1O7MB

Naphthalene 1,2-dioxygenase, binary complex with dioxygen
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Naphthalene Dioxygenase: Side-on Binding of Dioxygen to Iron
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
total genus 52
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1o7mB00
2HMNB 5JPPA 1JB5A 3B7CA 3F9SA 3EN1B 3JUOA 1A2KA 2HMLB 1O7MB 1JB2A 3B4PA 3F8XA 3GRDA 4WYKB 1EA2A 3DUKA 1OGZA 3GZBA 1GY7A 2BMRB 3JUMA 4HM8B 2Z7AA 4N3VA 1IDPA 3BLZA 1O7WB 3FSDA 3K7CA 1QJGA 7STDA 5CXOA 3EF8A 2UX0A 3EN8A 5BVBA 3DMCA 4X2OA 3NM2A 1JB4A 2XR8B 2HMJB 3CNXA 3EX9A 4XBYA 4OUQA 3ROBA 3UJMA 1ZO2A 2I9WA 5CF2A 3FGYA 1OCVA 3MG1A 3SOAA 5KP3A 1JN5B 3MKIA 4PEJA 5AIGA 3FH1A 1O7HB 4GB5A 5CLKA 3EBTA 3MHEA 2CHCA 5AIHA 3NXJA 2Z76A 4X2HA 5HGRA 4K1UA 1AR0A 3OWSA 1DMNA 1NU3A 4HM0B 4U13A 1GY5A 3NUVA 4R9KA 1ULJB 3MG3A 5G2GA 1S5AA 1VZZA 3Q90A 1W02A 2A15A 2IMJA 5DREA 2YFIB 3T8UA 4I4KA 2F98A 3STDA 3OV4A 3B4OA 2QIYA 1O7NB 1U5OA 3NV0B 4HM2B 1TP6A 3KSPA 5FW5A 3H3HA 5JPUA 4HM4B 4HM7B 2GEXA 3B8LA 3A76A 1JKGB 1OGXA 3MYTA 4LEHA 4STDA 2F86B 1Q40A 3FLJA 3FZWA 1UUWB 2K54A 1W6YA 2B1XB 3S5CA 5IENA 4XDWA 2YFLB 2BMOB 2GEYA 3CPOA 5AI1A 3ECFA 1GYBA 2XRXB 3I0YA 4MJDA 2BMQB 5D83A 3SOYA 4CDLA 2GBXB 3NV0A 4WP5A 4LGQA 1UUVB 5AEUB 2QGUA 4L8OA 4FCMA 3IPTA 1DMQA 4J9AA 3VGNA 1K41A 3MSOA 4K1VA 1Q42A 1Z1SA 3CNMA 3KE7A 1GS3A 2INXA 4Q53A 4R1KA 2HMKB 5KP4A 4HKVB 3BB9A 3FKAA 4RZMA 4HM3B 3JUQA 4J8TA 1NWWA 3F8HA 3H51A 3G0KA 3OWUA 2Z77A 5IEPA 3EHCA 2STDA 2HMOB 3KZTA 3UNLA 2PZVA 5BXQA 3K0ZA 4HM5B 4XB5A 2CKFB 3EQQB 5EVHA 1NDOB 3T8NA 1EG9B 3JUPA 2W2CA 5CK6A 3F7SA 3LZAA 5STDA 2R4IA 3RGRA 3DXOA 2RFRA 1OPYA 3D9RA 1W00A 3DZLA 4HZ9B 2XSHB 4HVNA 5AIFA 1O7GB 5DRVA 1SJWA 1ZX2A 2GXFA 1STDA 3LYGA 3NHXA 4H3UA 1OUNA 1E97A 3F7XA 5AEWB 5IERA 1ULIB 3RGAA 1WQLB 3G16A 1JN5A 1OHSA 2F99A 1E3RA 2RCDA 3FF2A 4HM6B 3WMDA 4XBTA 3MG2A 3JUNA 4FCJA 3F14A 3EJVA 3SEDA 1C7HA 3HX8A 2JQ5A 5IG5A 1OH0A 4L7KA 1OHOA 3EBYA 1TUHA 4R9LA 3ER7A 5D81A 3GZXB 4XDVA 4KVHA 8CHOA 1GY6A 5IG0A 2GBWB 3M8CA 1CQSA 3GWRA 5KP1A 3E99A 3GZYB 1DMMA 5CF1A 1OF5B 1OHPA 4XBXA 5IG3A 5IG4A 3HZPA 4L8PA 1W01A 2RGQA 4HZBB 3EC9A 3OX9A 4XM4A 5IF6A 2XSOB 1JKGA 6STDA 4HJLB 2OWPA 3CU3A 3NBRA 4HM1B 4LMIA 1QMAA 3OXAA 3FF0A 2B24B 4IIAA 3VSYA 1BUQA 4OVMA 1OF5A 3DM8A 3HK4A 4WYKA 2BNGA 1ISKA 2HMMB 4ORLA 3GZRA 3F40A 1O7PB 3KKGA 1HKXA 2YFJB 3OWYA 5AIIA 1ASKA 3G8ZA 4WWUC 5IEOA 5TGNA 1Q40B 1E3VA 5D82A
chains in the Genus database with same CATH superfamily
5JPPA 1I8VA 1JRQA 3V99A 2PNCA 1JB5A 2F5WA 3F9SA 1BSAA 2HMLB 1O7MB 1JB2A 3B4PA 3F8XA 3GRDA 1EA2A 3WOEB 1PY3A 3S28A 3ZG5A 4EW5A 1IDPA 3BLZA 1O7WB 3D4AA 3K7CA 1UCKA 4KFFA 3EN8A 3DMCA 2W56B 3NM2A 2HMJB 3CNXA 1FYSA 1YJN3 1VQ63 3SX1A 1BSDA 4N6LA 2ML5A 3FGYA 1Q824 1OCVA 2XGLA 3MG1A 4HOHA 1JN5B 4QWTA 4PEJA 5AIGA 3FH1A 3EBTA 2XGNA 1V74A 1LNIA 3N9HA 4WFOA 3OW22 1HZ1A 4K90B 4U13A 3NUVA 4R9KA 2OTL3 1VZZA 2CFKA 2O3OA 2YFIB 1AVLA 4HBRA 1FGMA 4I4KA 2KAAA 3OV4A 4HM2B 2QIYA 3X3XA 1U5OA 1V57A 2W04A 1I3IA 2CFDA 1QAKA 1WNHA 2WGQA 7GSPA 5JPUA 1PU4A 2LQVA 1CH0A 3B8LA 3FG1A 1JKGB 1OGXA 4LEHA 2CWTA 2CX1A 2F86B 1Q40A 2IY2A 3FZWA 4OK0A 4H61A 1TJDA 2BMOB 3ECFA 3U1WA 2ML6A 1D6YA 2QGUA 4L8OA 3LTAA 3SLUA 8CHOA 4RNZA 1KWIA 3KE7A 6RNTA 1OACA 1Q9EA 1WTHA 4I5QA 5HOHA 1UI8A 3Q3FA 4HKVB 4MMXB 3WA3A 6GSPA 3CC73 3DGMA 3Q1CA 4RZMA 2XH9A 1KC84 2CWUA 3RNTA 5IEPA 2OOVA 5A0OB 3U97A 3WR2A 5BXQA 3K0ZA 3A5EA 4HM5B 3K9MC 2W2CA 3NX0A 2R4IA 2XEPA 1F8NA 3DXOA 1MGWA 2RFRA 3N8BA 1UCLA 4GSPA 2Y73A 1Q7HA 1W4NA 1BRJA 2GXFA 3AGNA 5BIRA 1A67A 1E97A 5LC7A 2W9PA 1JV2B 1ULIB 3G16A 2C11A 1EUIC 2F99A 1JJ22 1RTUA 1UDII 3JUNA 3WDGB 4FCJA 3I553 5M19A 2AAEA 1NO3A 5IG5A 1UW1A 3BNEA 1TUHA 1JBTA 1WMPA 5D81A 1DE3A 1Y4KA 1YGEA 3NBBA 1GY6A 3K63A 5IG0A 1RCKA 3PZWA 1S723 1T3BA 1GD4A 1VQO3 1US1A 4EXRA 4XBXA 1RNBA 3HZPA 1K734 2P0XA 2RGQA 4RBNA 5M1AA 1R4CA 2LYXA 1B21A 4HJLB 3CU3A 4LMIA 3OXAA 6STDA 1LOXA 2B24B 3NQZA 3X41A 1OF5A 3HK4A 2RBIA 4WYKA 1VQ73 1M904 1BSCA 3JVCA 1IVUA 1O7PB 3KKGA 1VQQA 5AIIA 2C4BA 2RNTA 4KFDA 4KT3B 3O8YA 1BNGA 1BSEA 3CXC2 2K0MA 4RNTA 5EQLA 3SVAA 1NB3I 1RLSA 2P09A 1A2KA 1TRPA 1K28A 1FGRA 4J5GA 1T2HA 3IMAB 1PFPA 1UGHI 2Z7AA 3Q2PA 1ZS7A 1VQN3 1LQMB 2CH9A 3NM7A 4XBYA 5CF2A 4OUQA 1ZO2A 1RKYA 1MNLA 4BTXA 2GSPA 3BNBA 