1O7MB

Naphthalene 1,2-dioxygenase, binary complex with dioxygen
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
publication title Crystal Structure of Naphthalene Dioxygenase: Side-on Binding of Dioxygen to Iron
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 52
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1o7mB00
3UJMA 4K1UA 5IG5A 1JKGA 5IG0A 2B1XB 3MG3A 5IEOA 4RZMA 3A76A 1NWWA 4CDLA 3KE7A 1OH0A 3E99A 4HM8B 4H3UA 1QJGA 3NXJA 3FH1A 1JB4A 3EQQB 5KP3A 3OWYA 3T8NA 2I9WA 2XSHB 3MG2A 2HMJB 3JUPA 2GXFA 4Q53A 2XSOB 5DRVA 3FSDA 2F86B 2STDA 5D82A 4K1VA 1Q42A 4FCMA 3STDA 4KVHA 4LMIA 3F8HA 2GBXB 3F7SA 5BXQA 5AIIA 5CF1A 4WYKB 3B7CA 3B4PA 3EN1B 3RGAA 3G8ZA 1O7PB 5JPPA 4N3VA 1K41A 3SOYA 5AI1A 4XB5A 3LZAA 4XDWA 3F8XA 3WMDA 4HM4B 3NUVA 3OWSA 5AIFA 3EJVA 1DMNA 1W02A 2XRXB 3HZPA 4L8OA 2HMOB 1O7WB 1JN5A 3K0ZA 2F99A 2Z76A 1U5OA 3NV0A 4XBTA 3ROBA 3GZXB 3KKGA 5KP1A 3CU3A 3ER7A 1ISKA 2CHCA 1ZX2A 4HZ9B 5JPUA 1OHSA 1TP6A 4ORLA 3DXOA 4PEJA 4XM4A 2GEYA 3EN8A 2YFJB 1ASKA 3LYGA 5AEUB 1NDOB 4X2OA 3MSOA 3CNXA 1UUVB 2Z77A 5HGRA 4HM1B 5CLKA 5IEPA 4R1KA 3CNMA 3VSYA 2RCDA 1OGXA 4HM2B 2F98A 3OX9A 3JUOA 4XDVA 1JB5A 3DMCA 3S5CA 3GZBA 2IMJA 1Q40B 5D83A 1OPYA 2Z7AA 3JUQA 1WQLB 2BMQB 3B4OA 4I4KA 3I0YA 4IIAA 4HVNA 4WYKA 4R9LA 3RGRA 1O7MB 1HKXA 4HM7B 5D81A 3KZTA 1ZO2A 8CHOA 4OUQA 5TGNA 4R9KA 3H3HA 3H51A 3EBTA 3F7XA 4MJDA 3BLZA 1S5AA 2PZVA 5AIHA 3M8CA 3OXAA 3GZRA 3MYTA 3F9SA 5CF2A 3FZWA 1E97A 1O7GB 3SOAA 5IF6A 1GYBA 2GEXA 2CKFB 1GY5A 3G16A 5IG4A 4U13A 1DMQA 3T8UA 2BNGA 3VGNA 1GY7A 1Z1SA 3Q90A 1E3VA 5IENA 3EX9A 2BMOB 3EHCA 4HM0B 2RGQA 2JQ5A 2BMRB 3OV4A 3K7CA 4LGQA 1AR0A 4HKVB 1BUQA 3UNLA 1O7HB 4WWUC 2QIYA 3F40A 1IDPA 1Q40A 3EBYA 2A15A 3SEDA 1STDA 7STDA 5CK6A 4HM5B 1W6YA 2W2CA 1C7HA 1DMMA 4J9AA 1OGZA 4LEHA 4HJLB 5G2GA 3FKAA 2INXA 3MKIA 3FGYA 1GY6A 3FLJA 3D9RA 6STDA 1W01A 1OF5B 3BB9A 5AIGA 5KP4A 4WP5A 5EVHA 3EF8A 1E3RA 4OVMA 4GB5A 4STDA 1O7NB 5STDA 2HMLB 3NHXA 1JKGB 4FCJA 2GBWB 3HX8A 3GRDA 3IPTA 2HMNB 4HZBB 4X2HA 1JB2A 4XBYA 3MG1A 2UX0A 1OHOA 2RFRA 3GWRA 3NM2A 3DZLA 1QMAA 1ULIB 3EC9A 3JUNA 1W00A 4XBXA 3NBRA 1OHPA 2XR8B 1EA2A 4L7KA 4HM3B 3FF0A 4HM6B 1OUNA 1ULJB 3KSPA 3MHEA 1CQSA 3ECFA 1GS3A 2R4IA 3DM8A 1TUHA 1OCVA 5IG3A 3G0KA 1UUWB 2YFIB 5DREA 4L8PA 3OWUA 5CXOA 3F14A 5BVBA 2K54A 3HK4A 3FF2A 1SJWA 2HMMB 1A2KA 2B24B 5FW5A 4J8TA 1EG9B 2QGUA 2YFLB 1VZZA 2OWPA 1OF5A 3CPOA 5IERA 3GZYB 3B8LA 1JN5B 3JUMA 2HMKB 1NU3A 3NV0B 5AEWB 3DUKA
chains in the Genus database with same CATH superfamily
3UJMA 4K1UA 5IG5A 1JKGA 5IG0A 2B1XB 3MG3A 1FGRA 3LXUX 1RKYA 5IEOA 3URPA 1MWSA 3FG3A 4CJNA 2CK3H 4RZMA 1QALA 3A76A 1FGOA 1JZDA 3DGNA 1NWWA 1WMNA 4CDLA 3KCHA 3KE7A 1OH0A 1VQN3 3E99A 1VQ73 1BVIA 4HM8B 5M1AA 5G1LA 1LQMB 2UGIA 2QA43 1RGLA 4H3UA 3V98A 2D1WA 3X3ZA 1QJGA 3SX1A 1I2EA 3NXJA 2IUKA 3FH1A 3Q1CA 3T0UA 1JB4A 4EBGA 3EQQB 3MPHA 2CW9A 5KP3A 3CCU3 1LVNA 3OWYA 3T8NA 3WR2A 1DVCA 1YNVX 1BOXA 1B2ZA 1IU7A 1L5GB 3CCS3 2I9WA 2XSHB 4CCVA 1BSEA 2JDIH 1B21A 3MG2A 4FR9A 1N5HA 2HMJB 1RRLA 3NX0A 2CIUA 2CWVA 2CG1A 3JUPA 2GXFA 1HYFA 4Q53A 3UL6A 2XSOB 4N6TA 3X41A 5DRVA 3FSDA 3LMLA 2CFWA 2F86B 2H0GA 2STDA 5D82A 4K1VA 1Q42A 3PCRA 3TDGA 1JJ22 4FCMA 2MF7A 5AEUB 3QK9A 2PNCA 2XH9A 4ILFA 4R80A 1X1WA 3A5EA 1IV7A 4RBNA 5GSPA 1R4YA 4K90B 3STDA 1VQP3 2KCDA 1KWIA 1BNFA 1GMQA 2E2VA 4KVHA 1UW1A 4O8SA 1MNLA 3AHWA 2L1SA 1MWUA 3AGOA 2W9QA 4BTYA 5AYSC 4LMIA 5EEOA 3EE1A 1SQWA 3D5GA 1W6GA 1Y4KA 3F8HA 3U97A 2GBXB 3BNEA 3F7SA 5BXQA 1FA3A 1B20A 2OTJ3 3BNCA 3PS8A 4KFFA 2O9UX 1RCLA 2OQEC 4JRFA 5AIIA 5CF1A 3Q2PA 2F56A 1BRKA 4WYKB 2W56A 1IT7A 1SPUA 3B7CA 4OK0A 1CH0A 2XF3A 2SARA 1RJOA 1I3FA 3B4PA 3EN1B 2OOVC 3RGAA 1KC84 3G8ZA 2CFDA 1PFPA 2ZL8A 1S723 3PXMA 1M904 1Q9EA 1O7PB 5JPPA 2BT3A 4N3VA 2Y73A 3FG1A 1K41A 1LRAA 1UCKA 3WA3A 3SOYA 4BU4A 5AI1A 2J8XB 2F5WA 4XB5A 3LZAA 4XDWA 3F8XA 1GD4A 1W4NA 4HM4B 3WMDA 1RMSA 2LQVA 3NUVA 3OWSA 1RHLA 3EJVA 4H61A 5AIFA 5FGOA 3CCM3 1DMNA 1W02A 2WOFA 4KZ1A 2XRXB 3HZPA 3K9MC 3WA2X 2RSXA 4L8OA 2HMOB 1O7WB 5AYRB 3S29A 1JN5A 3K0ZA 3LH4A 1N9JA 2F99A 1HZ1A 1LNHA 2Z76A 3GSPA 1J2BA 1U5OA 1BGSA 1T2HA 3NV0A 4XBTA 5ELJA 2MC8A 3BU4A 4QWTA 2V1LA 3ROBA 3GZXB 1PYLA 2WOHA 4EC6A 1N8QA 1GMPA 2BHMA 2WGOA 3KKGA 3G4S3 2P0MA 5KP1A 4CPKA 3CU3A 2GSPA 3O8YA 1VQ53 1K734 2O3OA 