1O78A

Biotin carboxyl carrier domain of transcarboxylase (1.3s) [10-48] deletion mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
84
structure length
84
Chain Sequence
MKLKVTVNGAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Studies on the Solution Structure of a Deletion Mutant of the Transcarboxylase Biotin Carrier Subunit
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
molecule tags Carrier protein
molecule keywords BIOTIN CARBOXYL CARRIER PROTEIN OF METHYLMALONYL-COA CARBOXY
total genus 6
structure length 84
sequence length 84
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2002-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1o78A00
1T5EA 3ND8A 1VF7A 3AB9A 4KKUA 1Y8NB 2A6HC 3A8JE 3MFYA 3P20A 5KNCA 1CTMA 4OGQC 1IYUA 2D62A 4KI0A 1B9NA 5BN4A 2O5IC 3OOCA 2IT1A 1GHKA 4PV1C 1DD2A 1TKWB 4KKSA 3T51B 2LMCB 3VR2A 5K36G 3I72A 3VR3A 1OXTA 1CFMA 3CRLC 3IKJA 4G7OC 1OXVA 2KCCA 2A6EC 3GD7A 3HGBA 1GUSA 2DN8A 2V4DA 2B8FA 3A7LA 3I4LA 4H13C 2EVBA 4IQZA 4OO1G 1GJXA 2NN6G 3OPOA 4L8JA 2EDGA 5KNBA 2AWOA 2A68D 2B8GA 3ND9A 3VR5A 3QG1A 1E2VA 1E2ZA 1VCIA 2BE5C 4KKTA 2ZT9C 4LJZC 4XTCS 3T53B 1DCZA 2L5TA 3PUZA 2A6HD 4KHZA 1FYCA 2BE5D 5A35A 3A8KE 3FMCA 3I73A 2PPBC 2O5JC 2AUKA 1GHJA 3DXJC 4OO1H 1OXXK 3D4RA 2E76C 3BG3A 3QJYA 2JE6I 2E74C 4JK1C 1QJOA 1Q12A 2YYZA 3PV0A 1EWHA 1HCZA 5KNDA 4BA2I 1H9MA 2EJFC 4DNRB 1IYVA 3MXUA 4HR7B 3RLFA 1BDOA 5K36H 3NE5B 4G7HC 2KA7A 1G291 2JXMB 3PUXA 3VR6A 1HTPA 3KLRA 4DK0A 3U9SA 2D5DA 1GUGA 4I7ZC 1K8OA 1O7LA 2K33A 1VF5C 2PCFB 4DNTB 3A7AB 5C0XG 1H9SB 3FPPA 4JBWA 1V8QA 1IW7C 2A69C 2PNRC 2K32A 2DNCA 3OW7A 5C0XH 1K8MA 1IW7D 3VR4A 1ZYRC 1CI3M 2Q8IB 4KN7C 1H9SA 2D2CC 1I6VC 3M4YA 1ONLA 3W3AA 4G7ZC 1TU2B 2A68C 4H0LC 4DK1A 1LABA 2CW0C 1Y69U 2JEBI 1Z6HA 1HPCA 3PUVA 1B9MA 1PMRA 3L7ZC 1GUTA 1E2WA 1H9RA 1H9KA 4KMUC 4H44C 1VDZA 1O78A 1Q1BA 1Q90A 2QF7A 1DXMA 3GQBA 2BDOA 2A6ED 3QIAA 3LWUA 1OXSC 5JEAH 3IFTA 4RCNA 4XIGS 3TZUA 3EQLC 1Q1EA 1ZKOA 1HQMC 2F1MA 1V43A 4IFDG 1SMYC 3WDNA 1A6XA 3M85A 1H9JA 1GUNA 2E75C 4TQUS 1YNJC 1OXUA 1Z7TA 3PUYA 3D31A 2BA0A 2BA1A 4KN4C 1YNNC 2A69D 2R6GA 3A8IE 1LACA 1Y8PB 3H94A 3LNNA 3SE0A 2NN6H 5BN5A 4TKOB 1GUOA 2K7VA 2NN6I 4GZYC 2EJGC 3PUWA 4LK1C 3CRKC 5BN3A 2DNEA 4IFDH 3VA7A 1FR3A 2AUJD 2EJMA 4BA1I 5JEAG 3SDZA 3N6RA 3M7NA 2JEAI 3BDOA 1Y8OB 3T56B
chains in the Genus database with same CATH superfamily
1P16A 3K7AB 1VF7A 2L11A 1Y1VG 3KJPA 1CTMA 1EU3A 1QZGA 2XGTA 1O7IA 1A62A 1YJWA 3T51B 1LT5D 1Y1WB 3I4MB 3BVZA 3F2UA 3IKJA 4LFAQ 1EUJA 4A3LH 4EQ5A 2Q2HA 3Q6SA 5CC4A 4BY1G 3I4LA 2CFMA 5G3LD 2F0WA 4DV1L 5M3MG 3S17H 3KF8B 4AYBE 1SSOA 1PFNA 3BJUA 5FLXE 3D4RA 5LHY1 4QF4A 4HR7B 3GTMB 2SEBD 1STBA 2KA7A 2AQ2B 1Q81C 2E2JH 1HTPA 2I5LX 5J3BA 3I4NG 4C3JB 5E7NA 3K58A 3EA6A 4OELB 2Z1CA 1VQOA 2E8GA 4FF2A 2WACA 3HOZH 4DU9A 3S1NH 2ATWA 5JJLA 2FINB 3OMCA 1HFGA 4WJ4A 1SYEA 1E1OA 5M5YH 2KCTA 5DEHA 4X3UA 2D0OA 3T1HQ 2IY5B 4X65L 4IURA 1DOLA 1E1TA 3PUVA 1N33Q 2PW5A 2VY3A 4DAVA 5ISRA 4FF4A 3LX0A 2A73B 3I70A 3ITPA 2ZJPA 3S17B 2OT2A 4MTKA 4R1JA 4RGNA 2JP1A 3GTKB 4L5QA 2MO0A 3NTHA 2F1MA 4JVZA 1PRTB 2EYMA 1HNZQ 4A3GB 2E75C 5EBCA 1SMYD 3Q8DA 1U4MA 5M3MH 3C3LA 3W1GA 2NN6H 1FGUA 2CWPA 3QOJA 2IWHA 1IBLQ 3AFPA 1HUNA 1JB3A 1TWCB 4NXMQ 3MHBA 4NXML 2QGQA 2WB1E 2KHJA 1E22A 3R93A 2JA5H 2DJFC 5IWAL 1JOQA 1K0SA 4MIUA 3GV3A 4DV1Q 4ME3A 1TXYA 1T9HA 1XTDA 2JSOA 3CAMA 1TIID 4IFDJ 3DM3A 3DEPA 2NTTA 1DYQA 3HS0C 1ASYA 1GHKA 1YEZA 1STGA 4I7AA 4UAIA 4B3RL 2VUMB 4F7XA 3NUCA 2KEDA 1DOKA 1S72A 4BBSG 4LF4L 1JOKA 1JQYD 4JOIC 1V9PA 1TS4A 2PNHA 3KLSA 5D65A 3MXPA 4YCVA 5ELNA 1VQJA 1KNEA 1IHZA 5CV6A 3VYTA 2XN9C 3F2BA 4FVMA 2RDFA 2N3SA 1EEID 3ONAB 5CGKA 2IHEA 1XMOL 4O42A 4DAMA 2AUKA 1N32L 3UDGA 2X6GA 2ZTDA 2CCZA 4UP9A 5JEAG 2F0HA 2E5LQ 1HCZA 2MO1A 2K14A 4CJ0B 1IYVA 3FEWX 2NVYH 1LM0A 3A5UA 1BDOA 3FKIB 1PTOD 1EWCA 4R8NA 2F0TA 4YY3L 1K8OA 1RD9D 2QCPX 3J81c 5M5YB 3TZDA 1VF5C 2PCFB 2HQLA 1DZ1A 4DAYB 4A3DG 3GTOH 3OW7A 5ELDA 1WVLA 5C0XH 3ICEA 4ZUIA 4FF3A 3BYTB 1SLJA 3D4DA 2L4NA 2N8NA 4R4QA 2F3WA 4HCSA 2ZXRA 2N55A 2NVQH 3NBHA 5C4XH 2E2HB 1AH9A 2EIFA 1H9RA 1ET6A 3LWUA 2JA5G 1EFWA 1JICA 5LL6S 5IT9L 5DAUA 2LXKA 4DV6L 1N32Q 4Y7NH 2WIIB 4NXNQ 2CKZB 3HOUG 4ILWA 4HJ8A 2K05A 1Z7TA 4NKLA 3I2ZA 3T1HL 4BBRH 1YNNC 3A8IE 5I2YA 3S16H 5D14A 4F88A 4A75A 5C44H 2K52A 5M5WB 3K0YA 1ILQA 2EJMA 4XDXA 4BY7H 3RN2A 4QCLA 4L5RC 4JI5L 3N6RA 2P5ZX 1W6JA 2K1BA 4HJ9A 1I4GA 3HOXG 4X3KA 2JA6B 2YU9H 1PRTF 2G9DA 1Y8NB 2XRQD 1I3QH 4LF7L 5K5PA 4YCWA 1IBMQ 4NMZA 3K6OA 1K73C 3S1MH 2CHBD 3F8TA 2IT1A 5EPKA 2CH4A 2K03A 1QZHA 4V190 4OX9Q 2B3GA 5CYUA 2XWJB 4JPBW 3S16B 4U673 2QDLA 1PZJD 5IWAQ 2A6EC 4CGYB 1MJEA 1BCPB 4UDUC 1NE3A 4IUQA 1A0IA 4IQZA 3J7AF 3H09A 3H0GG 3D8GA 2F52A 3H3VI 4KTAA 4P72A 4J8QA 1B70B 2ZT9C 4NP5A 4GOPA 4JI6L 4RKBA 3U50C 5IYCH 2NZHA 1STNA 3D6WA 3EJIA 4GKKQ 1YBYA 3LGJA 2XWBB 3G4SA 3CPFA 5LMNL 3PO3G 3K5LA 4FDBA 5FO8B 4N8X1 4DNTB 3C46A 5KYLA 4DNRB 3OYYA 3NENA 5IYCG 1JR0D 5JJIA 3GTOB 5IP7H 3GTPH 2B63H 2ZXPA 1RKNA 1KABA 3IAYA 3T16A 2OF1A 3KLWA 1BR9A 5FLMH 5C0XG 4DR6Q 4QB4A 1F2YA 3FVQA 2PZWA 4PMBA 5D3DA 1C4QA 2KJXA 3NQTA 2B2TC 3I91A 1TS3A 4UP7A 3PGZA 4LFAL 4C3HG 1ZYRC 2QW7A 3E9HA 1MBYA 4N9TA 2D2CC 3M4YA 2F4VQ 3TSSA 1TU2B 2UUBQ 3HOUB 1LTGD 2M00A 1KDCA 2OEOA 5FLXL 3E9IA 2YTXA 1ESRA 1DGSA 4GN3B 4EVOA 1B2TA 3KLSX 3J80i 5JEAH 4LF9Q 4JI0Q 3TS0A 2CVRA 3MAQA 1PH6A 3KDFB 1QNUA 4C3HB 1HQMC 1V43A 5LL6X 2BCOA 2XSCA 1GUNA 1VQ4A 2HT1A 1U9RA 4RGMA 1K9MC 2NUCA 4AQYQ 3PO2G 2QA4A 5C3EG 4A3EH 1EY5A 4HJAA 1KAWA 4DAPA 1J5EQ 4B3SL 2Z8LA 3OTOQ 3A5ZB 1BUVT 1Y8OB 4JBWA 4BBSH 4DV7Q 1FNWA 2EE1A 3I4MH 3A8JE 4OGQC 2F0QA 1VQ6A 2Y0SE 1PTOH 5C4XG 5IYDG 2SDFA 1JC7A 1IKMA 2Y0SB 2ICEC 4M1UB 1EZ8A 1HR0W 2M9VA 1AE2A 1CFMA 1M8AA 4A3MB 3RZOH 1EY6A 2HD3A 4OX9L 4JV5L 1W3SA 2EZVA 3HOXH 5LMUQ 4GN5A 3I3CA 1CM9A 1EIYB 3DUZA 5C3EH 4JI4Q 4A3DB 1V1QA 1A3TA 1KIXA 4LJZC 1HA6A 2VQEQ 2HHHL 1FL0A 2B2VA 2L5TA 1B44D 5EJWA 3BS1A 3GTPB 4QJFA 4KHZA 2E2JB 4IUNA 2PPBC 3FMCA 4JI8Q 2O5JC 3L9AX 2V1CC 3KF8A 3T1YL 4JI7L 1U4LA 1Y14B 1BCPF 4DN4M 4IZ8A 2K75A 4JBMA 4DR7L 4DR1Q 4RFBA 3HOWB 4HAEA 2WAQE 3F1ZA 4DK0A 3E6ZX 5M3FB 4LF4Q 4KJOA 1Q86C 4POGA 4WORA 2ID0A 3V2TA 3HOWG 2PNRC 4CBVA 2FMMA 3D6CA 4CKEA 4R4CA 1HNWQ 5T1GA 4XT1B 2IX3A 2WFWA 4YWMA 1LTRD 1JWMD 1QOHA 2Q2IA 2A5HA 2B2TA 3OWEB 3CCEA 5T1IA 2A68C 1LABA 4KY5A 1H95A 1SNPA 3IL8A 1H9KA 4H44C 3PCOB 1Q90A 2QF7A 1GD7A 2A6ED 1JE4A 1RCVD 1SNOA 3RLOA 4IFDG 2R7FA 3AYHB 2LXJA 1HR0L 2F0LA 1ENAA 1OXUA 1X32A 4B3TL 1C7YA 4DPGA 3IRBA 4A93H 3CPWA 1HUMA 5L37A 1BBXC 3DWAA 5M3FH 4BY1H 3Q0AA 2KQ3A 4POFA 2F0MA 1YHQA 1IBKQ 4AYBG 3L0OA 3C1EA 3UI2A 2B29A 3U4VA 2LKVA 3NEMA 1PHJA 1AN8A 1DM0B 1T5EA 3I4NB 4IPCA 3KBGA 1HH2P 2B2YC 4KI0A 1RIPA 2KHIA 4ZQ3A 5EPJA 3ULPA 1PH1A 5EKLA 3RN5A 5HURA 5CBAE 5IYBG 3CC7A 1SDFA 1VQAA 1D6EC 1Z9FA 3G7LA 4FXKC 4LUOA 3GD7A 1WFQA 4BY7G 4A3BB 1CQVA 2WP8J 5KGUA 5FLXc 4S3SA 3I7FA 4L8JA 1VMPA 5KNBA 1XNRQ 1QVCA 3I4NH 1I3QB 3L2PA 3QG1A 1DCZA 4C3JG 3MZ5A 4A3EG 1XX8A 2ZTCA 1RODA 1PDQA 4EQNA 5I9OA 3DXJC 5AJ3Q 2R7ZH 3TQYA 2CQAA 4BA2I 1GO3E 2UXDQ 2JYOA 2B2VC 1HNZL 4G57A 3PF4A 2VQEL 2HHHQ 5JVH3 3GV6A 4DV2L 4P73A 2NVQB 1SRUA 4JI2L 1B53A 1QE6A 2R93G 3UE1A 1QVGA 3PF5A 1IW7D 4K2KA 1TWAH 1KDBA 2AWNA 1D1KA 3CMEA 3HEJA 1PV4A 4PZ8A 4G7ZC 1ONLA 3K5MA 5A2QL 4H0LC 3GTLB 4JI0L 2Q2UA 2KENA 4ZCKA 1BXTA 2HIXA 4KLKA 1E2WA 5JEAJ 1VDZA 1RDPD 3S24A 4A3MH 1T5XD 3RNUA 2JK8A 2Z9HA 2NZOA 3S2DH 3BVMA 4XIGS 4K6LA 1STAA 3GDEA 4QGUA 1CKOA 4JG2A 1U0LA 4ZK9B 3FP9A 1EY8A 2MPMA 1QILA 4LWCA 2L0CA 1AZQA 4IOAA 2MNAA 1SFOB 2KCMA 4DV5L 4AQYL 1R9TB 1S5DD 2YU9B 1BQQT 4K0KL 1I50H 1HFNA 4F87A 5I2XA 2PZTA 1BKBA 4DR2Q 4DV6Q 2JA6G 5KIXA 3T56B 4YHHL 1IBKL 4ZLTF 3P20A 1G8ZD 4N8FA 1QCBD 2QEJC 3KOJA 4LF8Q 1ENCA 2AQ1B 2NWGA 3I4OA 3VR2A 5IGEA 2RF4A 2YV5A 1SN8A 3CRLC 2IX1A 2EYHA 2EYPA 5JAVA 1UE5A 2VW9A 1GJXA 4C2MB 3GTQB 2NN6G 4DR7Q 3OPOA 1HRJA 4A76A 4H7BA 1L1OB 4JBJA 3F2CA 1STEA 4KJNA 2EYFA 1E2VA 2RDGA 1VCIA 3T53B 4MN3A 3K57A 3T1YQ 1EFID 5C5MA 5FO7B 3OIPA 2AHOB 1PYSB 2B63B 1FYCA 3G71A 2K4KA 4IUPA 1XPRA 3BG3A 1KD1C 2I07B 2XIWA 1PTOF 3LWEA 4IOCA 5I6YA 4BXXG 2OTLA 4GOPC 1XMQQ 1TWGH 1M4VA 1LTID 3PUXA 3JAMi 2K5WA 1NMFA 5E1FA 3WOEA 1EQTA 1AEXA 1K3RA 4BY1B 3I55A 1EQVA 2PMZE 3OHXC 1OO9B 1TVXA 4QY7A 4Q5VA 1A8VA 4RGTA 4YCUA 3UDFA 1PH2A 4KK7A 5ELBA 3CQZB 2PMZB 4ZYSA 1HXYD 2RBMA 1TS5A 3SEBA 3AFQA 2OCEA 1SNCA 1EY7A 1QVFA 2EYOA 4A3FH 1JJCB 3BZDB 4LMQD 1B1ZA 2F3IA 2NZ1D 1YIJA 3NPPA 5IODA 1HJPA 1MIUA 1D7QA 1DXMA 