1O7DD

The structure of the bovine lysosomal a-mannosidase suggests a novel mechanism for low ph activation
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
272
structure length
269
Chain Sequence
RDLVIQNEYLRARFDPNTGLLMELENLLLLPVRQAFYWYNASTGNNLSSQASGAYIFRPNQNKPLFVSHWAQTHLVKASLVQEVHQNFSAWCSQVVRLYPRQRHLELEWTVGPIPVGDGWGKEVISRFDTALATRGLFYTDSNGREILERRRNYRPTWKLNQTEPVAGNYYPVNSRIYITDGNMQLTVLTDRSQGGSSLRDGSLELMVHRRLLKDDARGVGEPLNKEGSGLWVRGRHLVLLDKKETAAARHRLQAEMEVLAPQVVLAQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysosomal alpha-mannosidase
publication title The Structure of Bovine Lysosomal Alpha-Mannosidase Suggests a Novel Mechanism for Low-Ph Activation
pubmed doi rcsb
molecule tags Hydrolase
total genus 59
structure length 269
sequence length 272
ec nomenclature ec 3.2.1.24: Alpha-mannosidase.
pdb deposition date 2002-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07748 Glyco_hydro_38C Glycosyl hydrolases family 38 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.30 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Golgi alpha-mannosidase II; domain 4 1o7dD01
1PS3A 3BVVA 3EJTA 3BUIA 2F7OA 3DX0A 3EJSA 2F7QA 3DX4A 3BUQA 1TQSA 2OW7A 3BUPA 2WYHA 1TQTA 1HTYA 3CZSA 2F1AA 3BVXA 3DX1A 4K3AA 3BVTA 1TQUA 2WYIA 1TQVA 3EJUA 4K35A 2F7RA 3BUDA 3CV5A 3BLBA 3LVTA 2F18A 1R33A 2ALWA 3EJPA 3DX3A 2OW6A 3D4YA 1HWWA 3EJQA 5KBPA 2F1BA 1QWNA 3EJRA 3D50A 3D52A 3D51A 1HXKA 1O7DD 3DDGA 3BVWA 3CZNA 3DX2A 1TQWA 2FYVA 3BVUA 1QWUA 1R34A 2F7PA 3D4ZA 3DDFA 1QX1A 3BUBA
chains in the Genus database with same CATH superfamily
1WMPA 3BUIA 2D1WA 2W0QA 2E2UA 1NSRA 3K5TA 3VD7A 2WGQA 5CA3A 3BVTA 1TQUA 3HIIA 4BZGA 3BUDA 4BTXA 2CISA 3SXXA 1SNZA 3DYMA 5KBPA 1PU4A 1X1JA 3VDCA 1AVLA 1QWNA 3DYPA 1F1SA 2BRPA 1W6GA 2CG1A 2WW3A 1W6CA 2WO0A 1QWUA 3MUY1 1RWGA 3A0OA 3X3ZA 1QAFA 3I3DA 3BUPA 1IQYA 1PX3A 4UFCA 1MMZA 1MMUA 3WIQA 2F18A 3T0UA 2OW6A 1OACA 2WDAA 3EJQA 2X03A 3MV11 3PGBA 4MMHA 2BT3A 3D52A 2CFLA 2F7PA 1QX1A 3X42A 1V7XA 