1O7MB

Naphthalene 1,2-dioxygenase, binary complex with dioxygen
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
193
Chain Sequence
b'MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
molecule tags Oxidoreductase
source organism Pseudomonas putida
publication title Crystal Structure of Naphthalene Dioxygenase: Side-on Binding of Dioxygen to Iron
pubmed doi rcsb
total genus 52
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1o7mB00
1E97A 3DUKA 3T8UA 2BNGA 3MG2A 4ORLA 4HVNA 1ISKA 3RGRA 1S5AA 3MYTA 1DMNA 3SOYA 5IG3A 1JN5A 2F99A 3NUVA 3ER7A 4FCMA 1VZZA 2RCDA 3HZPA 1GS3A 3Q90A 1ZX2A 4HM2B 4HM5B 4PEJA 1DMMA 3WMDA 1A2KA 4OVMA 4J8TA 2I9WA 4K1UA 4XM4A 3VGNA 4L8OA 3B4PA 2XSHB 3FSDA 3H3HA 3EJVA 1GY5A 3K0ZA 5IEPA 3CNMA 1JN5B 1OH0A 5JPUA 3UNLA 3H51A 3JUMA 1O7NB 3FZWA 3DXOA 3UJMA 4OUQA 4FCJA 1E3VA 1W01A 2Z76A 1WQLB 3B7CA 4H3UA 5EVHA 3STDA 1Q40A 1NDOB 1OUNA 4J9AA 3JUPA 3EN1B 1GY7A 1O7MB 4XDWA 4IIAA 3A76A 1OHSA 1ULIB 1O7HB 1W00A 3F8HA 5DRVA 2CHCA 6STDA 3F9SA 3HK4A 4XBYA 1TP6A 3ROBA 1AR0A 1E3RA 5AIGA 1JB2A 1OCVA 2GEXA 2HMOB 2OWPA 2XR8B 3GWRA 3JUNA 3NHXA 3NV0B 3F7SA 4L8PA 5CF2A 3NM2A 2PZVA 2CKFB 2GEYA 4WWUC 5IG0A 3KSPA 3HX8A 5IENA 1Q42A 2QGUA 4KVHA 5CK6A 3GRDA 4R9KA 4U13A 5AIHA 4CDLA 1QJGA 4MJDA 4WYKB 3M8CA 4K1VA 5IEOA 1W02A 1ZO2A 2BMOB 2XRXB 3F8XA 2GXFA 3MHEA 4Q53A 4HM7B 3T8NA 5AEWB 3NV0A 1NU3A 1JKGA 1O7PB 4N3VA 1OPYA 1OHPA 1OGXA 3GZYB 2GBWB 1IDPA 4LGQA 3KKGA 5TGNA 5G2GA 3LYGA 4HM0B 4RZMA 3CPOA 4STDA 2STDA 2INXA 2R4IA 5IF6A 2HMLB 3FH1A 1Q40B 2HMMB 4HZBB 4HKVB 2F86B 3JUQA 5BXQA 3I0YA 3B4OA 1EA2A 3G16A 1K41A 3MG1A 1DMQA 1OGZA 4R9LA 5KP1A 3FLJA 3OWSA 4XB5A 2JQ5A 5CXOA 3K7CA 3DZLA 3EBTA 1EG9B 3NXJA 3FKAA 3MG3A 2XSOB 4HZ9B 5HGRA 1TUHA 3JUOA 3EX9A 3IPTA 2GBXB 3OXAA 3NBRA 5IG5A 5JPPA 1O7GB 2B1XB 