3R2TA 3IFTA 1KNAA 2EY2A 4AYBB 1CHPD 3OWFA 4QQBX 1NUCA 1QB5D 4QIWE 3M85A 1VQEA 3NTKA 3NBIA 3RR5A 4GZYC 5BN5A 4HIMA 4HIOA 1XWEA 4IJHA 2H4OA 4GN4B 4DV4L 3HG9A 4HN7A 4BWGB 2OQKA 3EN2A 3BDOA 3J81E 3TREA 2D0PA 1IBML 1SBBB 4KKUA 4Q0FA 5JPMC 1CKNB 1PH9A 5CBEE 3E3XA 4A3KH 2D62A 2O4XA 5CV8A 4EGVA 1ILPA 5AFWA 4PMWA 1Y1VH 3TDQA 3S14H 3U4ZA 2HQEA 4C3HH 2B2YA 2LMCB 1SROA 3FDTA 2OQ0A 1AZPA 3G6JB 1D8LA 3TMEA 3MA2B 1X3PA 1JB7A 1EU4A 4O0AA 4OWXB 1IL8A 2B8GA 2EQSA 2G9HD 3VR5A 5EPLA 2F4VL 3DM1A 4LF5L 3S1RH 2I0QA 2I5HA 2K28A 1BO0A 1WCMB 1GHJA 4JI6Q 1FNVA 4JV5Q 2EXDA 1JE5A 4GKJQ 4C3IG 3PV0A 1EWHA 1X55A 3KF6A 2QKIC 4TSSA 3CQZH 4G7HC 1G291 2JQOA 2F0FA 2D5DA 3SK8A 3M3YB 2PQEA 1O7LA 1SYCA 4DV3Q 3ZYYX 1YNND 4GNXA 4A3DH 4C1NK 5M9OA 3CC2A 5E3FA 3PIO3 4IPDA 4O1NA 2UUBL 5LMNQ 1LTSD 2XNAC 4R4OA 2EPBA 1WD1A 3HOZG 1QG7A 1JORA 5CV9A 2Q8IB 4KN7C 3S2HB 2X69A 5EAYA 3DMUA 4K6DA 1Y69U 3KK7A 1PRTD 3DEOA 1PMRA 3L7ZC 3S1RB 2K5VA 3FHWA 3AEVA 3NSWA 4ZKCB 3HKZB 1HTLD 1V1PA 3PSIA 2NBFA 5E4XA 1HNXQ 2G5DA 1WTOA 1G2SA 1LT4D 1NBWA 1HNXL 2HCIA 2MFIA 4C2MH 3GTQH 3NP8A 5M3FG 4HTHA 1BOSA 2X6LA 3PO2B 1UWVA 3ER0A 1VQ8A 1WI5A 3HOYG 4A3CH 2JA7H 1WTXA 3S2HH 2FXQA 3KBXA 1STYA 3CHBD 3M3YH 2EJGC 2IPKD 1E0BA 4LK1C 4H02A 3VA7A 3Q22A 4BA1I 2UXCQ 2JA8H 1Y1VB 1N8RC 1RF2D 1N36L 5F2DA 4OWTB 3AB9A 3EBEA 2A6HC 4GNXC 1C48A 2LFNA 4JI1Q 5IGGA 2N78A 5C4HA 1NSNS 1LYLA 1DONA 4ZAIA 1PH4A 3IFDA 1WYDA 1JWUD 3ULLA 3A7LA 3CD6A 4J15A 1S3OA 1PH5A 2XTIA 1G6PA 1K8AC 1Y1WH 5GAHC 2JA7B 4BS9A 2F0NA 2C9OA 5TSSA 1CK1A 3ZJYC 4DFAA 4UPAA 3G6EA 1TWFB 1KRTA 1YNXA 3ULJA 1QJOA 5EBDA 4L6TB 2WAQB 2I46A 5C5LA 3RZDB 4J1MA 3U58A 3TP7A 3CCLA 1ET9A 4DA2A 2ZTEA 3T4AC 1XJVA 5CORA 1YJ9A 4RKLA 1X3GA 1YJNA 3J7ZC 4HMIA 3VYUA 2AMCB 4ME5A 1D5XC 2F3VA 1SJED 4P71A 1AP0A 1IL2A 1G91A 1SAPA 3A54A 1KHIA 2N49A 1YVCA 2WKCA 1K0RA 3SK6A 3H3VH 1CKNA 2LY7A 2F0EA 1HPCA 3PO2H 3HOZB 1FJGQ 4DK6C 1UE1A 1GUTA 3KUPA 1EQQA 3M4OH 3QR8A 2PQAA 2K50A 3F2DA 1B8AA 3J7AV 4NDXA 2EY1A 1JWSD 3UDXA 1Q1EA 2L1BA 2HDMA 3BDCA 3BZCA 1RJTA 1KQSA 3S1MB 4TQUS 3HOVB 3T13A 3R8BA 3BDLA 3AQQA 1F9PA 1ICFB 1M90C 1EY0A 4KD3A 2F0VA 3H3VC 1ZEQX 2KOLA 1NNXA 1SYGA 1Q3LA 1IYJB 4DV0Q 2DJGC 5ELOA 2K5QA 1CHQD 2F0SA 1EY9A 3NWSA 3JC66 2UUCL 1DD2A 1SR3A 1IKLA 1OXTA 1KAAA 3J80E 1DOMA 3K8AA 1K8GA 3VA5A 4RHSA 2VL6A 1PTOB 2Z4IA 5FLMG 2UUAL 1XNQQ 1XMOQ 2UXDL 1N33L 1ENFA 1FGBD 1TWHB 2Q8TA 4C3JH 5IOCA 1PRTC 4X3SA 3H15A 2ZM6Q 4XTCS 5IP7G 4ZKBB 3AMUA 5AJ3L 2A6HD 1QUQA 3HOXB 3A74A 3W2DA 3NTIA 3S1NB 3EROA 1DJRD 3MTSA 4A3FB 4HIDA 1C8CA 4OO1H 1OXXK 2PQAB 4OL7A 3GO5A 3K7AH 1A2UA 2UXBL 2E2IH 3GTGB 3SR1A 1VQFA 1XNQL 4LFCL 2RSNA 3SHLA 3UDIA 5K36H 4A3MG 3K81C 1VQIA 3X3NA 3U9SA 4ALPA 3HRZC 5ELEA 3B6YA 3P75A 1LUZA 1V8QA 3QO2A 3U9OA 2JA5B 3HOWH 1I5FA 2EY5A 1LV9A 2SNSA 3MEFA 3S15B 4G4KA 2JEBI 4BXXH 1B9MA 1R4PB 5IT9E 4P75A 4L63B 5GAGC 1Q1BA 1RL2A 4DR4L 4GS3A 4RCNA 5C4JH 1ZKOA 3VDYA 5C44G 1TT2A 5IGBA 1WTQA 4TRDA 5A2QE 3PUYA 4A93G 4DK1A 2R6GA 4OO1I 1Y8PB 2UU9Q 3MC0B 3CRKC 1PFSA 3R3OA 4Z9CB 2DGYA 1GOZA 2RDHA 4X62Q 2EYJA 1R4QB 1U5KA 1UEBA 1S5FD 5JOBA 1X3EA 1L0XB 4JOIA 4OIKA 1G6ZA 1HHVA 3DWQA 2WINB 2A1AA 2E2DC 2NB0A 3GTJH 4FO2A 4IN3A 3EVQA 1PXUA 2PYKA 4UY8C 3ERSX 1XPUA 5LMUL 4A3IG 1I4RA 3FPUB 4EQOA 1IXRA 4QUFA 1ML0D 5CV5A 5C3WA 1I94L 1EY4A 2GVBA 1I6HB 4IUVA 1E2ZA 1TWAB 2K6AA 4JI8L 5HY6A 1YI2A 3ERQA 4JI2Q 4OWWB 3GTLH 4X66L 1V1PB 2F0KA 3H0GB 4DV7L 2YYZA 2WKDA 4AH6A 4DR4Q 4PQXA 1H9MA 3TP5A 4LNQA 3A55A 3CCSA 4JI4L 3RLFA 4A3JH 3HOVH 2A19A 1FD7D 1LT3D 4EQPA 2F0OA 2J7ZA 2ZJQA 3URYA 1GUGA 4A3GG 1X54A 1I6HH 2HIVA 1N34Q 1TY0A 4MHEA 1RTOA 4DUYQ 4KY6A 1K83H 3FKIG 5LMNW 2NVTB 5J1ZA 4TVAB 1ZYRD 1X3QA 3STBC 3M7GA 4Y7NB 4LW1A 5JJZA 1EIFA 3HKSA 3GTKH 1WJJA 1WCMH 4DK3C 4X3TA 2O2LD 1U4RA 2F0IA 5H1SE 1NR2A 5BR8L 4NPSA 4QL5A 1M1KC 2BDOA 4UP8A 4HCEA 4LF6Q 4DR1L 4OHJA 3WDNA 2NVYB 2RQXA 2BA0A 4R4TA 1MKHA 3CF5A 1XYIA 1LACA 1I94Q 2ZM6L 4LFBL 4CJ1B 1TS2A 3NWTA 1L1OA 1YITA 2DNEA 1NTGA 1N9WA 2TMPA 2KVMA 3E0JA 4A3BH 1J8IA 1WOCA 5DM63 4JI3L 2JA9A 4OIJA 1EYDA 4PZ7A 1XTCD 3Q23A 3TRZA 1PH8A 4A3EB 2R93H 1HR0Q 1S5CD 4P74A 2IW3A 4K5VA 4K2LA 2VQFL 4C3IB 2F0DA 4DF7A 1VQ7A 1Q82C 3I72A 1K28A 3VR3A 4HSVA 4RA8A 3I4MG 3X3MA 1GUSA 2V4DA 1C0AA 2B8FA 1BBUA 1OTCA 5FK9C 5C3XA 4JI1L 3Q24A 2JA8G 3V96A 2BDNA 2EXZA 4KHPL 2ICIA 2B63G 4NB3A 1ASZA 4HIKA 1EL0A 1B3AA 1Q8KA 2QILA 5BR8Q 1BNZA 4GKKL 2KHSA 3PQIA 5C4JB 2KECA 1S5BD 1YHAA 5IP9G 3PO3H 4ZUJA 4FXDA 5M5XB 2FJ2A 4JI5Q 1RTNA 3PIPA 3DLLA 2R92B 4KHVA 4WRDA 2K5HA 2K33A 4FYDA 1UAPA 4KV6A 3UE0A 4DUZQ 2A69C 4DXFA 3QOLA 3J80c 4IJLA 1O7YA 4FP5D 1CUKA 1J6QA 2IL8A 2OWOA 2GVAA 1CI3M 5IYBH 2AKWB 1SYFA 4E6IA 3W3AA 2JJQA 2D9UA 3GTJB 2R7DA 4M8AA 1NY4A 1E7ZA 3OMGA 4DR6L 1CKMA 2HCCA 1LT6D 1VQKA 1PFBA 3A56A 1PTOC 3RZOB 4JBKA 4RWSC 1X3FA 3EFXD 2R7ZB 5JJKA 4RG1A 3HP3A 1SNDA 1H9JA 2KEEA 4MNOA 1KLUD 4KN4C 4B9XA 4YY3Q 1L0YB 4IFDH 1FR3A 2AUJD 5IY0A 4B3SQ 1J5EL 1B3QA 3HZXA 4IPHA 4K5WA 3P7JA 2JN4A 1EWIA 3DWPA 1MJCA 2MP1A 3RUZA 1WTPA 2SNMA 3NK9A 2IHFA 1B4OA 5IT9c 1QWYA 4MZ9A 4G7OC 1SEBD 2Z6KC 2KCCA 3HGBA 5KEEA 1I4QA 1KTKA 2ENBA 3CW2C 4LF7Q 1TWGB 2UUAQ 2EDGA 5C4XB 2R92G 2Z0SA 5M5XH 3CCRA 1A3VA 3TS2A 2GA4B 3PMFA 1X56A 2QEXA 1O80A 3I73A 2CQOA 4XQNA 1GM5A 4Y52H 3V05A 1Z47A 4DGZA 1SE4A 3MEHA 4JCVE 2N88A 3S14B 1S4ZA 4OXPA 1P8LA 1Y1WG 4GLAC 3KLRA 3SK5A 3SXHA 5C0XJ 4I7ZC 3TN2A 5FOBB 1WTVA 2LSSA 1IW7C 4HSPA 1LLRD 1GKHA 4DR3Q 2K01A 4CKCA 4B08A 1J9OA 3STBD 5DM73 4A93B 1B50A 4HMJA 4B3MQ 3QB3A 2KCNA 2PI2A 4X65Q 1ZXTA 4JW0A 4A3GH 1F2LA 1X65A 2AQ3B 3M9BA 1I4HA 1NJIC 1O78A 3VR4A 5EQ0A 1OXSC 1N34L 1NAPA 3TZUA 4LUVA 2DY8A 2YTYA 2RSOA 1O7ZA 1WD0A 1N36Q 2QDBA 3BZKA 1UE6A 2RHSB 4C56C 1A6XA 4YWKA 3D31A 1IZ6A 2BA1A 1HZ9A 4QIWB 1MSGA 3PUWA 4X66Q 1SE8A 3SK4A 3BU2A 4IO9A 3K80C 3J81j 5CV4A 4PNYA 3CC4A 3ND8A 5GADC 1NMGA 1XXGA 2F03A 1ESFA 2L15A 3EIVA 4O2DA 3O13A 4B9WA 2F0PA 3D3RA 3OOCA 5HGTA 3OW2A 1CT1D 5IYDH 3JAMc 1TKWB 1EOTA 3NHHA 1MGSA 1KLGD 3CCJA 1LTTD 1ICWA 2F0UA 4DR3L 2R7ZG 2R3ZA 3HKZE 3TP8A 4ID6A 1K83B 3AU7A 2YTVA 3M4QA 4XQQA 1KL9A 5I9PA 5FJ8G 2R93B 2AWOA 4FXGC 4LAAA 3S1QB 2NYZD 2VZAA 5D3IB 4OEMB 3K5NA 1S40A 1C9OA 1F2MA 1EQRA 3JAML 3E0EA 4ABNA 3HOYH 4A3CG 3A8KE 2RKSA 4IALA 4LUZA 3J80L 3NELA 4RH6A 5G3LF 3W1BA 5CMDA 2E74C 2WB1B 1Q12A 1Q46A 1MD2D 3H6MA 4C1NI 2IX0A 3M4OB 2VUMH 2FFKB 1L2FA 3OSOA 2VNUD 5GQOA 2FHTA 1HZAA 3CU7A 4LF5Q 4AIMA 2Y0SG 4LFCQ 2LS01 4A3IB 4RHRA 4KHPQ 4QUCA 2F4IA 3D4WA 3S2DB 2KUMA 2DUDA 4BBRB 1SJHD 1LTAD 3P1HA 4U68A 4YWLA 2RVLA 5C44B 3KFUA 1A3UA 1K8MA 1VQCA 4A3BG 4BY7B 1GXDC 3L3OC 5EKKA 1CA6A 3CKIB 2BH8A 2EOTA 5J22A 1PVOA 1TWFH 2VQFQ 4XYOA 2Z6BA 4R8IA 3NQIA 3CP0A 4KMUC 1FVIA 1JJ2A 1EOVA 5IIFA 2B2UA 4GKJL 1KXLA 4HEDA 1F9QA 4FNFA 2MJ8A 1VQPA 1PZKD 1BVSA 2IJ0A 3GP7A 3TP6A 1YHBA 2VXWA 4BBRG 3SVMA 4WFN3 4LFBQ 4GOPB 1GUOA 2K7VA 3J81L 4DV3L 2ZJRA 4DR2L 1PZID 1UEAB 1EZ6A 2ALYB 1IBLL 2JEAI 4K8IA 3M7NA 1KC8C 2ASBA 1G51A 1VQLA 3MFYA 4WJ3M 4A3FG 1BCPD 3J81i 2RCNA 3WWVA 4LF8L 4PV1C 3GTMH 1W6KA 1Q7YC 4KD4A 2E5LL 1NR4A 1PFMA 4OONA 2DN8A 4YHHQ 2GN5A 4NW2A 5NUCA 1TR5A 1STHA 3MXGA 2EVBA 5ELCA 5GAEC 3KF6B 3BVGA 2A68D 3J7A5 3PO3B 3A0JA 3BYYB 1SFOH 4B3ML 2BE5C 4FF1A 1R9TH 2NTSA 4PMCA 3PUZA 3KJOA 2WB1G 2R92H 3CMAA 1KRSA 3MVVA 2BOSA 1D5ZC 1MSHA 3I8ZA 1A15A 3CCMA 3JAME 1LTLA 4A3IH 2WAQG 1TWHH 5GROA 5ELFA 2F0JA 2B2UC 2OXPA 4GLVB 3NE5B 4ULLA 2JXMB 3VR6A 5C6AA 1CSQA 2ES2A 2H5XA 3HFZB 4RMFA 3RD4A 4L5SA 5JPNC 1VQHA 1VQBA 2MUYA 1D2BA 4CDCC 4PG3A 2DNCA 2CWAA 4DNIA 4DUYL 1WTWA 2Q8RE 4DAYA 3MWYW 1XNRL 5IGCA 4K0KQ 3D0FA 3SGIA 5FKAC 4RCOA 2UXCL 1LO5D 2C5CA 1JMCA 1TQOA 3CXCA 1I50B 1E3PA 3S15H 1CZGA 2RA4A 5KRUA 4EX5A 4JYAL 1YNJD 1L1OC 1QUQB 2OTJA 2HDLA 1MHWC 3RZDH 4DR5Q 2Q2TA 2A69D 5FJ8H 2L55A 1HA5A 2NN6I 5BN3A 5C3EB 4JI7Q 1VQ5A 2B39A 4XT3B 4J6HA 2K04A 2A74C 4F8MA 5C4ZA 1XMQL 1UNSA 1W2BA 5M3MB 1EIHA 2MGSA 1D1IA 5IGFA 5KNCA 3I90A 4IFDI 2PI2E 5J39A 1SYDA 5EKIA 1RHPA 2L12A 5BN4A 3CCUA 4A4IA 1VQGA 3WOFA 4DV4Q 2Z4HA 4KKSA 1CQFA 1II3A 1I4PA 3TEHB 5K36G 4DKAC 5E4WC 4P2CB 4H13C 1SXTA 4NXNL 4OO1G 3PIOA 2B2WC 2NVTH 1TWCH 2I5MX 1I4XA 4JYAQ 3ND9A 4DV5Q 1F2ZA 4HJ5A 2K5NA 4KKTA 1QNKA 3MFGA 1BBWA 2BE5D 5A35A 4CDFC 3OIQA 2E2HH 5IP9H 2VB2X 1EYGA 4JK1C 4XXEA 2E76C 2EY6A 2HUGA 4X64L 2CH4W 2C35B 2PO4A 1A2TA 4R9WA 1A63A 4XYQA 4JC0A 5C0XI 4DR5L 3H0GH 3C1FA 3MXNB 4ODGA 1PLFA 3FPPA 3HOYB 2K32A 1VQNA 3FKIH 1HNWL 1EYAA 3J7YW 5M5WH 1Q8IA 1S5ED 4K14A 2NVXH 1I6VC 1VQDA 5KYIA 3HKZG 4CKBA 1JCKB 2CW0C 1Z6HA 2TSSA 3K59A 4A3KG 1JT8A 1PYBA 2L9HA 3H91A 4DUZL 