTR A;  1UNS A;  2E76 C;  3NTH A;  1GUW A;  4EQP A;  1WTP A;  1TU2 B;  3BZD B;  2NTT A;  2AWO A;  4IUT A;  5IGG A;  2RVL A;  1IW7 C;  3MHB A;  2HCI A;  5G3L D;  5I2Y A;  1STN A;  2RSO A;  2D5D A;  2XRQ D;  3VR4 A;  3X3M A;  5JEA H;  4A3I B;  1QCB D;  3HKZ B;  1ZYR C;  1GUN A;  3NWS A;  1C48 A;  3S2H B;  2D62 A;  1BCP F;  2WB1 B;  1QNU A;  4IAL A;  2PQE A;  1TY0 A;  2WKD A;  3R8B A;  2E2H B;  5M3F B;  4EVO A;  1PTO C;  1PXU A;  2KJX A;  5LHY 1;  1BXT A;  2BDO A;  1II3 A;  4F7X A;  4J1M A;  2IWH A;  2HQE A;  2NVY B;  2CHB D;  2L12 A;  4FF1 A;  1PZK D;  4A3J B;  1E2W A;  4A3E B;  3A55 A;  1CHP D;  2KQ3 A;  1S4Z A;  3I4L A;  4KN7 C;  3NXW A;  3NQT A;  1CTM A;  4HED A;  1F77 A;  1A2T A;  1KDB A;  2K28 A;  1DZ1 A;  3SXH A;  4IQZ A;  4PMB A;  1GHJ A;  2HUG A;  3C1F A;  1JOO A;  3H0G B;  1Q1B A;  2JA6 B;  4IUQ A;  1HQR D;  5CV8 A;  4QB4 A;  1FR3 A;  4RGN A;  2K5D A;  2QIL A;  1H9J A;  3ITP A;  2F0N A;  4A3D B;  1Y1W B;  1I4H A;  5DM7 3;  3TP5 A;  2NYZ D;  1Q12 A;  4MHE A;  3PO3 B;  4BBS B;  1ET9 A;  1YNJ C;  3GTL B;  1ILQ A;  1GUG A;  5D3I B;  3BVM A;  2RKS A;  1FD7 D;  4WRD A;  3H94 A;  4CJ2 C;  5EPL A;  3QIA A;  5KEE A;  2TSS A;  3OOC A;  4K2L A;  1JB3 A;  1SYD A;  1E2V A;  1CK1 A;  2B8F A;  5C6A A;  2EDG A;  2F0F A;  1I4G A;  5JPM C;  4ODG A;  3S1Q B;  1M8A A;  1XXG A;  3MZ5 A;  3NP8 A;  2K32 A;  2F0W A;  3OWE B;  2PNR C;  2A6H C;  2F0L A;  1A3U A;  3L7Z C;  1DOL A;  3SEB A;  1JQY D;  2XSC A;  2B2U C;  2IX1 A;  4KJN A;  2EXZ A;  1SYE A;  1SND A;  3A8I E;  4RHR A;  5I6Y A;  2QEJ C;  1G2T A;  2EZV A;  1HTL D;  1SE3 A;  4CKE A;  2MGS A;  1LTA D;  3Q6S A;  1O7L A;  5FO9 B;  1AEX A;  2SOB A;  5M3M B;  4BS9 A;  4FO2 A;  2SNM A;  5C0X J;  1F2Z A;  1PZJ D;  4Z9C B;  3MVV A;  1G6Z A;  1C4Q A;  2EY6 A;  5IGB A;  2B2W C;  3PUV A;  3P75 A;  1NR2 A;  1KLG D;  2DY7 A;  1MSH A;  4IUR A;  1HQM C;  2QDB A;  2Q8I B;  1SFO B;  3K58 A;  3QJY A;  3A54 A;  2NN6 H;  3JAM L;  4IUV A;  1HTP A;  1DON A;  1RF2 D;  4PQX A;  3CRL C;  3AU7 A;  4DGZ A;  5CYU A;  1JOK A;  3BDC A;  4AYB B;  5CGK A;  2IT1 A;  4JBW A;  2XNA C;  1BR9 A;  1F9P A;  4K8J A;  4ID6 A;  1EU4 A;  4XQJ A;  5CV7 A;  3MFY A;  1TQO A;  2SEB D;  3DM1 A;  