3ER7A 2CHCA 1ISKA 1D6YA 1RNTA 1W2ZA 4KFEA 1ZX2A 1QVG2 2LYXA 4HZ9B 5JPUA 1OHSA 1BRIA 1TP6A 3X3YA 2M7OA 2E2TA 4ORLA 3DXOA 2K0MA 2P09A 4BIRA 4PEJA 1I2GA 3EB8A 1T3BA 4XM4A 2GEYA 1W6CA 3EN8A 2YFJB 1ASKA 1IT8A 1DYUA 1FUSA 1NDOB 3LYGA 3MSOA 4IT7A 4NREA 3CNXA 4X2OA 4HBRA 1Q814 3LTDA 1K8A4 3AHSA 1M1K4 1DVDA 1G02A 4N6LA 3PCSA 2L4VA 1FGQA 2RNTA 1B2XA 1D6UA 1BNJA 1U8CB 1UUVB 2Z77A 1VQ83 1SIIA 2KF5A 5HGRA 7GSPA 3UB1A 1GOUA 3N8BA 1Q7HA 1RGAA 4HM1B 5CLKA 5IEPA 1UCJA 4R1KA 1DE3A 1YJN3 1JBRA 4R4KA 1KD14 2F4YA 3CNMA 1BANA 3VSYA 2RCDA 1OGXA 4HM2B 4HYZA 1A67A 2F98A 3WDGB 1TFOA 3OX9A 1QAKA 1SIHA 3JUOA 1YGWA 4XDVA 1IVVA 3WOEB 4RNZA 1R4CA 3D5IA 1JB5A 1FUWA 2C4BA 1BRJA 3CC23 3DMCA 2ML5A 3D3LA 3V92A 3S5CA 3GZBA 3AMOA 1LOXA 2IMJA 1GMRA 1Q40B 2XGLA 3JVCA 4IPBA 4K61A 1JBSA 2CFGA 3DGOA 5D83A 3CCJ3 1ZS7A 3CME3 2ZHXB 4N6NB 1OPYA 4KT3B 4NHFA 1EQKA 2Z7AA 5HOHA 1Q7Y4 3JUQA 1SARA 1WQLB 2BMQB 3B4OA 3K5TA 4I4KA 1KSIA 1BRHA 1WMOA 1IVUA 4BL2A 2C10A 4BTWA 1GOYA 2P0XA 3I0YA 4IIAA 3CPW2 2BU4A 2Y74A 2QEX3 4HVNA 3X42A 4WYKA 4R9LA 3CC73 3RGRA 1VQO3 2KXGA 1FW7A 1O7MB 5BU4A 5M18A 2Q07A 1BRSA 1HKXA 4N6V0 1V58A 4HM7B 4J5GA 5D81A 1I3IA 3MWZA 3KZTA 1ZO2A 4TX4A 8CHOA 1ROAA 4G1MB 4OUQA 5TGNA 1BSBA 1I0VA 1VQQA 4R9KA 1G96A 3H3HA 3DY5A 3H51A 2K3DA 1MGWA 2W6JH 3DGLA 3S28A 2F5MA 3G6E3 1PY3A 5LC7A 2IYJA 3EBTA 2CC3A 3V99A 3F7XA 1X1YA 4MJDA 1RCKA 3BLZA 1US1A 3UL5A 1S5AA 4BL3A 1PU4A 4O02B 1KQS2 1FZUA 1LOYA 4RNTA 1X1XA 3ALAA 3PZWA 1IVWA 1LOVA 1T2IA 3PYJA 4JF8A 1BNRA 1JNQA 2PZVA 4N6OB 4BTXA 5AIHA 1RLSA 6GSPA 3M8CA 3OXAA 2AADA 4MEIA 3GZRA 3MYTA 1B2MA 1WMPA 3F9SA 1A2PA 3U1WA 4LYLB 5CF2A 3FZWA 1E97A 1O7GB 3KFQC 3SOAA 5IF6A 9RNTA 2WO0A 1GYBA 2C11A 1W7CA 2BO9B 1VQ63 2GEXA 3NBJA 2CKFB 2OQEA 5JBSA 1GY5A 2ZA4A 1V74A 3D79A 1LQGC 3G16A 4AEQA 4U13A 5IG4A 1VQK3 1DMQA 1AV4A 3CCE3 1EEJA 3T8UA 2BNGA 3KIIA 4RNYA 2W0QA 3QRDA 2OOVA 5BIRA 3VGNA 1TTOA 3I563 1VQ43 2H0IA 4LSOA 1GY7A 1QAFA 1Z1SA 3N9HA 3HIGA 1IYYA 1G0TA 3Q90A 1FGMA 3WHOA 1AVLA 1JZOA 1UI8A 4EXRA 4ZM8A 1VQ93 1QVF2 1E3VA 2ML6A 3HI7A 1NB5I 1RGCA 1X1UA 1IVXA 5IENA 1LNIA 2R41A 3EX9A 2BMOB 4FMAA 3NQYA 2CG0A 3EHCA 4HM0B 2RGQA 4N6MA 3I553 2JQ5A 1UCIA 4O2HA 1AY7A 1GD3A 1N9EA 2BMRB 3OV4A 3CCV3 3K7CA 1RRHA 4LGQA 2BIRA 1Q864 1AR0A 1I0XA 4HKVB 2P05A 1BUQA 1RN7A 3UNLA 1O7HB 4WWUC 1RTUA 2QIYA 3F40A 1MWTA 1RGEA 5A0OB 1IDPA 1Q40A 1AQZA 1EKMA 2OCTA 1CEWI 3EBYA 2A15A 3SEDA 1UI7A 1STDA 7STDA 1B27A 3N54B 1I70A 1UDII 3D4AA 1YHQ3 5CK6A 1GOVA 2H0HA 3CCL3 3X3XA 2CX0A 1M9GA 2IY2A 4HM5B 4EV5A 3CXC2 1RSNA 1EUIC 1YIJ3 1BIRA 1W6YA 1HU9A 1RN1A 2W2CA 1C7HA 1IQXA 4AKYA 1DMMA 4J9AA 3ZG0A 1OGZA 3LTCA 1LXEA 4FMDA 4LEHA 4HJLB 2KRTA 3FG4A 3SVAA 5G2GA 1JRQA 1K28A 3FKAA 3DGYA 2KF6A 3RNTA 5IW9A 2OTL3 3LT9A 1BNSA 2INXA 2XEPA 3FGYA 3MKIA 4DKIA 1GY6A 1GSPA 2HOHA 2CX1A 3FLJA 4WHAA 4GHOA 3FCSB 2GU1A 1A90A 1MGRA 3D9RA 6STDA 1K9M4 3DH2A 1YJ93 2IUJA 1W01A 4KFDA 1OF5B 2KF4A 3X40A 3BB9A 5AIGA 2W9PA 1N8R4 5KP4A 4WP5A 1VQL3 5EVHA 3EF8A 4HOHA 1WTHA 1FGTA 1E3RA 4OVMA 3CC43 3S67A 3LTBA 4GB5A 5ELUA 4EV2A 1RGKA 1TJDA 3S27A 3KN4A 4STDA 1STFI 1O7NB 2W04A 5STDA 4MMYB 1I8VA 1RNBA 3K63A 2HMLB 3NHXA 1YI23 1NJI4 1JKGB 4FMCA 4FCJA 2KAAA 2GBWB 3HX8A 2W03A 3J7Yd 1V57A 3CD63 3GRDA 5G1KA 3L0RA 3OW22 4J5KA 1ZGXA 3SLUA 3CCR3 1Q824 3IPTA 2HMNB 4HZBB 4X2HA 1RDSA 1M1XB 1JB2A 3IMAB 4XBYA 3LT8A 1LOWA 1UUGB 3MG1A 4O3VA 2AAEA 2CFKA 1UGIA 2UX0A 3SYUA 1OHOA 1T5YA 1W5ZA 2RBIA 1TRPA 2RFRA 2UUGC 3GWRA 3KSED 3ZFZA 3NM2A 1FYSA 1IK3A 2P38A 3NQZA 1BAOA 1JBTA 3DZLA 1QMAA 1RGGA 1ULIB 3AMOB 3NBBA 2XFTA 3LTAA 3BIRA 3EC9A 3ZG5A 2XGNA 3JUNA 1W00A 1BSCA 1ROVA 4XBXA 5RNTA 2KF3A 1BRGA 3NBRA 1TFKA 1TIJA 4FMBA 1OHPA 1RN4A 2XR8B 1B2SA 1BRNL 1BU4A 1EA2A 3BNDA 1IQYA 2XFSA 4L7KA 2FXTA 4HM3B 3FF0A 7RNTA 8RNTA 1RGFA 4HM6B 4FCZA 1OUNA 2IA7A 3HIIA 1UGHI 1NO3A 1BUJA 1ULJB 1B2UA 1NNVA 1YVBI 2CH9A 1OACA 1F8NA 4HAAA 4I5QA 3KSPA 3MHEA 4AKZA 1BSAA 1CQSA 1AVKA 1GS3A 2R4IA 3ECFA 5M19A 1BNIA 1BNGA 3CMA3 2GU3A 5LC6A 3DM8A 1TUHA 1FUTA 3LOYA 1YGEA 1OCVA 1VQM3 2YX9A 5IG3A 3RDEA 4EYCA 3G0KA 1UUWB 2YFIB 5DREA 2ZDJA 4L8PA 3OWUA 5CXOA 1DETA 3F14A 4NPBA 4MMZB 3HOHA 5BVBA 3Q3FA 2W56B 1A2VA 2K54A 3HK4A 4MMXB 1WNHA 2E2UA 3NM7A 4GL6A 4EW5A 4N6UA 1TU5A 1CYVA 1BNEA 3FF2A 1YJW3 2D42A 1N5PA 4GSPA 1SJWA 1I2FA 3WODG 2SBLA 5I97A 1RGHA 1IQ8A 2HMMB 5EQLA 3SXXA 1A2KA 1UCLA 1BSDA 3IJEB 2B24B 3CCQ3 2CWUA 5FW5A 1D6ZA 2FGTA 4J8TA 3VF1A 1EG9B 2QGUA 2Z6BA 2YFLB 3PGBA 1VZZA 1MOLA 1W2B2 2FNQA 2OWPA 4WFOA 1C54A 3DGMA 1OF5A 1YVSA 1CYUA 3G713 3CPOA 1MWRA 2CWTA 5IERA 3AGNA 3B8LA 3GZYB 1JN5B 4LZIA 1TRQA 2CFLA 3BNBA 2WGQA 3JUMA 2HMKB 3WOFB 1YIT3 3GAXA 1NU3A 1JV2B 1NB3I 3NV0B 5AEWB 1B3SA 6RNTA 3DUKA 1IV9A
