1O7DA

The structure of the bovine lysosomal a-mannosidase suggests a novel mechanism for low ph activation
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
291
structure length
291
Chain Sequence
b'GYKTCPKVKPDMLNVHLVPHTHDDVGWLKTVDQYFYGIYNNIQPAGVQYILDSVISSLLANPTRRFIYVEIAFFSRWWRQQTNATQKIVRELVRQGRLEFANGGWVMNDEATTHYGAIIDQMTLGLRFLEETFGSDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKKVRKKTLQMEQVWRASTSLKPPTADLFTSVLPNMYNPPEGLCWDMLCADKPVVEDTRSPEYNAKELVRYFLKLATDQGKLYRTKHTVMTMGSDFQYENANTWFKNLDKLIQLVNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysosomal alpha-mannosidase
publication title The Structure of Bovine Lysosomal Alpha-Mannosidase Suggests a Novel Mechanism for Low-Ph Activation
pubmed doi rcsb
molecule tags Hydrolase
total genus 93
structure length 291
sequence length 291
ec nomenclature ec 3.2.1.24: Alpha-mannosidase.
pdb deposition date 2002-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.110.10 Alpha Beta Alpha-Beta Barrel 7-stranded beta/alpha barrel Glycoside hydrolase 38, N terminal domain 1o7dA01
2B5DX 2FYVA 1TQTA 3BVTA 1TQVA 3P0BA 1HXKA 3BUPA 1QX1A 1R34A 3N98A 2F7QA 3DX0A 3N92A 1TQWA 3N8TA 2ALWA 3DX3A 2F7PA 3EJRA 1HWWA 3EJUA 3BVWA 3BLBA 3DDGA 2OW7A 3DX4A 3CZSA 1TQSA 3BUIA 3EJTA 3EJSA 1O7DA 3D50A 3EJQA 3EJPA 1PS3A 1QWNA 1HTYA 3DX2A 3D52A 3BVVA 3DX1A 3DDFA 1TQUA 3BVXA 1UFAA 2F7RA 3D4YA 3D4ZA 1QWUA 1R33A 3BUBA 3BUDA 2F1BA 2F7OA 3BUQA 3D51A 2F1AA 5KBPA 3CZNA 2OW6A 2F18A 3CV5A 3BVUA 3LVTA
chains in the Genus database with same CATH superfamily
2B5DX 2FYVA 1TQTA 3BVTA 1TQVA 3P0BA 1HXKA 3BUPA 1K1WA 1QX1A 1R34A 2F7QA 3DX0A 3N92A 3N98A 1TQWA 3N8TA 2ALWA 3DX3A 2F7PA 3EJRA 1HWWA 3EJUA 3BVWA 3BLBA 3DDGA 2OW7A 3DX4A 3CZSA 1TQSA 1K1XA 3BUIA 3EJTA 3EJSA 1O7DA 3D50A 3EJQA 3EJPA 1PS3A 1QWNA 1HTYA 3DX2A 3D52A 3BVVA 3DX1A 3DDFA 1TQUA 3BVXA 1UFAA 2F7RA 3D4YA 3D4ZA 1QWUA 1R33A 3BUBA 3BUDA 1K1YA 2F1BA 2F7OA 3BUQA 3D51A 2F1AA 5KBPA 3CZNA 2OW6A 2F18A 3CV5A 3BVUA 3LVTA
chains in the Genus database with same CATH topology