1K3BC 2R61A 5IGDA 2EYLA 3EQLC 2H1EA 3R2IA 1JJGA 1X6OA 5DLQE 4C3IH 5DNFA 1YZ6A 3KYHC 1VQMA 4LF6L 3GTGH 2E2IB 3K5OA 3KDFA 3DHQA 5EGTA 1PH3A 2UU9L 5KNDA 2J4XA 2PW7A 3SE0A 2ZXOA 4IUUA 3RMHA 4B3TQ 2KBNA 1LTBD 4DV2Q 3SDZA 4JI3Q 4XQJA 1MI2A 1PH7A 1VMCA 3N52A 3RLNA 1F77A 2Z6KA 4A3LG 3G48A 1IYUA 2F0GA 2NVXB 1FNUA 1B9NA 4RAUC 3W5OA 1L0WA 1WCMG 3FRPB 5FO9B 1FJGL 2O5IC 3C2PA 1AFPA 4IUTA 4LF9L 3HOVG 3S1QH 1BF4A 2JA6H 3S9WA 3CCQA 1PA6A 3MXNA 1EEFD 1OXVA 1SNMA 1KDAA 1UUPA 4R4IA 1D5MC 4HJ7A 1F9SA 2JA8B 4UHVA 4RGOS 1CSPA 3QWNA 3OTOL 2J0TD 4CJ2C 1AW7A 4B3RQ 3M4PA 2FMCA 4IPGA 2XRSD 1E24A 5I6WA 2UXBQ 2UUCQ 5HGQA 2A8VA 3HOUH 2B2WA 1B7YB 2WV6D 2M2LA 1UE7A 3QJYA 2JE6I 2EJFC 1WTRA 3MXUA 5COYA 4V0BA 5JVG3 1F9RA 2MQHA 1HZBA 4DV0L 4N9PA 3VYSA 4PZ6A 1SYBA 4X64Q 3VYRA 1AE3A 4K8JA 3TBIB 2VS1A 1EIGA 4YIJA 3A7AB 1H9SB 2PZUA 4DXGA 2XVSA 4GNXB 4CHTB 1EYCA 1CZWA 1HZCA 4A3KB 1GVPA 1SE3A 1VS0A 1BCPC 1V1OA 4L5TA 1WTHA 1TY2A 1H9SA 4ZRZA 2RCFA 2RHQB 1NCVA 2SOBA 4BBSB 1PYWD 2DY7A 5CR3A 5CV7A 4X62L 2VUMG 3NXWA 2JA7G 1SMXA 4GLXA 5IE8A 1XPOA 3GQBA 4A3JG 3QIAA 2MHVA 5I4DA 3CCVA 4MTNA 4I65A 1SNQA 3PIP3 4X6AH 1SE2A 1GUWA 1SMYC 1VQ9A 4K5XA 1U4PA 2VB3X 4WJWA 1X9NA 2BH2A 1YNJC 4A3JB 1CA5A 4KY7A 1JOOA 4APVA 4QMGA 3H94A 3LNNA 4TKOB 4CDEC 3E5SA 1HQRD 2K5DA 3K0XA 3I56A 2CW0D 3K7UC 3NBHB 1G2TA 4CDDC
chains in the Genus database with same CATH topology
3K7AB 1VF7A 2L11A 1CTMA 1EU3A 3T51B 1LT5D 1Y1WB 3I4MB 3BVZA 3F2UA 3IKJA 3Q6SA 5CC4A 3I4LA 5G3LD 2F0WA 1SSOA 1PFNA 5FLXE 3D4RA 5LHY1 4QF4A 4HR7B 3GTMB 2SEBD 1STBA 2KA7A 2AQ2B 1HTPA 4C3JB 3K58A 3EA6A 2Z1CA 4FF2A 2WACA 4DU9A 2FINB 3OMCA 1HFGA 1SYEA 5DEHA 4X3UA 4IURA 1DOLA 3PUVA 2PW5A 4DAVA 5ISRA 4FF4A 3LX0A 2A73B 3I70A 3ITPA 3S17B 2OT2A 4RGNA 2JP1A 3GTKB 3NTHA 2F1MA 1PRTB 2EYMA 4A3GB 2E75C 5EBCA 1SMYD 3C3LA 1U4MA 2NN6H 3QOJA 2IWHA 1HUNA 1JB3A 1TWCB 3MHBA 3R93A 1JOQA 4MIUA 3GV3A 2JSOA 1TIID 4IFDJ 3DEPA 2NTTA 1DYQA 3HS0C 1GHKA 1STGA 4UAIA 2VUMB 4F7XA 3NUCA 2KEDA 1DOKA 1JOKA 1JQYD 1TS4A 3KLSA 5D65A 3MXPA 1KNEA 1IHZA 5CV6A 3VYTA 2XN9C 4FVMA 2RDFA 1EEID 3ONAB 5CGKA 4O42A 2AUKA 2X6GA 5JEAG 2F0HA 1HCZA 4CJ0B 1IYVA 3FEWX 1BDOA 3FKIB 1PTOD 1EWCA 4R8NA 2F0TA 1K8OA 1RD9D 2QCPX 5M5YB 3TZDA 1VF5C 2PCFB 1DZ1A 3OW7A 5ELDA 1WVLA 5C0XH 4ZUIA 4FF3A 3BYTB 3D4DA 2L4NA 2F3WA 4HCSA 2ZXRA 2N55A 3NBHA 2E2HB 1H9RA 1ET6A 3LWUA 1JICA 5LL6S 5IT9L 5DAUA 2WIIB 4ILWA 2K05A 1Z7TA 4NKLA 1YNNC 3A8IE 5I2YA 5D14A 4F88A 5M5WB 3K0YA 1ILQA 2EJMA 4XDXA 4QCLA 3N6RA 1W6JA 2K1BA 1I4GA 2JA6B 4X3KA 1PRTF 2G9DA 1Y8NB 2XRQD 5K5PA 4NMZA 3K6OA 2CHBD 5EPKA 2IT1A 2K03A 4V190 5CYUA 2XWJB 3S16B 4U673 1PZJD 2A6EC 4CGYB 1BCPB 4UDUC 4IUQA 3J7AF 4IQZA 3H09A 3D8GA 4KTAA 4J8QA 2ZT9C 4NP5A 4RKBA 1STNA 3D6WA 3EJIA 2XWBB 3K5LA 5FO8B 4DNTB 3C46A 5KYLA 4DNRB 1JR0D 3GTOB 2ZXPA 1RKNA 1KABA 3IAYA 3T16A 2OF1A 1BR9A 5C0XG 4QB4A 1F2YA 3FVQA 2PZWA 4PMBA 5D3DA 1C4QA 2KJXA 3NQTA 2B2TC 3I91A 1TS3A 4C3HG 1ZYRC 1MBYA 4N9TA 2D2CC 3M4YA 3TSSA 1TU2B 3HOUB 1LTGD 5FLXL 1KDCA 2M00A 2OEOA 1ESRA 4EVOA 1B2TA 3KLSX 5JEAH 2CVRA 3MAQA 1QNUA 4C3HB 1HQMC 1V43A 5LL6X 2BCOA 2XSCA 1GUNA 1U9RA 4RGMA 2NUCA 1EY5A 4DAPA 2Z8LA 1BUVT 1Y8OB 4JBWA 1FNWA 2EE1A 3A8JE 4OGQC 2F0QA 1PTOH 2SDFA 1JC7A 1IKMA 2Y0SB 2ICEC 4M1UB 1EZ8A 2M9VA 1M8AA 1CFMA 4A3MB 1EY6A 2EZVA 3I3CA 1CM9A 3DUZA 4A3DB 1A3TA 4LJZC 1HA6A 2B2VA 2L5TA 1B44D 5EJWA 3GTPB 3BS1A 4KHZA 2E2JB 4IUNA 2PPBC 3FMCA 2O5JC 3L9AX 3KF8A 1U4LA 1BCPF 4DN4M 4IZ8A 4RFBA 3HOWB 4HAEA 4DK0A 3E6ZX 5M3FB 4KJOA 4WORA 2ID0A 3V2TA 2PNRC 4CBVA 2FMMA 3D6CA 4CKEA 5T1GA 4XT1B 2IX3A 1LTRD 1JWMD 1QOHA 2A5HA 2B2TA 3OWEB 5T1IA 2A68C 1LABA 4KY5A 1SNPA 3IL8A 1H9KA 4H44C 1Q90A 2QF7A 2A6ED 1JE4A 1RCVD 1SNOA 4IFDG 2F0LA 1ENAA 1OXUA 1X32A 1HUMA 1BBXC 3DWAA 3Q0AA 2KQ3A 2F0MA 3C1EA 3UI2A 2LKVA 1AN8A 1DM0B 1T5EA 3I4NB 3KBGA 2B2YC 4KI0A 5EPJA 4ZQ3A 5EKLA 5HURA 5CBAE 1SDFA 1D6EC 3G7LA 4FXKC 3GD7A 4A3BB 1CQVA 2WP8J 5KGUA 4S3SA 4L8JA 5KNBA 1VMPA 1I3QB 3QG1A 1DCZA 4C3JG 3MZ5A 1XX8A 1RODA 1PDQA 4EQNA 5I9OA 3DXJC 2CQAA 4BA2I 2JYOA 2B2VC 4G57A 5JVH3 3GV6A 2NVQB 1B53A 1QE6A 1IW7D 4K2KA 1KDBA 2AWNA 1D1KA 3HEJA 4G7ZC 1ONLA 3K5MA 5A2QL 4H0LC 3GTLB 1BXTA 1E2WA 5JEAJ 1VDZA 1RDPD 1T5XD 3BVMA 4XIGS 4K6LA 1STAA 4ZK9B 1EY8A 2MPMA 1QILA 1AZQA 2L0CA 1SFOB 1R9TB 2YU9B 1S5DD 1BQQT 1HFNA 4F87A 5I2XA 2PZTA 5KIXA 3T56B 4ZLTF 3P20A 1G8ZD 1QCBD 2QEJC 1ENCA 2AQ1B 2NWGA 3VR2A 5IGEA 2IX1A 3CRLC 2EYHA 2EYPA 5JAVA 1GJXA 4C2MB 3GTQB 2NN6G 1HRJA 3OPOA 4H7BA 1STEA 4KJNA 2EYFA 1E2VA 2RDGA 1VCIA 3T53B 4MN3A 3K57A 1EFID 5C5MA 5FO7B 3OIPA 2B63B 1FYCA 4IUPA 3BG3A 2I07B 2XIWA 1PTOF 3LWEA 5I6YA 1M4VA 1LTID 3PUXA 2K5WA 5E1FA 3WOEA 1EQTA 1AEXA 4BY1B 1EQVA 3OHXC 1OO9B 1TVXA 4Q5VA 4RGTA 4KK7A 5ELBA 3CQZB 2PMZB 4ZYSA 1HXYD 2RBMA 1TS5A 3SEBA 1SNCA 1EY7A 2EYOA 3BZDB 4LMQD 1B1ZA 2NZ1D 3NPPA 5IODA 1DXMA 3R2TA 3IFTA 1KNAA 2EY2A 4AYBB 1CHPD 3OWFA 1NUCA 1QB5D 3M85A 3NTKA 3NBIA 4GZYC 5BN5A 1XWEA 2H4OA 3HG9A 4HN7A 4BWGB 3BDOA 3J81E 1SBBB 4KKUA 4Q0FA 5JPMC 5CBEE 2D62A 2O4XA 5CV8A 4EGVA 1ILPA 5AFWA 4PMWA 3TDQA 2HQEA 2B2YA 2LMCB 3FDTA 1AZPA 3G6JB 3TMEA 3MA2B 1X3PA 1EU4A 1IL8A 2B8GA 2G9HD 3VR5A 5EPLA 3DM1A 2K28A 1BO0A 1WCMB 1GHJA 1FNVA 4C3IG 3PV0A 1EWHA 2QKIC 4TSSA 4G7HC 1G291 2F0FA 2D5DA 3SK8A 3M3YB 2PQEA 1O7LA 1SYCA 3ZYYX 1YNND 4C1NK 5M9OA 5E3FA 3PIO3 4O1NA 1LTSD 2XNAC 2EPBA 1WD1A 1QG7A 1JORA 5CV9A 2Q8IB 4KN7C 3S2HB 2X69A 3DMUA 4K6DA 1Y69U 3KK7A 1PRTD 3DEOA 1PMRA 3L7ZC 3S1RB 3NSWA 4ZKCB 3HKZB 1HTLD 1V1PA 5E4XA 2NBFA 1WTOA 1G2SA 1LT4D 2HCIA 3NP8A 4HTHA 1BOSA 2X6LA 3PO2B 1WTXA 3KBXA 1STYA 3CHBD 2EJGC 2IPKD 1E0BA 4LK1C 3Q22A 3VA7A 4BA1I 1Y1VB 1RF2D 5F2DA 3AB9A 2A6HC 1C48A 2LFNA 5IGGA 5C4HA 1NSNS 1DONA 4ZAIA 3IFDA 1JWUD 3A7LA 2JA7B 4BS9A 2F0NA 2C9OA 5TSSA 1CK1A 4DFAA 1TWFB 1QJOA 5EBDA 4L6TB 2WAQB 2I46A 5C5LA 3RZDB 4J1MA 3TP7A 1ET9A 4DA2A 3T4AC 5CORA 4RKLA 4HMIA 3VYUA 4ME5A 1D5XC 2F3VA 1SJED 1AP0A 1G91A 1SAPA 3A54A 2WKCA 3SK6A 2LY7A 2F0EA 1HPCA 3HOZB 1GUTA 3KUPA 3J7AV 4NDXA 2EY1A 1JWSD 1Q1EA 2L1BA 2HDMA 3BDCA 1RJTA 3S1MB 4TQUS 3HOVB 3T13A 3R8BA 3BDLA 1F9PA 1EY0A 4KD3A 2F0VA 3H3VC 1ZEQX 2KOLA 1SYGA 1Q3LA 2K5QA 1CHQD 2F0SA 1EY9A 3NWSA 1DD2A 1IKLA 1OXTA 1KAAA 3J80E 1DOMA 3VA5A 4RHSA 1PTOB 2Z4IA 1ENFA 1FGBD 1TWHB 2Q8TA 5IOCA 1PRTC 4X3SA 3AMUA 4XTCS 4ZKBB 2A6HD 3HOXB 3W2DA 3NTIA 3S1NB 3EROA 1DJRD 3MTSA 4A3FB 1C8CA 4OO1H 1OXXK 4OL7A 3GO5A 1A2UA 3GTGB 3SR1A 2RSNA 3SHLA 5K36H 3X3NA 3U9SA 3HRZC 5ELEA 3P75A 1V8QA 3QO2A 3U9OA 2JA5B 2EY5A 1LV9A 2SNSA 3S15B 4G4KA 2JEBI 1B9MA 1R4PB 5IT9E 4L63B 1Q1BA 4RCNA 1ZKOA 1TT2A 5IGBA 1WTQA 4TRDA 5A2QE 3PUYA 4DK1A 2R6GA 4OO1I 1Y8PB 3MC0B 3CRKC 3R3OA 4Z9CB 1GOZA 2RDHA 2EYJA 1R4QB 5JOBA 1S5FD 1L0XB 4OIKA 1G6ZA 1HHVA 3DWQA 2WINB 2E2DC 2NB0A 4FO2A 4IN3A 3EVQA 1PXUA 2PYKA 1I4RA 3FPUB 4EQOA 4QUFA 1ML0D 5CV5A 5C3WA 1EY4A 1I6HB 4IUVA 1E2ZA 1TWAB 2K6AA 3ERQA 1V1PB 2F0KA 3H0GB 2YYZA 2WKDA 4PQXA 1H9MA 3TP5A 3A55A 3RLFA 1FD7D 1LT3D 4EQPA 2F0OA 2J7ZA 3URYA 1GUGA 1TY0A 4MHEA 1RTOA 4KY6A 2NVTB 5J1ZA 1ZYRD 1X3QA 3M7GA 4Y7NB 5JJZA 4X3TA 2O2LD 1U4RA 2F0IA 1NR2A 2BDOA 4HCEA 4OHJA 3WDNA 2NVYB 2RQXA 2BA0A 1XYIA 1LACA 4CJ1B 1TS2A 3NWTA 2DNEA 2TMPA 2KVMA 3E0JA 1J8IA 5DM63 4OIJA 1EYDA 1XTCD 3Q23A 4A3EB 1S5CD 2IW3A 4K5VA 4K2LA 4C3IB 2F0DA 4DF7A 3I72A 3VR3A 4HSVA 4RA8A 3X3MA 1GUSA 2V4DA 2B8FA 5FK9C 5C3XA 3Q24A 3V96A 2BDNA 2EXZA 2ICIA 1EL0A 1B3AA 2QILA 1BNZA 2KHSA 5C4JB 2KECA 1S5BD 4ZUJA 4FXDA 5M5XB 2FJ2A 1RTNA 2R92B 4KHVA 4WRDA 2K33A 4FYDA 1UAPA 4KV6A 2A69C 4DXFA 3QOLA 1O7YA 4FP5D 2IL8A 1CI3M 1SYFA 4E6IA 3W3AA 2D9UA 3GTJB 4M8AA 3OMGA 2HCCA 1LT6D 1PFBA 3A56A 1PTOC 3RZOB 4RWSC 3EFXD 2R7ZB 3HP3A 1SNDA 1H9JA 2KEEA 1KLUD 4KN4C 4B9XA 1L0YB 4IFDH 1FR3A 2AUJD 3HZXA 4K5WA 3P7JA 3DWPA 2MP1A 3RUZA 1WTPA 2SNMA 3NK9A 1B4OA 1QWYA 4G7OC 1SEBD 2KCCA 3HGBA 5KEEA 1I4QA 1KTKA 2ENBA 1TWGB 2EDGA 5C4XB 1A3VA 2GA4B 3PMFA 1O80A 3I73A 4XQNA 3V05A 1Z47A 4DGZA 1SE4A 3MEHA 3S14B 2N88A 1S4ZA 3KLRA 3SK5A 3SXHA 5C0XJ 4I7ZC 3TN2A 5FOBB 1WTVA 1IW7C 4HSPA 1LLRD 2K01A 4CKCA 4B08A 1J9OA 5DM73 4A93B 1B50A 4HMJA 3QB3A 2KCNA 1ZXTA 1F2LA 2AQ3B 1I4HA 1O78A 3VR4A 5EQ0A 1OXSC 1NAPA 3TZUA 2DY8A 2RSOA 1O7ZA 1WD0A 2QDBA 4C56C 1A6XA 3D31A 2BA1A 4QIWB 1MSGA 3PUWA 3SK4A 5CV4A 4PNYA 3ND8A 1XXGA 2F03A 1ESFA 3O13A 4B9WA 2F0PA 3D3RA 3OOCA 5HGTA 1CT1D 1TKWB 1EOTA 3NHHA 1MGSA 1KLGD 1LTTD 1ICWA 2F0UA 2R3ZA 3TP8A 4ID6A 1K83B 3AU7A 4XQQA 5I9PA 2R93B 2AWOA 4FXGC 4LAAA 3S1QB 2NYZD 5D3IB 3K5NA 1F2MA 3JAML 4ABNA 3A8KE 2RKSA 4IALA 3J80L 4RH6A 5G3LF 5CMDA 2E74C 2WB1B 1Q12A 