1O7WB 1STDA 1UUWB 2IMJA 2K54A 3E99A 3F7XA 3FF2A 4R1KA 3GZRA 4XBTA 5AIFA 1JB4A 1ULJB 2F98A 5D81A 3GZBA 5BVBA 3KE7A 1CQSA 1U5OA 4HJLB 3F40A 1JB5A 3FGYA 5AI1A 4GB5A 3RGAA 1OF5A 2BMQB 3D9RA 2W2CA 3CNXA 3FF0A 4XBXA 5STDA 2RFRA 4L7KA 2B24B 3CU3A 3S5CA 5KP4A 4WP5A 3OV4A 3F14A 2YFJB 1JKGB 4LEHA 4X2OA 3B8LA 5IG4A 5D82A 3GZXB 3OWYA 5KP3A 4LMIA 7STDA 4HM3B 3SOAA 1GY6A 4WYKA 4HM6B 1OHOA 5FW5A 2YFIB 1NWWA 2UX0A 1SJWA 1QMAA 1Z1SA 8CHOA 5DREA 2YFLB 4HM4B 4X2HA 3G8ZA 1BUQA 2QIYA 3EBYA 3OWUA 2RGQA 1GYBA 3BLZA 4I4KA 3SEDA 3BB9A 2Z7AA 5CLKA 4HM1B 5AEUB 3MSOA 2A15A 1HKXA 1UUVB 5CF1A 3EQQB 2HMJB 2HMNB 3EC9A 4XDVA 1C7HA 3LZAA 3EN8A 4HM8B 3VSYA 3EF8A 3G0KA 5AIIA 2HMKB 3MKIA 3OX9A 1OF5B 3DM8A 3EHCA 1ASKA 3DMCA 3KZTA 2Z77A 2BMRB 1W6YA 5D83A 5IERA 3ECFA
chains in the Genus database with same CATH superfamily
1YGEA 1E97A 3T8UA 2CG0A 1B21A 1EEJA 3CCR3 4ORLA 3GSPA 2M7OA 3MYTA 4HAAA 3SVAA 1DMNA 2OTJ3 1I8VA 2P0XA 1D6YA 4HM2B 1BOXA 1GS3A 1R4CA 4K90B 3RDEA 5BIRA 3FG4A 4N6TA 1YJW3 1M1K4 3VGNA 1V74A 3LT9A 1CYUA 3FSDA 2OOVC 3K0ZA 1IT7A 1JN5B 1OH0A 5JPUA 1IT8A 1I0VA 1Q824 1FW7A 1W01A 1D6UA 3STDA 1Q864 3S27A 3UL6A 4J5GA 1FGRA 4QWTA 1DETA 1SARA 3A76A 3BIRA 1JRQA 2K3DA 1KQS2 1M1XB 1N9JA 1FZUA 2W56B 5GSPA 2XR8B 3JUNA 2HMOB 3SOYA 1B2UA 1QALA 5IW9A 6RNTA 3AHWA 1MNLA 3L0RA 3HX8A 8RNTA 2QGUA 3ZFZA 3IJEB 1RMSA 4R9KA 4U13A 2GU3A 3X3YA 2P05A 3SXXA 1RCKA 1LRAA 3M8CA 4K1VA 1ZO2A 2XRXB 3AHSA 2GXFA 1BUJA 1NU3A 2FGTA 4N3VA 1OPYA 1OGXA 2Z6BA 1I3IA 3CME3 1SQWA 3WODG 1FUWA 1IDPA 1TU5A 5JBSA 3KKGA 5A0OB 5TGNA 1MWUA 1UW1A 2BU4A 1B27A 1YNVX 2H0IA 4O2HA 4STDA 1BSCA 2D42A 1DVCA 2KXGA 1GOVA 1RGCA 3JUQA 2J8XB 1IV9A 4R9LA 5G1KA 1RJOA 3FLJA 2CC3A 2ZHXB 4RNYA 3KFQC 4FMBA 1UGHI 3NXJA 3FKAA 1Q814 1BGSA 4BTXA 3A5EA 1BIRA 1W6GA 2IYJA 3BNBA 3JUOA 3LXUX 2GBXB 