chains in the Genus database with same CATH topology
3UJMA 4K1UA 5IG5A 1JKGA 5IG0A 2B1XB 3MG3A 1FGRA 3LXUX 1RKYA 5IEOA 3FG3A 2CK3H 4RZMA 1QALA 3A76A 1FGOA 3DGNA 1NWWA 1WMNA 4CDLA 3KE7A 1OH0A 1VQN3 3E99A 1VQ73 4HM8B 2QA43 3V98A 4H3UA 2D1WA 3X3ZA 1QJGA 3SX1A 3NXJA 2IUKA 3FH1A 3Q1CA 3T0UA 1JB4A 4EBGA 3EQQB 3MPHA 2CW9A 5KP3A 3CCU3 1LVNA 3OWYA 3T8NA 1DVCA 1L5GB 1IU7A 3CCS3 2I9WA 2XSHB 4CCVA 2JDIH 3MG2A 4FR9A 1N5HA 2HMJB 1RRLA 3NX0A 2CIUA 2CWVA 2CG1A 3JUPA 2GXFA 4Q53A 3UL6A 2XSOB 4N6TA 3X41A 5DRVA 3FSDA 3LMLA 2CFWA 2F86B 2STDA 5D82A 4K1VA 1Q42A 3PCRA 3TDGA 1JJ22 4FCMA 2MF7A 3QK9A 2PNCA 2XH9A 4R80A 1IV7A 4RBNA 1VQP3 4K90B 3STDA 2KCDA 1KWIA 2E2VA 4KVHA 1UW1A 4O8SA 1MNLA 2W9QA 4BTYA 5AYSC 4LMIA 5EEOA 3EE1A 1SQWA 1W6GA 1Y4KA 3F8HA 3U97A 2GBXB 3BNEA 3F7SA 5BXQA 1FA3A 2OTJ3 3BNCA 3PS8A 4KFFA 2O9UX 4JRFA 2OQEC 5AIIA 5CF1A 3Q2PA 4WYKB 2W56A 1IT7A 1SPUA 3B7CA 4OK0A 2XF3A 1RJOA 3B4PA 3EN1B 2OOVC 3RGAA 1KC84 3G8ZA 2CFDA 1PFPA 2ZL8A 1S723 3PXMA 1M904 1O7PB 5JPPA 2BT3A 4N3VA 2Y73A 3FG1A 1K41A 3WA3A 3SOYA 5AI1A 4XB5A 3LZAA 4XDWA 3F8XA 1GD4A 1W4NA 4HM4B 3WMDA 1NJI4 2LQVA 3NUVA 3OWSA 4H61A 3EJVA 5AIFA 5FGOA 3CCM3 1DMNA 1W02A 2WOFA 4KZ1A 2XRXB 3HZPA 3K9MC 3WA2X 2RSXA 4L8OA 2HMOB 1O7WB 5AYRB 3S29A 1JN5A 3K0ZA 3LH4A 1N9JA 2F99A 2Z76A 1LNHA 1J2BA 1U5OA 3NV0A 4XBTA 5ELJA 2MC8A 3ROBA 4QWTA 2V1LA 3GZXB 2WOHA 4EC6A 1N8QA 2BHMA 2WGOA 3KKGA 3G4S3 2P0MA 5KP1A 3CU3A 3O8YA 1VQ53 1K734 2O3OA 3ER7A 2CHCA 1ISKA 1D6YA 4KFEA 1W2ZA 1ZX2A 1QVG2 2LYXA 4HZ9B 5JPUA 1OHSA 1TP6A 3X3YA 2M7OA 2E2TA 4ORLA 3DXOA 2K0MA 2P09A 4PEJA 3EB8A 4XM4A 2GEYA 1W6CA 3EN8A 2YFJB 1ASKA 1IT8A 1DYUA 3LYGA 1NDOB 4IT7A 3MSOA 4NREA 4X2OA 3CNXA 5AEUB 4HBRA 1Q814 3LTDA 1K8A4 1M1K4 1DVDA 4N6LA 3PCSA 2L4VA 1FGQA 1D6UA 1U8CB 1UUVB 2Z77A 1VQ83 1SIIA 5HGRA 3UB1A 3N8BA 4HM1B 5CLKA 5IEPA 4R1KA 1YJN3 4R4KA 1KD14 3CNMA 3VSYA 2RCDA 1OGXA 4HM2B 4HYZA 1A67A 2F98A 3WDGB 1TFOA 3OX9A 1QAKA 1SIHA 3JUOA 4XDVA 1IVVA 3WOEB 4RNZA 1R4CA 1JB5A 1FUWA 3CC23 3DMCA 2ML5A 3D3LA 3V92A 3S5CA 3GZBA 3AMOA 1LOXA 2IMJA 3JVCA 1Q40B 2XGLA 4IPBA 4K61A 2CFGA 3DGOA 5D83A 3CCJ3 3CME3 4N6NB 1OPYA 4NHFA 1EQKA 2Z7AA 1Q7Y4 3JUQA 1WQLB 2BMQB 3B4OA 3K5TA 4I4KA 1KSIA 1WMOA 1IVUA 2C10A 4BTWA 2P0XA 3I0YA 4IIAA 3CPW2 2Y74A 2QEX3 4HVNA 3X42A 4WYKA 4R9LA 3CC73 3RGRA 1VQO3 2KXGA 1O7MB 2Q07A 1HKXA 4N6V0 4HM7B 5D81A 3MWZA 3KZTA 1ZO2A 4TX4A 8CHOA 1ROAA 4G1MB 4OUQA 5TGNA 4R9KA 1G96A 3H3HA 3DY5A 3H51A 2W6JH 3DGLA 3S28A 3G6E3 5LC7A 3EBTA 2CC3A 3V99A 3F7XA 4MJDA 3BLZA 1US1A 3UL5A 1S5AA 1PU4A 1KQS2 4O02B 3ALAA 3PZWA 1IVWA 3PYJA 4JF8A 1JNQA 2PZVA 4N6OB 4BTXA 5AIHA 3M8CA 3OXAA 4MEIA 3GZRA 3MYTA 1WMPA 3F9SA 3U1WA 5CF2A 3FZWA 1E97A 1O7GB 3KFQC 3SOAA 5IF6A 2WO0A 1GYBA 2C11A 1W7CA 2BO9B 1VQ63 2GEXA 3NBJA 2CKFB 2OQEA 5JBSA 1GY5A 4AEQA 1V74A 3G16A 5IG4A 4U13A 1VQK3 1DMQA 1AV4A 3CCE3 3T8UA 2BNGA 3KIIA 4RNYA 2W0QA 3QRDA 2OOVA 3VGNA 3I563 1VQ43 4LSOA 1GY7A 1QAFA 1Z1SA 3N9HA 3HIGA 3Q90A 1FGMA 4EXRA 1AVLA 1UI8A 4ZM8A 1QVF2 1VQ93 1E3VA 2ML6A 3HI7A 1NB5I 1IVXA 5IENA 3EX9A 2BMOB 4FMAA 3NQYA 2CG0A 3EHCA 4HM0B 2RGQA 4N6MA 3I553 2JQ5A 4O2HA 1GD3A 1N9EA 2BMRB 3OV4A 3CCV3 3K7CA 1RRHA 4LGQA 1Q864 1AR0A 4HKVB 2P05A 1BUQA 1RN7A 3UNLA 1O7HB 4WWUC 2QIYA 3F40A 5A0OB 1IDPA 1Q40A 1EKMA 2OCTA 1CEWI 3EBYA 2A15A 3SEDA 1UI7A 1STDA 7STDA 3N54B 1YHQ3 5CK6A 3CCL3 3X3XA 1M9GA 4HM5B 4EV5A 3CXC2 1YIJ3 1W6YA 1HU9A 2W2CA 1C7HA 1IQXA 4AKYA 1DMMA 4J9AA 1OGZA 3LTCA 1LXEA 4FMDA 4LEHA 4HJLB 2KRTA 3FG4A 3SVAA 5G2GA 1JRQA 1K28A 3FKAA 5IW9A 2OTL3 3LT9A 2XEPA 2INXA 3MKIA 3FGYA 1GY6A 3FLJA 4WHAA 3FCSB 2GU1A 1A90A 3D9RA 6STDA 1K9M4 1YJ93 2IUJA 1W01A 4KFDA 1OF5B 3X40A 3BB9A 5AIGA 2W9PA 1N8R4 5KP4A 4WP5A 1VQL3 5EVHA 3EF8A 1WTHA 1FGTA 1E3RA 4OVMA 3CC43 3S67A 3LTBA 4GB5A 5ELUA 4EV2A 3S27A 3KN4A 4STDA 1STFI 1O7NB 2W04A 5STDA 4MMYB 3K63A 2HMLB 3NHXA 1YI23 1JKGB 4FMCA 4FCJA 2GBWB 3HX8A 2W03A 3J7Yd 3CD63 3GRDA 3L0RA 3OW22 3SLUA 