1I0VA 2BO9B 3G4S3 3S29A 2CIUA 1FGQA 4MMZB 5AIHA 1BRHA 4TX4A 2H0HA 1AR0A 1B2SA 5GSPA 1FUTA 1SARA 1ULJB 3MG3A 5G2GA 3DGYA 1W02A 2A15A 4AKYA 4GHOA 3CD63 2F98A 1FUWA 1O7NB 1IV7A 2BU4A 1TP6A 1YVBI 3D3LA 3MWZA 1J2BA 4DKIA 1IU7A 1LQGC 1N9JA 1X1UA 3A76A 4STDA 5I97A 2K3DA 4EYCA 2CG0A 2FGTA 4N6V0 1BRKA 4N6MA 1FZUA 4O02B 3S5CA 2YFLB 3I563 4ILFA 3CPOA 1NNVA 1IQ8A 2XRXB 2IUJA 1RJOA 4CDLA 1D6ZA 1BUJA 4LGQA 2ZA4A 3IPTA 5AEUB 1Q42A 1BRGA 2F56A 1MWTA 2INXA 4CCVA 2HMKB 4BTWA 3G713 2P0MA 1Q7Y4 3ZG0A 1UCJA 2KXGA 1VQK3 4HM3B 3JUQA 4BL2A 3F8HA 3OWUA 3J7Yd 3G0KA 1I2FA 2Z77A 3K5TA 1X1XA 2STDA 8RNTA 1TU5A 2CKFB 1NB5I 1NDOB 4EBGA 4CJNA 5CK6A 3UB1A 3F7SA 3LTDA 3LZAA 1LXEA 4HZ9B 1W00A 1GOYA 2XSHB 1IK3A 5M18A 2JDIH 1MWUA 3LYGA 1RGEA 2KF3A 3URPA 1MGRA 3F7XA 3X42A 4K61A 1DVDA 4BTYA 4WHAA 1YHQ3 1G02A 1OHSA 2RCDA 3FF2A 3HOHA 3X40A 3WMDA 2XFTA 4XBTA 1KSIA 4ZM8A 3SEDA 1LOVA 1B2UA 1RN4A 1FW7A 1OH0A 1BVIA 3DGLA 3ER7A 3CC23 4FR9A 3CC43 4XDVA 1RGAA 4KVHA 4RNYA 1Q814 1SPUA 2P05A 3SYUA 3M8CA 5KP1A 3GWRA 3E99A 2L4VA 1DMMA 3GZYB 3LTBA 1L5GB 1RN7A 1BNFA 4O8SA 3CCS3 1ZGXA 2CC3A 5EEOA 1RGGA 4HZBB 3EC9A 5IF6A 2KCDA 3FCSB 3LT8A 4FMAA 4LYLB 3WHOA 2KF4A 3WODG 1X1YA 1DYUA 2CFGA 2XFSA 3AMOA 4EV2A 2J8XB 4IIAA 3WA2X 2O9UX 4OVMA 3GSPA 3IJEB 2HMMB 3GZRA 2W03A 3OWYA 1CYUA 1IT8A 2L1SA 3GAXA 4WWUC 3FG3A 1Q40B 1E3VA 5KP4A 1Q864 1RRHA 1DETA 1I70A 1RGFA 1IT7A 1N5HA 1N9EA 2HMNB 3BNDA 1STFI 1TTOA 3B7CA 2IA7A 3G6E3 1ROAA 2W6JH 2BHMA 2QEX3 3EN1B 3JUOA 3AHSA 4WYKB 3CCM3 2FXTA 3DUKA 1OGZA 3S67A 2BMRB 4EV5A 1A90A 1DVCA 1I2EA 3LXUX 3FSDA 5CXOA 2UX0A 1QALA 4X2OA 2XR8B 5ELUA 1LRAA 3CCR3 4R4KA 1W7CA 3ZFZA 4BU4A 1IV9A 2MC8A 1IVXA 5KP3A 3CME3 1VQ53 3CCJ3 3ALAA 1BNJA 1YNVX 1AV4A 2UUGC 2W9QA 4GL6A 2CHCA 1FGTA 1M1K4 4O2HA 1K8A4 3MPHA 4X2HA 4FCZA 4K1UA 1YJ93 1NU3A 3PS8A 4HM0B 1KD14 1FGOA 2ZHXB 1UUGB 4J5KA 2KF5A 1S5AA 1HU9A 3CCE3 3HIIA 1W6GA 4KFEA 3DGOA 1TFOA 4CPKA 1B20A 2Z6BA 3B4OA 3NV0B 1GMQA 1R4YA 4FMBA 3H3HA 2GEXA 1X1WA 3MYTA 1EEJA 1JBRA 4R80A 3CCQ3 2E2UA 2GU3A 1A2PA 1W6YA 2B1XB 1FUSA 2CFWA 2K54A 2F5MA 3N54B 2CWVA 5IENA 2GEYA 3BIRA 3I0YA 3KSED 4MJDA 4HYZA 1JZOA 3SOYA 2GBXB 1BRNL 4WP5A 3PCSA 3LTCA 2MF7A 4J9AA 2RSXA 3VGNA 1K41A 3MSOA 1BNRA 2BIRA 1GD3A 1Z1SA 1GS3A 1GSPA 3CNMA 3DY5A 1C54A 3BB9A 3D5GA 3FKAA 2FNQA 3QK9A 3VF1A 4J8TA 2CFLA 3AGOA 1MWSA 2IUKA 3KZTA 1W2B2 3V92A 1KQS2 1B3SA 1BSBA 5STDA 3RGRA 2QA43 1QVF2 1RHLA 1W2ZA 3D9RA 3DZLA 5DRVA 2WGOA 4HVNA 5EVHA 1O7GB 3CCU3 1ZX2A 1STDA 2W56A 3D5IA 3NHXA 1OUNA 4MEIA 3TDGA 1VQP3 2P38A 1E3RA 2WOFA 3PCRA 1YJW3 5AYSC 1LNHA 1C7HA 3HX8A 2JQ5A 2SBLA 1M9GA 4L7KA 1OHOA 3EBYA 1MWRA 1RDSA 3EB8A 4HAAA 3GZXB 3UL5A 3PYJA 2C10A 4AEQA 1UGIA 1B2XA 1MOLA 1VQ83 5CF1A 1IVVA 1OHPA 3DH2A 2F4YA 2HOHA 5RNTA 1TRQA 5IG4A 1LOYA 1BAOA 1W01A 4L8PA 1ROVA 1W6CA 2KRTA 4XM4A 1GMPA 2BT3A 1JKGA 2XSOB 1EQKA 4G1MB 9RNTA 3RDEA 2OQEA 2SARA 3NBRA 2GU1A 4FMDA 4LZIA 1BUQA 1UI7A 1GOUA 1HYFA 1I0XA 1BRIA 2CK3H 3DM8A 4IT7A 1IYYA 3CCL3 1ISKA 4IPBA 1AVKA 1RN1A 4ORLA 1RCLA 1HKXA 2YFJB 4NPBA 5TGNA 5IEOA 1QVG2 1SIHA 1BGSA 1BNSA 3BNCA 1RRLA 3LH4A 5D82A 7RNTA 3PGBA 2R41A 1BANA 1V58A 3PXMA 4BL3A 3GZBA 1IQXA 1GY7A 3JUMA 4HM8B 1WMOA 4N3VA 1RGLA 1QJGA 3EF8A 1GOVA 1VQ43 3LMLA 1JZDA 5BVBA 3KN4A 4N6UA 3CPW2 1JB4A 3EX9A 5LC6A 1YIT3 3ROBA 3UJMA 1BRSA 2I9WA 1IVWA 1TFKA 3BU4A 3SOAA 3MKIA 1IQYA 1O7HB 4GB5A 5CLKA 3MHEA 4NREA 1BU4A 1RGCA 3NXJA 2Z76A 1BIRA 3QRDA 3OWSA 1DMNA 5AYRB 2E2TA 2IYJA 1GY5A 4AKZA 3WOFB 3Q90A 2H0IA 2IMJA 5DREA 4NHFA 3T8UA 1JNQA 2Y74A 3STDA 5BU4A 7STDA 5FW5A 2E2VA 1YVSA 3KSPA 4HM4B 1YGWA 4HM7B 3AHWA 2D42A 3FLJA 2YX9A 2CG1A 1BNIA 1RMSA 1UUWB 1T2IA 2UGIA 2KF6A 1VQM3 4XDWA 3DGNA 1LOWA 5D83A 5AI1A 1GYBA 3CCV3 1VQL3 1RGKA 1W5ZA 2BMQB 3KIIA 4N6TA 3V98A 3NV0A 1UUVB 4FCMA 1DMQA 3T0UA 3HI7A 2AADA 4K1VA 4Q53A 4R1KA 2OQEC 1BNEA 3KFQC 4JF8A 3AMOB 3CMA3 1QAFA 3LOYA 1NWWA 3H51A 5G1KA 3EHCA 3UNLA 2HMOB 2PZVA 4XB5A 3EQQB 3T8NA 5G1LA 1EG9B 3JUPA 1G96A 1VQ93 2OTJ3 3KCHA 1AY7A 1OPYA 1I3FA 5AIFA 3LT9A 2CW9A 1SJWA 2OOVC 4EC6A 4H3UA 3NBJA 1N5PA 4KZ1A 5IW9A 5AEWB 5IERA 3NQYA 3RGAA 3X3ZA 1WQLB 1JN5A 4LSOA 1K9M4 1PYLA 4HM6B 4O3VA 2ZDJA 4JRFA 1SQWA 3MG2A 1G0TA 1CYVA 2XF3A 3F14A 3EJVA 1YIJ3 4N6OB 1YI23 1T5YA 2WO0A 4R9LA 2CX0A 1BOXA 2Q07A 1AQZA 3L0RA 3HIGA 1NJI4 2OCTA 1TIJA 2GBWB 5JBSA 1CQSA 1B2ZA 1D6UA 1A2VA 1OF5B 1GMRA 5IG3A 1UCIA 1EKMA 1JBSA 1WMNA 2D1WA 3D79A 1B2MA 1N8QA 1RGHA 2WOHA 3EE1A 3OX9A 2V1LA 3FG4A 5FGOA 1RSNA 2M7OA 1RNTA 4FMCA 1B27A 4N6NB 3X3YA 2OWPA 5HGRA 3S27A 1I2GA 1U8CB 1QMAA 4HM1B 3FF0A 3SXXA 3VSYA 1N8R4 4BIRA 2W0QA 2BNGA 5ELJA 1CEWI 1M1XB 1LVNA 1SIIA 2H0GA 2ZL8A 3F40A 3UL6A 1FA3A 4MMYB 1ASKA 3G8ZA
