1O7DD

The structure of the bovine lysosomal a-mannosidase suggests a novel mechanism for low ph activation
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
272
structure length
269
Chain Sequence
b'RDLVIQNEYLRARFDPNTGLLMELENLLLLPVRQAFYWYNASTGNNLSSQASGAYIFRPNQNKPLFVSHWAQTHLVKASLVQEVHQNFSAWCSQVVRLYPRQRHLELEWTVGPIPVGDGWGKEVISRFDTALATRGLFYTDSNGREILERRRNYRPTWKLNQTEPVAGNYYPVNSRIYITDGNMQLTVLTDRSQGGSSLRDGSLELMVHRRLLKDDARGVGEPLNKEGSGLWVRGRHLVLLDKKETAAARHRLQAEMEVLAPQVVLAQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysosomal alpha-mannosidase
publication title The Structure of Bovine Lysosomal Alpha-Mannosidase Suggests a Novel Mechanism for Low-Ph Activation
pubmed doi rcsb
molecule tags Hydrolase
total genus 59
structure length 269
sequence length 272
ec nomenclature ec 3.2.1.24: Alpha-mannosidase.
pdb deposition date 2002-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07748 Glyco_hydro_38C Glycosyl hydrolases family 38 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.30 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Golgi alpha-mannosidase II; domain 4 1o7dD01
1R34A 3EJQA 1HXKA 3DX3A 1TQSA 2WYHA 3BVUA 2F7QA 3BVWA 3D4ZA 3BUBA 1TQVA 2WYIA 3DX0A 1O7DD 3BUPA 1R33A 3D52A 3DX1A 2OW6A 1TQUA 2F1BA 3EJTA 1QX1A 2F7RA 2OW7A 1HTYA 1TQTA 2F1AA 3BVXA 4K35A 3BLBA 3LVTA 3D50A 3EJRA 3DX4A 3DX2A 3CZSA 3EJSA 3EJUA 1HWWA 3DDGA 1QWUA 3BUDA 2F7OA 3BUQA 3D4YA 3CZNA 1TQWA 3D51A 4K3AA 5KBPA 3DDFA 1QWNA 3BVTA 3BUIA 3CV5A 2F7PA 2ALWA 3BVVA 3EJPA 2F18A 1PS3A 2FYVA
chains in the Genus database with same CATH superfamily
2EABA 3E80A 2ZL8A 3D4ZA 1QAFA 3QFZA 3BUPA 1HM3A 2Y74A 3D52A 4FNRA 3MUZ1 3NJVA 2EACA 5JMFA 1TU5A 1AVKA 4RNLA 3DX2A 4KTPA 3CZSA 3VD3A 2WGQA 2YX9A 1D6YA 3CZNA 3T09A 5KBPA 3MI6A 1MMUA 2XN0A 1PX3A 3DCDA 1JZ4A 3W7SA 2WW3A 2Y73A 2BRPA 3DX1A 3BLCA 1JRQA 1QX1A 2E24A 1YQ2A 3S4BA 3IMHA 1J0MA 1NSMA 3LVTA 3EJRA 1SO0A 4OK4A 3X3XA 4FNTA 2D1WA 1NSZA 3ECQA 2CG1A 3T0AA 2XN1A 2F18A 2X03A 4BZGA 4UFCA 2CWTA 