2E74 C;  5FOB B;  1PLF A;  2F03 A;  2PZT A;  2MHV A;  2Z4I A;  4TRD A;  3DWP A;  1EQT A;  4A3F B;  2JP1 A;  1E2Z A;  2F0Q A;  2BOS A;  5EBC A;  3BYT B;  5LL6 X;  3FPU B;  1ML0 D;  2A74 C;  1LV9 A;  3I4M B;  2EJM A;  4FP5 D;  1O78 A;  2RDG A;  3HS0 C;  5C5L A;  1TS3 A;  3O13 A;  1H9S B;  4N9P A;  3KK7 A;  3MTS A;  3R93 A;  1STA A;  1TWA B;  1O7Y A;  4G7O C;  1SAP A;  2YYZ A;  1NAP A;  2RSN A;  4WFN 3;  3RUZ A;  3HG9 A;  4O1N A;  1SDF A;  3KLS A;  5D3D A;  2F0V A;  4CJ0 B;  4H13 C;  5D65 A;  1SMY C;  2LKV A;  2AWN A;  1ONL A;  2D9U A;  4HTH A;  3QOJ A;  3D4W A;  4DNR B;  2KEC A;  1TS2 A;  3V2T A;  3SE0 A;  1JWS D;  4ZUI A;  1LAB A;  1VDZ A;  1ZEQ X;  1IYU A;  3GD7 A;  3HOX B;  3AMU A;  4IFD G;  3VR5 A;  5C0X H;  3OPO A;  3OIP A;  5CV6 A;  1SJE D;  1W6J A;  5HGT A;  1HFN A;  5FLX L;  4M8A A;  1HA6 A;  1PDQ A;  5I9P A;  2N55 A;  3OHX C;  4QUC A;  5BN4 A;  2NVQ B;  1STG A;  2R7Z B;  2R3Z A;  3IAY A;  3Q23 A;  4ZUJ A;  5T1I A;  1JE4 A;  2Q8T A;  1SE4 A;  3I70 A;  2F0G A;  2ICE C;  1CQV A;  4LK1 C;  3PV0 A;  3QO2 A;  3T56 B;  3BDL A;  3HEJ A;  2L4N A;  1I6H B;  4BY1 B;  3M7N A;  2XRS D;  3TN2 A;  1J9O A;  2F0U A;  2FHT A;  4KY6 A;  1G91 A;  4TKO B;  3VR2 A;  2IJ0 A;  1K8M A;  5JEA J;  5CV4 A;  1WD0 A;  1MI2 A;  1RJT A;  2JE6 I;  1ESF A;  1U4M A;  3VYR A;  1S5E D;  2EPB A;  3VYS A;  4G57 A;  4X3U A;  3BVZ A;  4RCO A;  3A7L A;  1EY0 A;  1BCP D;  3VYU A;  2WAQ B;  5KGU A;  1UAP A;  1Z6H A;  1PRT B;  1QB5 D;  4S3S A;  4KKS A;  1TWF B;  1V1P B;  3RZO B;  5M9O A;  3U9O A;  2Z1C A;  2F0H A;  1NR4 A;  4KKU A;  1WTV A;  1W6K A;  5CBA E;  1SSO A;  3K5N A;  4HCS A;  5EQ0 A;  2NVT B;  3NTI A;  1KAA A;  5KYI A;  1PYW D;  3T16 A;  4XIG S;  2PW5 A;  2R93 B;  1A15 A;  4XT3 B;  5KYL A;  3IFT A;  1KDA A;  1XYI A;  2ID0 A;  5JVH 3;  3VR3 A;  1GUT A;  1LT4 D;  2PCF B;  3VA5 A;  3ERQ A;  1SBB B;  2F3W A;  1LTR D;  2JEA I;  2WAC A;  3KBX A;  3ERO A;  5IOD A;  1UUP A;  1D5Z C;  2FFK B;  4KHV A;  4B9W A;  2A68 D;  5K36 H;  4RA8 A;  4OO1 I;  4K5W A;  4L8J A;  2NUC A;  3L9A X;  5EJW A;  3HGB A;  2FJ2 A;  1NCV A;  1QE6 A;  3SHL A;  4ZRZ A;  3FMC A;  1RTN A;  3NE5 B;  1HXY D;  4B08 A;  1IKM A;  5E1F A;  2KA7 A;  2I07 