chains in the Genus database with same CATH topology
5JPPA 1JRQA 3V99A 2PNCA 1JB5A 3F9SA 2HMLB 1O7MB 1JB2A 3B4PA 3F8XA 3GRDA 1EA2A 3WOEB 3S28A 1IDPA 3BLZA 1O7WB 3K7CA 4KFFA 3EN8A 3DMCA 2W56B 3NM2A 2HMJB 3CNXA 1YJN3 1VQ63 3SX1A 4N6LA 2ML5A 3FGYA 1Q824 1OCVA 2XGLA 3MG1A 1JN5B 4QWTA 4PEJA 5AIGA 3FH1A 3EBTA 2XGNA 1V74A 3N9HA 4WFOA 3OW22 4K90B 4U13A 3NUVA 4R9KA 2OTL3 1VZZA 2CFKA 2O3OA 2YFIB 1AVLA 4HBRA 1FGMA 4I4KA 3OV4A 4HM2B 2QIYA 3X3XA 1U5OA 2WGQA 2W04A 2CFDA 5JPUA 1QAKA 1WNHA 3CD63 1PU4A 2LQVA 3B8LA 3FG1A 1JKGB 1OGXA 4LEHA 2CWTA 2F86B 1Q40A 3FZWA 4OK0A 4H61A 2BMOB 3ECFA 3U1WA 2ML6A 1D6YA 2QGUA 4L8OA 3LTAA 3SLUA 8CHOA 4RNZA 1KWIA 3KE7A 1OACA 1WTHA 1UI8A 4HKVB 4MMXB 3WA3A 3CC73 3DGMA 3Q1CA 4RZMA 2XH9A 1KC84 2CWUA 5IEPA 2OOVA 5A0OB 3U97A 5BXQA 3K0ZA 4HM5B 3K9MC 2W2CA 3NX0A 2R4IA 2XEPA 1F8NA 3DXOA 2RFRA 3N8BA 2Y73A 1W4NA 2GXFA 1A67A 1E97A 5LC7A 2W9PA 1JV2B 1ULIB 3G16A 2C11A 2F99A 1JJ22 3JUNA 3WDGB 4FCJA 3I553 1NO3A 5IG5A 1UW1A 3BNEA 1TUHA 1WMPA 5D81A 1Y4KA 1YGEA 3NBBA 1GY6A 3K63A 5IG0A 3PZWA 1S723 1GD4A 1VQO3 1US1A 4EXRA 4XBXA 3HZPA 1K734 2P0XA 2RGQA 4RBNA 1R4CA 2LYXA 4HJLB 3CU3A 4LMIA 3OXAA 1LOXA 2B24B 3NQZA 3X41A 1OF5A 3HK4A 4WYKA 1VQ73 1M904 3JVCA 1IVUA 1O7PB 3KKGA 5AIIA 4KFDA 3O8YA 3CXC2 2K0MA 5EQLA 3SVAA 1NB3I 2P09A 1A2KA 1K28A 1FGRA 3IMAB 1PFPA 2Z7AA 3Q2PA 1VQN3 2CH9A 3NM7A 4XBYA 5CF2A 4OUQA 1ZO2A 1RKYA 1MNLA 4BTXA 3BNBA 3G4S3 2BO9B 3S29A 2CIUA 1FGQA 4MMZB 5AIHA 4TX4A 1AR0A 1ULJB 3MG3A 5G2GA 1W02A 2A15A 4AKYA 2F98A 1FUWA 1O7NB 1IV7A 1TP6A 1YVBI 3D3LA 3MWZA 1J2BA 1IU7A 1N9JA 3A76A 4STDA 5I97A 4EYCA 2CG0A 2FGTA 4N6V0 4N6MA 3S5CA 4O02B 3I563 2YFLB 3CPOA 1IQ8A 2XRXB 2IUJA 1RJOA 4CDLA 1D6ZA 4LGQA 3IPTA 5AEUB 1Q42A 2INXA 4CCVA 2HMKB 4BTWA 3G713 2P0MA 1Q7Y4 1VQK3 2KXGA 4HM3B 3JUQA 3F8HA 3OWUA 3J7Yd 3G0KA 2Z77A 3K5TA 2STDA 1TU5A 2CKFB 1NB5I 1NDOB 4EBGA 5CK6A 3UB1A 3F7SA 3LTDA 3LZAA 1LXEA 4HZ9B 1W00A 1IK3A 2XSHB 2JDIH 3LYGA 3F7XA 3X42A 4K61A 1DVDA 4BTYA 4WHAA 1YHQ3 1OHSA 2RCDA 3FF2A 3X40A 3WMDA 2XFTA 4XBTA 1KSIA 4ZM8A 3SEDA 1OH0A 3DGLA 3ER7A 3CC23 4FR9A 3CC43 4XDVA 4KVHA 4RNYA 1Q814 1SPUA 2P05A 3M8CA 5KP1A 3GWRA 3E99A 2L4VA 1DMMA 3GZYB 3LTBA 1L5GB 1RN7A 4O8SA 3CCS3 2CC3A 5EEOA 4HZBB 3EC9A 5IF6A 2KCDA 3FCSB 3LT8A 4FMAA 3WODG 3AMOA 1DYUA 2CFGA 2XFSA 4EV2A 4IIAA 3WA2X 2O9UX 4OVMA 3IJEB 2HMMB 3GZRA 2W03A 3OWYA 1CYUA 1IT8A 3GAXA 4WWUC 1Q864 3FG3A 1Q40B 1E3VA 5KP4A 1RRHA 3BNDA 1N5HA 2HMNB 1IT7A 3G6E3 1N9EA 1STFI 3B7CA 2IA7A 1ROAA 2W6JH 2BHMA 2QEX3 3EN1B 3JUOA 3CCM3 4WYKB 2FXTA 3DUKA 1OGZA 3S67A 2BMRB 4EV5A 1A90A 1DVCA 3LXUX 3FSDA 5CXOA 2UX0A 1QALA 4X2OA 2XR8B 5ELUA 3CCR3 4R4KA 1W7CA 1IV9A 2MC8A 1IVXA 5KP3A 3CME3 1VQ53 3CCJ3 3ALAA 2W9QA 1AV4A 4GL6A 2CHCA 1FGTA 1M1K4 4O2HA 1K8A4 3MPHA 4X2HA 4FCZA 4K1UA 1YJ93 1NU3A 3PS8A 4HM0B 1KD14 1FGOA 1S5AA 1HU9A 3CCE3 3HIIA 1W6GA 4KFEA 3DGOA 1TFOA 2Z6BA 3B4OA 3NV0B 4FMBA 3H3HA 2GEXA 3MYTA 4R80A 3CCQ3 2E2UA 2GU3A 1W6YA 2CFWA 2B1XB 2K54A 3N54B 5IENA 2CWVA 2GEYA 3I0YA 3KSED 4MJDA 4HYZA 3SOYA 2GBXB 4WP5A 3PCSA 3LTCA 2MF7A 4J9AA 2RSXA 3VGNA 1K41A 3MSOA 1GD3A 1Z1SA 3CNMA 1GS3A 3DY5A 3BB9A 3FKAA 2FNQA 3QK9A 3VF1A 4J8TA 2CFLA 2IUKA 3KZTA 1W2B2 3V92A 1KQS2 5STDA 3RGRA 2QA43 1QVF2 1W2ZA 3D9RA 3DZLA 5DRVA 2WGOA 4HVNA 5EVHA 1O7GB 3CCU3 1ZX2A 1STDA 2W56A 3NHXA 4MEIA 1OUNA 1VQP3 3TDGA 2P38A 1E3RA 2WOFA 3PCRA 1YJW3 5AYSC 1LNHA 1C7HA 3HX8A 2JQ5A 2SBLA 1M9GA 4L7KA 1OHOA 3EBYA 3EB8A 3UL5A 3GZXB 3PYJA 2C10A 4AEQA 1MOLA 1VQ83 5CF1A 1IVVA 1OHPA 5IG4A 4L8PA 1W01A 1ROVA 1W6CA 2KRTA 4XM4A 2BT3A 1JKGA 2XSOB 1EQKA 4G1MB 3RDEA 2OQEA 3NBRA 4FMDA 2GU1A 4LZIA 1BUQA 1UI7A 2CK3H 4IT7A 3DM8A 3CCL3 1ISKA 4IPBA 1AVKA 4ORLA 1HKXA 2YFJB 5TGNA 5IEOA 1QVG2 1SIHA 3BNCA 5D82A 3LH4A 1RRLA 3PGBA 3PXMA 3GZBA 1IQXA 1GY7A 3JUMA 4HM8B 1WMOA 4N3VA 1QJGA 3EF8A 1VQ43 3LMLA 5BVBA 3CPW2 3KN4A 4N6UA 1JB4A 3EX9A 5LC6A 1YIT3 3ROBA 3UJMA 2I9WA 1IVWA 1TFKA 3SOAA 3MKIA 1IQYA 1O7HB 4GB5A 5CLKA 