1MD2D 3H6MA 4C1NI 2IX0A 3M4OB 2FFKB 3OSOA 2VNUD 2FHTA 3CU7A 2LS01 4A3IB 4RHRA 4QUCA 2F4IA 3D4WA 3S2DB 2KUMA 4BBRB 1SJHD 1LTAD 3P1HA 4U68A 2RVLA 5C44B 1A3UA 1K8MA 4BY7B 1GXDC 3L3OC 5EKKA 1CA6A 3CKIB 2EOTA 5J22A 4XYOA 4R8IA 3NQIA 4KMUC 5IIFA 2B2UA 4HEDA 1F9QA 4FNFA 2MJ8A 1PZKD 2IJ0A 3GP7A 3TP6A 2VXWA 3SVMA 4WFN3 1GUOA 2K7VA 3J81L 1PZID 1UEAB 1EZ6A 3M7NA 2JEAI 4K8IA 3MFYA 1BCPD 4PV1C 1W6KA 4KD4A 1NR4A 1PFMA 2DN8A 4NW2A 5NUCA 1TR5A 1STHA 3MXGA 2EVBA 5ELCA 3BVGA 2A68D 3PO3B 3BYYB 2BE5C 4FF1A 2NTSA 4PMCA 3PUZA 3MVVA 2BOSA 1D5ZC 1MSHA 3I8ZA 1A15A 3JAME 5ELFA 2F0JA 2B2UC 2OXPA 3NE5B 4ULLA 2JXMB 3VR6A 5C6AA 3RD4A 5JPNC 2MUYA 1D2BA 2DNCA 1WTWA 2Q8RE 4DAYA 3MWYW 5IGCA 5FKAC 4RCOA 1LO5D 2C5CA 1TQOA 1I50B 1CZGA 2RA4A 5KRUA 1YNJD 2HDLA 2A69D 2L55A 1HA5A 2NN6I 5BN3A 5C3EB 2B39A 4XT3B 2K04A 4J6HA 2A74C 4F8MA 5C4ZA 1UNSA 1EIHA 5M3MB 2MGSA 1D1IA 5IGFA 5KNCA 3I90A 4IFDI 5J39A 1SYDA 5EKIA 1RHPA 2L12A 5BN4A 3WOFA 2Z4HA 4KKSA 1CQFA 1II3A 1I4PA 5K36G 5E4WC 4P2CB 4H13C 1SXTA 4OO1G 2B2WC 1I4XA 3ND9A 1F2ZA 4KKTA 1QNKA 3MFGA 2BE5D 5A35A 3OIQA 2VB2X 4JK1C 4XXEA 2E76C 2EY6A 2HUGA 2PO4A 1A2TA 4R9WA 4XYQA 5C0XI 3C1FA 4ODGA 1PLFA 3FPPA 3HOYB 2K32A 1EYAA 3J7YW 1Q8IA 1S5ED 4K14A 1I6VC 5KYIA 4CKBA 1JCKB 2CW0C 1Z6HA 2TSSA 3K59A 2L9HA 3H91A 2R61A 5IGDA 2EYLA 3EQLC 2H1EA 3R2IA 5DNFA 2E2IB 3K5OA 5EGTA 3DHQA 5KNDA 2J4XA 2PW7A 3SE0A 2ZXOA 4IUUA 3RMHA 1LTBD 3SDZA 4XQJA 1MI2A 1VMCA 3N52A 1F77A 1IYUA 2F0GA 2NVXB 1FNUA 1B9NA 4RAUC 5FO9B 3FRPB 2O5IC 1AFPA 3C2PA 4IUTA 1BF4A 3S9WA 1EEFD 3MXNA 1OXVA 1SNMA 1KDAA 1UUPA 1D5MC 2JA8B 1F9SA 4RGOS 3QWNA 2J0TD 4CJ2C 1AW7A 2FMCA 2XRSD 5I6WA 2B2WA 2WV6D 2M2LA 3QJYA 2JE6I 2EJFC 1WTRA 3MXUA 5COYA 4V0BA 5JVG3 1F9RA 4N9PA 3VYSA 1SYBA 3VYRA 4K8JA 3TBIB 1EIGA 4YIJA 3A7AB 1H9SB 2PZUA 4DXGA 2XVSA 4CHTB 1EYCA 1CZWA 4A3KB 1SE3A 1BCPC 1V1OA 1TY2A 1H9SA 4ZRZA 1NCVA 2SOBA 4BBSB 1PYWD 2DY7A 5CR3A 5CV7A 3NXWA 3GQBA 3QIAA 2MHVA 5I4DA 4I65A 1SNQA 3PIP3 1SE2A 1GUWA 1SMYC 4K5XA 1U4PA 2VB3X 4WJWA 1YNJC 4A3JB 1CA5A 4KY7A 1JOOA 4QMGA 3H94A 3LNNA 4TKOB 3E5SA 1HQRD 2K5DA 1G2TA 2CW0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T5E A;  3ND8 A;  1VF7 A;  3AB9 A;  4KKU A;  1Y8N B;  2A6H C;  3A8J E;  3MFY A;  3P20 A;  5KNC A;  1CTM A;  4OGQ C;  1IYU A;  2D62 A;  4KI0 A;  1B9N A;  5BN4 A;  2O5I C;  3OOC A;  2IT1 A;  1GHK A;  4PV1 C;  1DD2 A;  1TKW B;  4KKS A;  3T51 B;  2LMC B;  3VR2 A;  5K36 G;  3I72 A;  3VR3 A;  1OXT A;  1CFM A;  3CRL C;  3IKJ A;  4G7O C;  1OXV A;  2KCC A;  2A6E C;  3GD7 A;  3HGB A;  1GUS A;  2DN8 A;  2V4D A;  2B8F A;  3A7L A;  3I4L A;  4H13 C;  2EVB A;  4IQZ A;  4OO1 G;  1GJX A;  2NN6 G;  3OPO A;  4L8J A;  2EDG A;  5KNB A;  2AWO A;  2A68 D;  2B8G A;  3ND9 A;  3VR5 A;  3QG1 A;  1E2V A;  1E2Z A;  1VCI A;  2BE5 C;  4KKT A;  2ZT9 C;  4LJZ C;  4XTC S;  3T53 B;  1DCZ A;  2L5T A;  3PUZ A;  2A6H D;  4KHZ A;  1FYC A;  2BE5 D;  5A35 A;  3A8K E;  3FMC A;  3I73 A;  2PPB C;  2O5J C;  2AUK A;  1GHJ A;  3DXJ C;  4OO1 H;  1OXX K;  3D4R A;  2E76 C;  3BG3 A;  3QJY A;  2JE6 I;  2E74 C;  4JK1 C;  1QJO A;  1Q12 A;  2YYZ A;  3PV0 A;  1EWH A;  1HCZ A;  5KND A;  4BA2 I;  1H9M A;  2EJF C;  4DNR B;  1IYV A;  3MXU A;  4HR7 B;  3RLF A;  1BDO A;  5K36 H;  3NE5 B;  4G7H C;  2KA7 A;  1G29 1;  2JXM B;  3PUX A;  3VR6 A;  1HTP A;  3KLR A;  4DK0 A;  3U9S A;  2D5D A;  1GUG A;  4I7Z C;  1K8O A;  1O7L A;  2K33 A;  1VF5 C;  2PCF B;  4DNT B;  3A7A B;  5C0X G;  1H9S B;  3FPP A;  4JBW A;  1V8Q A;  1IW7 C;  2A69 C;  2PNR C;  2K32 A;  2DNC A;  3OW7 A;  5C0X H;  1K8M A;  1IW7 D;  3VR4 A;  1ZYR C;  1CI3 M;  2Q8I B;  4KN7 C;  1H9S A;  2D2C C;  1I6V C;  3M4Y A;  1ONL A;  3W3A A;  4G7Z C;  1TU2 B;  2A68 C;  4H0L C;  4DK1 A;  1LAB A;  2CW0 C;  1Y69 U;  2JEB I;  1Z6H A;  1HPC A;  3PUV A;  1B9M A;  1PMR A;  3L7Z C;  1GUT A;  1E2W A;  1H9R A;  1H9K A;  4KMU C;  4H44 C;  1VDZ A;  1O78 A;  1Q1B A;  1Q90 A;  2QF7 A;  1DXM A;  3GQB A;  2BDO A;  2A6E D;  3QIA A;  3LWU A;  1OXS C;  5JEA H;  3IFT A;  4RCN A;  4XIG S;  3TZU A;  3EQL C;  1Q1E A;  1ZKO A;  1HQM C;  2F1M A;  1V43 A;  4IFD G;  1SMY C;  3WDN A;  1A6X A;  3M85 A;  1H9J A;  1GUN A;  2E75 C;  4TQU S;  1YNJ C;  1OXU A;  1Z7T A;  3PUY A;  3D31 A;  2BA0 A;  2BA1 A;  4KN4 C;  1YNN C;  2A69 D;  2R6G A;  3A8I E;  1LAC A;  1Y8P B;  3H94 A;  3LNN A;  3SE0 A;  2NN6 H;  5BN5 A;  4TKO B;  1GUO A;  2K7V A;  2NN6 I;  4GZY C;  2EJG C;  3PUW A;  4LK1 C;  3CRK C;  5BN3 A;  2DNE A;  4IFD H;  3VA7 A;  1FR3 A;  2AUJ D;  2EJM A;  4BA1 I;  5JEA G;  3SDZ A;  3N6R A;  3M7N A;  2JEA I;  3BDO A;  1Y8O B;  3T56 B; 
#chains in the Genus database with same CATH topology
 1P16 A;  3K7A B;  1VF7 A;  2L11 A;  1Y1V G;  3KJP A;  1CTM A;  1EU3 A;  1QZG A;  2XGT A;  1O7I A;  1A62 A;  1YJW A;  3T51 B;  1LT5 D;  1Y1W B;  3I4M B;  3BVZ A;  3F2U A;  3IKJ A;  4LFA Q;  1EUJ A;  4A3L H;  4EQ5 A;  2Q2H A;  3Q6S A;  5CC4 A;  4BY1 G;  3I4L A;  2CFM A;  5G3L D;  2F0W A;  4DV1 L;  5M3M G;  3S17 H;  3KF8 B;  4AYB E;  1SSO A;  1PFN A;  3BJU A;  5FLX E;  3D4R A;  5LHY 1;  4QF4 A;  4HR7 B;  3GTM B;  2SEB D;  1STB A;  2KA7 A;  2AQ2 B;  1Q81 C;  2E2J H;  1HTP A;  2I5L X;  5J3B A;  3I4N G;  4C3J B;  5E7N A;  3K58 A;  3EA6 A;  4OEL B;  2Z1C A;  1VQO A;  2E8G A;  4FF2 A;  2WAC A;  3HOZ H;  4DU9 A;  3S1N H;  2ATW A;  5JJL A;  2FIN B;  3OMC A;  1HFG A;  4WJ4 A;  1SYE A;  1E1O A;  5M5Y H;  2KCT A;  5DEH A;  4X3U A;  2D0O A;  3T1H Q;  2IY5 B;  4X65 L;  4IUR A;  1DOL A;  1E1T A;  3PUV A;  1N33 Q;  2PW5 A;  2VY3 A;  4DAV A;  5ISR A;  4FF4 A;  3LX0 A;  2A73 B;  3I70 A;  3ITP A;  2ZJP A;  3S17 B;  2OT2 A;  4MTK A;  4R1J A;  4RGN A;  2JP1 A;  3GTK B;  4L5Q A;  2MO0 A;  3NTH A;  2F1M A;  4JVZ A;  1PRT B;  2EYM A;  1HNZ Q;  4A3G B;  2E75 C;  5EBC A;  1SMY D;  3Q8D A;  1U4M A;  5M3M H;  3C3L A;  3W1G A;  2NN6 H;  1FGU A;  2CWP A;  3QOJ A;  2IWH A;  1IBL Q;  3AFP A;  1HUN A;  1JB3 A;  1TWC B;  4NXM Q;  3MHB A;  4NXM L;  2QGQ A;  2WB1 E;  2KHJ A;  1E22 A;  3R93 A;  2JA5 H;  2DJF C;  5IWA L;  1JOQ A;  1K0S A;  4MIU A;  3GV3 A;  4DV1 Q;  4ME3 A;  1TXY A;  1T9H A;  1XTD A;  2JSO A;  3CAM A;  1TII D;  4IFD J;  3DM3 A;  3DEP A;  2NTT A;  1DYQ A;  3HS0 C;  1ASY A;  1GHK A;  1YEZ A;  1STG A;  4I7A A;  4UAI A;  4B3R L;  2VUM B;  4F7X A;  3NUC A;  2KED A;  1DOK A;  1S72 A;  4BBS G;  4LF4 L;  1JOK A;  1JQY D;  4JOI C;  1V9P A;  1TS4 A;  2PNH A;  3KLS A;  5D65 A;  3MXP A;  4YCV A;  5ELN A;  1VQJ A;  1KNE A;  1IHZ A;  5CV6 A;  3VYT A;  2XN9 C;  3F2B A;  4FVM A;  2RDF A;  2N3S A;  1EEI D;  3ONA B;  5CGK A;  2IHE A;  1XMO L;  4O42 A;  4DAM A;  2AUK A;  1N32 L;  3UDG A;  2X6G A;  2ZTD A;  2CCZ A;  4UP9 A;  5JEA G;  2F0H A;  2E5L Q;  1HCZ A;  2MO1 A;  2K14 A;  4CJ0 B;  1IYV A;  3FEW X;  2NVY H;  1LM0 A;  3A5U A;  1BDO A;  3FKI B;  1PTO D;  1EWC A;  4R8N A;  2F0T A;  4YY3 L;  1K8O A;  1RD9 D;  2QCP X;  3J81 c;  5M5Y B;  3TZD A;  1VF5 C;  2PCF B;  2HQL A;  1DZ1 A;  4DAY B;  4A3D G;  3GTO H;  3OW7 A;  5ELD A;  1WVL A;  5C0X H;  3ICE A;  4ZUI A;  4FF3 A;  3BYT B;  1SLJ A;  3D4D A;  2L4N A;  2N8N A;  4R4Q A;  2F3W A;  4HCS A;  2ZXR A;  2N55 A;  2NVQ H;  3NBH A;  5C4X H;  2E2H B;  1AH9 A;  2EIF A;  1H9R A;  1ET6 A;  3LWU A;  2JA5 G;  1EFW A;  1JIC A;  5LL6 S;  5IT9 L;  5DAU A;  2LXK A;  4DV6 L;  1N32 Q;  4Y7N H;  2WII B;  4NXN Q;  2CKZ B;  3HOU G;  4ILW A;  4HJ8 A;  2K05 A;  1Z7T A;  4NKL A;  3I2Z A;  3T1H L;  4BBR H;  1YNN C;  3A8I E;  5I2Y A;  3S16 H;  5D14 A;  4F88 A;  4A75 A;  5C44 H;  2K52 A;  5M5W B;  3K0Y A;  1ILQ A;  2EJM A;  4XDX A;  4BY7 H;  3RN2 A;  4QCL A;  4L5R C;  4JI5 L;  3N6R A;  2P5Z X;  1W6J A;  2K1B A;  4HJ9 A;  1I4G A;  3HOX G;  4X3K A;  2JA6 B;  2YU9 H;  1PRT F;  2G9D A;  1Y8N B;  2XRQ D;  1I3Q H;  4LF7 L;  5K5P A;  4YCW A;  1IBM Q;  4NMZ A;  3K6O A;  1K73 C;  3S1M H;  2CHB D;  3F8T A;  2IT1 A;  5EPK A;  2CH4 A;  2K03 A;  1QZH A;  4V19 0;  4OX9 Q;  2B3G A;  5CYU A;  2XWJ B;  4JPB W;  3S16 B;  4U67 3;  2QDL A;  1PZJ D;  5IWA Q;  2A6E C;  4CGY B;  1MJE A;  1BCP B;  4UDU C;  1NE3 A;  4IUQ A;  1A0I A;  4IQZ A;  3J7A F;  3H09 A;  3H0G G;  3D8G A;  2F52 A;  3H3V I;  4KTA A;  4P72 A;  4J8Q A;  1B70 B;  2ZT9 C;  4NP5 A;  4GOP A;  4JI6 L;  4RKB A;  3U50 C;  5IYC H;  2NZH A;  1STN A;  3D6W A;  3EJI A;  4GKK Q;  1YBY A;  3LGJ A;  2XWB B;  3G4S A;  3CPF A;  5LMN L;  3PO3 G;  3K5L A;  4FDB A;  5FO8 B;  4N8X 1;  4DNT B;  3C46 A;  5KYL A;  4DNR B;  3OYY