B;  3PUX A;  4HSP A;  1EZ6 A;  3Q0A A;  2M2L A;  1YNN D;  2BDN A;  1RTO A;  4Q0F A;  1IYV A;  2A69 D;  2JYO A;  1OXX K;  3J7A F;  2VXW A;  4KI0 A;  3DMU A;  2FMC A;  3RD4 A;  1XX8 A;  2OXP A;  4PV1 C;  1CHQ D;  2CW0 D;  5FK9 C;  1F2L A;  2XWJ B;  3D6C A;  3PUZ A;  2VUM B;  3N6R A;  2PO4 A;  2EYP A;  3V05 A;  3EVQ A;  4K2K A;  4IUN A;  4EGV A;  2KHS A;  4DK0 A;  3DEP A;  2G9H D;  2YU9 B;  1O7Z A;  2WP8 J;  4KY5 A;  4WJW A;  1L0Y B;  2MPM A;  3D3R A;  1QIL A;  2AQ1 B;  1I4Q A;  5KNB A;  2JA8 B;  4BA2 I;  2XWB B;  2BA1 A;  1H9M A;  3M4O B;  2KUM A;  2E2J B;  4H44 C;  3Q22 A;  3NBH A;  2AQ2 B;  1VF7 A;  4CHT B;  1LT5 D;  4CKB A;  4R8I A;  1RD9 D;  3BG3 A;  4XT1 B;  2EYH A;  1PTO B;  3QWN A;  3RLF A;  1HHV A;  1QNK A;  3H3V C;  2JSO A;  3BS1 A;  1FNW A;  2EYO A;  4QIW B;  1HUN A;  1RCV D;  1DOK A;  4L6T B;  4HMI A;  3GTM B;  4XYO A;  4LJZ C;  3SK4 A;  1FGB D;  1AW7 A;  1D5X C;  3A56 A;  5DEH A;  1B1Z A;  2F0E A;  4C1N I;  4PMW A;  5BN5 A;  3DXJ C;  3MXN A;  3ONA B;  2R61 A;  3DUZ A;  1F9Q A;  1J8I A;  1JC7 A;  3Q24 A;  1MSG A;  4X3T A;  3GTG B;  2OT2 A;  1EY9 A;  5EBD A;  5JJZ A;  1VF5 C;  2X69 A;  3FVQ A;  5EPK A;  3RMH A;  5EKL A;  5CBE E;  3P20 A;  4H7B A;  2IW3 A;  4RH6 A;  1K83 B;  3J7A V;  5C3W A;  1B4O A;  1EYA A;  1I50 B;  4ME5 A;  2E2D C;  4BY7 B;  1PZI D;  1BF4 A;  2J4X A;  1CQF A;  2RA4 A;  1JWU D;  4E6I A;  5HUR A;  4QUF A;  1U4P A;  1DCZ A;  4CKC A;  2KCN A;  2B39 A;  3D8G A;  2HCC A;  4DNT B;  5ISR A;  3FRP B;  2X6L A;  5J22 A;  3HRZ C;  5C5M A;  1KDC A;  2DNE A;  5CC4 A;  4ILW A;  2NB0 A;  4JK1 C;  3W3A A;  1IL8 A;  3GQB A;  5C44 B;  3M4Y A;  1MGS A;  3T51 B;  2Q8R E;  1OXV A;  1D1I A;  4K6L A;  4G7Z C;  4RWS C;  1G29 1;  5M5X B;  2F0P A;  1TWC B;  1TWG B;  1VMC A;  1A6X A;  4I7Z C;  3ND9 A;  1IKL A;  3X3N A;  3NSW A;  2AUJ D;  3FKI B;  1TII D;  2R92 B;  1R9T B;  1GHK A;  1Y1V B;  3P1H A;  4IUP A;  1LO5 D;  1TVX A;  2QCP X;  1SEB D;  1WTX A;  2JA7 B;  5A2Q E;  3CKI B;  1ENF A;  2B2U A;  1HPC A;  4TSS A;  4DAY A;  1RDP D;  3TP7 A;  2B2V C;  5E4X A;  4J6H A;  5DM6 3;  2XVS A;  1B44 D;  3K7A B;  4BWG B;  2RBM A;  5COR A;  2K33 A;  2DY8 A;  4IFD J;  2KVM A;  1STY A;  1EWC A;  4FNF