5IG5A 1G02A 5JPPA 1QVF2 2B1XB 1GD4A 1O7WB 1STDA 2IMJA 1V58A 1U8CB 3F7XA 1BSBA 1ULJB 1IVVA 1BAOA 3KE7A 5AIGA 1N8R4 1CQSA 3KCHA 2IA7A 2MF7A 1I3FA 3AMOA 3G4S3 1US1A 3FGYA 3RGAA 2OOVA 3EB8A 1UGIA 2BMQB 2W03A 3FF0A 1JBTA 1BNSA 4BL2A 5KP4A 4HOHA 3PCSA 1B2SA 2YFJB 3URPA 5ELJA 1TRQA 4DKIA 1WTHA 1S723 2SARA 7STDA 1X1WA 1FGTA 1TRPA 1EUIC 2FXTA 2P38A 1RNBA 2D1WA 2UX0A 3K63A 1QMAA 1KWIA 4WHAA 1LOWA 2XGLA 2RGQA 3SLUA 4CCVA 3FG3A 5ELUA 1NJI4 1N8QA 4MMYB 2P0MA 1LOYA 1SIHA 2HMNB 1C7HA 3X40A 4EV2A 3G0KA 3SYUA 5AIIA 2HMKB 3WA2X 6STDA 3KZTA 4NREA 2BMRB 2KF6A 4CPKA 1VQK3 1ROVA 2OCTA 4I5QA 1IVXA 3CPW2 1ISKA 1S5AA 1FYSA 2E2VA 2XFTA 1W7CA 1JN5A 3LTCA 3SOAA 3ER7A 4FCMA 3Q90A 2W6JH 2F4YA 3AGNA 4O3VA 1VQ83 4PEJA 2UUGC 1MOLA 1A2KA 2CFLA 4J8TA 2I9WA 4K1UA 4XM4A 1L5GB 3S28A 3CCM3 3B4PA 4EYCA 1RRLA 1LNIA 2ML5A 4LSOA 4KFEA 2KRTA 3H51A 3JUMA 4HYZA 1NNVA 4RNZA 4OUQA 4FCJA 1I2EA 3B7CA 4H3UA 3X3ZA 1NDOB 1OUNA 1BRIA 2CWVA 1GY7A 1O7MB 4XDWA 4IIAA 7GSPA 2RBIA 3CC43 1OHSA 1VQL3 1RGFA 3HK4A 3ROBA 1TP6A 1E3RA 2WGOA 3K9MC 1UCLA 1BSDA 1OCVA 2GEXA 1BU4A 3GWRA 1G0TA 4NHFA 3NX0A 3T0UA 3J7Yd 3NQYA 1V57A 1SIIA 2C11A 1PYLA 1OACA 3NM2A 2PZVA 1UCKA 3ZG5A 3CMA3 4GHOA 1YJ93 1JJ22 1RGHA 1UUGB 5CK6A 1YIT3 5G1LA 1A2PA 3O8YA 1RN1A 4WYKB 4K61A 1W02A 2BMOB 4KFDA 5IEOA 1B2XA 2CFKA 3T8NA 3WR2A 1GMPA 3DGLA 2CX0A 3GZYB 1PY3A 2GBWB 5M1AA 3X3XA 1RLSA 4MEIA 1JZOA 1LOXA 4LYLB 3LOYA 4G1MB 1VQ93 2KCDA 4RZMA 2L1SA 2R41A 2HMLB 2YX9A 2ZDJA 1AVKA 1Q40B 4FMDA 4N6OB 5EQLA 3VF1A 3WOEB 1Q7Y4 5BXQA 3I0YA 1AV4A 2W9PA 1K41A 2Q07A 2CK3H 1OGZA 2WGQA 3CXC2 3PZWA 1FUSA 1GOYA 2IY2A 3EBTA 1EG9B 2C4BA 4ZM8A 2AADA 2OQEA 2BT3A 2XSOB 3OW22 5HGRA 3BNDA 3NBRA 1CYVA 3NQZA 1B3SA 2K54A 3E99A 1X1YA 1JZDA 2F98A 1BRNL 5D81A 1Q9EA 1UI7A 2CX1A 4HJLB 1ROAA 7RNTA 2ZL8A 1C54A 1W5ZA 3F40A 