A;  3NEN A;  5IYC G;  1JR0 D;  5JJI A;  3GTO B;  5IP7 H;  3GTP H;  2B63 H;  2ZXP A;  1RKN A;  1KAB A;  3IAY A;  3T16 A;  2OF1 A;  3KLW A;  1BR9 A;  5FLM H;  5C0X G;  4DR6 Q;  4QB4 A;  1F2Y A;  3FVQ A;  2PZW A;  4PMB A;  5D3D A;  1C4Q A;  2KJX A;  3NQT A;  2B2T C;  3I91 A;  1TS3 A;  4UP7 A;  3PGZ A;  4LFA L;  4C3H G;  1ZYR C;  2QW7 A;  3E9H A;  1MBY A;  4N9T A;  2D2C C;  3M4Y A;  2F4V Q;  3TSS A;  1TU2 B;  2UUB Q;  3HOU B;  1LTG D;  2M00 A;  1KDC A;  2OEO A;  5FLX L;  3E9I A;  2YTX A;  1ESR A;  1DGS A;  4GN3 B;  4EVO A;  1B2T A;  3KLS X;  3J80 i;  5JEA H;  4LF9 Q;  4JI0 Q;  3TS0 A;  2CVR A;  3MAQ A;  1PH6 A;  3KDF B;  1QNU A;  4C3H B;  1HQM C;  1V43 A;  5LL6 X;  2BCO A;  2XSC A;  1GUN A;  1VQ4 A;  2HT1 A;  1U9R A;  4RGM A;  1K9M C;  2NUC A;  4AQY Q;  3PO2 G;  2QA4 A;  5C3E G;  4A3E H;  1EY5 A;  4HJA A;  1KAW A;  4DAP A;  1J5E Q;  4B3S L;  2Z8L A;  3OTO Q;  3A5Z B;  1BUV T;  1Y8O B;  4JBW A;  4BBS H;  4DV7 Q;  1FNW A;  2EE1 A;  3I4M H;  3A8J E;  4OGQ C;  2F0Q A;  1VQ6 A;  2Y0S E;  1PTO H;  5C4X G;  5IYD G;  2SDF A;  1JC7 A;  1IKM A;  2Y0S B;  2ICE C;  4M1U B;  1EZ8 A;  1HR0 W;  2M9V A;  1AE2 A;  1CFM A;  1M8A A;  4A3M B;  3RZO H;  1EY6 A;  2HD3 A;  4OX9 L;  4JV5 L;  1W3S A;  2EZV A;  3HOX H;  5LMU Q;  4GN5 A;  3I3C A;  1CM9 A;  1EIY B;  3DUZ A;  5C3E H;  4JI4 Q;  4A3D B;  1V1Q A;  1A3T A;  1KIX A;  4LJZ C;  1HA6 A;  2VQE Q;  2HHH L;  1FL0 A;  2B2V A;  2L5T A;  1B44 D;  5EJW A;  3BS1 A;  3GTP B;  4QJF A;  4KHZ A;  2E2J B;  4IUN A;  2PPB C;  3FMC A;  4JI8 Q;  2O5J C;  3L9A X;  2V1C C;  3KF8 A;  3T1Y L;  4JI7 L;  1U4L A;  1Y14 B;  1BCP F;  4DN4 M;  4IZ8 A;  2K75 A;  4JBM A;  4DR7 L;  4DR1 Q;  4RFB A;  3HOW B;  4HAE A;  2WAQ E;  3F1Z A;  4DK0 A;  3E6Z X;  5M3F B;  4LF4 Q;  4KJO A;  1Q86 C;  4POG A;  4WOR A;  2ID0 A;  3V2T A;  3HOW G;  2PNR C;  4CBV A;  2FMM A;  3D6C A;  4CKE A;  4R4C A;  1HNW Q;  5T1G A;  4XT1 B;  2IX3 A;  2WFW A;  4YWM A;  1LTR D;  1JWM D;  1QOH A;  2Q2I A;  2A5H A;  2B2T A;  3OWE B;  3CCE A;  5T1I A;  2A68 C;  1LAB A;  4KY5 A;  1H95 A;  1SNP A;  3IL8 A;  1H9K A;  4H44 C;  3PCO B;  1Q90 A;  2QF7 A;  1GD7 A;  2A6E D;  1JE4 A;  1RCV D;  1SNO A;  3RLO A;  4IFD G;  2R7F A;  3AYH B;  2LXJ A;  1HR0 L;  2F0L A;  1ENA A;  1OXU A;  1X32 A;  4B3T L;  1C7Y A;  4DPG A;  3IRB A;  4A93 H;  3CPW A;  1HUM A;  5L37 A;  1BBX C;  3DWA A;  5M3F H;  4BY1 H;  3Q0A A;  2KQ3 A;  4POF A;  2F0M A;  1YHQ A;  1IBK Q;  4AYB G;  3L0O A;  3C1E A;  3UI2 A;  2B29 A;  3U4V A;  2LKV A;  3NEM A;  1PHJ A;  1AN8 A;  1DM0 B;  1T5E A;  3I4N B;  4IPC A;  3KBG A;  1HH2 P;  2B2Y C;  4KI0 A;  1RIP A;  2KHI A;  4ZQ3 A;  5EPJ A;  3ULP A;  1PH1 A;  5EKL A;  3RN5 A;  5HUR A;  5CBA E;  5IYB G;  3CC7 A;  1SDF A;  1VQA A;  1D6E C;  1Z9F A;  3G7L A;  4FXK C;  4LUO A;  3GD7 A;  1WFQ A;  4BY7 G;  4A3B B;  1CQV A;  2WP8 J;  5KGU A;  5FLX c;  4S3S A;  3I7F A;  4L8J A;  1VMP A;  5KNB A;  1XNR Q;  1QVC A;  3I4N H;  1I3Q B;  3L2P A;  3QG1 A;  1DCZ A;  4C3J G;  3MZ5 A;  4A3E G;  1XX8 A;  2ZTC A;  1ROD A;  1PDQ A;  4EQN A;  5I9O A;  3DXJ C;  5AJ3 Q;  2R7Z H;  3TQY A;  2CQA A;  4BA2 I;  1GO3 E;  2UXD Q;  2JYO A;  2B2V C;  1HNZ L;  4G57 A;  3PF4 A;  2VQE L;  2HHH Q;  5JVH 3;  3GV6 A;  4DV2 L;  4P73 A;  2NVQ B;  1SRU A;  4JI2 L;  1B53 A;  1QE6 A;  2R93 G;  3UE1 A;  1QVG A;  3PF5 A;  1IW7 D;  4K2K A;  1TWA H;  1KDB A;  2AWN A;  1D1K A;  3CME A;  3HEJ A;  1PV4 A;  4PZ8 A;  4G7Z C;  1ONL A;  3K5M A;  5A2Q L;  4H0L C;  3GTL B;  4JI0 L;  2Q2U A;  2KEN A;  4ZCK A;  1BXT A;  2HIX A;  4KLK A;  1E2W A;  5JEA J;  1VDZ A;  1RDP D;  3S24 A;  4A3M H;  1T5X D;  3RNU A;  2JK8 A;  2Z9H A;  2NZO A;  3S2D H;  3BVM A;  4XIG S;  4K6L A;  1STA A;  3GDE A;  4QGU A;  1CKO A;  4JG2 A;  1U0L A;  4ZK9 B;  3FP9 A;  1EY8 A;  2MPM A;  1QIL A;  4LWC A;  2L0C A;  1AZQ A;  4IOA A;  2MNA A;  1SFO B;  2KCM A;  4DV5 L;  4AQY L;  1R9T B;  1S5D D;  2YU9 B;  1BQQ T;  4K0K L;  1I50 H;  1HFN A;  4F87 A;  5I2X A;  2PZT A;  1BKB A;  4DR2 Q;  4DV6 Q;  2JA6 G;  5KIX A;  3T56 B;  4YHH L;  1IBK L;  4ZLT F;  3P20 A;  1G8Z D;  4N8F A;  1QCB D;  2QEJ C;  3KOJ A;  4LF8 Q;  1ENC A;  2AQ1 B;  2NWG A;  3I4O A;  3VR2 A;  5IGE A;  2RF4 A;  2YV5 A;  1SN8 A;  3CRL C;  2IX1 A;  2EYH A;  2EYP A;  5JAV A;  1UE5 A;  2VW9 A;  1GJX A;  4C2M B;  3GTQ B;  2NN6 G;  4DR7 Q;  3OPO A;  1HRJ A;  4A76 A;  4H7B A;  1L1O B;  4JBJ A;  3F2C A;  1STE A;  4KJN A;  2EYF A;  1E2V A;  2RDG A;  1VCI A;  3T53 B;  4MN3 A;  3K57 A;  3T1Y Q;  1EFI D;  5C5M A;  5FO7 B;  3OIP A;  2AHO B;  1PYS B;  2B63 B;  1FYC A;  3G71 A;  2K4K A;  4IUP A;  1XPR A;  3BG3 A;  1KD1 C;  2I07 B;  2XIW A;  1PTO F;  3LWE A;  4IOC A;  5I6Y A;  4BXX G;  2OTL A;  4GOP C;  1XMQ Q;  1TWG H;  1M4V A;  1LTI D;  3PUX A;  3JAM i;  2K5W A;  1NMF A;  5E1F A;  3WOE A;  1EQT A;  1AEX A;  1K3R A;  4BY1 B;  3I55 A;  1EQV A;  2PMZ E;  3OHX C;  1OO9 B;  1TVX A;  4QY7 A;  4Q5V A;  1A8V A;  4RGT A;  4YCU A;  3UDF A;  1PH2 A;  4KK7 A;  5ELB A;  3CQZ B;  2PMZ B;  4ZYS A;  1HXY D;  2RBM A;  1TS5 A;  3SEB A;  3AFQ A;  2OCE A;  1SNC A;  1EY7 A;  1QVF A;  2EYO A;  4A3F H;  1JJC B;  3BZD B;  4LMQ D;  1B1Z A;  2F3I A;  2NZ1 D;  1YIJ A;  3NPP A;  5IOD A;  1HJP A;  1MIU A;  1D7Q A;  1DXM A;  3R2T A;  3IFT A;  1KNA A;  2EY2 A;  4AYB B;  1CHP D;  3OWF A;  4QQB X;  1NUC A;  1QB5 D;  4QIW E;  3M85 A;  1VQE A;  3NTK A;  3NBI A;  3RR5 A;  4GZY C;  5BN5 A;  4HIM A;  4HIO A;  1XWE A;  4IJH A;  2H4O A;  4GN4 B;  4DV4 L;  3HG9 A;  4HN7 A;  4BWG B;  2OQK A;  3EN2 A;  3BDO A;  3J81 E;  3TRE A;  2D0P A;  1IBM L;  1SBB B;  4KKU A;  4Q0F A;  5JPM C;  1CKN B;  1PH9 A;  5CBE E;  3E3X A;  4A3K H;  2D62 A;  2O4X A;  5CV8 A;  4EGV A;  1ILP A;  5AFW A;  4PMW A;  1Y1V H;  3TDQ A;  3S14 H;  3U4Z A;  2HQE A;  4C3H H;  2B2Y A;  2LMC B;  1SRO A;  3FDT A;  2OQ0 A;  1AZP A;  3G6J B;  1D8L A;  3TME A;  3MA2 B;  1X3P A;  1JB7 A;  1EU4 A;  4O0A A;  4OWX B;  1IL8 A;  2B8G A;  2EQS A;  2G9H D;  3VR5 A;  5EPL A;  2F4V L;  3DM1 A;  4LF5 L;  3S1R H;  2I0Q A;  2I5H A;  2K28 A;  1BO0 A;  1WCM B;  1GHJ A;  4JI6 Q;  1FNV A;  4JV5 Q;  2EXD A;  1JE5 A;  4GKJ Q;  4C3I G;  3PV0 A;  1EWH A;  1X55 A;  3KF6 A;  2QKI C;  4TSS A;  3CQZ H;  4G7H C;  1G29 1;  2JQO A;  2F0F A;  2D5D A;  3SK8 A;  3M3Y B;  2PQE A;  1O7L A;  1SYC A;  4DV3 Q;  3ZYY X;  1YNN D;  4GNX A;  4A3D H;  4C1N K;  5M9O A;  3CC2 A;  5E3F A;  3PIO 3;  4IPD A;  4O1N A;  2UUB L;  5LMN Q;  1LTS D;  2XNA C;  4R4O A;  2EPB A;  1WD1 A;  3HOZ G;  1QG7 A;  1JOR A;  5CV9 A;  2Q8I B;  4KN7 C;  3S2H B;  2X69 A;  5EAY A;  3DMU A;  4K6D A;  1Y69 U;  3KK7 A;  1PRT D;  3DEO A;  1PMR A;  3L7Z C;  3S1R B;  2K5V A;  3FHW A;  3AEV A;  3NSW A;  4ZKC B;  3HKZ B;  1HTL D;  1V1P A;  3PSI A;  2NBF A;  5E4X A;  1HNX Q;  2G5D A;  1WTO A;  1G2S A;  1LT4 D;  1NBW A;  1HNX L;  2HCI A;  2MFI A;  4C2M H;  3GTQ H;  3NP8 A;  5M3F G;  4HTH A;  1BOS A;  2X6L A;  3PO2 B;  1UWV A;  3ER0 A;  1VQ8 A;  1WI5 A;  3HOY G;  4A3C H;  2JA7 H;  1WTX A;  3S2H H;  2FXQ A;  3KBX A;  1STY A;  3CHB D;  3M3Y H;  2EJG C;  2IPK D;  1E0B A;  4LK1 C;  4H02 A;  3VA7 A;  3Q22 A;  4BA1 I;  2UXC Q;  2JA8 H;  1Y1V B;  1N8R C;  1RF2 D;  1N36 L;  5F2D A;  4OWT B;  3AB9 A;  3EBE A;  2A6H C;  4GNX C;  1C48 A;  2LFN A;  4JI1 Q;  5IGG A;  2N78 A;  5C4H A;  1NSN S;  1LYL A;  1DON A;  4ZAI A;  1PH4 A;  3IFD A;  1WYD A;  1JWU D;  3ULL A;  3A7L A;  3CD6 A;  4J15 A;  1S3O A;  1PH5 A;  2XTI A;  1G6P A;  1K8A C;  1Y1W H;  5GAH C;  2JA7 B;  4BS9 A;  2F0N A;  2C9O A;  5TSS A;  1CK1 A;  3ZJY C;  4DFA A;  4UPA A;  3G6E A;  1TWF B;  1KRT A;  1YNX A;  3ULJ A;  1QJO A;  5EBD A;  4L6T B;  2WAQ B;  2I46 A;  5C5L A;  3RZD B;  4J1M A;  3U58 A;  3TP7 A;  3CCL A;  1ET9 A;  4DA2 A;  2ZTE A;  3T4A C;  1XJV A;  5COR A;  1YJ9 A;  4RKL A;  1X3G A;  1YJN A;  3J7Z C;  4HMI A;  3VYU A;  2AMC B;  4ME5 A;  1D5X C;  2F3V A;  1SJE D;  4P71 A;  1AP0 A;  1IL2 A;  1G91 A;  1SAP A;  3A54 A;  1KHI A;  2N49 A;  1YVC A;  2WKC A;  1K0R A;  3SK6 A;  3H3V H;  1CKN A;  2LY7 A;  2F0E A;  1HPC A;  3PO2 H;  3HOZ B;  1FJG Q;  4DK6 C;  1UE1 A;  1GUT A;  3KUP A;  1EQQ A;  3M4O H;  3QR8 A;  2PQA A;  2K50 A;  3F2D A;  1B8A A;  3J7A V;  4NDX A;  2EY1 A;  1JWS D;  3UDX A;  1Q1E A;  2L1B A;  2HDM A;  3BDC A;  3BZC A;  1RJT A;  1KQS A;  3S1M B;  4TQU S;  3HOV B;  3T13 A;  3R8B A;  3BDL A;  3AQQ A;  1F9P A;  1ICF B;  1M90 C;  1EY0 A;  4KD3 A;  