3MHEA 4NREA 3NXJA 2Z76A 3QRDA 3OWSA 1DMNA 5AYRB 2E2TA 1GY5A 4AKZA 3WOFB 3Q90A 2IMJA 5DREA 4NHFA 3T8UA 1JNQA 2Y74A 3STDA 7STDA 5FW5A 2E2VA 3KSPA 4HM4B 4HM7B 2D42A 3FLJA 2YX9A 2CG1A 1UUWB 1VQM3 4XDWA 3DGNA 5D83A 5AI1A 1GYBA 3CCV3 1VQL3 1W5ZA 2BMQB 3KIIA 4N6TA 3V98A 3NV0A 1UUVB 4FCMA 1DMQA 3T0UA 3HI7A 4K1VA 4Q53A 4R1KA 2OQEC 3KFQC 4JF8A 3AMOB 3CMA3 1QAFA 3LOYA 1NWWA 3H51A 3EHCA 3UNLA 2HMOB 2PZVA 4XB5A 3EQQB 3T8NA 1EG9B 3JUPA 1G96A 1VQ93 2OTJ3 1OPYA 5AIFA 3LT9A 1SJWA 2CW9A 2OOVC 4EC6A 4H3UA 3NBJA 1N5PA 4KZ1A 5IW9A 5AEWB 5IERA 3NQYA 3RGAA 3X3ZA 1WQLB 1JN5A 4LSOA 1K9M4 4HM6B 4O3VA 2ZDJA 4JRFA 1SQWA 3MG2A 1CYVA 2XF3A 3F14A 3EJVA 1YIJ3 4N6OB 1YI23 1T5YA 2WO0A 4R9LA 2Q07A 3L0RA 3HIGA 1NJI4 2OCTA 1TIJA 2GBWB 1CQSA 1D6UA 1A2VA 1OF5B 5IG3A 1EKMA 1WMNA 2D1WA 1N8QA 3EE1A 2WOHA 5FGOA 3OX9A 2V1LA 3FG4A 2M7OA 4FMCA 4N6NB 3X3YA 6STDA 5JBSA 2OWPA 5HGRA 3S27A 4HM1B 1U8CB 1QMAA 3SXXA 3FF0A 3VSYA 1N8R4 2W0QA 2BNGA 5ELJA 1CEWI 1M1XB 1LVNA 1SIIA 2ZL8A 3F40A 3UL6A 1FA3A 4MMYB 1ASKA 3G8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMN B;  5JPP A;  1JB5 A;  3B7C A;  3F9S A;  3EN1 B;  3JUO A;  1A2K A;  2HML B;  1O7M B;  1JB2 A;  3B4P A;  3F8X A;  3GRD A;  4WYK B;  1EA2 A;  3DUK A;  1OGZ A;  3GZB A;  1GY7 A;  2BMR B;  3JUM A;  4HM8 B;  2Z7A A;  4N3V A;  1IDP A;  3BLZ A;  1O7W B;  3FSD A;  3K7C A;  1QJG A;  7STD A;  5CXO A;  3EF8 A;  2UX0 A;  3EN8 A;  5BVB A;  3DMC A;  4X2O A;  3NM2 A;  1JB4 A;  2XR8 B;  2HMJ B;  3CNX A;  3EX9 A;  4XBY A;  4OUQ A;  3ROB A;  3UJM A;  1ZO2 A;  2I9W A;  5CF2 A;  3FGY A;  1OCV A;  3MG1 A;  3SOA A;  5KP3 A;  1JN5 B;  3MKI A;  4PEJ A;  5AIG A;  3FH1 A;  1O7H B;  4GB5 A;  5CLK A;  3EBT A;  3MHE A;  2CHC A;  5AIH A;  3NXJ A;  2Z76 A;  4X2H A;  5HGR A;  4K1U A;  1AR0 A;  3OWS A;  1DMN A;  1NU3 A;  4HM0 B;  4U13 A;  1GY5 A;  3NUV A;  4R9K A;  1ULJ B;  3MG3 A;  5G2G A;  1S5A A;  1VZZ A;  3Q90 A;  1W02 A;  2A15 A;  2IMJ A;  5DRE A;  2YFI B;  3T8U A;  4I4K A;  2F98 A;  3STD A;  3OV4 A;  3B4O A;  2QIY A;  1O7N B;  1U5O A;  3NV0 B;  4HM2 B;  1TP6 A;  3KSP A;  5FW5 A;  3H3H A;  5JPU A;  4HM4 B;  4HM7 B;  2GEX A;  3B8L A;  3A76 A;  1JKG B;  1OGX A;  3MYT A;  4LEH A;  4STD A;  2F86 B;  1Q40 A;  3FLJ A;  3FZW A;  1UUW B;  2K54 A;  1W6Y A;  2B1X B;  3S5C A;  5IEN A;  4XDW A;  2YFL B;  2BMO B;  2GEY A;  3CPO A;  5AI1 A;  3ECF A;  1GYB A;  2XRX B;  3I0Y A;  4MJD A;  2BMQ B;  5D83 A;  3SOY A;  4CDL A;  2GBX B;  3NV0 A;  4WP5 A;  4LGQ A;  1UUV B;  5AEU B;  2QGU A;  4L8O A;  4FCM A;  3IPT A;  1DMQ A;  4J9A A;  3VGN A;  1K41 A;  3MSO A;  4K1V A;  1Q42 A;  1Z1S A;  3CNM A;  3KE7 A;  1GS3 A;  2INX A;  4Q53 A;  4R1K A;  2HMK B;  5KP4 A;  4HKV B;  3BB9 A;  3FKA A;  4RZM A;  4HM3 B;  3JUQ A;  4J8T A;  1NWW A;  3F8H A;  3H51 A;  3G0K A;  3OWU A;  2Z77 A;  5IEP A;  3EHC A;  2STD A;  2HMO B;  3KZT A;  3UNL A;  2PZV A;  5BXQ A;  3K0Z A;  4HM5 B;  4XB5 A;  2CKF B;  3EQQ B;  5EVH A;  1NDO B;  3T8N A;  1EG9 B;  3JUP A;  2W2C A;  5CK6 A;  3F7S A;  3LZA A;  5STD A;  2R4I A;  3RGR A;  3DXO A;  2RFR A;  1OPY A;  3D9R A;  1W00 A;  3DZL A;  4HZ9 B;  2XSH B;  4HVN A;  5AIF A;  1O7G B;  5DRV A;  1SJW A;  1ZX2 A;  2GXF A;  1STD A;  3LYG A;  3NHX A;  4H3U A;  1OUN A;  1E97 A;  3F7X A;  5AEW B;  5IER A;  1ULI B;  3RGA A;  1WQL B;  3G16 A;  1JN5 A;  1OHS A;  2F99 A;  1E3R A;  2RCD A;  3FF2 A;  4HM6 B;  3WMD A;  4XBT A;  3MG2 A;  3JUN A;  4FCJ A;  3F14 A;  3EJV A;  3SED A;  1C7H A;  3HX8 A;  2JQ5 A;  5IG5 A;  1OH0 A;  4L7K A;  1OHO A;  3EBY A;  1TUH A;  4R9L A;  3ER7 A;  5D81 A;  3GZX B;  4XDV A;  4KVH A;  8CHO A;  1GY6 A;  5IG0 A;  2GBW B;  3M8C A;  1CQS A;  3GWR A;  5KP1 A;  3E99 A;  3GZY B;  1DMM A;  5CF1 A;  1OF5 B;  1OHP A;  4XBX A;  5IG3 A;  5IG4 A;  3HZP A;  4L8P A;  1W01 A;  2RGQ A;  4HZB B;  3EC9 A;  3OX9 A;  4XM4 A;  5IF6 A;  2XSO B;  1JKG A;  6STD A;  4HJL B;  2OWP A;  3CU3 A;  3NBR A;  4HM1 B;  4LMI A;  1QMA A;  3OXA A;  3FF0 A;  2B24 B;  4IIA A;  3VSY A;  1BUQ A;  4OVM A;  1OF5 A;  3DM8 A;  3HK4 A;  4WYK A;  2BNG A;  1ISK A;  2HMM B;  4ORL A;  3GZR A;  3F40 A;  1O7P B;  3KKG A;  1HKX A;  2YFJ B;  3OWY A;  5AII A;  1ASK A;  3G8Z A;  4WWU C;  5IEO A;  5TGN A;  1Q40 B;  1E3V A;  5D82 A; 