2B5DX 2FYVA 1TQTA 3BVTA 1TQVA 3P0BA 1HXKA 3BUPA 1QX1A 1R34A 3N98A 2F7QA 3DX0A 3N92A 1TQWA 3N8TA 2ALWA 3DX3A 2F7PA 3EJRA 1HWWA 3EJUA 3BVWA 3BLBA 3DDGA 2OW7A 3DX4A 3CZSA 1TQSA 3BUIA 3EJTA 3EJSA 1O7DA 3D50A 3EJQA 3EJPA 1PS3A 1QWNA 1HTYA 3DX2A 3D52A 3BVVA 3DX1A 3DDFA 1TQUA 3BVXA 1UFAA 2F7RA 3D4YA 3D4ZA 1QWUA 1R33A 3BUBA 3BUDA 2F1BA 2F7OA 3BUQA 3D51A 2F1AA 5KBPA 3CZNA 2OW6A 2F18A 3CV5A 3BVUA 3LVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5D X;  2FYV A;  1TQT A;  3BVT A;  1TQV A;  3P0B A;  1HXK A;  3BUP A;  1QX1 A;  1R34 A;  3N98 A;  2F7Q A;  3DX0 A;  3N92 A;  1TQW A;  3N8T A;  2ALW A;  3DX3 A;  2F7P A;  3EJR A;  1HWW A;  3EJU A;  3BVW A;  3BLB A;  3DDG A;  2OW7 A;  3DX4 A;  3CZS A;  1TQS A;  3BUI A;  3EJT A;  3EJS A;  1O7D A;  3D50 A;  3EJQ A;  3EJP A;  1PS3 A;  1QWN A;  1HTY A;  3DX2 A;  3D52 A;  3BVV A;  3DX1 A;  3DDF A;  1TQU A;  3BVX A;  1UFA A;  2F7R A;  3D4Y A;  3D4Z A;  1QWU A;  1R33 A;  3BUB A;  3BUD A;  2F1B A;  2F7O A;  3BUQ A;  3D51 A;  2F1A A;  5KBP A;  3CZN A;  2OW6 A;  2F18 A;  3CV5 A;  3BVU A;  3LVT A; 
#chains in the Genus database with same CATH topology
 2B5D X;  2FYV A;  1TQT A;  3BVT A;  1TQV A;  3P0B A;  1HXK A;  3BUP A;  1K1W A;  1QX1 A;  1R34 A;  2F7Q A;  3DX0 A;  3N92 A;  3N98 A;  1TQW A;  3N8T A;  2ALW A;  3DX3 A;  2F7P A;  3EJR A;  1HWW A;  3EJU A;  3BVW A;  3BLB A;  3DDG A;  2OW7 A;  3DX4 A;  3CZS A;  1TQS A;  1K1X A;  3BUI A;  3EJT A;  3EJS A;  1O7D A;  3D50 A;  3EJQ A;  3EJP A;  1PS3 A;  1QWN A;  1HTY A;  3DX2 A;  3D52 A;  3BVV A;  3DX1 A;  3DDF A;  1TQU A;  3BVX A;  1UFA A;  2F7R A;  3D4Y A;  3D4Z A;  1QWU A;  1R33 A;  3BUB A;  3BUD A;  1K1Y A;  2F1B A;  2F7O A;  3BUQ A;  3D51 A;  2F1A A;  5KBP A;  3CZN A;  2OW6 A;  2F18 A;  3CV5 A;  3BVU A;  3LVT A; 
#chains in the Genus database with same CATH homology
 2B5D X;  2FYV A;  1TQT A;  3BVT A;  1TQV A;  3P0B A;  1HXK A;  3BUP A;  1QX1 A;  1R34 A;  3N98 A;  2F7Q A;  3DX0 A;  3N92 A;  1TQW A;  3N8T A;  2ALW A;  3DX3 A;  2F7P A;  3EJR A;  1HWW A;  3EJU A;  3BVW A;  3BLB A;  3DDG A;  2OW7 A;  3DX4 A;  3CZS A;  1TQS A;  3BUI A;  3EJT A;  3EJS A;  1O7D A;  3D50 A;  3EJQ A;  3EJP A;  1PS3 A;  1QWN A;  1HTY A;  3DX2 A;  3D52 A;  3BVV A;  3DX1 A;  3DDF A;  1TQU A;  3BVX A;  1UFA A;  2F7R A;  3D4Y A;  3D4Z A;  1QWU A;  1R33 A;  3BUB A;  3BUD A;  2F1B A;  2F7O A;  3BUQ A;  3D51 A;  2F1A A;  5KBP A;  3CZN A;  2OW6 A;  2F18 A;  3CV5 A;  3BVU A;  3LVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...