2F0V A;  3H3V C;  1ZEQ X;  2KOL A;  1NNX A;  1SYG A;  1Q3L A;  1IYJ B;  4DV0 Q;  2DJG C;  5ELO A;  2K5Q A;  1CHQ D;  2F0S A;  1EY9 A;  3NWS A;  3JC6 6;  2UUC L;  1DD2 A;  1SR3 A;  1IKL A;  1OXT A;  1KAA A;  3J80 E;  1DOM A;  3K8A A;  1K8G A;  3VA5 A;  4RHS A;  2VL6 A;  1PTO B;  2Z4I A;  5FLM G;  2UUA L;  1XNQ Q;  1XMO Q;  2UXD L;  1N33 L;  1ENF A;  1FGB D;  1TWH B;  2Q8T A;  4C3J H;  5IOC A;  1PRT C;  4X3S A;  3H15 A;  2ZM6 Q;  4XTC S;  5IP7 G;  4ZKB B;  3AMU A;  5AJ3 L;  2A6H D;  1QUQ A;  3HOX B;  3A74 A;  3W2D A;  3NTI A;  3S1N B;  3ERO A;  1DJR D;  3MTS A;  4A3F B;  4HID A;  1C8C A;  4OO1 H;  1OXX K;  2PQA B;  4OL7 A;  3GO5 A;  3K7A H;  1A2U A;  2UXB L;  2E2I H;  3GTG B;  3SR1 A;  1VQF A;  1XNQ L;  4LFC L;  2RSN A;  3SHL A;  3UDI A;  5K36 H;  4A3M G;  3K81 C;  1VQI A;  3X3N A;  3U9S A;  4ALP A;  3HRZ C;  5ELE A;  3B6Y A;  3P75 A;  1LUZ A;  1V8Q A;  3QO2 A;  3U9O A;  2JA5 B;  3HOW H;  1I5F A;  2EY5 A;  1LV9 A;  2SNS A;  3MEF A;  3S15 B;  4G4K A;  2JEB I;  4BXX H;  1B9M A;  1R4P B;  5IT9 E;  4P75 A;  4L63 B;  5GAG C;  1Q1B A;  1RL2 A;  4DR4 L;  4GS3 A;  4RCN A;  5C4J H;  1ZKO A;  3VDY A;  5C44 G;  1TT2 A;  5IGB A;  1WTQ A;  4TRD A;  5A2Q E;  3PUY A;  4A93 G;  4DK1 A;  2R6G A;  4OO1 I;  1Y8P B;  2UU9 Q;  3MC0 B;  3CRK C;  1PFS A;  3R3O A;  4Z9C B;  2DGY A;  1GOZ A;  2RDH A;  4X62 Q;  2EYJ A;  1R4Q B;  1U5K A;  1UEB A;  1S5F D;  5JOB A;  1X3E A;  1L0X B;  4JOI A;  4OIK A;  1G6Z A;  1HHV A;  3DWQ A;  2WIN B;  2A1A A;  2E2D C;  2NB0 A;  3GTJ H;  4FO2 A;  4IN3 A;  3EVQ A;  1PXU A;  2PYK A;  4UY8 C;  3ERS X;  1XPU A;  5LMU L;  4A3I G;  1I4R A;  3FPU B;  4EQO A;  1IXR A;  4QUF A;  1ML0 D;  5CV5 A;  5C3W A;  1I94 L;  1EY4 A;  2GVB A;  1I6H B;  4IUV A;  1E2Z A;  1TWA B;  2K6A A;  4JI8 L;  5HY6 A;  1YI2 A;  3ERQ A;  4JI2 Q;  4OWW B;  3GTL H;  4X66 L;  1V1P B;  2F0K A;  3H0G B;  4DV7 L;  2YYZ A;  2WKD A;  4AH6 A;  4DR4 Q;  4PQX A;  1H9M A;  3TP5 A;  4LNQ A;  3A55 A;  3CCS A;  4JI4 L;  3RLF A;  4A3J H;  3HOV H;  2A19 A;  1FD7 D;  1LT3 D;  4EQP A;  2F0O A;  2J7Z A;  2ZJQ A;  3URY A;  1GUG A;  4A3G G;  1X54 A;  1I6H H;  2HIV A;  1N34 Q;  1TY0 A;  4MHE A;  1RTO A;  4DUY Q;  4KY6 A;  1K83 H;  3FKI G;  5LMN W;  2NVT B;  5J1Z A;  4TVA B;  1ZYR D;  1X3Q A;  3STB C;  3M7G A;  4Y7N B;  4LW1 A;  5JJZ A;  1EIF A;  3HKS A;  3GTK H;  1WJJ A;  1WCM H;  4DK3 C;  4X3T A;  2O2L D;  1U4R A;  2F0I A;  5H1S E;  1NR2 A;  5BR8 L;  4NPS A;  4QL5 A;  1M1K C;  2BDO A;  4UP8 A;  4HCE A;  4LF6 Q;  4DR1 L;  4OHJ A;  3WDN A;  2NVY B;  2RQX A;  2BA0 A;  4R4T A;  1MKH A;  3CF5 A;  1XYI A;  1LAC A;  1I94 Q;  2ZM6 L;  4LFB L;  4CJ1 B;  1TS2 A;  3NWT A;  1L1O A;  1YIT A;  2DNE A;  1NTG A;  1N9W A;  2TMP A;  2KVM A;  3E0J A;  4A3B H;  1J8I A;  1WOC A;  5DM6 3;  4JI3 L;  2JA9 A;  4OIJ A;  1EYD A;  4PZ7 A;  1XTC D;  3Q23 A;  3TRZ A;  1PH8 A;  4A3E B;  2R93 H;  1HR0 Q;  1S5C D;  4P74 A;  2IW3 A;  4K5V A;  4K2L A;  2VQF L;  4C3I B;  2F0D A;  4DF7 A;  1VQ7 A;  1Q82 C;  3I72 A;  1K28 A;  3VR3 A;  4HSV A;  4RA8 A;  3I4M G;  3X3M A;  1GUS A;  2V4D A;  1C0A A;  2B8F A;  1BBU A;  1OTC A;  5FK9 C;  5C3X A;  4JI1 L;  3Q24 A;  2JA8 G;  3V96 A;  2BDN A;  2EXZ A;  4KHP L;  2ICI A;  2B63 G;  4NB3 A;  1ASZ A;  4HIK A;  1EL0 A;  1B3A A;  1Q8K A;  2QIL A;  5BR8 Q;  1BNZ A;  4GKK L;  2KHS A;  3PQI A;  5C4J B;  2KEC A;  1S5B D;  1YHA A;  5IP9 G;  3PO3 H;  4ZUJ A;  4FXD A;  5M5X B;  2FJ2 A;  4JI5 Q;  1RTN A;  3PIP A;  3DLL A;  2R92 B;  4KHV A;  4WRD A;  2K5H A;  2K33 A;  4FYD A;  1UAP A;  4KV6 A;  3UE0 A;  4DUZ Q;  2A69 C;  4DXF A;  3QOL A;  3J80 c;  4IJL A;  1O7Y A;  4FP5 D;  1CUK A;  1J6Q A;  2IL8 A;  2OWO A;  2GVA A;  1CI3 M;  5IYB H;  2AKW B;  1SYF A;  4E6I A;  3W3A A;  2JJQ A;  2D9U A;  3GTJ B;  2R7D A;  4M8A A;  1NY4 A;  1E7Z A;  3OMG A;  4DR6 L;  1CKM A;  2HCC A;  1LT6 D;  1VQK A;  1PFB A;  3A56 A;  1PTO C;  3RZO B;  4JBK A;  4RWS C;  1X3F A;  3EFX D;  2R7Z B;  5JJK A;  4RG1 A;  3HP3 A;  1SND A;  1H9J A;  2KEE A;  4MNO A;  1KLU D;  4KN4 C;  4B9X A;  4YY3 Q;  1L0Y B;  4IFD H;  1FR3 A;  2AUJ D;  5IY0 A;  4B3S Q;  1J5E L;  1B3Q A;  3HZX A;  4IPH A;  4K5W A;  3P7J A;  2JN4 A;  1EWI A;  3DWP A;  1MJC A;  2MP1 A;  3RUZ A;  1WTP A;  2SNM A;  3NK9 A;  2IHF A;  1B4O A;  5IT9 c;  1QWY A;  4MZ9 A;  4G7O C;  1SEB D;  2Z6K C;  2KCC A;  3HGB A;  5KEE A;  1I4Q A;  1KTK A;  2ENB A;  3CW2 C;  4LF7 Q;  1TWG B;  2UUA Q;  2EDG A;  5C4X B;  2R92 G;  2Z0S A;  5M5X H;  3CCR A;  1A3V A;  3TS2 A;  2GA4 B;  3PMF A;  1X56 A;  2QEX A;  1O80 A;  3I73 A;  2CQO A;  4XQN A;  1GM5 A;  4Y52 H;  3V05 A;  1Z47 A;  4DGZ A;  1SE4 A;  3MEH A;  4JCV E;  2N88 A;  3S14 B;  1S4Z A;  4OXP A;  1P8L A;  1Y1W G;  4GLA C;  3KLR A;  3SK5 A;  3SXH A;  5C0X J;  4I7Z C;  3TN2 A;  5FOB B;  1WTV A;  2LSS A;  1IW7 C;  4HSP A;  1LLR D;  1GKH A;  4DR3 Q;  2K01 A;  4CKC A;  4B08 A;  1J9O A;  3STB D;  5DM7 3;  4A93 B;  1B50 A;  4HMJ A;  4B3M Q;  3QB3 A;  2KCN A;  2PI2 A;  4X65 Q;  1ZXT A;  4JW0 A;  4A3G H;  1F2L A;  1X65 A;  2AQ3 B;  3M9B A;  1I4H A;  1NJI C;  1O78 A;  3VR4 A;  5EQ0 A;  1OXS C;  1N34 L;  1NAP A;  3TZU A;  4LUV A;  2DY8 A;  2YTY A;  2RSO A;  1O7Z A;  1WD0 A;  1N36 Q;  2QDB A;  3BZK A;  1UE6 A;  2RHS B;  4C56 C;  1A6X A;  4YWK A;  3D31 A;  1IZ6 A;  2BA1 A;  1HZ9 A;  4QIW B;  1MSG A;  3PUW A;  4X66 Q;  1SE8 A;  3SK4 A;  3BU2 A;  4IO9 A;  3K80 C;  3J81 j;  5CV4 A;  4PNY A;  3CC4 A;  3ND8 A;  5GAD C;  1NMG A;  1XXG A;  2F03 A;  1ESF A;  2L15 A;  3EIV A;  4O2D A;  3O13 A;  4B9W A;  2F0P A;  3D3R A;  3OOC A;  5HGT A;  3OW2 A;  1CT1 D;  5IYD H;  3JAM c;  1TKW B;  1EOT A;  3NHH A;  1MGS A;  1KLG D;  3CCJ A;  1LTT D;  1ICW A;  2F0U A;  4DR3 L;  2R7Z G;  2R3Z A;  3HKZ E;  3TP8 A;  4ID6 A;  1K83 B;  3AU7 A;  2YTV A;  3M4Q A;  4XQQ A;  1KL9 A;  5I9P A;  5FJ8 G;  2R93 B;  2AWO A;  4FXG C;  4LAA A;  3S1Q B;  2NYZ D;  2VZA A;  5D3I B;  4OEM B;  3K5N A;  1S40 A;  1C9O A;  1F2M A;  1EQR A;  3JAM L;  3E0E A;  4ABN A;  3HOY H;  4A3C G;  3A8K E;  2RKS A;  4IAL A;  4LUZ A;  3J80 L;  3NEL A;  4RH6 A;  5G3L F;  3W1B A;  5CMD A;  2E74 C;  2WB1 B;  1Q12 A;  1Q46 A;  1MD2 D;  3H6M A;  4C1N I;  2IX0 A;  3M4O B;  2VUM H;  2FFK B;  1L2F A;  3OSO A;  2VNU D;  5GQO A;  2FHT A;  1HZA A;  3CU7 A;  4LF5 Q;  4AIM A;  2Y0S G;  4LFC Q;  2LS0 1;  4A3I B;  4RHR A;  4KHP Q;  4QUC A;  2F4I A;  3D4W A;  3S2D B;  2KUM A;  2DUD A;  4BBR B;  1SJH D;  1LTA D;  3P1H A;  4U68 A;  4YWL A;  2RVL A;  5C44 B;  3KFU A;  1A3U A;  1K8M A;  1VQC A;  4A3B G;  4BY7 B;  1GXD C;  3L3O C;  5EKK A;  1CA6 A;  3CKI B;  2BH8 A;  2EOT A;  5J22 A;  1PVO A;  1TWF H;  2VQF Q;  4XYO A;  2Z6B A;  4R8I A;  3NQI A;  3CP0 A;  4KMU C;  1FVI A;  1JJ2 A;  1EOV A;  5IIF A;  2B2U A;  4GKJ L;  1KXL A;  4HED A;  1F9Q A;  4FNF A;  2MJ8 A;  1VQP A;  1PZK D;  1BVS A;  2IJ0 A;  3GP7 A;  3TP6 A;  1YHB A;  2VXW A;  4BBR G;  3SVM A;  4WFN 3;  4LFB Q;  4GOP B;  1GUO A;  2K7V A;  3J81 L;  4DV3 L;  2ZJR A;  4DR2 L;  1PZI D;  1UEA B;  1EZ6 A;  2ALY B;  1IBL L;  2JEA I;  4K8I A;  3M7N A;  1KC8 C;  2ASB A;  1G51 A;  1VQL A;  3MFY A;  4WJ3 M;  4A3F G;  1BCP D;  3J81 i;  2RCN A;  3WWV A;  4LF8 L;  4PV1 C;  3GTM H;  1W6K A;  1Q7Y C;  4KD4 A;  2E5L L;  1NR4 A;  1PFM A;  4OON A;  2DN8 A;  4YHH Q;  2GN5 A;  4NW2 A;  5NUC A;  1TR5 A;  1STH A;  3MXG A;  2EVB A;  5ELC A;  5GAE C;  3KF6 B;  3BVG A;  2A68 D;  3J7A 5;  3PO3 B;  3A0J A;  3BYY B;  1SFO H;  4B3M L;  2BE5 C;  4FF1 A;  1R9T H;  2NTS A;  4PMC A;  3PUZ A;  3KJO A;  2WB1 G;  2R92 H;  3CMA A;  1KRS A;  3MVV A;  2BOS A;  1D5Z C;  1MSH A;  3I8Z A;  1A15 A;  3CCM A;  3JAM E;  1LTL A;  4A3I H;  2WAQ G;  1TWH H;  5GRO A;  5ELF A;  2F0J A;  2B2U C;  2OXP A;  4GLV B;  3NE5 B;  4ULL A;  2JXM B;  3VR6 A;  5C6A A;  1CSQ A;  2ES2 A;  2H5X A;  3HFZ B;  4RMF A;  3RD4 A;  4L5S A;  5JPN C;  1VQH A;  1VQB A;  2MUY A;  1D2B A;  4CDC C;  4PG3 A;  2DNC A;  2CWA A;  4DNI A;  4DUY L;  1WTW A;  2Q8R E;  4DAY A;  3MWY W;  1XNR L;  5IGC A;  4K0K Q;  3D0F A;  3SGI A;  5FKA C;  4RCO A;  2UXC L;  1LO5 D;  2C5C A;  1JMC A;  1TQO A;  3CXC A;  1I50 B;  1E3P A;  3S15 H;  1CZG A;  2RA4 A;  5KRU A;  4EX5 A;  4JYA L;  1YNJ D;  1L1O C;  1QUQ B;  2OTJ A;  2HDL A;  1MHW C;  3RZD H;  4DR5 Q;  2Q2T A;  2A69 D;  5FJ8 H;  2L55 A;  1HA5 A;  2NN6 I;  5BN3 A;  5C3E B;  4JI7 Q;  1VQ5 A;  2B39 A;  4XT3 B;  4J6H A;  2K04 A;  2A74 C;  4F8M A;  5C4Z A;  