1JB5A 5AI1A 2IUKA 3CNXA 1MGRA 3K5TA 5STDA 4FMAA 3CCL3 1VQP3 1K734 3S29A 3EE1A 1CH0A 2O9UX 4WP5A 2CIUA 1GMQA 4LEHA 1SPUA 3D3LA 3PCRA 3RNTA 3V92A 3OWYA 4LMIA 1IK3A 2Y73A 1GY6A 4WYKA 2K0MA 1OHOA 1T3BA 2W9QA 5FW5A 4X2HA 1Q7HA 1BUQA 1RN7A 3OWUA 1I70A 2W56A 4I4KA 2JDIH 4HM1B 5CF1A 4J5KA 1UUVB 2CFDA 1G96A 3NM7A 4WFOA 2HMJB 2XFSA 4XDVA 3TDGA 1A90A 1BNFA 2IUJA 1BSAA 3Q2PA 2QA43 1N5PA 1STFI 3DMCA 3N8BA 2CFGA 1RGKA 1W6YA 3IMAB 1AQZA 5HOHA 3HOHA 1RGLA 1RNTA 1MGWA 2W0QA 4FR9A 1JV2B 3RGRA 1RGEA 2F56A 5IG3A 4HM5B 1VZZA 2RCDA 3HZPA 1VQN3 3WMDA 1J2BA 1R4YA 1WNHA 1GY5A 3EJVA 3G713 3V99A 3CCU3 5IEPA 3CNMA 1B2MA 1JBRA 1IU7A 3UNLA 3FZWA 3QRDA 3DXOA 3FCSB 2KF5A 2CW9A 2Z76A 1WQLB 5EVHA 1ZGXA 1Q40A 4J9AA 5LC6A 3EN1B 1IV7A 3SX1A 1HYFA 3LTBA 1B2ZA 1ULIB 4MMXB 3F8HA 5DRVA 1BNGA 2RNTA 1N9EA 1JBSA 1AR0A 1YIJ3 1FGOA 1WMNA 2OWPA 1T2IA 3NV0B 4ILFA 3NBBA 3F7SA 3N54B 1KD14 2HOHA 2QEX3 3GAXA 5AYRB 2CKFB 4WWUC 3KSPA 5IENA 1BRHA 2XF3A 4EC6A 5AIHA 1IYYA 1ZS7A 1QAKA 3F8XA 1GSPA 3MHEA 4Q53A 1IQXA 1BRGA 1I0XA 1X1XA 1A2VA 1JKGA 1UDII 1RDSA 1QAFA 1OHPA 1D6ZA 3CCS3 1BVIA 4LGQA 4LZIA 2FNQA 5G2GA 2ML6A 1GD3A 3LYGA 4HM0B 3LTDA 3CPOA 4JRFA 5RNTA 3CCJ3 2STDA 5IF6A 2R4IA 4RNTA 3FH1A 2HMMB 3AMOB 3HI7A 4HZBB 2F86B 2UGIA 2V1LA 1EA2A 3B4OA 1LNHA 3MG1A 2KAAA 2L4VA 3OWSA 4BU4A 2JQ5A 5CXOA 3U97A 3K7CA 1NB5I 3DZLA 3BU4A 1TFOA 3DGYA 3MG3A 3LH4A 1DYUA 1TUHA 4FCZA 3IPTA 4GL6A 3HIGA 1UUWB 4XBTA 5AIFA 4R1KA 5BVBA 1EKMA 1B20A 1GMRA 2Y74A 3GZRA 2SBLA 1IQYA 2BO9B 1U5OA 1HU9A 2E2UA 1QVG2 4N6NB 1RHLA 2H0HA 4OK0A 4AKYA 1BNJA 4BIRA 1VQ73 1T5YA 1RRHA 2PNCA 3D9RA 1HZ1A 2B24B 3CU3A 3S5CA 1BANA 1FGQA 1W2ZA 1AVLA 1JKGB 2CH9A 1RN4A 1RSNA 3B8LA 4JF8A 4IPBA 1RKYA 4HM3B 1F8NA 4HM6B 1VQM3 2BHMA 2YFIB 1Z1SA 1PFPA 8CHOA 1JNQA 2YFLB 5DREA 3NBJA 4HM4B 3CC73 2QIYA 3EBYA 