A;  2BA0 A;  1BDO A;  1G2S A;  2C9O A;  1CFM A;  5FKA C;  1B9M A;  3K57 A;  3PO2 B;  1EQV A;  3JAM E;  1EWH A;  2OEO A;  3HOW B;  3SK8 A;  1X3Q A;  5C4X B;  1JWM D;  4X3S A;  2B2W A;  4A3M B;  1HRJ A;  1T5X D;  4XYQ A;  1D6E C;  1LAC A;  1PRT D;  2KOL A;  3MA2 B;  1EEI D;  3NQI A;  1FNU A;  5KNC A;  4C1N K;  2H4O A;  3M7G A;  2EOT A;  3G7L A;  1EY8 A;  5C3E B;  2CQA A;  1WD1 A;  2B2V A;  1Q90 A;  3CRK C;  3A8K E;  4FF4 A;  2B2Y C;  4OGQ C;  3OMC A;  3DHQ A;  4V0B A;  5C4Z A;  3EQL C;  3NBI A;  4Q5V A;  1A3T A;  5IT9 L;  1QWY A;  3K5M A;  3LX0 A;  3FDT A;  4FXK C;  1AZQ A;  1EOT A;  4HAE A;  4C3J B;  1U4L A;  3U9S A;  4OO1 G;  3J80 L;  1QG7 A;  1Y8N B;  2LMC B;  3OSO A;  2E2I B;  2K6A A;  5ELE A;  1TKW B;  1ZXT A;  4UAI A;  3ZYY X;  4ZLT F;  3GO5 A;  3I3C A;  2XIW A;  4A3K B;  3IL8 A;  2L0C A;  1TS4 A;  5IIF A;  2E75 C;  5FO8 B;  1AN8 A;  2B2Y A;  2BE5 D;  5IGE A;  2IX0 A;  1TR5 A;  2L11 A;  3KF8 A;  1B53 A;  3HZX A;  3PMF A;  4QF4 A;  1S5D D;  3K5L A;  5IGF A;  2OF1 A;  1AZP A;  3MXU A;  5C4J B;  3S1R B;  3FEW X;  3CHB D;  4FXD A;  2K5Q A;  3KUP A;  5DNF A;  1BUV T;  5EGT A;  3MWY W;  4UDU C;  2TMP A;  3DWQ A;  1OXU A;  4CGY B;  5FLX E;  1STH A;  1FNV A;  1E0B A;  3GTK B;  1O80 A;  1DD2 A;  4IFD H;  1CZW A;  1I6V C;  1EY7 A;  1F9R A;  4ZK9 B;  1ZYR D;  2HDL A;  5AFW A;  3MAQ A;  3LNN A;  4C2M B;  2O5I C;  2B2T C;  2L5T A;  4KKT A;  3VYT A;  4I65 A;  4DXF A;  1PRT F;  2JEB I;  5CMD A;  4GZY C;  3MEH A;  1G8Z D;  1BNZ A;  1R4P B;  1LTI D;  3C3L A;  2F0D A;  2JA5 B;  2WKC A;  1OO9 B;  5IGD A;  3PIO 3;  3WDN A;  4RGT A;  4X3K A;  3C2P A;  1EY6 A;  1WTW A;  3I72 A;  2BCO A;  2WII B;  3S17 B;  2EY2 A;  4LAA A;  3GTJ B;  1V8Q A;  4C3J G;  2KED A;  3KBG A;  2B2T A;  3NPP A;  5M5W B;  1RHP A;  1ICW A;  3H6M A;  2PYK A;  2F0J A;  1VCI A;  1D1K A;  4FXG C;  1Z7T A;  3S9W A;  3I73 A;  4F87 A;  4L63 B;  3HOY B;  5ELF A;  1LLR D;  1GJX A;  3VR6 A;  4HR7 B;  2B63 B;  4K14 A;  4G7H C;  1LT3 D;  3UI2 A;  1R4Q B;  3J81 L;  5F2D A;  4DAP A;  3S14 B;  4ZKB B;  4K5X A;  2Y0S B;  1U4R A;  2F0S A;  1F9S A;  3NUC A;  3TDQ A;  4IUU A;  3T4A C;  1SYB A;  4TQU S;  5JEA G;  3SR1 A;  5I9O A;  1MD2 D;  3S16 B;  