#chains in the Genus database with same CATH topology
 5JPP A;  1I8V A;  1JRQ A;  3V99 A;  2PNC A;  1JB5 A;  2F5W A;  3F9S A;  1BSA A;  2HML B;  1O7M B;  1JB2 A;  3B4P A;  3F8X A;  3GRD A;  1EA2 A;  3WOE B;  1PY3 A;  3S28 A;  3ZG5 A;  4EW5 A;  1IDP A;  3BLZ A;  1O7W B;  3D4A A;  3K7C A;  1UCK A;  4KFF A;  3EN8 A;  3DMC A;  2W56 B;  3NM2 A;  2HMJ B;  3CNX A;  1FYS A;  1YJN 3;  1VQ6 3;  3SX1 A;  1BSD A;  4N6L A;  2ML5 A;  3FGY A;  1Q82 4;  1OCV A;  2XGL A;  3MG1 A;  4HOH A;  1JN5 B;  4QWT A;  4PEJ A;  5AIG A;  3FH1 A;  3EBT A;  2XGN A;  1V74 A;  1LNI A;  3N9H A;  4WFO A;  3OW2 2;  1HZ1 A;  4K90 B;  4U13 A;  3NUV A;  4R9K A;  2OTL 3;  1VZZ A;  2CFK A;  2O3O A;  2YFI B;  1AVL A;  4HBR A;  1FGM A;  4I4K A;  2KAA A;  3OV4 A;  4HM2 B;  2QIY A;  3X3X A;  1U5O A;  1V57 A;  2W04 A;  1I3I A;  2CFD A;  1QAK A;  1WNH A;  2WGQ A;  7GSP A;  5JPU A;  1PU4 A;  2LQV A;  1CH0 A;  3B8L A;  3FG1 A;  1JKG B;  1OGX A;  4LEH A;  2CWT A;  2CX1 A;  2F86 B;  1Q40 A;  2IY2 A;  3FZW A;  4OK0 A;  4H61 A;  1TJD A;  2BMO B;  3ECF A;  3U1W A;  2ML6 A;  1D6Y A;  2QGU A;  4L8O A;  3LTA A;  3SLU A;  8CHO A;  4RNZ A;  1KWI A;  3KE7 A;  6RNT A;  1OAC A;  1Q9E A;  1WTH A;  4I5Q A;  5HOH A;  1UI8 A;  3Q3F A;  4HKV B;  4MMX B;  3WA3 A;  6GSP A;  3CC7 3;  3DGM A;  3Q1C A;  4RZM A;  2XH9 A;  1KC8 4;  2CWU A;  3RNT A;  5IEP A;  2OOV A;  5A0O B;  3U97 A;  3WR2 A;  5BXQ A;  3K0Z A;  3A5E A;  4HM5 B;  3K9M C;  2W2C A;  3NX0 A;  2R4I A;  2XEP A;  1F8N A;  3DXO A;  1MGW A;  2RFR A;  3N8B A;  1UCL A;  4GSP A;  2Y73 A;  1Q7H A;  1W4N A;  1BRJ A;  2GXF A;  3AGN A;  5BIR A;  1A67 A;  1E97 A;  5LC7 A;  2W9P A;  1JV2 B;  1ULI B;  3G16 A;  2C11 A;  1EUI C;  2F99 A;  1JJ2 2;  1RTU A;  1UDI I;  3JUN A;  3WDG B;  4FCJ A;  3I55 3;  5M19 A;  2AAE A;  1NO3 A;  5IG5 A;  1UW1 A;  3BNE A;  1TUH A;  1JBT A;  1WMP A;  5D81 A;  1DE3 A;  1Y4K A;  1YGE A;  3NBB A;  1GY6 A;  3K63 A;  5IG0 A;  1RCK A;  3PZW A;  1S72 3;  1T3B A;  1GD4 A;  1VQO 3;  1US1 A;  4EXR A;  4XBX A;  1RNB A;  3HZP A;  1K73 4;  2P0X A;  2RGQ A;  4RBN A;  5M1A A;  1R4C A;  2LYX A;  1B21 A;  4HJL B;  3CU3 A;  4LMI A;  3OXA A;  6STD A;  1LOX A;  2B24 B;  3NQZ A;  3X41 A;  1OF5 A;  3HK4 A;  2RBI A;  4WYK A;  1VQ7 3;  1M90 4;  1BSC A;  3JVC A;  1IVU A;  1O7P B;  3KKG A;  1VQQ A;  5AII A;  2C4B A;  2RNT A;  4KFD A;  4KT3 B;  3O8Y A;  1BNG A;  1BSE A;  3CXC 2;  2K0M A;  4RNT A;  5EQL A;  3SVA A;  1NB3 I;  1RLS A;  2P09 A;  1A2K A;  1TRP A;  1K28 A;  1FGR A;  4J5G A;  1T2H A;  3IMA B;  1PFP A;  1UGH I;  2Z7A A;  3Q2P A;  1ZS7 A;  1VQN 3;  1LQM B;  2CH9 A;  3NM7 A;  4XBY A;  5CF2 A;  4OUQ A;  1ZO2 A;  1RKY A;  1MNL A;  4BTX A;  2GSP A;  3BNB A;  1I0V A;  2BO9 B;  3G4S 3;  3S29 A;  2CIU A;  1FGQ A;  4MMZ B;  5AIH A;  1BRH A;  4TX4 A;  2H0H A;  1AR0 A;  1B2S A;  5GSP A;  1FUT A;  1SAR A;  1ULJ B;  3MG3 A;  5G2G A;  3DGY A;  1W02 A;  2A15 A;  4AKY A;  4GHO A;  3CD6 3;  2F98 A;  1FUW A;  1O7N B;  1IV7 A;  2BU4 A;  1TP6 A;  1YVB I;  3D3L A;  3MWZ A;  1J2B A;  4DKI A;  1IU7 A;  1LQG C;  1N9J A;  1X1U A;  3A76 A;  4STD A;  5I97 A;  2K3D A;  4EYC A;  2CG0 A;  2FGT A;  4N6V 0;  1BRK A;  4N6M A;  1FZU A;  4O02 B;  3S5C A;  2YFL B;  3I56 3;  4ILF A;  3CPO A;  1NNV A;  1IQ8 A;  2XRX B;  2IUJ A;  1RJO A;  4CDL A;  1D6Z A;  1BUJ A;  4LGQ A;  2ZA4 A;  3IPT A;  5AEU B;  1Q42 A;  1BRG A;  2F56 A;  1MWT A;  2INX A;  4CCV A;  2HMK B;  4BTW A;  3G71 3;  2P0M A;  1Q7Y 4;  3ZG0 A;  1UCJ A;  2KXG A;  1VQK 3;  4HM3 B;  3JUQ A;  4BL2 A;  3F8H A;  3OWU A;  3J7Y d;  3G0K A;  1I2F A;  2Z77 A;  3K5T A;  1X1X A;  2STD A;  8RNT A;  1TU5 A;  2CKF B;  1NB5 I;  1NDO B;  4EBG A;  4CJN A;  5CK6 A;  3UB1 A;  3F7S A;  3LTD A;  3LZA A;  1LXE A;  4HZ9 B;  1W00 A;  1GOY A;  2XSH B;  1IK3 A;  5M18 A;  2JDI H;  1MWU A;  3LYG A;  1RGE A;  2KF3 A;  3URP A;  1MGR A;  3F7X A;  3X42 A;  4K61 A;  1DVD A;  4BTY A;  4WHA A;  1YHQ 3;  1G02 A;  1OHS A;  2RCD A;  3FF2 A;  3HOH A;  3X40 A;  3WMD A;  2XFT A;  4XBT A;  1KSI A;  4ZM8 A;  3SED A;  1LOV A;  1B2U A;  1RN4 A;  1FW7 A;  1OH0 A;  1BVI A;  3DGL A;  3ER7 A;  3CC2 3;  4FR9 A;  3CC4 3;  4XDV A;  1RGA A;  4KVH A;  4RNY A;  1Q81 4;  1SPU A;  2P05 A;  3SYU A;  3M8C A;  5KP1 A;  3GWR A;  3E99 A;  2L4V A;  1DMM A;  3GZY