3QK9A 1W2B2 4HBRA 3X42A 1DE3A 2Z7AA 2CWTA 3PXMA 4BL3A 3MSOA 2A15A 1BRJA 4N6LA 4RBNA 1YGWA 5M18A 3EQQB 1TFKA 3EC9A 3PGBA 3CCV3 3MPHA 1M9GA 2RSXA 3EN8A 4EXRA 3EF8A 2XEPA 3WA3A 1RGAA 3D5GA 3MKIA 3OX9A 1LOVA 3EHCA 5D83A 2Z77A 1RTUA 1VQ53 3D4AA 3DUKA 2BNGA 1UI8A 3MG2A 2AAEA 5M19A 4HVNA 4MMZB 1EQKA 3V98A 3Q1CA 2F99A 2C10A 3NUVA 1TJDA 3LT8A 3LTAA 1ZX2A 1DMMA 1LQMB 4EV5A 4OVMA 1UCJA 4L8OA 1BNRA 2XSHB 3H3HA 4EW5A 1MWTA 2F5MA 1DVDA 3X41A 2GSPA 3DGNA 1O7NB 1WMOA 3LMLA 3DH2A 3UJMA 1E3VA 1LQGC 2GU1A 1I2GA 1YJN3 3JUPA 4GSPA 3DY5A 3FG1A 4FMCA 1FA3A 2H0GA 3DGOA 1X1UA 2KF3A 1O7HB 1W00A 3PYJA 3BNEA 1VQ63 2OQEC 1LXEA 2CHCA 3F9SA 4CJNA 4XBYA 3AGOA 1JB2A 1Y4KA 4L8PA 3NHXA 5CF2A 3WHOA 2O3OA 4BTWA 1VQ43 3I553 1PU4A 3UL5A 4EBGA 2GEYA 5IG0A 3D79A 2CWUA 3N9HA 1Q42A 2XH9A 4KVHA 4BTYA 3DGMA 3CCQ3 5AYSC 3GRDA 1MWSA 1T2HA 4CDLA 1QJGA 4MJDA 3UB1A 1RGGA 1UCIA 1AY7A 1NO3A 4HM7B 4R4KA 5AEWB 3NV0A 2BIRA 1YVBI 1O7PB 4IT7A 1GOUA 1W4NA 1VQQA 2WOHA 3KN4A 4KT3B 2OTL3 4N6UA 4NPBA 4AEQA 1TIJA 3PS8A 2INXA 1KSIA 1IVUA 9RNTA 4AKZA 4HKVB 6GSPA 3KIIA 3G16A 2CG1A 5I97A 1DMQA 5KP1A 1VQO3 4XB5A 1CEWI 1FUTA 1K28A 2LQVA 4HZ9B 2LYXA 4O8SA 4TX4A 3EX9A 3OXAA 3I563 1O7GB 3FF2A 1W6CA 4R80A 4N6MA 3VSYA 1YHQ3 3HIIA 1FGMA 1JB4A 5BU4A 3GZBA 1MWRA 3G6E3 4O02B 3CC23 1KC84 3BNCA 1A67A 4GB5A 1I2FA 1N5HA 4N6V0 3U1WA 1OF5A 3S67A 2W2CA 2W04A 4XBXA 5LC7A 2RFRA 4L7KA 2MC8A 3D5IA 3CD63 3KSED 1BRSA 1WMPA 1YVSA 1IQ8A 3OV4A 3F14A 1M904 4X2OA 3ZG0A 5IG4A 4KFFA 1BRKA 5D82A 3GZXB 2ZA4A 5KP3A 1K8A4 1BNEA 1IVWA 1BNIA 1NWWA 1SJWA 1K9M4 5FGOA 3G8ZA 2WO0A 2XGNA 3BLZA 1GYBA 3SEDA 3Q3FA 3BB9A 1NB3I 5CLKA 5AEUB 4H61A 2CFWA 1HKXA 3WDGB 1TTOA 2P09A 1LVNA 4KZ1A 3JVCA 5EEOA 3LZAA 1BSEA 1RCLA 4HM8B 2F5WA 3CCE3 3MWZA 1YI23 2KF4A 3WOFB 2WOFA 1OF5B 3DM8A 1ASKA 3ALAA 2E2TA 5IERA 3ECFA