3VD7A 2CWUA 3MUY1 2WO0A 2WVZA 1NSVA 1X1HA 1HWWA 3T0BA 4KTRA 1IVVA 3RRSA 3Q1NA 3W7XA 1V7VA 3BUIA 2XSGA 3BVVA 1RWGA 3WFAA 1JOVA 2OOVA 1A2VA 4MMIA 1W7CA 4BTYA 1HM2A 1WMOA 1O7DD 3X3YA 3MWXA 1TQUA 3S4AA 3WA3A 1ULVA 1N7OA 3E7JA 1DYUA 2CFGA 1QWNA 1PX4A 1RW9A 2WW0A 1IVXA 2HTBA 1QALA 1D6UA 2JKPA 3HIIA 4MMHA 2CIQA 1OJPA 2YFOA 2OQEC 1JZ5A 1LURA 2F1AA 1W2ZA 3IAQA 4BTWA 2WW2A 2YFNA 4EV5A 5CA3A 2RDYA 3J7HA 1SIHA 3DECA 1I8QA 3HI7A 2ZQ0A 1X1IA 1LVNA 1SIIA 3OS7A 1JYNA 5E1QA 1JYXA 4FNSA 4KFDA 3BGAA 1W4NA 3I3DA 2C10A 1RWAA 2WVYA 3OBAA 3WIQA 3SXXA 1NSUA 3NREA 1N7PA 3VDCA 1W6GA 3CV5A 2CFLA 1JZ7A 3NJXA 3W7TA 3AFJA 1PU4A 3MV11 1HMWA 1N7RA 3D3IA 3LOYA 1EGUA 3I3EA 2EAEA 4AQ0A 1US1A 1NS7A 1HMUA 3K25A 1W5ZA 2F7PA 3S4CA 3VD5A 2XN2A 2BT3A 2FUTA 2CQTA 4BZEA 2Q1FA 3KN4A 2OW6A 4K35A 3DX4A 3MPHA 2CWVA 3A24A 3AFLA 4EV2A 3T2QA 3T2OA 1UI8A 3TY1A 1OACA 1NKGA 3I3BA 1NS2A 3DYMA 1W6CA 1C82A 3BVWA 4DUWA 3OB8A 2FUQA 2BRWA 1JYVA 3CZJA 2CFWA 2JKEA 1F4HA 1L7KA 3EJUA 3D4YA 3N9HA 3D51A 1NSSA 2WOFA 1SNZA 3AMOB 4J5TA 3DYPA 1K1XA 3X3ZA 3BVUA 1NSXA 3BUBA 1TQVA 3W7UA 1RJOA 3PGBA 2WW1A 2F7RA 3IAPA 4KFEA 2CFKA 1IQXA 1F1SA 1RWHA 3DDGA 4DUVA 3AMOA 4FNPA 3BS6A 3BVTA 1N9EA 1IQYA 3T0DA 3WIRA 1L7JA 2WYHA 3E1F1 3T2PA 2WDAA 3VD9A 1MMZA 3NBBA 3T0UA 3K5TA 3BLBA 1IVUA 1SPUA 3D50A 3ACSA 1QWUA 2EADA 1LF9A 2CISA 2WVXB 1IU7A 4NEIA 2WYIA 1TXKA 4BZHA 3SX1A 3EJTA 1HTYA 1NS0A 1JYWA 1UI7A 1RWFA 1YGAA 1IVWA 3WA2X 1OJOA 2OOVC 1QAKA 3BUDA 3W7WA 2OQEA 2WVXA 2W0QA 2CG0A 3DDFA 1JZ8A 1HN0A 3EJPA 1N7QA 1HXKA 1TQSA 1V7XA 1LXKA 4BTXA 4FNUA 2JKAA 3DX0A 2E2TA 3X42A 4BZFA 4OK2A 1N7NA 3T08A 2CQSA 3X40A 2WZSA 1LOHA 1OJMA 3KIIA 5A1AA 3ALAA 4OJZA 1X1JA 1RWCA 4K3AA 2D73A 3QFYA 3QDEA 3MV01 1MMYA 2E2VA 3QG0A 4FNQA 1R34A 1WMNA 1MMXA 2F7QA 1NS8A 1W3YA 2HTAA 1RKYA 3RSYA 1H54A 1HN1A 1D6ZA 3DYOA 1TQTA 2WCOA 2PNCA 1K1WA 1K1YA 4FNVA 3ACTA 1JZ3A 2E22A 1OJNA 1TQWA 3S4DA 3VD4A 3VSNA 1UG9A 2ALWA 2ZXQA 1PS3A 3BUQA 2WOHA 1NS4A 1AV4A 2XHNA 2CIRA 1Z45A 1R33A 1LXMA 4TTGA 5JMDA 1V7WA 1JZ2A 3BVXA 1JZ6A 3X41A 3VDAA 5GW7A 1NSRA 2F7OA 4KFFA 2CFDA 3A0OA 3HIGA 2BRVX 1MN0A 1KSIA 1DP0A 3SEPA 3VSMA 3EJQA 3DX3A 2C11A 4DUXA 2F1BA 2OW7A 2E2UA 3VDBA 1J0NA 3EJSA 1F9GA 1F4AA 1WMPA 3WVFA 1CB8A 3NBJA 1LF6A 1AVLA 1EKMA 2FYVA