2H1E A;  4NKL A;  4HCE A;  3EJI A;  4KN4 C;  3LWU A;  1Q3L A;  4EQN A;  4F8M A;  4K6D A;  5EKI A;  1I4P A;  5NUC A;  2K05 A;  4DK1 A;  2ZXP A;  1KNA A;  1NUC A;  1KTK A;  3H09 A;  1JIC A;  3K5O A;  4FF3 A;  3SK6 A;  2EVB A;  1JR0 D;  1EY5 A;  3CU7 A;  4ZAI A;  1ENC A;  4C3I B;  1U9R A;  5ELB A;  1RKN A;  3TSS A;  4NDX A;  3P7J A;  1ILP A;  3TZU A;  1BQQ T;  1PTO F;  3T53 B;  4P2C B;  2NTS A;  2Z8L A;  1Y69 U;  3S15 B;  3OWF A;  1I3Q B;  5KRU A;  2A73 B;  1TT2 A;  1KLU D;  1JOR A;  4PNY A;  3BYY B;  1ROD A;  4A93 B;  2Z4H A;  4NP5 A;  3IKJ A;  5I6W A;  1SE2 A;  3R3O A;  2A6E D;  4N9T A;  1BCP C;  4DU9 A;  2D2C C;  3A7A B;  1UEA B;  1B3A A;  1LTT D;  1FYC A;  3TME A;  4NW2 A;  1BCP B;  2NBF A;  2L55 A;  4WOR A;  2F1M A;  4IN3 A;  2L1B A;  2EJG C;  4HN7 A;  1LTB D;  3OIQ A;  1DJR D;  5I4D A;  2EYL A;  4FVM A;  1BBX C;  1OXS C;  2F0K A;  3I90 A;  4KD3 A;  2F3V A;  3FPP A;  4J8Q A;  2LFN A;  1HA5 A;  4U67 3;  1TY2 A;  1M4V A;  5CV9 A;  3TP8 A;  4FF2 A;  4M1U B;  4OIK A;  1BOS A;  4QCL A;  2PZW A;  1NSN S;  1DXM A;  4XQN A;  2L9H A;  4ZYS A;  4RGO S;  1CA6 A;  1ESR A;  1SXT A;  2A68 C;  2SNS A;  2M9V A;  2ZXO A;  1Q8I A;  1STE A;  3R2I A;  1SNM A;  2O4X A;  1S5B D;  1TWH B;  1SNQ A;  1EL0 A;  3QB3 A;  4YIJ A;  2PZU A;  4RFB A;  1A2U A;  2O2L D;  5FO7 B;  3GTO B;  3VA7 A;  4C3I G;  1SMY D;  3DEO A;  4V19 0;  2PMZ B;  5EKK A;  3S2D B;  3W2D A;  4KK7 A;  1SJH D;  1YNN C;  1BO0 A;  2A69 C;  1ZKO A;  1JOQ A;  1DOM A;  3ND8 A;  2VB3 X;  1AFP A;  3RZD B;  1PFM A;  3S1N B;  1B2T A;  2CW0 C;  2FIN B;  5G3L F;  2DNC A;  1Y8O B;  2MP1 A;  4RHS A;  1Y8P B;  2NN6 G;  1KAB A;  1DM0 B;  3R2T A;  4F88 A;  2HDM A;  1JCK B;  2LY7 A;  2VB2 X;  1QJO A;  3AB9 A;  1CI3 M;  3TP6 A;  2PW7 A;  4RGM A;  5M5Y B;  2QF7 A;  2SDF A;  4FYD A;  3I4N B;  1B50 A;  2F4I A;  2EYM A;  5A2Q L;  3GV6 A;  5CV5 A;  1KNE A;  3K0Y A;  3NWT A;  3URY A;  2KEE A;  5COY A;  2LS0 1;  3TBI B;  1S5F D;  5KND A;  4U68 A;  2WIN B;  5J1Z A;  3PIP 3;  1X3P A;  1MBY A;  1EFI D;  4XXE A;  4DAV A;  1I4R A;  5CR3 A;  3WOE A;  2XN9 C;  2A6E C;  4HSV A;  3G6J B;  4BA1 I;  3KLS X;  1IHZ A;  2EY5 A;  2NZ1 D;  5JAV A;  4A3G B;  2O5J C;  1L0X B;  2CVR A;  