chains in the Genus database with same CATH topology
1YGEA 1E97A 3T8UA 2CG0A 3CCR3 4ORLA 2M7OA 3MYTA 3SVAA 1DMNA 2OTJ3 2P0XA 4HM2B 1D6YA 4K90B 1GS3A 1R4CA 3RDEA 1YJW3 1M1K4 3FG4A 4N6TA 3VGNA 1V74A 3LT9A 1CYUA 3FSDA 2OOVC 3K0ZA 1IT7A 1JN5B 1OH0A 5JPUA 1IT8A 1Q824 1W01A 1D6UA 3STDA 1Q864 3S27A 3UL6A 1FGRA 4QWTA 3A76A 1JRQA 1KQS2 1M1XB 1N9JA 2W56B 2XR8B 3JUNA 2HMOB 3SOYA 1QALA 5IW9A 1MNLA 3L0RA 3HX8A 2QGUA 3IJEB 4R9KA 4U13A 2GU3A 3X3YA 2P05A 3SXXA 3M8CA 4K1VA 1ZO2A 2XRXB 2GXFA 1NU3A 2FGTA 4N3VA 1OPYA 1OGXA 2Z6BA 3CME3 1SQWA 3WODG 1FUWA 1IDPA 1TU5A 5JBSA 3KKGA 5A0OB 5TGNA 1UW1A 4O2HA 4STDA 2D42A 1DVCA 2KXGA 3JUQA 1IV9A 4R9LA 1RJOA 3FLJA 2CC3A 4RNYA 3KFQC 4FMBA 3NXJA 3FKAA 1Q814 4BTXA 1W6GA 3BNBA 3JUOA 3LXUX 2GBXB 5IG5A 5JPPA 1QVF2 2B1XB 1GD4A 1O7WB 1STDA 2IMJA 3F7XA 1U8CB 1ULJB 1IVVA 3KE7A 1N8R4 1CQSA 2IA7A 2MF7A 3G4S3 3AMOA 1US1A 3FGYA 3RGAA 2OOVA 3EB8A 2BMQB 2W03A 3FF0A 5KP4A 3PCSA 2YFJB 5ELJA 1WTHA 1S723 7STDA 1FGTA 2P38A 2FXTA 2D1WA 2UX0A 3K63A 1QMAA 1KWIA 4WHAA 2XGLA 2RGQA 3SLUA 4CCVA 3FG3A 5ELUA 1NJI4 1N8QA 4MMYB 2P0MA 1SIHA 2HMNB 1C7HA 3X40A 4EV2A 3G0KA 5AIIA 2HMKB 3WA2X 6STDA 3KZTA 4NREA 2BMRB 1VQK3 1ROVA 2OCTA 3CPW2 1IVXA 1ISKA 1S5AA 2E2VA 2XFTA 1W7CA 1JN5A 3LTCA 3SOAA 3ER7A 4FCMA 3Q90A 2W6JH 4O3VA 1VQ83 4PEJA 1MOLA 1A2KA 2CFLA 4J8TA 2I9WA 4K1UA 4XM4A 1L5GB 3S28A 3CCM3 3B4PA 4EYCA 1RRLA 2ML5A 4LSOA 4KFEA 2KRTA 3H51A 3JUMA 4HYZA 4RNZA 4OUQA 4FCJA 3B7CA 4H3UA 3X3ZA 1NDOB 1OUNA 2CWVA 1GY7A 1O7MB 4XDWA 4IIAA 3CC43 1OHSA 1VQL3 3HK4A 3ROBA 1TP6A 1E3RA 2WGOA 3K9MC 5AIGA 1OCVA 2GEXA 4NHFA 3GWRA 3T0UA 3J7Yd 1K9M4 3NX0A 3NQYA 1SIIA 2C11A 1OACA 3NM2A 2PZVA 3CMA3 1YJ93 1JJ22 5CK6A 1YIT3 3O8YA 4WYKB 4K61A 1W02A 2BMOB 4KFDA 5IEOA 2CFKA 3T8NA 3DGLA 3GZYB 2GBWB 3X3XA 4MEIA 1LOXA 3LOYA 4G1MB 