3CCR3 1Q824 3IPTA 2HMNB 4HZBB 4X2HA 1M1XB 1JB2A 3IMAB 4XBYA 4O3VA 3MG1A 2CFKA 2UX0A 1OHOA 1T5YA 1W5ZA 3KSED 2RFRA 3GWRA 3NM2A 1IK3A 2P38A 3NQZA 3DZLA 1QMAA 1ULIB 3AMOB 3NBBA 2XFTA 3LTAA 3EC9A 2XGNA 3JUNA 1W00A 1ROVA 4XBXA 3NBRA 1TFKA 1TIJA 4FMBA 1OHPA 2XR8B 1EA2A 3BNDA 1IQYA 2XFSA 4L7KA 2FXTA 4HM3B 3FF0A 4HM6B 4FCZA 1OUNA 2IA7A 3HIIA 1NO3A 1ULJB 1YVBI 2CH9A 1OACA 1F8NA 3KSPA 3MHEA 4AKZA 1CQSA 1AVKA 1GS3A 2R4IA 3ECFA 3CMA3 2GU3A 5LC6A 3DM8A 1TUHA 3LOYA 1YGEA 1OCVA 1VQM3 2YX9A 5IG3A 3RDEA 4EYCA 3G0KA 1UUWB 2YFIB 5DREA 2ZDJA 4L8PA 3OWUA 5CXOA 3F14A 4MMZB 5BVBA 2W56B 1A2VA 2K54A 3HK4A 4MMXB 1WNHA 2E2UA 3NM7A 4GL6A 1TU5A 4N6UA 1CYVA 1YJW3 3FF2A 2D42A 1N5PA 3WODG 1SJWA 2SBLA 5I97A 5EQLA 1IQ8A 2HMMB 3SXXA 1A2KA 3IJEB 2B24B 3CCQ3 2CWUA 5FW5A 1D6ZA 2FGTA 4J8TA 3VF1A 1EG9B 2QGUA 2Z6BA 2YFLB 3PGBA 1VZZA 1MOLA 1W2B2 2FNQA 2OWPA 4WFOA 3DGMA 1OF5A 1CYUA 3G713 3CPOA 2CWTA 5IERA 3GZYB 3B8LA 1JN5B 4LZIA 2CFLA 3BNBA 2WGQA 3JUMA 2HMKB 3WOFB 1YIT3 3GAXA 1NU3A 1JV2B 1NB3I 3NV0B 5AEWB 3LT8A 3DUKA 1IV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UJM A;  4K1U A;  5IG5 A;  1JKG A;  5IG0 A;  2B1X B;  3MG3 A;  5IEO A;  4RZM A;  3A76 A;  1NWW A;  4CDL A;  3KE7 A;  1OH0 A;  3E99 A;  4HM8 B;  4H3U A;  1QJG A;  3NXJ A;  3FH1 A;  1JB4 A;  3EQQ B;  5KP3 A;  3OWY A;  3T8N A;  2I9W A;  2XSH B;  3MG2 A;  2HMJ B;  3JUP A;  2GXF A;  4Q53 A;  2XSO B;  5DRV A;  3FSD A;  2F86 B;  2STD A;  5D82 A;  4K1V A;  1Q42 A;  4FCM A;  3STD A;  4KVH A;  4LMI A;  3F8H A;  2GBX B;  3F7S A;  5BXQ A;  5AII A;  5CF1 A;  4WYK B;  3B7C A;  3B4P A;  3EN1 B;  3RGA A;  3G8Z A;  1O7P B;  5JPP A;  4N3V A;  1K41 A;  3SOY A;  5AI1 A;  4XB5 A;  3LZA A;  4XDW A;  3F8X A;  3WMD A;  4HM4 B;  3NUV A;  3OWS A;  5AIF A;  3EJV A;  1DMN A;  1W02 A;  2XRX B;  3HZP A;  4L8O A;  2HMO B;  1O7W B;  1JN5 A;  3K0Z A;  2F99 A;  2Z76 A;  1U5O A;  3NV0 A;  4XBT A;  3ROB A;  3GZX B;  3KKG A;  5KP1 A;  3CU3 A;  3ER7 A;  1ISK A;  2CHC A;  1ZX2 A;  4HZ9 B;  5JPU A;  1OHS A;  1TP6 A;  4ORL A;  3DXO A;  4PEJ A;  4XM4 A;  2GEY A;  3EN8 A;  2YFJ B;  1ASK A;  3LYG A;  5AEU B;  1NDO B;  4X2O A;  3MSO A;  3CNX A;  1UUV B;  2Z77 A;  5HGR A;  4HM1 B;  5CLK A;  5IEP A;  4R1K A;  3CNM A;  3VSY A;  2RCD A;  1OGX A;  4HM2 B;  2F98 A;  3OX9 A;  3JUO A;  4XDV A;  1JB5 A;  3DMC A;  3S5C A;  3GZB A;  2IMJ A;  1Q40 B;  5D83 A;  1OPY A;  2Z7A A;  3JUQ A;  1WQL B;  2BMQ B;  3B4O A;  4I4K A;  3I0Y A;  4IIA A;  4HVN A;  4WYK A;  4R9L A;  3RGR A;  1O7M B;  1HKX A;  4HM7 B;  5D81 A;  3KZT A;  1ZO2 A;  8CHO A;  4OUQ A;  5TGN A;  4R9K A;  3H3H A;  3H51 A;  3EBT A;  3F7X A;  4MJD A;  3BLZ A;  1S5A A;  2PZV A;  5AIH A;  3M8C A;  3OXA A;  3GZR A;  3MYT A;  3F9S A;  5CF2 A;  3FZW A;  1E97 A;  1O7G B;  3SOA A;  5IF6 A;  1GYB A;  2GEX A;  2CKF B;  1GY5 A;  3G16 A;  5IG4 A;  4U13 A;  1DMQ A;  3T8U A;  2BNG A;  3VGN A;  1GY7 A;  1Z1S A;  3Q90 A;  1E3V A;  5IEN A;  3EX9 A;  2BMO B;  3EHC A;  4HM0 B;  2RGQ A;  2JQ5 A;  2BMR B;  3OV4 A;  3K7C A;  4LGQ A;  1AR0 A;  4HKV B;  1BUQ A;  3UNL A;  1O7H B;  4WWU C;  2QIY A;  3F40 A;  1IDP A;  1Q40 A;  3EBY A;  2A15 A;  3SED A;  1STD A;  7STD A;  5CK6 A;  4HM5 B;  1W6Y A;  2W2C A;  1C7H A;  1DMM A;  4J9A A;  1OGZ A;  4LEH A;  4HJL B;  5G2G A;  3FKA A;  2INX A;  3MKI A;  3FGY A;  1GY6 A;  3FLJ A;  3D9R A;  6STD A;  1W01 A;  1OF5 B;  3BB9 A;  5AIG A;  5KP4 A;  4WP5 A;  5EVH A;  3EF8 A;  1E3R A;  4OVM A;  4GB5 A;  4STD A;  1O7N B;  5STD A;  2HML B;  3NHX A;  1JKG B;  4FCJ A;  2GBW B;  3HX8 A;  3GRD A;  3IPT A;  2HMN B;  4HZB B;  4X2H A;  1JB2 A;  4XBY A;  3MG1 A;  2UX0 A;  1OHO A;  2RFR A;  3GWR A;  3NM2 A;  3DZL A;  1QMA A;  1ULI B;  3EC9 A;  3JUN A;  1W00 A;  4XBX A;  3NBR A;  1OHP A;  2XR8 B;  1EA2 A;  4L7K A;  4HM3 B;  3FF0 A;  4HM6 B;  1OUN A;  1ULJ B;  3KSP A;  3MHE A;  1CQS A;  3ECF A;  1GS3 A;  2R4I A;  3DM8 A;  1TUH A;  1OCV A;  5IG3 A;  3G0K A;  1UUW B;  2YFI B;  5DRE A;  4L8P A;  3OWU A;  5CXO A;  3F14 A;  5BVB A;  2K54 A;  3HK4 A;  3FF2 A;  1SJW A;  2HMM B;  1A2K A;  2B24 B;  5FW5 A;  4J8T A;  1EG9 B;  2QGU A;  2YFL B;  1VZZ A;  2OWP A;  1OF5 A;  3CPO A;  5IER A;  3GZY B;  3B8L A;  1JN5 B;  3JUM A;  2HMK B;  1NU3 A;  3NV0 B;  5AEW B;  3DUK A; 