chains in the Genus database with same CATH topology
1R34A 3EJQA 1HXKA 3DX3A 1TQSA 2WYHA 3BVUA 2F7QA 3BVWA 3D4ZA 3BUBA 1TQVA 2WYIA 3DX0A 1O7DD 3BUPA 1R33A 3D52A 3DX1A 2OW6A 1TQUA 2F1BA 3EJTA 1QX1A 2F7RA 2OW7A 1HTYA 1TQTA 2F1AA 3BVXA 4K35A 3BLBA 3LVTA 3D50A 3EJRA 3DX4A 3DX2A 3CZSA 3EJSA 3EJUA 1HWWA 3DDGA 1QWUA 3BUDA 2F7OA 3BUQA 3D4YA 3CZNA 1TQWA 3D51A 4K3AA 5KBPA 3DDFA 1QWNA 3BVTA 3BUIA 3CV5A 2F7PA 2ALWA 3BVVA 3EJPA 2F18A 1PS3A 2FYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R34 A;  3EJQ A;  1HXK A;  3DX3 A;  1TQS A;  2WYH A;  3BVU A;  2F7Q A;  3BVW A;  3D4Z A;  3BUB A;  1TQV A;  2WYI A;  3DX0 A;  1O7D D;  3BUP A;  1R33 A;  3D52 A;  3DX1 A;  2OW6 A;  1TQU A;  2F1B A;  3EJT A;  1QX1 A;  2F7R A;  2OW7 A;  1HTY A;  1TQT A;  2F1A A;  3BVX A;  4K35 A;  3BLB A;  3LVT A;  3D50 A;  3EJR A;  3DX4 A;  3DX2 A;  3CZS A;  3EJS A;  3EJU A;  1HWW A;  3DDG A;  1QWU A;  3BUD A;  2F7O A;  3BUQ A;  3D4Y A;  3CZN A;  1TQW A;  3D51 A;  4K3A A;  5KBP A;  3DDF A;  1QWN A;  3BVT A;  3BUI A;  3CV5 A;  2F7P A;  2ALW A;  3BVV A;  3EJP A;  2F18 A;  1PS3 A;  2FYV A; 
#chains in the Genus database with same CATH topology
 2EAB A;  3E80 A;  2ZL8 A;  3D4Z A;  1QAF A;  3QFZ A;  3BUP A;  1HM3 A;  2Y74 A;  3D52 A;  4FNR A;  3MUZ 1;  3NJV A;  2EAC A;  5JMF A;  1TU5 A;  1AVK A;  4RNL A;  3DX2 A;  4KTP A;  3CZS A;  3VD3 A;  2WGQ A;  2YX9 A;  1D6Y A;  3CZN A;  3T09 A;  5KBP A;  3MI6 A;  1MMU A;  2XN0 A;  1PX3 A;  3DCD A;  1JZ4 A;  3W7S A;  2WW3 A;  2Y73 A;  2BRP A;  3DX1 A;  3BLC A;  1JRQ A;  1QX1 A;  2E24 A;  1YQ2 A;  3S4B A;  3IMH A;  1J0M A;  1NSM A;  3LVT A;  3EJR A;  1SO0 A;  4OK4 A;  3X3X A;  4FNT A;  2D1W A;  1NSZ A;  3ECQ A;  2CG1 A;  3T0A A;  2XN1 A;  2F18 A;  2X03 A;  4BZG A;  4UFC A;  2CWT A;  3VD7 A;  2CWU A;  3MUY 