1XMQ L;  1UNS A;  1W2B A;  5M3M B;  1EIH A;  2MGS A;  1D1I A;  5IGF A;  5KNC A;  3I90 A;  4IFD I;  2PI2 E;  5J39 A;  1SYD A;  5EKI A;  1RHP A;  2L12 A;  5BN4 A;  3CCU A;  4A4I A;  1VQG A;  3WOF A;  4DV4 Q;  2Z4H A;  4KKS A;  1CQF A;  1II3 A;  1I4P A;  3TEH B;  5K36 G;  4DKA C;  5E4W C;  4P2C B;  4H13 C;  1SXT A;  4NXN L;  4OO1 G;  3PIO A;  2B2W C;  2NVT H;  1TWC H;  2I5M X;  1I4X A;  4JYA Q;  3ND9 A;  4DV5 Q;  1F2Z A;  4HJ5 A;  2K5N A;  4KKT A;  1QNK A;  3MFG A;  1BBW A;  2BE5 D;  5A35 A;  4CDF C;  3OIQ A;  2E2H H;  5IP9 H;  2VB2 X;  1EYG A;  4JK1 C;  4XXE A;  2E76 C;  2EY6 A;  2HUG A;  4X64 L;  2CH4 W;  2C35 B;  2PO4 A;  1A2T A;  4R9W A;  1A63 A;  4XYQ A;  4JC0 A;  5C0X I;  4DR5 L;  3H0G H;  3C1F A;  3MXN B;  4ODG A;  1PLF A;  3FPP A;  3HOY B;  2K32 A;  1VQN A;  3FKI H;  1HNW L;  1EYA A;  3J7Y W;  5M5W H;  1Q8I A;  1S5E D;  4K14 A;  2NVX H;  1I6V C;  1VQD A;  5KYI A;  3HKZ G;  4CKB A;  1JCK B;  2CW0 C;  1Z6H A;  2TSS A;  3K59 A;  4A3K G;  1JT8 A;  1PYB A;  2L9H A;  3H91 A;  4DUZ L;  1K3B C;  2R61 A;  5IGD A;  2EYL A;  3EQL C;  2H1E A;  3R2I A;  1JJG A;  1X6O A;  5DLQ E;  4C3I H;  5DNF A;  1YZ6 A;  3KYH C;  1VQM A;  4LF6 L;  3GTG H;  2E2I B;  3K5O A;  3KDF A;  3DHQ A;  5EGT A;  1PH3 A;  2UU9 L;  5KND A;  2J4X A;  2PW7 A;  3SE0 A;  2ZXO A;  4IUU A;  3RMH A;  4B3T Q;  2KBN A;  1LTB D;  4DV2 Q;  3SDZ A;  4JI3 Q;  4XQJ A;  1MI2 A;  1PH7 A;  1VMC A;  3N52 A;  3RLN A;  1F77 A;  2Z6K A;  4A3L G;  3G48 A;  1IYU A;  2F0G A;  2NVX B;  1FNU A;  1B9N A;  4RAU C;  3W5O A;  1L0W A;  1WCM G;  3FRP B;  5FO9 B;  1FJG L;  2O5I C;  3C2P A;  1AFP A;  4IUT A;  4LF9 L;  3HOV G;  3S1Q H;  1BF4 A;  2JA6 H;  3S9W A;  3CCQ A;  1PA6 A;  3MXN A;  1EEF D;  1OXV A;  1SNM A;  1KDA A;  1UUP A;  4R4I A;  1D5M C;  4HJ7 A;  1F9S A;  2JA8 B;  4UHV A;  4RGO S;  1CSP A;  3QWN A;  3OTO L;  2J0T D;  4CJ2 C;  1AW7 A;  4B3R Q;  3M4P A;  2FMC A;  4IPG A;  2XRS D;  1E24 A;  5I6W A;  2UXB Q;  2UUC Q;  5HGQ A;  2A8V A;  3HOU H;  2B2W A;  1B7Y B;  2WV6 D;  2M2L A;  1UE7 A;  3QJY A;  2JE6 I;  2EJF C;  1WTR A;  3MXU A;  5COY A;  4V0B A;  5JVG 3;  1F9R A;  2MQH A;  1HZB A;  4DV0 L;  4N9P A;  3VYS A;  4PZ6 A;  1SYB A;  4X64 Q;  3VYR A;  1AE3 A;  4K8J A;  3TBI B;  2VS1 A;  1EIG A;  4YIJ A;  3A7A B;  1H9S B;  2PZU A;  4DXG A;  2XVS A;  4GNX B;  4CHT B;  1EYC A;  1CZW A;  1HZC A;  4A3K B;  1GVP A;  1SE3 A;  1VS0 A;  1BCP C;  1V1O A;  4L5T A;  1WTH A;  1TY2 A;  1H9S A;  4ZRZ A;  2RCF A;  2RHQ B;  1NCV A;  2SOB A;  4BBS B;  1PYW D;  2DY7 A;  5CR3 A;  5CV7 A;  4X62 L;  2VUM G;  3NXW A;  2JA7 G;  1SMX A;  4GLX A;  5IE8 A;  1XPO A;  3GQB A;  4A3J G;  3QIA A;  2MHV A;  5I4D A;  3CCV A;  4MTN A;  4I65 A;  1SNQ A;  3PIP 3;  4X6A H;  1SE2 A;  1GUW A;  1SMY C;  1VQ9 A;  4K5X A;  1U4P A;  2VB3 X;  4WJW A;  1X9N A;  2BH2 A;  1YNJ C;  4A3J B;  1CA5 A;  4KY7 A;  1JOO A;  4APV A;  4QMG A;  3H94 A;  3LNN A;  4TKO B;  4CDE C;  3E5S A;  1HQR D;  2K5D A;  3K0X A;  3I56 A;  2CW0 D;  3K7U C;  3NBH B;  1G2T A;  4CDD C; 
#chains in the Genus database with same CATH homology
 3K7A B;  1VF7 A;  2L11 A;  1CTM A;  1EU3 A;  3T51 B;  1LT5 D;  1Y1W B;  3I4M B;  3BVZ A;  3F2U A;  3IKJ A;  3Q6S A;  5CC4 A;  3I4L A;  5G3L D;  2F0W A;  1SSO A;  1PFN A;  5FLX E;  3D4R A;  5LHY 1;  4QF4 A;  4HR7 B;  3GTM B;  2SEB D;  1STB A;  2KA7 A;  2AQ2 B;  1HTP A;  4C3J B;  3K58 A;  3EA6 A;  2Z1C A;  4FF2 A;  2WAC A;  4DU9 A;  2FIN B;  3OMC A;  1HFG A;  1SYE A;  5DEH A;  4X3U A;  4IUR A;  1DOL A;  3PUV A;  2PW5 A;  4DAV A;  5ISR A;  4FF4 A;  3LX0 A;  2A73 B;  3I70 A;  3ITP A;  3S17 B;  2OT2 A;  4RGN A;  2JP1 A;  3GTK B;  3NTH A;  2F1M A;  1PRT B;  2EYM A;  4A3G B;  2E75 C;  5EBC A;  1SMY D;  3C3L A;  1U4M A;  2NN6 H;  3QOJ A;  2IWH A;  1HUN A;  1JB3 A;  1TWC B;  3MHB A;  3R93 A;  1JOQ A;  4MIU A;  3GV3 A;  2JSO A;  1TII D;  4IFD J;  3DEP A;  2NTT A;  1DYQ A;  3HS0 C;  1GHK A;  1STG A;  4UAI A;  2VUM B;  4F7X A;  3NUC A;  2KED A;  1DOK A;  1JOK A;  1JQY D;  1TS4 A;  3KLS A;  5D65 A;  3MXP A;  1KNE A;  1IHZ A;  5CV6 A;  3VYT A;  2XN9 C;  4FVM A;  2RDF A;  1EEI D;  3ONA B;  5CGK A;  4O42 A;  2AUK A;  2X6G A;  5JEA G;  2F0H A;  1HCZ A;  4CJ0 B;  1IYV A;  3FEW X;  1BDO A;  3FKI B;  1PTO D;  1EWC A;  4R8N A;  2F0T A;  1K8O A;  1RD9 D;  2QCP X;  5M5Y B;  3TZD A;  1VF5 C;  2PCF B;  1DZ1 A;  3OW7 A;  5ELD A;  1WVL A;  5C0X H;  4ZUI A;  4FF3 A;  3BYT B;  3D4D A;  2L4N A;  2F3W A;  4HCS A;  2ZXR A;  2N55 A;  3NBH A;  2E2H B;  1H9R A;  1ET6 A;  3LWU A;  1JIC A;  5LL6 S;  5IT9 L;  5DAU A;  2WII B;  4ILW A;  2K05 A;  1Z7T A;  4NKL A;  1YNN C;  3A8I E;  5I2Y A;  5D14 A;  4F88 A;  5M5W B;  3K0Y A;  1ILQ A;  2EJM A;  4XDX A;  4QCL A;  3N6R A;  1W6J A;  2K1B A;  1I4G A;  2JA6 B;  4X3K A;  1PRT F;  2G9D A;  1Y8N B;  2XRQ D;  5K5P A;  4NMZ A;  3K6O A;  2CHB D;  5EPK A;  2IT1 A;  2K03 A;  4V19 0;  5CYU A;  2XWJ B;  3S16 B;  4U67 3;  1PZJ D;  2A6E C;  4CGY B;  1BCP B;  4UDU C;  4IUQ A;  3J7A F;  4IQZ A;  3H09 A;  3D8G A;  4KTA A;  4J8Q A;  2ZT9 C;  4NP5 A;  4RKB A;  1STN A;  3D6W A;  3EJI A;  2XWB B;  3K5L A;  5FO8 B;  4DNT B;  3C46 A;  5KYL A;  4DNR B;  1JR0 D;  3GTO B;  2ZXP A;  1RKN A;  1KAB A;  3IAY A;  3T16 A;  2OF1 A;  1BR9 A;  5C0X G;  4QB4 A;  1F2Y A;  3FVQ A;  2PZW A;  4PMB A;  5D3D A;  1C4Q A;  2KJX A;  3NQT A;  2B2T C;  3I91 A;  1TS3 A;  4C3H G;  1ZYR C;  1MBY A;  4N9T A;  2D2C C;  3M4Y A;  3TSS A;  1TU2 B;  3HOU B;  1LTG D;  5FLX L;  1KDC A;  2M00 A;  2OEO A;  1ESR A;  4EVO A;  1B2T A;  3KLS X;  5JEA H;  2CVR A;  3MAQ A;  1QNU A;  4C3H B;  1HQM C;  1V43 A;  5LL6 X;  2BCO A;  2XSC A;  1GUN A;  1U9R A;  4RGM A;  2NUC A;  1EY5 A;  4DAP A;  2Z8L A;  1BUV T;  1Y8O B;  4JBW A;  1FNW A;  2EE1 A;  3A8J E;  4OGQ C;  2F0Q A;  1PTO H;  2SDF A;  1JC7 A;  1IKM A;  2Y0S B;  2ICE C;  4M1U B;  1EZ8 A;  2M9V A;  1M8A A;  1CFM A;  4A3M B;  1EY6 A;  2EZV A;  3I3C A;  1CM9 A;  3DUZ A;  4A3D B;  1A3T A;  4LJZ C;  1HA6 A;  2B2V A;  2L5T A;  1B44 D;  5EJW A;  3GTP B;  3BS1 A;  4KHZ A;  2E2J B;  4IUN A;  2PPB C;  3FMC A;  2O5J C;  3L9A X;  3KF8 A;  1U4L A;  1BCP F;  4DN4 M;  4IZ8 A;  4RFB A;  3HOW B;  4HAE A;  4DK0 A;  3E6Z X;  5M3F B;  4KJO A;  4WOR A;  2ID0 A;  3V2T A;  2PNR C;  4CBV A;  2FMM A;  3D6C A;  4CKE A;  5T1G A;  4XT1 B;  2IX3 A;  1LTR D;  1JWM D;  1QOH A;  2A5H A;  2B2T A;  3OWE B;  5T1I A;  2A68 C;  1LAB A;  4KY5 A;  1SNP A;  3IL8 A;  1H9K A;  4H44 C;  1Q90 A;  2QF7 A;  2A6E D;  1JE4 A;  1RCV D;  1SNO A;  4IFD G;  2F0L A;  1ENA A;  1OXU A;  1X32 A;  1HUM A;  1BBX C;  3DWA A;  3Q0A A;  2KQ3 A;  2F0M A;  3C1E A;  3UI2 A;  2LKV A;  1AN8 A;  1DM0 B;  1T5E A;  3I4N B;  3KBG A;  2B2Y C;  4KI0 A;  5EPJ A;  4ZQ3 A;  5EKL A;  5HUR A;  5CBA E;  1SDF A;  1D6E C;  3G7L A;  4FXK C;  3GD7 A;  4A3B B;  1CQV A;  2WP8 J;  5KGU A;  4S3S A;  4L8J A;  5KNB A;  1VMP A;  1I3Q B;  3QG1 A;  1DCZ A;  4C3J G;  3MZ5 A;  1XX8 A;  1ROD A;  1PDQ A;  4EQN A;  5I9O A;  3DXJ C;  2CQA A;  4BA2 I;  2JYO A;  2B2V C;  4G57 A;  5JVH 3;  3GV6 A;  2NVQ B;  1B53 A;  1QE6 A;  1IW7 D;  4K2K A;  1KDB A;  2AWN A;  1D1K A;  3HEJ A;  4G7Z C;  1ONL A;  3K5M A;  5A2Q L;  4H0L C;  3GTL B;  1BXT A;  1E2W A;  5JEA J;  1VDZ A;  1RDP D;  1T5X D;  3BVM A;  4XIG S;  4K6L A;  1STA A;  4ZK9 B;  1EY8 A;  2MPM A;  1QIL A;  1AZQ A;  2L0C A;  1SFO B;  1R9T B;  2YU9 B;  1S5D D;  1BQQ T;  1HFN A;  4F87 A;  5I2X A;  2PZT A;  5KIX A;  3T56 B;  4ZLT F;  3P20 A;  1G8Z D;  1QCB D;  2QEJ C;  1ENC A;  2AQ1 B;  2NWG A;  3VR2 A;  5IGE A;  2IX1 A;  3CRL C;  2EYH A;  2EYP A;  5JAV A;  1GJX A;  4C2M B;  3GTQ B;  2NN6 G;  1HRJ A;  3OPO A;  4H7B A;  1STE A;  4KJN A;  2EYF A;  1E2V A;  2RDG A;  1VCI A;  3T53 B;  4MN3 A;  3K57 A;  1EFI D;  5C5M A;  5FO7 B;  3OIP A;  2B63 B;  1FYC A;  4IUP A;  3BG3 A;  2I07 B;  2XIW A;  1PTO F;  3LWE A;  5I6Y A;  1M4V A;  1LTI D;  3PUX A;  2K5W A;  5E1F A;  3WOE A;  1EQT A;  1AEX A;  4BY1 B;  1EQV A;  3OHX C;  1OO9 B;  1TVX A;  4Q5V A;  4RGT A;  4KK7 A;  5ELB A;  3CQZ B;  2PMZ B;  4ZYS A;  1HXY D;  2RBM A;  1TS5 A;  3SEB A;  1SNC A;  1EY7 A;  2EYO A;  3BZD B;  4LMQ D;  1B1Z A;  2NZ1 D;  3NPP A;  5IOD A;  1DXM A;  3R2T A;  3IFT A;  1KNA A;  2EY2 A;  4AYB B;  1CHP D;  3OWF A;  1NUC A;  1QB5 D;  3M85 A;  3NTK A;  3NBI A;  4GZY C;  5BN5 A;  1XWE A;  2H4O A;  3HG9 A;  4HN7 A;  4BWG B;  3BDO A;  3J81 E;  1SBB B;  4KKU A;  4Q0F A;  