#chains in the Genus database with same CATH topology
 3UJM A;  4K1U A;  5IG5 A;  1JKG A;  5IG0 A;  2B1X B;  3MG3 A;  1FGR A;  3LXU X;  1RKY A;  5IEO A;  3URP A;  1MWS A;  3FG3 A;  4CJN A;  2CK3 H;  4RZM A;  1QAL A;  3A76 A;  1FGO A;  1JZD A;  3DGN A;  1NWW A;  1WMN A;  4CDL A;  3KCH A;  3KE7 A;  1OH0 A;  1VQN 3;  3E99 A;  1VQ7 3;  1BVI A;  4HM8 B;  5M1A A;  5G1L A;  1LQM B;  2UGI A;  2QA4 3;  1RGL A;  4H3U A;  3V98 A;  2D1W A;  3X3Z A;  1QJG A;  3SX1 A;  1I2E A;  3NXJ A;  2IUK A;  3FH1 A;  3Q1C A;  3T0U A;  1JB4 A;  4EBG A;  3EQQ B;  3MPH A;  2CW9 A;  5KP3 A;  3CCU 3;  1LVN A;  3OWY A;  3T8N A;  3WR2 A;  1DVC A;  1YNV X;  1BOX A;  1B2Z A;  1IU7 A;  1L5G B;  3CCS 3;  2I9W A;  2XSH B;  4CCV A;  1BSE A;  2JDI H;  1B21 A;  3MG2 A;  4FR9 A;  1N5H A;  2HMJ B;  1RRL A;  3NX0 A;  2CIU A;  2CWV A;  2CG1 A;  3JUP A;  2GXF A;  1HYF A;  4Q53 A;  3UL6 A;  2XSO B;  4N6T A;  3X41 A;  5DRV A;  3FSD A;  3LML A;  2CFW A;  2F86 B;  2H0G A;  2STD A;  5D82 A;  4K1V A;  1Q42 A;  3PCR A;  3TDG A;  1JJ2 2;  4FCM A;  2MF7 A;  5AEU B;  3QK9 A;  2PNC A;  2XH9 A;  4ILF A;  4R80 A;  1X1W A;  3A5E A;  1IV7 A;  4RBN A;  5GSP A;  1R4Y A;  4K90 B;  3STD A;  1VQP 3;  2KCD A;  1KWI A;  1BNF A;  1GMQ A;  2E2V A;  4KVH A;  1UW1 A;  4O8S A;  1MNL A;  3AHW A;  2L1S A;  1MWU A;  3AGO A;  2W9Q A;  4BTY A;  5AYS C;  4LMI A;  5EEO A;  3EE1 A;  1SQW A;  3D5G A;  1W6G A;  1Y4K A;  3F8H A;  3U97 A;  2GBX B;  3BNE A;  3F7S A;  5BXQ A;  1FA3 A;  1B20 A;  2OTJ 3;  3BNC A;  3PS8 A;  4KFF A;  2O9U X;  1RCL A;  2OQE C;  4JRF A;  5AII A;  5CF1 A;  3Q2P A;  2F56 A;  1BRK A;  4WYK B;  2W56 A;  1IT7 A;  1SPU A;  3B7C A;  4OK0 A;  1CH0 A;  2XF3 A;  2SAR A;  1RJO A;  1I3F A;  3B4P A;  3EN1 B;  2OOV C;  3RGA A;  1KC8 4;  3G8Z A;  2CFD A;  1PFP A;  2ZL8 A;  1S72 3;  3PXM A;  1M90 4;  1Q9E A;  1O7P B;  5JPP A;  2BT3 A;  4N3V A;  2Y73 A;  3FG1 A;  1K41 A;  1LRA A;  1UCK A;  3WA3 A;  3SOY A;  4BU4 A;  5AI1 A;  2J8X B;  2F5W A;  4XB5 A;  3LZA A;  4XDW A;  3F8X A;  1GD4 A;  1W4N A;  4HM4 B;  3WMD A;  1RMS A;  2LQV A;  3NUV A;  3OWS A;  1RHL A;  3EJV A;  4H61 A;  5AIF A;  5FGO A;  3CCM 3;  1DMN A;  1W02 A;  2WOF A;  4KZ1 A;  2XRX B;  3HZP A;  3K9M C;  3WA2 X;  2RSX A;  4L8O A;  2HMO B;  1O7W B;  5AYR B;  3S29 A;  1JN5 A;  3K0Z A;  3LH4 A;  1N9J A;  2F99 A;  1HZ1 A;  1LNH A;  2Z76 A;  3GSP A;  1J2B A;  1U5O A;  1BGS A;  1T2H A;  3NV0 A;  4XBT A;  5ELJ A;  2MC8 A;  3BU4 A;  4QWT A;  2V1L A;  3ROB A;  3GZX B;  1PYL A;  2WOH A;  4EC6 A;  1N8Q A;  1GMP A;  2BHM A;  2WGO A;  3KKG A;  3G4S 3;  2P0M A;  5KP1 A;  4CPK A;  3CU3 A;  2GSP A;  3O8Y A;  1VQ5 3;  1K73 4;  2O3O A;  3ER7 A;  2CHC A;  1ISK A;  1D6Y A;  1RNT A;  1W2Z A;  4KFE A;  1ZX2 A;  1QVG 2;  2LYX A;  4HZ9 B;  5JPU A;  1OHS A;  1BRI A;  1TP6 A;  3X3Y A;  2M7O A;  2E2T A;  4ORL A;  3DXO A;  2K0M A;  2P09 A;  4BIR A;  4PEJ A;  1I2G A;  3EB8 A;  1T3B A;  4XM4 A;  2GEY A;  1W6C A;  3EN8 A;  2YFJ B;  1ASK A;  1IT8 A;  1DYU A;  1FUS A;  1NDO B;  3LYG A;  3MSO A;  4IT7 A;  4NRE A;  3CNX A;  4X2O A;  4HBR A;  1Q81 4;  3LTD A;  1K8A 4;  3AHS A;  1M1K 4;  1DVD A;  1G02 A;  4N6L A;  3PCS A;  2L4V A;  1FGQ A;  2RNT A;  1B2X A;  1D6U A;  1BNJ A;  1U8C B;  1UUV B;  2Z77 A;  1VQ8 3;  1SII A;  2KF5 A;  5HGR A;  7GSP A;  3UB1 A;  1GOU A;  3N8B A;  1Q7H A;  1RGA A;  4HM1 B;  5CLK A;  5IEP A;  1UCJ A;  4R1K A;  1DE3 A;  1YJN 3;  1JBR A;  4R4K A;  1KD1 4;  2F4Y A;  3CNM A;  1BAN A;  3VSY A;  2RCD A;  1OGX A;  4HM2 B;  4HYZ A;  1A67 A;  2F98 A;  3WDG B;  1TFO A;  3OX9 A;  1QAK A;  1SIH A;  3JUO A;  1YGW A;  4XDV A;  1IVV A;  3WOE B;  4RNZ A;  1R4C A;  3D5I A;  1JB5 A;  1FUW A;  2C4B A;  1BRJ A;  3CC2 3;  3DMC A;  2ML5 A;  3D3L A;  3V92 A;  3S5C A;  3GZB A;  3AMO A;  1LOX A;  2IMJ A;  1GMR A;  1Q40 B;  2XGL A;  3JVC A;  4IPB A;  4K61 A;  1JBS A;  2CFG A;  3DGO A;  5D83 A;  3CCJ 3;  1ZS7 A;  3CME 3;  2ZHX B;  4N6N B;  1OPY A;  4KT3 B;  4NHF A;  1EQK A;  2Z7A A;  5HOH A;  1Q7Y 4;  3JUQ A;  1SAR A;  1WQL B;  2BMQ B;  3B4O A;  3K5T A;  4I4K A;  1KSI A;  1BRH A;  1WMO A;  1IVU A;  4BL2 A;  2C10 A;  4BTW A;  1GOY A;  2P0X A;  3I0Y A;  4IIA A;  3CPW 2;  2BU4 A;  2Y74 A;  2QEX 3;  4HVN A;  3X42 A;  4WYK A;  4R9L A;  3CC7 3;  3RGR A;  