B;  3LTB A;  1L5G B;  1RN7 A;  1BNF A;  4O8S A;  3CCS 3;  1ZGX A;  2CC3 A;  5EEO A;  1RGG A;  4HZB B;  3EC9 A;  5IF6 A;  2KCD A;  3FCS B;  3LT8 A;  4FMA A;  4LYL B;  3WHO A;  2KF4 A;  3WOD G;  1X1Y A;  1DYU A;  2CFG A;  2XFS A;  3AMO A;  4EV2 A;  2J8X B;  4IIA A;  3WA2 X;  2O9U X;  4OVM A;  3GSP A;  3IJE B;  2HMM B;  3GZR A;  2W03 A;  3OWY A;  1CYU A;  1IT8 A;  2L1S A;  3GAX A;  4WWU C;  3FG3 A;  1Q40 B;  1E3V A;  5KP4 A;  1Q86 4;  1RRH A;  1DET A;  1I70 A;  1RGF A;  1IT7 A;  1N5H A;  1N9E A;  2HMN B;  3BND A;  1STF I;  1TTO A;  3B7C A;  2IA7 A;  3G6E 3;  1ROA A;  2W6J H;  2BHM A;  2QEX 3;  3EN1 B;  3JUO A;  3AHS A;  4WYK B;  3CCM 3;  2FXT A;  3DUK A;  1OGZ A;  3S67 A;  2BMR B;  4EV5 A;  1A90 A;  1DVC A;  1I2E A;  3LXU X;  3FSD A;  5CXO A;  2UX0 A;  1QAL A;  4X2O A;  2XR8 B;  5ELU A;  1LRA A;  3CCR 3;  4R4K A;  1W7C A;  3ZFZ A;  4BU4 A;  1IV9 A;  2MC8 A;  1IVX A;  5KP3 A;  3CME 3;  1VQ5 3;  3CCJ 3;  3ALA A;  1BNJ A;  1YNV X;  1AV4 A;  2UUG C;  2W9Q A;  4GL6 A;  2CHC A;  1FGT A;  1M1K 4;  4O2H A;  1K8A 4;  3MPH A;  4X2H A;  4FCZ A;  4K1U A;  1YJ9 3;  1NU3 A;  3PS8 A;  4HM0 B;  1KD1 4;  1FGO A;  2ZHX B;  1UUG B;  4J5K A;  2KF5 A;  1S5A A;  1HU9 A;  3CCE 3;  3HII A;  1W6G A;  4KFE A;  3DGO A;  1TFO A;  4CPK A;  1B20 A;  2Z6B A;  3B4O A;  3NV0 B;  1GMQ A;  1R4Y A;  4FMB A;  3H3H A;  2GEX A;  1X1W A;  3MYT A;  1EEJ A;  1JBR A;  4R80 A;  3CCQ 3;  2E2U A;  2GU3 A;  1A2P A;  1W6Y A;  2B1X B;  1FUS A;  2CFW A;  2K54 A;  2F5M A;  3N54 B;  2CWV A;  5IEN A;  2GEY A;  3BIR A;  3I0Y A;  3KSE D;  4MJD A;  4HYZ A;  1JZO A;  3SOY A;  2GBX B;  1BRN L;  4WP5 A;  3PCS A;  3LTC A;  2MF7 A;  4J9A A;  2RSX A;  3VGN A;  1K41 A;  3MSO A;  1BNR A;  2BIR A;  1GD3 A;  1Z1S A;  1GS3 A;  1GSP A;  3CNM A;  3DY5 A;  1C54 A;  3BB9 A;  3D5G A;  3FKA A;  2FNQ A;  3QK9 A;  3VF1 A;  4J8T A;  2CFL A;  3AGO A;  1MWS A;  2IUK A;  3KZT A;  1W2B 2;  3V92 A;  1KQS 2;  1B3S A;  1BSB A;  5STD A;  3RGR A;  2QA4 3;  1QVF 2;  1RHL A;  1W2Z A;  3D9R A;  3DZL A;  5DRV A;  2WGO A;  4HVN A;  5EVH A;  1O7G B;  3CCU 3;  1ZX2 A;  1STD A;  2W56 A;  3D5I A;  3NHX A;  1OUN A;  4MEI A;  3TDG A;  1VQP 3;  2P38 A;  1E3R A;  2WOF A;  3PCR A;  1YJW 3;  5AYS C;  1LNH A;  1C7H A;  3HX8 A;  2JQ5 A;  2SBL A;  1M9G A;  4L7K A;  1OHO A;  3EBY A;  1MWR A;  1RDS A;  3EB8 A;  4HAA A;  3GZX B;  3UL5 A;  3PYJ A;  2C10 A;  4AEQ A;  1UGI A;  1B2X A;  1MOL A;  1VQ8 3;  5CF1 A;  1IVV A;  1OHP A;  3DH2 A;  2F4Y A;  2HOH A;  5RNT A;  1TRQ A;  5IG4 A;  1LOY A;  1BAO A;  1W01 A;  4L8P A;  1ROV A;  1W6C A;  2KRT A;  4XM4 A;  1GMP A;  2BT3 A;  1JKG A;  2XSO B;  1EQK A;  4G1M B;  9RNT A;  3RDE A;  2OQE A;  2SAR A;  3NBR A;  2GU1 A;  4FMD A;  4LZI A;  1BUQ A;  1UI7 A;  1GOU A;  1HYF A;  1I0X A;  1BRI A;  2CK3 H;  3DM8 A;  4IT7 A;  1IYY A;  3CCL 3;  1ISK A;  4IPB A;  1AVK A;  1RN1 A;  4ORL A;  1RCL A;  1HKX A;  2YFJ B;  4NPB A;  5TGN A;  5IEO A;  1QVG 2;  1SIH A;  1BGS A;  1BNS A;  3BNC A;  1RRL A;  3LH4 A;  5D82 A;  7RNT A;  3PGB A;  2R41 A;  1BAN A;  1V58 A;  3PXM A;  4BL3 A;  3GZB A;  1IQX A;  1GY7 A;  3JUM A;  4HM8 B;  1WMO A;  4N3V A;  1RGL A;  1QJG A;  3EF8 A;  1GOV A;  1VQ4 3;  3LML A;  1JZD A;  5BVB A;  3KN4 A;  4N6U A;  3CPW 2;  1JB4 A;  3EX9 A;  5LC6 A;  1YIT 3;  3ROB A;  3UJM A;  1BRS A;  2I9W A;  1IVW A;  1TFK A;  3BU4 A;  3SOA A;  3MKI A;  1IQY A;  1O7H B;  4GB5 A;  5CLK A;  3MHE A;  4NRE A;  1BU4 A;  1RGC A;  3NXJ A;  2Z76 A;  1BIR A;  3QRD A;  3OWS A;  1DMN A;  5AYR B;  2E2T A;  2IYJ A;  1GY5 A;  4AKZ A;  3WOF B;  3Q90 A;  2H0I A;  2IMJ A;  5DRE A;  4NHF A;  3T8U A;  1JNQ A;  2Y74 A;  3STD A;  5BU4 A;  7STD A;  5FW5 A;  2E2V A;  1YVS A;  3KSP A;  4HM4 B;  1YGW A;  4HM7 B;  3AHW A;  2D42 A;  3FLJ A;  2YX9 A;  2CG1 A;  1BNI A;  1RMS A;  1UUW B;  1T2I A;  2UGI A;  2KF6 A;  1VQM 3;  4XDW A;  3DGN A;  1LOW A;  5D83 A;  5AI1 A;  1GYB A;  3CCV 3;  1VQL 3;  1RGK A;  1W5Z A;  2BMQ B;  3KII A;  4N6T A;  3V98 A;  3NV0 A;  1UUV B;  4FCM A;  1DMQ A;  3T0U A;  3HI7 A;  2AAD A;  4K1V A;  4Q53 A;  4R1K A;  2OQE C;  1BNE A;  3KFQ C;  4JF8 A;  3AMO B;  3CMA 3;  1QAF A;  3LOY A;  1NWW A;  3H51 A;  5G1K A;  3EHC A;  3UNL A;  2HMO B;  2PZV A;  4XB5 A;  3EQQ B;  3T8N A;  