2E22A 1NS8A 2F7OA 1JYVA 1NSXA 2OW7A 1JZ3A 1LF9A 3DX1A 3EJUA 1R33A 2EADA 2WVXA 3D4YA 2WZSA 1NSSA 3QG0A 3KN4A 1HN0A 3DDFA 3VD3A 2C10A 2Q1FA 4BTWA 3DX0A 3VD4A 1HMWA 3A24A 2CQTA 1YGAA 5A1AA 2PNCA 1K1WA 4FNVA 4KFEA 1N7NA 3T0BA 3Q1NA 3OBAA 3W7XA 1MN0A 1JZ6A 2EAEA 2OQEA 2BRWA 2WOFA 1DYUA 3OB8A 3IMHA 4NEIA 1WMNA 1OJOA 1QALA 3MUZ1 1JZ8A 1IVWA 2WVZA 3BLCA 1I8QA 2JKPA 3CV5A 3T08A 1IQXA 2ALWA 3QFZA 4AQ0A 4KFFA 3DDGA 3AMOB 2FYVA 2WW1A 2XSGA 1IVXA 2JKEA 4DUXA 3T2QA 3EJTA 4FNUA 3X3XA 3HIGA 1HTYA 1RJOA 2OOVC 1CB8A 1SIHA 3VSNA 4BTYA 1RWCA 1RWAA 4OK4A 4BZEA 4EV5A 1UI7A 2CFGA 1C82A 2D73A 3T0DA 3W7UA 2EACA 1DP0A 1O7DD 2JKAA 1PS3A 1JRQA 2E2TA 3QFYA 3I3BA 2EABA 3S4CA 1TQVA 2F7RA 1NSMA 4MMIA 4TTGA 1LXMA 3MI6A 3DYOA 3WA3A 1NSZA 1PX4A 4RNLA 3CZJA 2YFOA 1J0MA 4FNPA 2RDYA 1LOHA 1R34A 3T09A 1HMUA 1LXKA 3ACTA 2CQSA 4FNQA 3IAPA 1HN1A 3WA2X 3VDBA 2XHNA 3SEPA 2FUQA 3W7WA 2ZL8A 3VD5A 1N7PA 1L7JA 2CWTA 1OJPA 1F9GA 1JZ2A 3T0AA 3VD9A 2CG0A 3EJSA 3DX4A 4KTRA 4OJZA 1K1XA 3AFJA 1SPUA 1W5ZA 1JYNA 1NS4A 4K35A 3DX3A 3AMOA 3I3EA 3S4DA 1L7KA 1JZ4A 1N7RA 2C11A 1JYWA 3BVWA 2YFNA 3CZNA 3DX2A 4EV2A 3ALAA 3BVUA 3D4ZA 1TU5A 2ZXQA 2BRVX 1ULVA 3CZSA 4K3AA 3NJVA 1LVNA 1RWHA 1KSIA 3E7JA 2FUTA 3BLBA 3RRSA 3AFLA 1HM2A 1HWWA 1JOVA 1QAKA 1WMOA 2E2VA 1EGUA 1K1YA 3BGAA 2CFKA 1D6UA 1SIIA 2YX9A 3SX1A 5E1QA 3K25A 5GW7A 3NREA 1UI8A 4KFDA 1JZ7A 2Y73A 1LURA 3X41A 2F1BA 2XN1A 1AVKA 3NBJA 1W3YA 4FNTA 3BS6A 4DUWA 3DCDA 1N7QA 1LF6A 1F4HA 3QDEA 4J5TA 3T2PA 3BUQA 3W7TA 3TY1A 4BZHA 3S4BA 1UG9A 3D3IA 3VDAA 3DECA 2XN2A 1J0NA 3D50A 3MV01 1D6YA 1RW9A 1N9EA 2WW2A 1IVVA 4FNRA 2HTAA 5JMFA 1X1IA 2CFWA 2OOVA 3HI7A 1NKGA 1NS0A 2Y74A 3N9HA 1H54A 1W2ZA 3OS7A 1NS2A 3ECQA 1JZ5A 4FNSA 1MMYA 2WOHA 4KTPA 3NJXA 3WVFA 3W7SA 3X3YA 2OQEC 1W7CA 5JMDA 3BUBA 1F4AA 1US1A 3BVVA 3KIIA 4DUVA 3IAQA 2ZQ0A 1TQTA 2WW0A 2F1AA 2WYIA 3EJPA 3WFAA 2WCOA 3MWXA 3EJRA 1JYXA 3X40A 1HXKA 1NS7A 3MPHA 3VSMA 1HM3A 2E24A 1V7VA 3E1F1 1V7WA 1MMXA 2F7QA 1D6ZA 1TQSA 2WYHA 2CWUA 3LOYA 1X1HA 1SO0A 3WIRA 1RWFA 1RKYA 3ACSA 3S4AA 2CWVA 2WVXB 2CIRA 4BZFA 1EKMA 1IVUA 1N7OA 3NBBA 1W4NA 1OJNA 1Z45A 3BVXA 1OJMA 1NSVA 1TXKA 3J7HA 2HTBA 1IU7A 3LVTA 1A2VA 2CFDA 3RSYA 1NSUA 2CIQA 3T2OA 3D51A 4OK2A 3E80A 1TQWA 1YQ2A 2XN0A 2WVYA 1AV4A