1VQO 3;  2KXG A;  1FW7 A;  1O7M B;  5BU4 A;  5M18 A;  2Q07 A;  1BRS A;  1HKX A;  4N6V 0;  1V58 A;  4HM7 B;  4J5G A;  5D81 A;  1I3I A;  3MWZ A;  3KZT A;  1ZO2 A;  4TX4 A;  8CHO A;  1ROA A;  4G1M B;  4OUQ A;  5TGN A;  1BSB A;  1I0V A;  1VQQ A;  4R9K A;  1G96 A;  3H3H A;  3DY5 A;  3H51 A;  2K3D A;  1MGW A;  2W6J H;  3DGL A;  3S28 A;  2F5M A;  3G6E 3;  1PY3 A;  5LC7 A;  2IYJ A;  3EBT A;  2CC3 A;  3V99 A;  3F7X A;  1X1Y A;  4MJD A;  1RCK A;  3BLZ A;  1US1 A;  3UL5 A;  1S5A A;  4BL3 A;  1PU4 A;  4O02 B;  1KQS 2;  1FZU A;  1LOY A;  4RNT A;  1X1X A;  3ALA A;  3PZW A;  1IVW A;  1LOV A;  1T2I A;  3PYJ A;  4JF8 A;  1BNR A;  1JNQ A;  2PZV A;  4N6O B;  4BTX A;  5AIH A;  1RLS A;  6GSP A;  3M8C A;  3OXA A;  2AAD A;  4MEI A;  3GZR A;  3MYT A;  1B2M A;  1WMP A;  3F9S A;  1A2P A;  3U1W A;  4LYL B;  5CF2 A;  3FZW A;  1E97 A;  1O7G B;  3KFQ C;  3SOA A;  5IF6 A;  9RNT A;  2WO0 A;  1GYB A;  2C11 A;  1W7C A;  2BO9 B;  1VQ6 3;  2GEX A;  3NBJ A;  2CKF B;  2OQE A;  5JBS A;  1GY5 A;  2ZA4 A;  1V74 A;  3D79 A;  1LQG C;  3G16 A;  4AEQ A;  4U13 A;  5IG4 A;  1VQK 3;  1DMQ A;  1AV4 A;  3CCE 3;  1EEJ A;  3T8U A;  2BNG A;  3KII A;  4RNY A;  2W0Q A;  3QRD A;  2OOV A;  5BIR A;  3VGN A;  1TTO A;  3I56 3;  1VQ4 3;  2H0I A;  4LSO A;  1GY7 A;  1QAF A;  1Z1S A;  3N9H A;  3HIG A;  1IYY A;  1G0T A;  3Q90 A;  1FGM A;  3WHO A;  1AVL A;  1JZO A;  1UI8 A;  4EXR A;  4ZM8 A;  1VQ9 3;  1QVF 2;  1E3V A;  2ML6 A;  3HI7 A;  1NB5 I;  1RGC A;  1X1U A;  1IVX A;  5IEN A;  1LNI A;  2R41 A;  3EX9 A;  2BMO B;  4FMA A;  3NQY A;  2CG0 A;  3EHC A;  4HM0 B;  2RGQ A;  4N6M A;  3I55 3;  2JQ5 A;  1UCI A;  4O2H A;  1AY7 A;  1GD3 A;  1N9E A;  2BMR B;  3OV4 A;  3CCV 3;  3K7C A;  1RRH A;  4LGQ A;  2BIR A;  1Q86 4;  1AR0 A;  1I0X A;  4HKV B;  2P05 A;  1BUQ A;  1RN7 A;  3UNL A;  1O7H B;  4WWU C;  1RTU A;  2QIY A;  3F40 A;  1MWT A;  1RGE A;  5A0O B;  1IDP A;  1Q40 A;  1AQZ A;  1EKM A;  2OCT A;  1CEW I;  3EBY A;  2A15 A;  3SED A;  1UI7 A;  1STD A;  7STD A;  1B27 A;  3N54 B;  1I70 A;  1UDI I;  3D4A A;  1YHQ 3;  5CK6 A;  1GOV A;  2H0H A;  3CCL 3;  3X3X A;  2CX0 A;  1M9G A;  2IY2 A;  4HM5 B;  4EV5 A;  3CXC 2;  1RSN A;  1EUI C;  1YIJ 3;  1BIR A;  1W6Y A;  1HU9 A;  1RN1 A;  2W2C A;  1C7H A;  1IQX A;  4AKY A;  1DMM A;  4J9A A;  3ZG0 A;  1OGZ A;  3LTC A;  1LXE A;  4FMD A;  4LEH A;  4HJL B;  2KRT A;  3FG4 A;  3SVA A;  5G2G A;  1JRQ A;  1K28 A;  3FKA A;  3DGY A;  2KF6 A;  3RNT A;  5IW9 A;  2OTL 3;  3LT9 A;  1BNS A;  2INX A;  2XEP A;  3FGY A;  3MKI A;  4DKI A;  1GY6 A;  1GSP A;  2HOH A;  2CX1 A;  3FLJ A;  4WHA A;  4GHO A;  3FCS B;  2GU1 A;  1A90 A;  1MGR A;  3D9R A;  6STD A;  1K9M 4;  3DH2 A;  1YJ9 3;  2IUJ A;  1W01 A;  4KFD A;  1OF5 B;  2KF4 A;  3X40 A;  3BB9 A;  5AIG A;  2W9P A;  1N8R 4;  5KP4 A;  4WP5 A;  1VQL 3;  5EVH A;  3EF8 A;  4HOH A;  1WTH A;  1FGT A;  1E3R A;  4OVM A;  3CC4 3;  3S67 A;  3LTB A;  4GB5 A;  5ELU A;  4EV2 A;  1RGK A;  1TJD A;  3S27 A;  3KN4 A;  4STD A;  1STF I;  1O7N B;  2W04 A;  5STD A;  4MMY B;  1I8V A;  1RNB A;  3K63 A;  2HML B;  3NHX A;  1YI2 3;  1NJI 4;  1JKG B;  4FMC A;  4FCJ A;  2KAA A;  2GBW B;  3HX8 A;  2W03 A;  3J7Y d;  1V57 A;  3CD6 3;  3GRD A;  5G1K A;  3L0R A;  3OW2 2;  4J5K A;  1ZGX A;  3SLU A;  3CCR 3;  1Q82 4;  3IPT A;  2HMN B;  4HZB B;  4X2H A;  1RDS A;  1M1X B;  1JB2 A;  3IMA B;  4XBY A;  3LT8 A;  1LOW A;  1UUG B;  3MG1 A;  4O3V A;  2AAE A;  2CFK A;  1UGI A;  2UX0 A;  3SYU A;  1OHO A;  1T5Y A;  1W5Z A;  2RBI A;  1TRP A;  2RFR A;  2UUG C;  3GWR A;  3KSE D;  3ZFZ A;  3NM2 A;  1FYS A;  1IK3 A;  2P38 A;  3NQZ A;  1BAO A;  1JBT A;  3DZL A;  1QMA A;  1RGG A;  1ULI B;  3AMO B;  3NBB A;  2XFT A;  3LTA A;  3BIR A;  3EC9 A;  3ZG5 A;  2XGN A;  3JUN A;  1W00 A;  1BSC A;  1ROV A;  4XBX A;  5RNT A;  2KF3 A;  1BRG A;  3NBR A;  1TFK A;  1TIJ A;  4FMB A;  1OHP A;  1RN4 A;  2XR8 B;  1B2S A;  1BRN L;  1BU4 A;  1EA2 A;  3BND A;  1IQY A;  2XFS A;  4L7K A;  2FXT A;  4HM3 B;  3FF0 A;  7RNT A;  8RNT A;  1RGF A;  4HM6 B;  4FCZ A;  1OUN A;  2IA7 A;  3HII A;  1UGH I;  1NO3 A;  1BUJ A;  1ULJ B;  1B2U A;  1NNV A;  1YVB I;  2CH9 A;  1OAC A;  1F8N A;  4HAA A;  4I5Q A;  3KSP A;  3MHE A;  4AKZ A;  1BSA A;  1CQS A;  1AVK A;  1GS3 A;  2R4I A;  3ECF A;  5M19 A;  1BNI