5JPM C;  5CBE E;  2D62 A;  2O4X A;  5CV8 A;  4EGV A;  1ILP A;  5AFW A;  4PMW A;  3TDQ A;  2HQE A;  2B2Y A;  2LMC B;  3FDT A;  1AZP A;  3G6J B;  3TME A;  3MA2 B;  1X3P A;  1EU4 A;  1IL8 A;  2B8G A;  2G9H D;  3VR5 A;  5EPL A;  3DM1 A;  2K28 A;  1BO0 A;  1WCM B;  1GHJ A;  1FNV A;  4C3I G;  3PV0 A;  1EWH A;  2QKI C;  4TSS A;  4G7H C;  1G29 1;  2F0F A;  2D5D A;  3SK8 A;  3M3Y B;  2PQE A;  1O7L A;  1SYC A;  3ZYY X;  1YNN D;  4C1N K;  5M9O A;  5E3F A;  3PIO 3;  4O1N A;  1LTS D;  2XNA C;  2EPB A;  1WD1 A;  1QG7 A;  1JOR A;  5CV9 A;  2Q8I B;  4KN7 C;  3S2H B;  2X69 A;  3DMU A;  4K6D A;  1Y69 U;  3KK7 A;  1PRT D;  3DEO A;  1PMR A;  3L7Z C;  3S1R B;  3NSW A;  4ZKC B;  3HKZ B;  1HTL D;  1V1P A;  5E4X A;  2NBF A;  1WTO A;  1G2S A;  1LT4 D;  2HCI A;  3NP8 A;  4HTH A;  1BOS A;  2X6L A;  3PO2 B;  1WTX A;  3KBX A;  1STY A;  3CHB D;  2EJG C;  2IPK D;  1E0B A;  4LK1 C;  3Q22 A;  3VA7 A;  4BA1 I;  1Y1V B;  1RF2 D;  5F2D A;  3AB9 A;  2A6H C;  1C48 A;  2LFN A;  5IGG A;  5C4H A;  1NSN S;  1DON A;  4ZAI A;  3IFD A;  1JWU D;  3A7L A;  2JA7 B;  4BS9 A;  2F0N A;  2C9O A;  5TSS A;  1CK1 A;  4DFA A;  1TWF B;  1QJO A;  5EBD A;  4L6T B;  2WAQ B;  2I46 A;  5C5L A;  3RZD B;  4J1M A;  3TP7 A;  1ET9 A;  4DA2 A;  3T4A C;  5COR A;  4RKL A;  4HMI A;  3VYU A;  4ME5 A;  1D5X C;  2F3V A;  1SJE D;  1AP0 A;  1G91 A;  1SAP A;  3A54 A;  2WKC A;  3SK6 A;  2LY7 A;  2F0E A;  1HPC A;  3HOZ B;  1GUT A;  3KUP A;  3J7A V;  4NDX A;  2EY1 A;  1JWS D;  1Q1E A;  2L1B A;  2HDM A;  3BDC A;  1RJT A;  3S1M B;  4TQU S;  3HOV B;  3T13 A;  3R8B A;  3BDL A;  1F9P A;  1EY0 A;  4KD3 A;  2F0V A;  3H3V C;  1ZEQ X;  2KOL A;  1SYG A;  1Q3L A;  2K5Q A;  1CHQ D;  2F0S A;  1EY9 A;  3NWS A;  1DD2 A;  1IKL A;  1OXT A;  1KAA A;  3J80 E;  1DOM A;  3VA5 A;  4RHS A;  1PTO B;  2Z4I A;  1ENF A;  1FGB D;  1TWH B;  2Q8T A;  5IOC A;  1PRT C;  4X3S A;  3AMU A;  4XTC S;  4ZKB B;  2A6H D;  3HOX B;  3W2D A;  3NTI A;  3S1N B;  3ERO A;  1DJR D;  3MTS A;  4A3F B;  1C8C A;  4OO1 H;  1OXX K;  4OL7 A;  3GO5 A;  1A2U A;  3GTG B;  3SR1 A;  2RSN A;  3SHL A;  5K36 H;  3X3N A;  3U9S A;  3HRZ C;  5ELE A;  3P75 A;  1V8Q A;  3QO2 A;  3U9O A;  2JA5 B;  2EY5 A;  1LV9 A;  2SNS A;  3S15 B;  4G4K A;  2JEB I;  1B9M A;  1R4P B;  5IT9 E;  4L63 B;  1Q1B A;  4RCN A;  1ZKO A;  1TT2 A;  5IGB A;  1WTQ A;  4TRD A;  5A2Q E;  3PUY A;  4DK1 A;  2R6G A;  4OO1 I;  1Y8P B;  3MC0 B;  3CRK C;  3R3O A;  4Z9C B;  1GOZ A;  2RDH A;  2EYJ A;  1R4Q B;  5JOB A;  1S5F D;  1L0X B;  4OIK A;  1G6Z A;  1HHV A;  3DWQ A;  2WIN B;  2E2D C;  2NB0 A;  4FO2 A;  4IN3 A;  3EVQ A;  1PXU A;  2PYK A;  1I4R A;  3FPU B;  4EQO A;  4QUF A;  1ML0 D;  5CV5 A;  5C3W A;  1EY4 A;  1I6H B;  4IUV A;  1E2Z A;  1TWA B;  2K6A A;  3ERQ A;  1V1P B;  2F0K A;  3H0G B;  2YYZ A;  2WKD A;  4PQX A;  1H9M A;  3TP5 A;  3A55 A;  3RLF A;  1FD7 D;  1LT3 D;  4EQP A;  2F0O A;  2J7Z A;  3URY A;  1GUG A;  1TY0 A;  4MHE A;  1RTO A;  4KY6 A;  2NVT B;  5J1Z A;  1ZYR D;  1X3Q A;  3M7G A;  4Y7N B;  5JJZ A;  4X3T A;  2O2L D;  1U4R A;  2F0I A;  1NR2 A;  2BDO A;  4HCE A;  4OHJ A;  3WDN A;  2NVY B;  2RQX A;  2BA0 A;  1XYI A;  1LAC A;  4CJ1 B;  1TS2 A;  3NWT A;  2DNE A;  2TMP A;  2KVM A;  3E0J A;  1J8I A;  5DM6 3;  4OIJ A;  1EYD A;  1XTC D;  3Q23 A;  4A3E B;  1S5C D;  2IW3 A;  4K5V A;  4K2L A;  4C3I B;  2F0D A;  4DF7 A;  3I72 A;  3VR3 A;  4HSV A;  4RA8 A;  3X3M A;  1GUS A;  2V4D A;  2B8F A;  5FK9 C;  5C3X A;  3Q24 A;  3V96 A;  2BDN A;  2EXZ A;  2ICI A;  1EL0 A;  1B3A A;  2QIL A;  1BNZ A;  2KHS A;  5C4J B;  2KEC A;  1S5B D;  4ZUJ A;  4FXD A;  5M5X B;  2FJ2 A;  1RTN A;  2R92 B;  4KHV A;  4WRD A;  2K33 A;  4FYD A;  1UAP A;  4KV6 A;  2A69 C;  4DXF A;  3QOL A;  1O7Y A;  4FP5 D;  2IL8 A;  1CI3 M;  1SYF A;  4E6I A;  3W3A A;  2D9U A;  3GTJ B;  4M8A A;  3OMG A;  2HCC A;  1LT6 D;  1PFB A;  3A56 A;  1PTO C;  3RZO B;  4RWS C;  3EFX D;  2R7Z B;  3HP3 A;  1SND A;  1H9J A;  2KEE A;  1KLU D;  4KN4 C;  4B9X A;  1L0Y B;  4IFD H;  1FR3 A;  2AUJ D;  3HZX A;  4K5W A;  3P7J A;  3DWP A;  2MP1 A;  3RUZ A;  1WTP A;  2SNM A;  3NK9 A;  1B4O A;  1QWY A;  4G7O C;  1SEB D;  2KCC A;  3HGB A;  5KEE A;  1I4Q A;  1KTK A;  2ENB A;  1TWG B;  2EDG A;  5C4X B;  1A3V A;  2GA4 B;  3PMF A;  1O80 A;  3I73 A;  4XQN A;  3V05 A;  1Z47 A;  4DGZ A;  1SE4 A;  3MEH A;  3S14 B;  2N88 A;  1S4Z A;  3KLR A;  3SK5 A;  3SXH A;  5C0X J;  4I7Z C;  3TN2 A;  5FOB B;  1WTV A;  1IW7 C;  4HSP A;  1LLR D;  2K01 A;  4CKC A;  4B08 A;  1J9O A;  5DM7 3;  4A93 B;  1B50 A;  4HMJ A;  3QB3 A;  2KCN A;  1ZXT A;  1F2L A;  2AQ3 B;  1I4H A;  1O78 A;  3VR4 A;  5EQ0 A;  1OXS C;  1NAP A;  3TZU A;  2DY8 A;  2RSO A;  1O7Z A;  1WD0 A;  2QDB A;  4C56 C;  1A6X A;  3D31 A;  2BA1 A;  4QIW B;  1MSG A;  3PUW A;  3SK4 A;  5CV4 A;  4PNY A;  3ND8 A;  1XXG A;  2F03 A;  1ESF A;  3O13 A;  4B9W A;  2F0P A;  3D3R A;  3OOC A;  5HGT A;  1CT1 D;  1TKW B;  1EOT A;  3NHH A;  1MGS A;  1KLG D;  1LTT D;  1ICW A;  2F0U A;  2R3Z A;  3TP8 A;  4ID6 A;  1K83 B;  3AU7 A;  4XQQ A;  5I9P A;  2R93 B;  2AWO A;  4FXG C;  4LAA A;  3S1Q B;  2NYZ D;  5D3I B;  3K5N A;  1F2M A;  3JAM L;  4ABN A;  3A8K E;  2RKS A;  4IAL A;  3J80 L;  4RH6 A;  5G3L F;  5CMD A;  2E74 C;  2WB1 B;  1Q12 A;  1MD2 D;  3H6M A;  4C1N I;  2IX0 A;  3M4O B;  2FFK B;  3OSO A;  2VNU D;  2FHT A;  3CU7 A;  2LS0 1;  4A3I B;  4RHR A;  4QUC A;  2F4I A;  3D4W A;  3S2D B;  2KUM A;  4BBR B;  1SJH D;  1LTA D;  3P1H A;  4U68 A;  2RVL A;  5C44 B;  1A3U A;  1K8M A;  4BY7 B;  1GXD C;  3L3O C;  5EKK A;  1CA6 A;  3CKI B;  2EOT A;  5J22 A;  4XYO A;  4R8I A;  3NQI A;  4KMU C;  5IIF A;  2B2U A;  4HED A;  1F9Q A;  4FNF A;  2MJ8 A;  1PZK D;  2IJ0 A;  3GP7 A;  3TP6 A;  2VXW A;  3SVM A;  4WFN 3;  1GUO A;  2K7V A;  3J81 L;  1PZI D;  1UEA B;  1EZ6 A;  3M7N A;  2JEA I;  4K8I A;  3MFY A;  1BCP D;  4PV1 C;  1W6K A;  4KD4 A;  1NR4 A;  1PFM A;  2DN8 A;  4NW2 A;  5NUC A;  1TR5 A;  1STH A;  3MXG A;  2EVB A;  5ELC A;  3BVG A;  2A68 D;  3PO3 B;  3BYY B;  2BE5 C;  4FF1 A;  2NTS A;  4PMC A;  3PUZ A;  3MVV A;  2BOS A;  1D5Z C;  1MSH A;  3I8Z A;  1A15 A;  3JAM E;  5ELF A;  2F0J A;  2B2U C;  2OXP A;  3NE5 B;  4ULL A;  2JXM B;  3VR6 A;  5C6A A;  3RD4 A;  5JPN C;  2MUY A;  1D2B A;  2DNC A;  1WTW A;  2Q8R E;  4DAY A;  3MWY W;  5IGC A;  5FKA C;  4RCO A;  1LO5 D;  2C5C A;  1TQO A;  1I50 B;  1CZG A;  2RA4 A;  5KRU A;  1YNJ D;  2HDL A;  2A69 D;  2L55 A;  1HA5 A;  2NN6 I;  5BN3 A;  5C3E B;  2B39 A;  4XT3 B;  2K04 A;  4J6H A;  2A74 C;  4F8M A;  5C4Z A;  1UNS A;  1EIH A;  5M3M B;  2MGS A;  1D1I A;  5IGF A;  5KNC A;  3I90 A;  4IFD I;  5J39 A;  1SYD A;  5EKI A;  1RHP A;  2L12 A;  5BN4 A;  3WOF A;  2Z4H A;  4KKS A;  1CQF A;  1II3 A;  1I4P A;  5K36 G;  5E4W C;  4P2C B;  4H13 C;  1SXT A;  4OO1 G;  2B2W C;  1I4X A;  3ND9 A;  1F2Z A;  4KKT A;  1QNK A;  3MFG A;  2BE5 D;  5A35 A;  3OIQ A;  2VB2 X;  4JK1 C;  4XXE A;  2E76 C;  2EY6 A;  2HUG A;  2PO4 A;  1A2T A;  4R9W A;  4XYQ A;  5C0X I;  3C1F A;  4ODG A;  1PLF A;  3FPP A;  3HOY B;  2K32 A;  1EYA A;  3J7Y W;  1Q8I A;  1S5E D;  4K14 A;  1I6V C;  5KYI A;  4CKB A;  1JCK B;  2CW0 C;  1Z6H A;  2TSS A;  3K59 A;  2L9H A;  3H91 A;  2R61 A;  5IGD A;  2EYL A;  3EQL C;  2H1E A;  3R2I A;  5DNF A;  2E2I B;  3K5O A;  5EGT A;  3DHQ A;  5KND A;  2J4X A;  2PW7 A;  3SE0 A;  2ZXO A;  4IUU A;  3RMH A;  1LTB D;  3SDZ A;  4XQJ A;  1MI2 A;  1VMC A;  3N52 A;  1F77 A;  1IYU A;  2F0G A;  2NVX B;  1FNU A;  1B9N A;  4RAU C;  5FO9 B;  3FRP B;  2O5I C;  1AFP A;  3C2P A;  4IUT A;  1BF4 A;  3S9W A;  1EEF D;  3MXN A;  1OXV A;  1SNM A;  1KDA A;  1UUP A;  1D5M C;  2JA8 B;  1F9S A;  4RGO S;  3QWN A;  2J0T D;  4CJ2 C;  1AW7 A;  2FMC A;  2XRS D;  5I6W A;  2B2W A;  2WV6 D;  2M2L A;  3QJY A;  2JE6 I;  2EJF C;  1WTR A;  3MXU A;  5COY A;  4V0B A;  5JVG 3;  1F9R A;  4N9P A;  3VYS A;  1SYB A;  3VYR A;  4K8J A;  3TBI B;  1EIG A;  4YIJ A;  3A7A B;  1H9S B;  2PZU A;  4DXG A;  2XVS A;  4CHT B;  1EYC A;  1CZW A;  4A3K B;  1SE3 A;  1BCP C;  1V1O A;  1TY2 A;  1H9S A;  4ZRZ A;  1NCV A;  2SOB A;  4BBS B;  1PYW D;  2DY7 A;  5CR3 A;  5CV7 A;  3NXW A;  3GQB A;  3QIA A;  2MHV A;  5I4D A;  4I65 A;  1SNQ A;  3PIP 3;  1SE2 A;  1GUW A;  1SMY C;  4K5X A;  1U4P A;  2VB3 X;  4WJW A;  1YNJ C;  4A3J B;  1CA5 A;  4KY7 A;  1JOO A;  4QMG A;  3H94 A;  3LNN A;  4TKO B;  3E5S A;  1HQR D;  2K5D A;  1G2T A;  2CW0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...