chains in the Genus database with same CATH topology
1PS3A 3BVVA 3EJTA 3BUIA 2F7OA 3DX0A 3EJSA 2F7QA 3DX4A 3BUQA 1TQSA 2OW7A 3BUPA 2WYHA 1TQTA 1HTYA 3CZSA 2F1AA 3BVXA 3DX1A 4K3AA 3BVTA 1TQUA 2WYIA 1TQVA 3EJUA 4K35A 2F7RA 3BUDA 3CV5A 3BLBA 3LVTA 2F18A 1R33A 2ALWA 3EJPA 3DX3A 2OW6A 3D4YA 1HWWA 3EJQA 5KBPA 2F1BA 1QWNA 3EJRA 3D50A 3D52A 3D51A 1HXKA 1O7DD 3DDGA 3BVWA 3CZNA 3DX2A 1TQWA 2FYVA 3BVUA 1QWUA 1R34A 2F7PA 3D4ZA 3DDFA 1QX1A 3BUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PS3 A;  3BVV A;  3EJT A;  3BUI A;  2F7O A;  3DX0 A;  3EJS A;  2F7Q A;  3DX4 A;  3BUQ A;  1TQS A;  2OW7 A;  3BUP A;  2WYH A;  1TQT A;  1HTY A;  3CZS A;  2F1A A;  3BVX A;  3DX1 A;  4K3A A;  3BVT A;  1TQU A;  2WYI A;  1TQV A;  3EJU A;  4K35 A;  2F7R A;  3BUD A;  3CV5 A;  3BLB A;  3LVT A;  2F18 A;  1R33 A;  2ALW A;  3EJP A;  3DX3 A;  2OW6 A;  3D4Y A;  1HWW A;  3EJQ A;  5KBP A;  2F1B A;  1QWN A;  3EJR A;  3D50 A;  3D52 A;  3D51 A;  1HXK A;  1O7D D;  3DDG A;  3BVW A;  3CZN A;  3DX2 A;  1TQW A;  2FYV A;  3BVU A;  1QWU A;  1R34 A;  2F7P A;  3D4Z A;  3DDF A;  1QX1 A;  3BUB A; 
#chains in the Genus database with same CATH topology
 1WMP A;  3BUI A;  2D1W A;  2W0Q A;  2E2U A;  1NSR A;  3K5T A;  3VD7 A;  2WGQ A;  5CA3 A;  3BVT A;  1TQU A;  3HII A;  4BZG A;  3BUD A;  4BTX A;  2CIS A;  3SXX A;  1SNZ A;  3DYM A;  5KBP A;  1PU4 A;  1X1J A;  3VDC A;  1AVL A;  1QWN A;  3DYP A;  1F1S A;  2BRP A;  1W6G A;  2CG1 A;  2WW3 A;  1W6C A;  2WO0 A;  1QWU A;  3MUY 1;  1RWG A;  3A0O A;  3X3Z A;  1QAF A;  3I3D A;  3BUP A;  1IQY A;  1PX3 A;  4UFC A;  1MMZ A;  1MMU A;  3WIQ A;  2F18 A;  3T0U A;  2OW6 A;  1OAC A;  2WDA A;  3EJQ A;  2X03 A;  3MV1 1;  3PGB A;  4MMH A;  2BT3 A;  3D52 A;  2CFL A;  2F7P A;  1QX1 A;  3X42 A;  1V7X A;  2E22 A;  1NS8 A;  2F7O