3D31 A;  1SYG A;  1EU3 A;  4KD4 A;  1PTO H;  5ELC A;  2PPB C;  2F0T A;  4G4K A;  1D2B A;  3NTK A;  2RQX A;  1SNO A;  3BVG A;  4C3H B;  1SYF A;  1HCZ A;  5C3X A;  4DF7 A;  1S5C D;  5E4W C;  3K59 A;  1CZG A;  1EYC A;  4B9X A;  4DFA A;  1EZ8 A;  2J7Z A;  1GUS A;  1SYC A;  2A5H A;  1PMR A;  4CJ1 B;  3GTP B;  5BN3 A;  2ENB A;  1CT1 D;  1V1O A;  3E6Z X;  1LT6 D;  3GP7 A;  3NHH A;  2ZXR A;  3J7Y W;  1EYD A;  5C0X G;  2RDH A;  2X6G A;  4RKB A;  1B9N A;  5D14 A;  3NK9 A;  2NWG A;  3E0J A;  1H9R A;  1EIG A;  2IL8 A;  2K01 A;  4PMC A;  3MXP A;  3QG1 A;  1A3V A;  4KHZ A;  4Y7N B;  2IPK D;  5I2X A;  2KCC A;  3HP3 A;  1F2Y A;  2RDF A;  2F0M A;  2MUY A;  1LTS D;  3I8Z A;  4XTC S;  3BDO A;  1I4X A;  4ULL A;  5T1G A;  2M00 A;  5IT9 E;  3F2U A;  4QMG A;  2DN8 A;  3MXG A;  4K8I A;  2VNU D;  2NN6 I;  4XQQ A;  3H91 A;  1ENA A;  1EEF D;  5JPN C;  2B8G A;  5TSS A;  4C56 C;  4CBV A;  1H9S A;  1WTO A;  3GV3 A;  1H9K A;  1XWE A;  3S1M B;  3J80 E;  1T5E A;  1SNC A;  2EYF A;  3EFX D;  1ET6 A;  1VMP A;  3HOV B;  3K6O A;  1V43 A;  4O42 A;  1PFN A;  2R6G A;  4OIJ A;  3L3O C;  3D4R A;  4OO1 H;  3M85 A;  4OL7 A;  3V96 A;  4MIU A;  4KMU C;  1IW7 D;  2K1B A;  1GXD C;  5EPJ A;  1D5M C;  2WV6 D;  5ELD A;  4C3H G;  1WCM B;  5LL6 S;  2K5W A;  1CM9 A;  2J0T D;  1CA5 A;  3SVM A;  1WTQ A;  3T13 A;  5JVG 3;  1HFG A;  1QOH A;  3EA6 A;  1XTC D;  5J39 A;  3IFD A;  4HMJ A;  4ZKC B;  2EJF C;  3TZD A;  4LMQ D;  1PTO D;  3HOU B;  2N88 A;  3DWA A;  3C46 A;  2GA4 B;  1GUO A;  3MFG A;  1Z47 A;  2FMM A;  1K8O A;  1AP0 A;  4KJO A;  2K03 A;  1C8C A;  3SK5 A;  2EY1 A;  2AQ3 B;  4DA2 A;  3LWE A;  5A35 A;  1WVL A;  1EY4 A;  4BBR B;  3N52 A;  3D6W A;  4RCN A;  4DXG A;  4A3B B;  1PRT C;  1DYQ A;  4IZ8 A;  5DAU A;  1OXT A;  2G9D A;  4ZQ3 A;  5KIX A;  5K36 G;  2IX3 A;  4R9W A;  1SNP A;  3C1E A;  2C5C A;  3HOZ B;  3GTQ B;  5E3F A;  1STB A;  3M3Y B;  2F0I A;  4RAU C;  5C0X I;  4NMZ A;  3OW7 A;  3OMG A;  4MN3 A;  1EIH A;  1HUM A;  3PUW A;  2F0O A;  4RKL A;  2V4D A;  1LTG D;  2ICI A;  5C4H A;  1YNJ D;  4K5V A;  4H0L C;  2MJ8 A;  4EQO A;  2JXM B;  4R8N A;  3MC0 B;  5IOC A;  3A8J E;  4KV6 A;  3PUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...