A;  1BNG A;  3CMA 3;  2GU3 A;  5LC6 A;  3DM8 A;  1TUH A;  1FUT A;  3LOY A;  1YGE A;  1OCV A;  1VQM 3;  2YX9 A;  5IG3 A;  3RDE A;  4EYC A;  3G0K A;  1UUW B;  2YFI B;  5DRE A;  2ZDJ A;  4L8P A;  3OWU A;  5CXO A;  1DET A;  3F14 A;  4NPB A;  4MMZ B;  3HOH A;  5BVB A;  3Q3F A;  2W56 B;  1A2V A;  2K54 A;  3HK4 A;  4MMX B;  1WNH A;  2E2U A;  3NM7 A;  4GL6 A;  4EW5 A;  4N6U A;  1TU5 A;  1CYV A;  1BNE A;  3FF2 A;  1YJW 3;  2D42 A;  1N5P A;  4GSP A;  1SJW A;  1I2F A;  3WOD G;  2SBL A;  5I97 A;  1RGH A;  1IQ8 A;  2HMM B;  5EQL A;  3SXX A;  1A2K A;  1UCL A;  1BSD A;  3IJE B;  2B24 B;  3CCQ 3;  2CWU A;  5FW5 A;  1D6Z A;  2FGT A;  4J8T A;  3VF1 A;  1EG9 B;  2QGU A;  2Z6B A;  2YFL B;  3PGB A;  1VZZ A;  1MOL A;  1W2B 2;  2FNQ A;  2OWP A;  4WFO A;  1C54 A;  3DGM A;  1OF5 A;  1YVS A;  1CYU A;  3G71 3;  3CPO A;  1MWR A;  2CWT A;  5IER A;  3AGN A;  3B8L A;  3GZY B;  1JN5 B;  4LZI A;  1TRQ A;  2CFL A;  3BNB A;  2WGQ A;  3JUM A;  2HMK B;  3WOF B;  1YIT 3;  3GAX A;  1NU3 A;  1JV2 B;  1NB3 I;  3NV0 B;  5AEW B;  1B3S A;  6RNT A;  3DUK A;  1IV9 A; 
#chains in the Genus database with same CATH homology
 3UJM A;  4K1U A;  5IG5 A;  1JKG A;  5IG0 A;  2B1X B;  3MG3 A;  1FGR A;  3LXU X;  1RKY A;  5IEO A;  3FG3 A;  2CK3 H;  4RZM A;  1QAL A;  3A76 A;  1FGO A;  3DGN A;  1NWW A;  1WMN A;  4CDL A;  3KE7 A;  1OH0 A;  1VQN 3;  3E99 A;  1VQ7 3;  4HM8 B;  2QA4 3;  3V98 A;  4H3U A;  2D1W A;  3X3Z A;  1QJG A;  3SX1 A;  3NXJ A;  2IUK A;  3FH1 A;  3Q1C A;  3T0U A;  1JB4 A;  4EBG A;  3EQQ B;  3MPH A;  2CW9 A;  5KP3 A;  3CCU 3;  1LVN A;  3OWY A;  3T8N A;  1DVC A;  1L5G B;  1IU7 A;  3CCS 3;  2I9W A;  2XSH B;  4CCV A;  2JDI H;  3MG2 A;  4FR9 A;  1N5H A;  2HMJ B;  1RRL A;  3NX0 A;  2CIU A;  2CWV A;  2CG1 A;  3JUP A;  2GXF A;  4Q53 A;  3UL6 A;  2XSO B;  4N6T A;  3X41 A;  5DRV A;  3FSD A;  3LML A;  2CFW A;  2F86 B;  2STD A;  5D82 A;  4K1V A;  1Q42 A;  3PCR A;  3TDG A;  1JJ2 2;  4FCM A;  2MF7 A;  3QK9 A;  2PNC A;  2XH9 A;  4R80 A;  1IV7 A;  4RBN A;  1VQP 3;  4K90 B;  3STD A;  2KCD A;  1KWI A;  2E2V A;  4KVH A;  1UW1 A;  4O8S A;  1MNL A;  2W9Q A;  4BTY A;  5AYS C;  4LMI A;  5EEO A;  3EE1 A;  1SQW A;  1W6G A;  1Y4K A;  3F8H A;  3U97 A;  2GBX B;  3BNE A;  3F7S A;  5BXQ A;  1FA3 A;  2OTJ 3;  3BNC A;  3PS8 A;  4KFF A;  2O9U X;  4JRF A;  2OQE C;  5AII A;  5CF1 A;  3Q2P A;  4WYK B;  2W56 A;  1IT7 A;  1SPU A;  3B7C A;  4OK0 A;  2XF3 A;  1RJO A;  3B4P A;  3EN1 B;  2OOV C;  3RGA A;  1KC8 4;  3G8Z A;  2CFD A;  1PFP A;  2ZL8 A;  1S72 3;  3PXM A;  1M90 4;  1O7P B;  5JPP A;  2BT3 A;  4N3V A;  2Y73 A;  3FG1 A;  1K41 A;  3WA3 A;  3SOY A;  5AI1 A;  4XB5 A;  3LZA A;  4XDW A;  3F8X A;  1GD4 A;  1W4N A;  4HM4 B;  3WMD A;  1NJI 4;  2LQV A;  3NUV A;  3OWS A;  4H61 A;  3EJV A;  5AIF A;  5FGO A;  3CCM 3;  1DMN A;  1W02 A;  2WOF A;  4KZ1 A;  2XRX B;  3HZP A;  3K9M C;  3WA2 X;  2RSX A;  4L8O A;  2HMO B;  1O7W B;  5AYR B;  3S29 A;  1JN5 A;  3K0Z A;  3LH4 A;  1N9J A;  2F99 A;  2Z76 A;  1LNH A;  1J2B A;  1U5O A;  3NV0 A;  4XBT A;  5ELJ A;  2MC8 A;  3ROB A;  4QWT A;  2V1L A;  3GZX B;  2WOH A;  4EC6 A;  1N8Q A;  2BHM A;  2WGO A;  3KKG A;  3G4S 3;  2P0M A;  5KP1 A;  3CU3 A;  3O8Y A;  1VQ5 3;  1K73 4;  2O3O A;  3ER7 A;  2CHC A;  1ISK A;  1D6Y A;  4KFE A;  1W2Z A;  1ZX2 A;  1QVG 2;  2LYX A;  4HZ9 B;  5JPU A;  1OHS A;  1TP6 A;  3X3Y A;  2M7O A;  2E2T A;  4ORL A;  3DXO A;  2K0M A;  2P09 A;  4PEJ A;  3EB8 A;  4XM4 A;  2GEY A;  1W6C A;  3EN8 A;  2YFJ B;  1ASK A;  1IT8 A;  1DYU A;  3LYG A;  1NDO B;  4IT7 A;  3MSO A;  4NRE A;  4X2O A;  3CNX A;  5AEU B;  4HBR A;  1Q81 4;  3LTD A;  1K8A 4;  1M1K 4;  1DVD A;  4N6L A;  3PCS A;  2L4V A;  1FGQ A;  1D6U A;  1U8C B;  1UUV B;  2Z77 A;  1VQ8 3;  1SII A;  5HGR A;  3UB1 A;  3N8B A;  4HM1 B;  5CLK A;  5IEP A;  4R1K A;  1YJN 3;  4R4K A;  1KD1 4;  3CNM A;  3VSY A;  2RCD A;  1OGX A;  4HM2 B;  4HYZ A;  1A67 A;  2F98 A;  3WDG B;  1TFO A;  3OX9 A;  1QAK A;  1SIH A;  3JUO A;  4XDV A;  1IVV A;  3WOE B;  4RNZ A;  1R4C A;  1JB5 A;  1FUW A;  3CC2 3;  3DMC A;  2ML5 A;  3D3L A;  3V92 A;  3S5C A;  3GZB A;  3AMO A;  1LOX A;  2IMJ A;  3JVC A;  1Q40 B;  2XGL A;  4IPB A;  4K61 A;  2CFG A;  3DGO A;  5D83 A;  3CCJ 3;  3CME 3;  4N6N B;  1OPY A;  4NHF A;  1EQK