A;  1JYV A;  1NSX A;  2OW7 A;  1JZ3 A;  1LF9 A;  3DX1 A;  3EJU A;  1R33 A;  2EAD A;  2WVX A;  3D4Y A;  2WZS A;  1NSS A;  3QG0 A;  3KN4 A;  1HN0 A;  3DDF A;  3VD3 A;  2C10 A;  2Q1F A;  4BTW A;  3DX0 A;  3VD4 A;  1HMW A;  3A24 A;  2CQT A;  1YGA A;  5A1A A;  2PNC A;  1K1W A;  4FNV A;  4KFE A;  1N7N A;  3T0B A;  3Q1N A;  3OBA A;  3W7X A;  1MN0 A;  1JZ6 A;  2EAE A;  2OQE A;  2BRW A;  2WOF A;  1DYU A;  3OB8 A;  3IMH A;  4NEI A;  1WMN A;  1OJO A;  1QAL A;  3MUZ 1;  1JZ8 A;  1IVW A;  2WVZ A;  3BLC A;  1I8Q A;  2JKP A;  3CV5 A;  3T08 A;  1IQX A;  2ALW A;  3QFZ A;  4AQ0 A;  4KFF A;  3DDG A;  3AMO B;  2FYV A;  2WW1 A;  2XSG A;  1IVX A;  2JKE A;  4DUX A;  3T2Q A;  3EJT A;  4FNU A;  3X3X A;  3HIG A;  1HTY A;  1RJO A;  2OOV C;  1CB8 A;  1SIH A;  3VSN A;  4BTY A;  1RWC A;  1RWA A;  4OK4 A;  4BZE A;  4EV5 A;  1UI7 A;  2CFG A;  1C82 A;  2D73 A;  3T0D A;  3W7U A;  2EAC A;  1DP0 A;  1O7D D;  2JKA A;  1PS3 A;  1JRQ A;  2E2T A;  3QFY A;  3I3B A;  2EAB A;  3S4C A;  1TQV A;  2F7R A;  1NSM A;  4MMI A;  4TTG A;  1LXM A;  3MI6 A;  3DYO A;  3WA3 A;  1NSZ A;  1PX4 A;  4RNL A;  3CZJ A;  2YFO A;  1J0M A;  4FNP A;  2RDY A;  1LOH A;  1R34 A;  3T09 A;  1HMU A;  1LXK A;  3ACT A;  2CQS A;  4FNQ A;  3IAP A;  1HN1 A;  3WA2 X;  3VDB A;  2XHN A;  3SEP A;  2FUQ A;  3W7W A;  2ZL8 A;  3VD5 A;  1N7P A;  1L7J A;  2CWT A;  1OJP A;  1F9G A;  1JZ2 A;  3T0A A;  3VD9 A;  2CG0 A;  3EJS A;  3DX4 A;  4KTR A;  4OJZ A;  1K1X A;  3AFJ A;  1SPU A;  1W5Z A;  1JYN A;  1NS4 A;  4K35 A;  3DX3 A;  3AMO A;  3I3E A;  3S4D A;  1L7K A;  1JZ4 A;  1N7R A;  2C11 A;  1JYW A;  3BVW A;  2YFN A;  3CZN A;  3DX2 A;  4EV2 A;  3ALA A;  3BVU A;  3D4Z A;  1TU5 A;  2ZXQ A;  2BRV X;  1ULV A;  3CZS A;  4K3A A;  3NJV A;  1LVN A;  1RWH A;  1KSI A;  3E7J A;  2FUT A;  3BLB A;  3RRS A;  3AFL A;  1HM2 A;  1HWW A;  1JOV A;  1QAK A;  1WMO A;  2E2V A;  1EGU A;  1K1Y A;  3BGA A;  2CFK A;  1D6U A;  1SII A;  2YX9 A;  3SX1 A;  5E1Q A;  3K25 A;  5GW7 A;  3NRE A;  1UI8 A;  4KFD A;  1JZ7 A;  