1;  2WO0 A;  2WVZ A;  1NSV A;  1X1H A;  1HWW A;  3T0B A;  4KTR A;  1IVV A;  3RRS A;  3Q1N A;  3W7X A;  1V7V A;  3BUI A;  2XSG A;  3BVV A;  1RWG A;  3WFA A;  1JOV A;  2OOV A;  1A2V A;  4MMI A;  1W7C A;  4BTY A;  1HM2 A;  1WMO A;  1O7D D;  3X3Y A;  3MWX A;  1TQU A;  3S4A A;  3WA3 A;  1ULV A;  1N7O A;  3E7J A;  1DYU A;  2CFG A;  1QWN A;  1PX4 A;  1RW9 A;  2WW0 A;  1IVX A;  2HTB A;  1QAL A;  1D6U A;  2JKP A;  3HII A;  4MMH A;  2CIQ A;  1OJP A;  2YFO A;  2OQE C;  1JZ5 A;  1LUR A;  2F1A A;  1W2Z A;  3IAQ A;  4BTW A;  2WW2 A;  2YFN A;  4EV5 A;  5CA3 A;  2RDY A;  3J7H A;  1SIH A;  3DEC A;  1I8Q A;  3HI7 A;  2ZQ0 A;  1X1I A;  1LVN A;  1SII A;  3OS7 A;  1JYN A;  5E1Q A;  1JYX A;  4FNS A;  4KFD A;  3BGA A;  1W4N A;  3I3D A;  2C10 A;  1RWA A;  2WVY A;  3OBA A;  3WIQ A;  3SXX A;  1NSU A;  3NRE A;  1N7P A;  3VDC A;  1W6G A;  3CV5 A;  2CFL A;  1JZ7 A;  3NJX A;  3W7T A;  3AFJ A;  1PU4 A;  3MV1 1;  1HMW A;  1N7R A;  3D3I A;  3LOY A;  1EGU A;  3I3E A;  2EAE A;  4AQ0 A;  1US1 A;  1NS7 A;  1HMU A;  3K25 A;  1W5Z A;  2F7P A;  3S4C A;  3VD5 A;  2XN2 A;  2BT3 A;  2FUT A;  2CQT A;  4BZE A;  2Q1F A;  3KN4 A;  2OW6 A;  4K35 A;  3DX4 A;  3MPH A;  2CWV A;  3A24 A;  3AFL A;  4EV2 A;  3T2Q A;  3T2O A;  1UI8 A;  3TY1 A;  1OAC A;  1NKG A;  3I3B A;  1NS2 A;  3DYM A;  1W6C A;  1C82 A;  3BVW A;  4DUW A;  3OB8 A;  2FUQ A;  2BRW A;  1JYV A;  3CZJ A;  2CFW A;  2JKE A;  1F4H A;  1L7K A;  3EJU A;  3D4Y A;  3N9H A;  3D51 A;  1NSS A;  2WOF A;  1SNZ A;  3AMO B;  4J5T A;  3DYP A;  1K1X A;  3X3Z A;  3BVU A;  1NSX A;  3BUB A;  1TQV A;  3W7U A;  1RJO A;  3PGB A;  2WW1 A;  2F7R A;  3IAP A;  4KFE A;  2CFK A;  1IQX A;  1F1S A;  1RWH A;  3DDG A;  4DUV A;  3AMO A;  4FNP A;  3BS6 A;  3BVT A;  1N9E A;  1IQY A;  3T0D A;  3WIR A;  1L7J A;  2WYH A;  3E1F 1;  3T2P A;  2WDA A;  3VD9 A;  1MMZ A;  3NBB A;  3T0U A;  3K5T A;  3BLB A;  1IVU A;  1SPU A;  3D50 A;  3ACS A;  1QWU A;  2EAD A;  1LF9 A;  2CIS A;  2WVX B;  1IU7 A;  4NEI A;  2WYI A;  1TXK A;  4BZH A;  