A;  2Z7A A;  1Q7Y 4;  3JUQ A;  1WQL B;  2BMQ B;  3B4O A;  3K5T A;  4I4K A;  1KSI A;  1WMO A;  1IVU A;  2C10 A;  4BTW A;  2P0X A;  3I0Y A;  4IIA A;  3CPW 2;  2Y74 A;  2QEX 3;  4HVN A;  3X42 A;  4WYK A;  4R9L A;  3CC7 3;  3RGR A;  1VQO 3;  2KXG A;  1O7M B;  2Q07 A;  1HKX A;  4N6V 0;  4HM7 B;  5D81 A;  3MWZ A;  3KZT A;  1ZO2 A;  4TX4 A;  8CHO A;  1ROA A;  4G1M B;  4OUQ A;  5TGN A;  4R9K A;  1G96 A;  3H3H A;  3DY5 A;  3H51 A;  2W6J H;  3DGL A;  3S28 A;  3G6E 3;  5LC7 A;  3EBT A;  2CC3 A;  3V99 A;  3F7X A;  4MJD A;  3BLZ A;  1US1 A;  3UL5 A;  1S5A A;  1PU4 A;  1KQS 2;  4O02 B;  3ALA A;  3PZW A;  1IVW A;  3PYJ A;  4JF8 A;  1JNQ A;  2PZV A;  4N6O B;  4BTX A;  5AIH A;  3M8C A;  3OXA A;  4MEI A;  3GZR A;  3MYT A;  1WMP A;  3F9S A;  3U1W A;  5CF2 A;  3FZW A;  1E97 A;  1O7G B;  3KFQ C;  3SOA A;  5IF6 A;  2WO0 A;  1GYB A;  2C11 A;  1W7C A;  2BO9 B;  1VQ6 3;  2GEX A;  3NBJ A;  2CKF B;  2OQE A;  5JBS A;  1GY5 A;  4AEQ A;  1V74 A;  3G16 A;  5IG4 A;  4U13 A;  1VQK 3;  1DMQ A;  1AV4 A;  3CCE 3;  3T8U A;  2BNG A;  3KII A;  4RNY A;  2W0Q A;  3QRD A;  2OOV A;  3VGN A;  3I56 3;  1VQ4 3;  4LSO A;  1GY7 A;  1QAF A;  1Z1S A;  3N9H A;  3HIG A;  3Q90 A;  1FGM A;  4EXR A;  1AVL A;  1UI8 A;  4ZM8 A;  1QVF 2;  1VQ9 3;  1E3V A;  2ML6 A;  3HI7 A;  1NB5 I;  1IVX A;  5IEN A;  3EX9 A;  2BMO B;  4FMA A;  3NQY A;  2CG0 A;  3EHC A;  4HM0 B;  2RGQ A;  4N6M A;  3I55 3;  2JQ5 A;  4O2H A;  1GD3 A;  1N9E A;  2BMR B;  3OV4 A;  3CCV 3;  3K7C A;  1RRH A;  4LGQ A;  1Q86 4;  1AR0 A;  4HKV B;  2P05 A;  1BUQ A;  1RN7 A;  3UNL A;  1O7H B;  4WWU C;  2QIY A;  3F40 A;  5A0O B;  1IDP A;  1Q40 A;  1EKM A;  2OCT A;  1CEW I;  3EBY A;  2A15 A;  3SED A;  1UI7 A;  1STD A;  7STD A;  3N54 B;  1YHQ 3;  5CK6 A;  3CCL 3;  3X3X A;  1M9G A;  4HM5 B;  4EV5 A;  3CXC 2;  1YIJ 3;  1W6Y A;  1HU9 A;  2W2C A;  1C7H A;  1IQX A;  4AKY A;  1DMM A;  4J9A A;  1OGZ A;  3LTC A;  1LXE A;  4FMD A;  4LEH A;  4HJL B;  2KRT A;  3FG4 A;  3SVA A;  5G2G A;  1JRQ A;  1K28 A;  3FKA A;  5IW9 A;  2OTL 3;  3LT9 A;  2XEP A;  2INX A;  3MKI A;  3FGY A;  1GY6 A;  3FLJ A;  4WHA A;  3FCS B;  2GU1 A;  1A90 A;  3D9R A;  6STD A;  1K9M 4;  1YJ9 3;  2IUJ A;  1W01 A;  4KFD A;  1OF5 B;  3X40 A;  3BB9 A;  5AIG A;  2W9P A;  1N8R 4;  5KP4 A;  4WP5 A;  1VQL 3;  5EVH A;  3EF8 A;  1WTH A;  1FGT A;  1E3R A;  4OVM A;  3CC4 3;  3S67 A;  3LTB A;  4GB5 A;  5ELU A;  4EV2 A;  3S27 A;  3KN4 A;  4STD A;  1STF I;  1O7N B;  2W04 A;  5STD A;  4MMY B;  3K63 A;  2HML B;  3NHX A;  1YI2 3;  1JKG B;  4FMC A;  4FCJ A;  2GBW B;  3HX8 A;  2W03 A;  3J7Y d;  3CD6 3;  3GRD A;  3L0R A;  3OW2 2;  3SLU A;  3CCR 3;  1Q82 4;  3IPT A;  2HMN B;  4HZB B;  4X2H A;  1M1X B;  1JB2 A;  3IMA B;  4XBY A;  4O3V A;  3MG1 A;  2CFK A;  2UX0 A;  1OHO A;  1T5Y A;  1W5Z A;  3KSE D;  2RFR A;  3GWR A;  3NM2 A;  1IK3 A;  2P38 A;  3NQZ A;  3DZL A;  1QMA A;  1ULI B;  3AMO B;  3NBB A;  2XFT A;  3LTA A;  3EC9 A;  2XGN A;  3JUN A;  1W00 A;  1ROV A;  4XBX A;  3NBR A;  1TFK A;  1TIJ A;  4FMB A;  1OHP A;  2XR8 B;  1EA2 A;  3BND A;  1IQY A;  2XFS A;  4L7K A;  2FXT A;  4HM3 B;  3FF0 A;  4HM6 B;  4FCZ A;  1OUN A;  2IA7 A;  3HII A;  1NO3 A;  1ULJ B;  1YVB I;  2CH9 A;  1OAC A;  1F8N A;  3KSP A;  3MHE A;  4AKZ A;  1CQS A;  1AVK A;  1GS3 A;  2R4I A;  3ECF A;  3CMA 3;  2GU3 A;  5LC6 A;  3DM8 A;  1TUH A;  3LOY A;  1YGE A;  1OCV A;  1VQM 3;  2YX9 A;  5IG3 A;  3RDE A;  4EYC A;  3G0K A;  1UUW B;  2YFI B;  5DRE A;  2ZDJ A;  4L8P A;  3OWU A;  5CXO A;  3F14 A;  4MMZ B;  5BVB A;  2W56 B;  1A2V A;  2K54 A;  3HK4 A;  4MMX B;  1WNH A;  2E2U A;  3NM7 A;  4GL6 A;  1TU5 A;  4N6U A;  1CYV A;  1YJW 3;  3FF2 A;  2D42 A;  1N5P A;  3WOD G;  1SJW A;  2SBL A;  5I97 A;  5EQL A;  1IQ8 A;  2HMM B;  3SXX A;  1A2K A;  3IJE B;  2B24 B;  3CCQ 3;  2CWU A;  5FW5 A;  1D6Z A;  2FGT A;  4J8T A;  3VF1 A;  1EG9 B;  2QGU A;  2Z6B A;  2YFL B;  3PGB A;  1VZZ A;  1MOL A;  1W2B 2;  2FNQ A;  2OWP A;  4WFO A;  3DGM A;  1OF5 A;  1CYU A;  3G71 3;  3CPO A;  2CWT A;  5IER A;  3GZY B;  3B8L A;  1JN5 B;  4LZI A;  2CFL A;  3BNB A;  2WGQ A;  3JUM A;  2HMK B;  3WOF B;  1YIT 3;  3GAX A;  1NU3 A;  1JV2 B;  1NB3 I;  3NV0 B;  5AEW B;  3LT8 A;  3DUK A;  1IV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...