5G1L A;  1EG9 B;  3JUP A;  1G96 A;  1VQ9 3;  2OTJ 3;  3KCH A;  1AY7 A;  1OPY A;  1I3F A;  5AIF A;  3LT9 A;  2CW9 A;  1SJW A;  2OOV C;  4EC6 A;  4H3U A;  3NBJ A;  1N5P A;  4KZ1 A;  5IW9 A;  5AEW B;  5IER A;  3NQY A;  3RGA A;  3X3Z A;  1WQL B;  1JN5 A;  4LSO A;  1K9M 4;  1PYL A;  4HM6 B;  4O3V A;  2ZDJ A;  4JRF A;  1SQW A;  3MG2 A;  1G0T A;  1CYV A;  2XF3 A;  3F14 A;  3EJV A;  1YIJ 3;  4N6O B;  1YI2 3;  1T5Y A;  2WO0 A;  4R9L A;  2CX0 A;  1BOX A;  2Q07 A;  1AQZ A;  3L0R A;  3HIG A;  1NJI 4;  2OCT A;  1TIJ A;  2GBW B;  5JBS A;  1CQS A;  1B2Z A;  1D6U A;  1A2V A;  1OF5 B;  1GMR A;  5IG3 A;  1UCI A;  1EKM A;  1JBS A;  1WMN A;  2D1W A;  3D79 A;  1B2M A;  1N8Q A;  1RGH A;  2WOH A;  3EE1 A;  3OX9 A;  2V1L A;  3FG4 A;  5FGO A;  1RSN A;  2M7O A;  1RNT A;  4FMC A;  1B27 A;  4N6N B;  3X3Y A;  2OWP A;  5HGR A;  3S27 A;  1I2G A;  1U8C B;  1QMA A;  4HM1 B;  3FF0 A;  3SXX A;  3VSY A;  1N8R 4;  4BIR A;  2W0Q A;  2BNG A;  5ELJ A;  1CEW I;  1M1X B;  1LVN A;  1SII A;  2H0G A;  2ZL8 A;  3F40 A;  3UL6 A;  1FA3 A;  4MMY B;  1ASK A;  3G8Z A; 
#chains in the Genus database with same CATH homology
 5JPP A;  1JRQ A;  3V99 A;  2PNC A;  1JB5 A;  3F9S A;  2HML B;  1O7M B;  1JB2 A;  3B4P A;  3F8X A;  3GRD A;  1EA2 A;  3WOE B;  3S28 A;  1IDP A;  3BLZ A;  1O7W B;  3K7C A;  4KFF A;  3EN8 A;  3DMC A;  2W56 B;  3NM2 A;  2HMJ B;  3CNX A;  1YJN 3;  1VQ6 3;  3SX1 A;  4N6L A;  2ML5 A;  3FGY A;  1Q82 4;  1OCV A;  2XGL A;  3MG1 A;  1JN5 B;  4QWT A;  4PEJ A;  5AIG A;  3FH1 A;  3EBT A;  2XGN A;  1V74 A;  3N9H A;  4WFO A;  3OW2 2;  4K90 B;  4U13 A;  3NUV A;  4R9K A;  2OTL 3;  1VZZ A;  2CFK A;  2O3O A;  2YFI B;  1AVL A;  4HBR A;  1FGM A;  4I4K A;  3OV4 A;  4HM2 B;  2QIY A;  3X3X A;  1U5O A;  2WGQ A;  2W04 A;  2CFD A;  5JPU A;  1QAK A;  1WNH A;  3CD6 3;  1PU4 A;  2LQV A;  3B8L A;  3FG1 A;  1JKG B;  1OGX A;  4LEH A;  2CWT A;  2F86 B;  1Q40 A;  3FZW A;  4OK0 A;  4H61 A;  2BMO B;  3ECF A;  3U1W A;  2ML6 A;  1D6Y A;  2QGU A;  4L8O A;  3LTA A;  3SLU A;  8CHO A;  4RNZ A;  1KWI A;  3KE7 A;  1OAC A;  1WTH A;  1UI8 A;  4HKV B;  4MMX B;  3WA3 A;  3CC7 3;  3DGM A;  3Q1C A;  4RZM A;  2XH9 A;  1KC8 4;  2CWU A;  5IEP A;  2OOV A;  5A0O B;  3U97 A;  5BXQ A;  3K0Z A;  4HM5 B;  3K9M C;  2W2C A;  3NX0 A;  2R4I A;  2XEP A;  1F8N A;  3DXO A;  2RFR A;  3N8B A;  2Y73 A;  1W4N A;  2GXF A;  1A67 A;  1E97 A;  5LC7 A;  2W9P A;  1JV2 B;  1ULI B;  3G16 A;  2C11 A;  2F99 A;  1JJ2 2;  3JUN A;  3WDG B;  4FCJ A;  3I55 3;  1NO3 A;  5IG5 A;  1UW1 A;  3BNE A;  1TUH A;  1WMP A;  5D81 A;  1Y4K A;  1YGE A;  3NBB A;  1GY6 A;  3K63 A;  5IG0 A;  3PZW A;  1S72 3;  1GD4 A;  1VQO 3;  1US1 A;  4EXR A;  4XBX A;  3HZP A;  1K73 4;  2P0X A;  2RGQ A;  4RBN A;  1R4C A;  2LYX A;  4HJL B;  3CU3 A;  4LMI A;  3OXA A;  1LOX A;  2B24 B;  3NQZ A;  3X41 A;  1OF5 A;  3HK4 A;  4WYK A;  1VQ7 3;  1M90 4;  3JVC A;  1IVU A;  1O7P B;  3KKG A;  5AII A;  4KFD A;  3O8Y A;  3CXC 2;  2K0M A;  5EQL A;  3SVA A;  1NB3 I;  2P09 A;  1A2K A;  1K28 A;  1FGR A;  3IMA B;  1PFP A;  2Z7A A;  3Q2P A;  1VQN 3;  2CH9 A;  3NM7 A;  4XBY A;  5CF2 A;  4OUQ A;  1ZO2 A;  1RKY A;  1MNL A;  4BTX A;  3BNB A;  3G4S 3;  2BO9 B;  3S29 A;  2CIU A;  1FGQ A;  4MMZ B;  5AIH A;  4TX4 A;  1AR0 A;  1ULJ B;  3MG3 A;  5G2G A;  1W02 A;  2A15 A;  4AKY A;  2F98 A;  1FUW A;  1O7N B;  1IV7 A;  1TP6 A;  1YVB I;  3D3L A;  3MWZ A;  1J2B A;  1IU7 A;  1N9J A;  3A76 A;  4STD A;  5I97 A;  4EYC A;  2CG0 A;  2FGT A;  4N6V 0;  4N6M A;  3S5C A;  4O02 B;  3I56 3;  2YFL B;  3CPO A;  1IQ8 A;  2XRX B;  2IUJ A;  1RJO A;  4CDL A;  1D6Z A;  4LGQ A;  3IPT A;  5AEU B;  1Q42 A;  2INX A;  4CCV A;  2HMK B;  4BTW A;  3G71 3;  2P0M A;  1Q7Y 4;  1VQK 3;  2KXG A;  4HM3 B;  3JUQ A;  3F8H A;  3OWU A;  3J7Y d;  3G0K A;  2Z77 A;  3K5T A;  2STD A;  1TU5 A;  2CKF B;  1NB5 I;  1NDO B;  4EBG A;  5CK6 A;  3UB1 A;  3F7S A;  3LTD A;  3LZA A;  1LXE A;  4HZ9 B;  1W00 A;  1IK3 A;  2XSH B;  2JDI H;  3LYG A;  3F7X A;  3X42 A;  4K61 A;  1DVD A;  4BTY A;  4WHA A;  1YHQ 3;  1OHS A;  2RCD A;  3FF2 A;  3X40 A;  3WMD A;  2XFT A;  4XBT A;  1KSI A;  4ZM8 A;  3SED A;  1OH0 A;  3DGL A;  3ER7 A;  3CC2 3;  4FR9 A;  3CC4 3;  4XDV A;  4KVH A;  4RNY A;  1Q81 4;  1SPU A;  2P05 A;  3M8C A;  5KP1 