3SX1 A;  3EJT A;  1HTY A;  1NS0 A;  1JYW A;  1UI7 A;  1RWF A;  1YGA A;  1IVW A;  3WA2 X;  1OJO A;  2OOV C;  1QAK A;  3BUD A;  3W7W A;  2OQE A;  2WVX A;  2W0Q A;  2CG0 A;  3DDF A;  1JZ8 A;  1HN0 A;  3EJP A;  1N7Q A;  1HXK A;  1TQS A;  1V7X A;  1LXK A;  4BTX A;  4FNU A;  2JKA A;  3DX0 A;  2E2T A;  3X42 A;  4BZF A;  4OK2 A;  1N7N A;  3T08 A;  2CQS A;  3X40 A;  2WZS A;  1LOH A;  1OJM A;  3KII A;  5A1A A;  3ALA A;  4OJZ A;  1X1J A;  1RWC A;  4K3A A;  2D73 A;  3QFY A;  3QDE A;  3MV0 1;  1MMY A;  2E2V A;  3QG0 A;  4FNQ A;  1R34 A;  1WMN A;  1MMX A;  2F7Q A;  1NS8 A;  1W3Y A;  2HTA A;  1RKY A;  3RSY A;  1H54 A;  1HN1 A;  1D6Z A;  3DYO A;  1TQT A;  2WCO A;  2PNC A;  1K1W A;  1K1Y A;  4FNV A;  3ACT A;  1JZ3 A;  2E22 A;  1OJN A;  1TQW A;  3S4D A;  3VD4 A;  3VSN A;  1UG9 A;  2ALW A;  2ZXQ A;  1PS3 A;  3BUQ A;  2WOH A;  1NS4 A;  1AV4 A;  2XHN A;  2CIR A;  1Z45 A;  1R33 A;  1LXM A;  4TTG A;  5JMD A;  1V7W A;  1JZ2 A;  3BVX A;  1JZ6 A;  3X41 A;  3VDA A;  5GW7 A;  1NSR A;  2F7O A;  4KFF A;  2CFD A;  3A0O A;  3HIG A;  2BRV X;  1MN0 A;  1KSI A;  1DP0 A;  3SEP A;  3VSM A;  3EJQ A;  3DX3 A;  2C11 A;  4DUX A;  2F1B A;  2OW7 A;  2E2U A;  3VDB A;  1J0N A;  3EJS A;  1F9G A;  1F4A A;  1WMP A;  3WVF A;  1CB8 A;  3NBJ A;  1LF6 A;  1AVL A;  1EKM A;  2FYV A; 
#chains in the Genus database with same CATH homology
 1R34 A;  3EJQ A;  1HXK A;  3DX3 A;  1TQS A;  2WYH A;  3BVU A;  2F7Q A;  3BVW A;  3D4Z A;  3BUB A;  1TQV A;  2WYI A;  3DX0 A;  1O7D D;  3BUP A;  1R33 A;  3D52 A;  3DX1 A;  2OW6 A;  1TQU A;  2F1B A;  3EJT A;  1QX1 A;  2F7R A;  2OW7 A;  1HTY A;  1TQT A;  2F1A A;  3BVX A;  4K35 A;  3BLB A;  3LVT A;  3D50 A;  3EJR A;  3DX4 A;  3DX2 A;  3CZS A;  3EJS A;  3EJU A;  1HWW A;  3DDG A;  1QWU A;  3BUD A;  2F7O A;  3BUQ A;  3D4Y A;  3CZN A;  1TQW A;  3D51 A;  4K3A A;  5KBP A;  3DDF A;  1QWN A;  3BVT A;  3BUI A;  3CV5 A;  2F7P A;  2ALW A;  3BVV A;  3EJP A;  2F18 A;  1PS3 A;  2FYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...