2Y73 A;  1LUR A;  3X41 A;  2F1B A;  2XN1 A;  1AVK A;  3NBJ A;  1W3Y A;  4FNT A;  3BS6 A;  4DUW A;  3DCD A;  1N7Q A;  1LF6 A;  1F4H A;  3QDE A;  4J5T A;  3T2P A;  3BUQ A;  3W7T A;  3TY1 A;  4BZH A;  3S4B A;  1UG9 A;  3D3I A;  3VDA A;  3DEC A;  2XN2 A;  1J0N A;  3D50 A;  3MV0 1;  1D6Y A;  1RW9 A;  1N9E A;  2WW2 A;  1IVV A;  4FNR A;  2HTA A;  5JMF A;  1X1I A;  2CFW A;  2OOV A;  3HI7 A;  1NKG A;  1NS0 A;  2Y74 A;  3N9H A;  1H54 A;  1W2Z A;  3OS7 A;  1NS2 A;  3ECQ A;  1JZ5 A;  4FNS A;  1MMY A;  2WOH A;  4KTP A;  3NJX A;  3WVF A;  3W7S A;  3X3Y A;  2OQE C;  1W7C A;  5JMD A;  3BUB A;  1F4A A;  1US1 A;  3BVV A;  3KII A;  4DUV A;  3IAQ A;  2ZQ0 A;  1TQT A;  2WW0 A;  2F1A A;  2WYI A;  3EJP A;  3WFA A;  2WCO A;  3MWX A;  3EJR A;  1JYX A;  3X40 A;  1HXK A;  1NS7 A;  3MPH A;  3VSM A;  1HM3 A;  2E24 A;  1V7V A;  3E1F 1;  1V7W A;  1MMX A;  2F7Q A;  1D6Z A;  1TQS A;  2WYH A;  2CWU A;  3LOY A;  1X1H A;  1SO0 A;  3WIR A;  1RWF A;  1RKY A;  3ACS A;  3S4A A;  2CWV A;  2WVX B;  2CIR A;  4BZF A;  1EKM A;  1IVU A;  1N7O A;  3NBB A;  1W4N A;  1OJN A;  1Z45 A;  3BVX A;  1OJM A;  1NSV A;  1TXK A;  3J7H A;  2HTB A;  1IU7 A;  3LVT A;  1A2V A;  2CFD A;  3RSY A;  1NSU A;  2CIQ A;  3T2O A;  3D51 A;  4OK2 A;  3E80 A;  1TQW A;  1YQ2 A;  2XN0 A;  2WVY A;  1AV4 A; 
#chains in the Genus database with same CATH homology
 1PS3 A;  3BVV A;  3EJT A;  3BUI A;  2F7O A;  3DX0 A;  3EJS A;  2F7Q A;  3DX4 A;  3BUQ A;  1TQS A;  2OW7 A;  3BUP A;  2WYH A;  1TQT A;  1HTY A;  3CZS A;  2F1A A;  3BVX A;  3DX1 A;  4K3A A;  3BVT A;  1TQU A;  2WYI A;  1TQV A;  3EJU A;  4K35 A;  2F7R A;  3BUD A;  3CV5 A;  3BLB A;  3LVT A;  2F18 A;  1R33 A;  2ALW A;  3EJP A;  3DX3 A;  2OW6 A;  3D4Y A;  1HWW A;  3EJQ A;  5KBP A;  2F1B A;  1QWN A;  3EJR A;  3D50 A;  3D52 A;  3D51 A;  1HXK A;  1O7D D;  3DDG A;  3BVW A;  3CZN A;  3DX2 A;  1TQW A;  2FYV A;  3BVU A;  1QWU A;  1R34 A;  2F7P A;  3D4Z A;  3DDF A;  1QX1 A;  3BUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...