A;  3GWR A;  3E99 A;  2L4V A;  1DMM A;  3GZY B;  3LTB A;  1L5G B;  1RN7 A;  4O8S A;  3CCS 3;  2CC3 A;  5EEO A;  4HZB B;  3EC9 A;  5IF6 A;  2KCD A;  3FCS B;  3LT8 A;  4FMA A;  3WOD G;  3AMO A;  1DYU A;  2CFG A;  2XFS A;  4EV2 A;  4IIA A;  3WA2 X;  2O9U X;  4OVM A;  3IJE B;  2HMM B;  3GZR A;  2W03 A;  3OWY A;  1CYU A;  1IT8 A;  3GAX A;  4WWU C;  1Q86 4;  3FG3 A;  1Q40 B;  1E3V A;  5KP4 A;  1RRH A;  3BND A;  1N5H A;  2HMN B;  1IT7 A;  3G6E 3;  1N9E A;  1STF I;  3B7C A;  2IA7 A;  1ROA A;  2W6J H;  2BHM A;  2QEX 3;  3EN1 B;  3JUO A;  3CCM 3;  4WYK B;  2FXT A;  3DUK A;  1OGZ A;  3S67 A;  2BMR B;  4EV5 A;  1A90 A;  1DVC A;  3LXU X;  3FSD A;  5CXO A;  2UX0 A;  1QAL A;  4X2O A;  2XR8 B;  5ELU A;  3CCR 3;  4R4K A;  1W7C A;  1IV9 A;  2MC8 A;  1IVX A;  5KP3 A;  3CME 3;  1VQ5 3;  3CCJ 3;  3ALA A;  2W9Q A;  1AV4 A;  4GL6 A;  2CHC A;  1FGT A;  1M1K 4;  4O2H A;  1K8A 4;  3MPH A;  4X2H A;  4FCZ A;  4K1U A;  1YJ9 3;  1NU3 A;  3PS8 A;  4HM0 B;  1KD1 4;  1FGO A;  1S5A A;  1HU9 A;  3CCE 3;  3HII A;  1W6G A;  4KFE A;  3DGO A;  1TFO A;  2Z6B A;  3B4O A;  3NV0 B;  4FMB A;  3H3H A;  2GEX A;  3MYT A;  4R80 A;  3CCQ 3;  2E2U A;  2GU3 A;  1W6Y A;  2CFW A;  2B1X B;  2K54 A;  3N54 B;  5IEN A;  2CWV A;  2GEY A;  3I0Y A;  3KSE D;  4MJD A;  4HYZ A;  3SOY A;  2GBX B;  4WP5 A;  3PCS A;  3LTC A;  2MF7 A;  4J9A A;  2RSX A;  3VGN A;  1K41 A;  3MSO A;  1GD3 A;  1Z1S A;  3CNM A;  1GS3 A;  3DY5 A;  3BB9 A;  3FKA A;  2FNQ A;  3QK9 A;  3VF1 A;  4J8T A;  2CFL A;  2IUK A;  3KZT A;  1W2B 2;  3V92 A;  1KQS 2;  5STD A;  3RGR A;  2QA4 3;  1QVF 2;  1W2Z A;  3D9R A;  3DZL A;  5DRV A;  2WGO A;  4HVN A;  5EVH A;  1O7G B;  3CCU 3;  1ZX2 A;  1STD A;  2W56 A;  3NHX A;  4MEI A;  1OUN A;  1VQP 3;  3TDG A;  2P38 A;  1E3R A;  2WOF A;  3PCR A;  1YJW 3;  5AYS C;  1LNH A;  1C7H A;  3HX8 A;  2JQ5 A;  2SBL A;  1M9G A;  4L7K A;  1OHO A;  3EBY A;  3EB8 A;  3UL5 A;  3GZX B;  3PYJ A;  2C10 A;  4AEQ A;  1MOL A;  1VQ8 3;  5CF1 A;  1IVV A;  1OHP A;  5IG4 A;  4L8P A;  1W01 A;  1ROV A;  1W6C A;  2KRT A;  4XM4 A;  2BT3 A;  1JKG A;  2XSO B;  1EQK A;  4G1M B;  3RDE A;  2OQE A;  3NBR A;  4FMD A;  2GU1 A;  4LZI A;  1BUQ A;  1UI7 A;  2CK3 H;  4IT7 A;  3DM8 A;  3CCL 3;  1ISK A;  4IPB A;  1AVK A;  4ORL A;  1HKX A;  2YFJ B;  5TGN A;  5IEO A;  1QVG 2;  1SIH A;  3BNC A;  5D82 A;  3LH4 A;  1RRL A;  3PGB A;  3PXM A;  3GZB A;  1IQX A;  1GY7 A;  3JUM A;  4HM8 B;  1WMO A;  4N3V A;  1QJG A;  3EF8 A;  1VQ4 3;  3LML A;  5BVB A;  3CPW 2;  3KN4 A;  4N6U A;  1JB4 A;  3EX9 A;  5LC6 A;  1YIT 3;  3ROB A;  3UJM A;  2I9W A;  1IVW A;  1TFK A;  3SOA A;  3MKI A;  1IQY A;  1O7H B;  4GB5 A;  5CLK A;  3MHE A;  4NRE A;  3NXJ A;  2Z76 A;  3QRD A;  3OWS A;  1DMN A;  5AYR B;  2E2T A;  1GY5 A;  4AKZ A;  3WOF B;  3Q90 A;  2IMJ A;  5DRE A;  4NHF A;  3T8U A;  1JNQ A;  2Y74 A;  3STD A;  7STD A;  5FW5 A;  2E2V A;  3KSP A;  4HM4 B;  4HM7 B;  2D42 A;  3FLJ A;  2YX9 A;  2CG1 A;  1UUW B;  1VQM 3;  4XDW A;  3DGN A;  5D83 A;  5AI1 A;  1GYB A;  3CCV 3;  1VQL 3;  1W5Z A;  2BMQ B;  3KII A;  4N6T A;  3V98 A;  3NV0 A;  1UUV B;  4FCM A;  1DMQ A;  3T0U A;  3HI7 A;  4K1V A;  4Q53 A;  4R1K A;  2OQE C;  3KFQ C;  4JF8 A;  3AMO B;  3CMA 3;  1QAF A;  3LOY A;  1NWW A;  3H51 A;  3EHC A;  3UNL A;  2HMO B;  2PZV A;  4XB5 A;  3EQQ B;  3T8N A;  1EG9 B;  3JUP A;  1G96 A;  1VQ9 3;  2OTJ 3;  1OPY A;  5AIF A;  3LT9 A;  1SJW A;  2CW9 A;  2OOV C;  4EC6 A;  4H3U A;  3NBJ A;  1N5P A;  4KZ1 A;  5IW9 A;  5AEW B;  5IER A;  3NQY A;  3RGA A;  3X3Z A;  1WQL B;  1JN5 A;  4LSO A;  1K9M 4;  4HM6 B;  4O3V A;  2ZDJ A;  4JRF A;  1SQW A;  3MG2 A;  1CYV A;  2XF3 A;  3F14 A;  3EJV A;  1YIJ 3;  4N6O B;  1YI2 3;  1T5Y A;  2WO0 A;  4R9L A;  2Q07 A;  3L0R A;  3HIG A;  1NJI 4;  2OCT A;  1TIJ A;  2GBW B;  1CQS A;  1D6U A;  1A2V A;  1OF5 B;  5IG3 A;  1EKM A;  1WMN A;  2D1W A;  1N8Q A;  3EE1 A;  2WOH A;  5FGO A;  3OX9 A;  2V1L A;  3FG4 A;  2M7O A;  4FMC A;  4N6N B;  3X3Y A;  6STD A;  5JBS A;  2OWP A;  5HGR A;  3S27 A;  4HM1 B;  1U8C B;  1QMA A;  3SXX A;  3FF0 A;  3VSY A;  1N8R 4;  2W0Q A;  2BNG A;  5ELJ A;  1CEW I;  1M1X B;  1LVN A;  1SII A;  2ZL8 A;  3F40 A;  3UL6 A;  1FA3 A;  4MMY B;  1ASK A;  3G8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...