1VQ93 2KCDA 4RZMA 2HMLB 2YX9A 2ZDJA 1AVKA 1Q40B 4FMDA 4N6OB 5EQLA 3VF1A 3WOEB 1Q7Y4 5BXQA 3I0YA 1AV4A 2W9PA 1K41A 2Q07A 2CK3H 1OGZA 2WGQA 3CXC2 3PZWA 3EBTA 1EG9B 4ZM8A 2OQEA 2BT3A 2XSOB 3OW22 5HGRA 3BNDA 3NBRA 1CYVA 3NQZA 2K54A 3E99A 2F98A 5D81A 1UI7A 4HJLB 1ROAA 2ZL8A 1W5ZA 3F40A 1JB5A 5AI1A 2IUKA 3CNXA 3CCL3 3K5TA 5STDA 4FMAA 1VQP3 1K734 3S29A 3EE1A 2O9UX 4WP5A 2CIUA 4LEHA 1SPUA 3D3LA 3PCRA 3V92A 3OWYA 4LMIA 1IK3A 2Y73A 1GY6A 4WYKA 2K0MA 1OHOA 2W9QA 5FW5A 4X2HA 1BUQA 1RN7A 3OWUA 2W56A 4I4KA 2JDIH 4HM1B 5CF1A 1UUVB 2CFDA 1G96A 3NM7A 4WFOA 2HMJB 2XFSA 4XDVA 3TDGA 1A90A 2IUJA 3Q2PA 2QA43 1N5PA 1STFI 3DMCA 3N8BA 2CFGA 1W6YA 3IMAB 4FR9A 2W0QA 1JV2B 3RGRA 5IG3A 4HM5B 1VZZA 2RCDA 3HZPA 1VQN3 3WMDA 1J2BA 1WNHA 1GY5A 3EJVA 3G713 3V99A 3CCU3 5IEPA 3CNMA 1IU7A 3UNLA 3FZWA 3QRDA 3DXOA 3FCSB 2CW9A 2Z76A 1WQLB 5EVHA 1Q40A 4J9AA 5LC6A 3EN1B 1IV7A 3SX1A 3LTBA 1ULIB 4MMXB 3F8HA 5DRVA 1N9EA 1AR0A 1YIJ3 1FGOA 1WMNA 2OWPA 3NV0B 3NBBA 3F7SA 3N54B 1KD14 2QEX3 3GAXA 5AYRB 2CKFB 4WWUC 3KSPA 5IENA 2XF3A 4EC6A 5AIHA 1QAKA 3F8XA 3MHEA 4Q53A 1IQXA 1A2VA 1JKGA 1QAFA 1OHPA 1D6ZA 3CCS3 4LGQA 4LZIA 2FNQA 5G2GA 2ML6A 1GD3A 3LYGA 4HM0B 3LTDA 3CPOA 4JRFA 3CCJ3 2STDA 5IF6A 2R4IA 3FH1A 2HMMB 3AMOB 3HI7A 4HZBB 2F86B 2V1LA 1EA2A 3B4OA 1LNHA 3MG1A 2L4VA 3OWSA 2JQ5A 5CXOA 3U97A 3K7CA 1NB5I 3DZLA 1TFOA 3MG3A 3LH4A 1DYUA 1TUHA 4FCZA 3IPTA 4GL6A 3HIGA 1UUWB 4XBTA 5AIFA 4R1KA 5BVBA 1EKMA 3GZRA 2Y74A 2SBLA 1IQYA 2BO9B 1U5OA 1HU9A 2E2UA 1QVG2 4N6NB 4OK0A 4AKYA 1VQ73 1T5YA 1RRHA 2PNCA 3D9RA 2B24B 3CU3A 3S5CA 1FGQA 1W2ZA 1AVLA 1JKGB 2CH9A 3B8LA 4JF8A 4IPBA 1RKYA 4HM3B 1F8NA 4HM6B 1VQM3 2BHMA 2YFIB 1Z1SA 1PFPA 8CHOA 1JNQA 2YFLB 5DREA 3NBJA 4HM4B 3CC73 2QIYA 3EBYA 3QK9A 1W2B2 4HBRA 3X42A 2Z7AA 2CWTA 3PXMA 3MSOA 2A15A 4N6LA 4RBNA 3EQQB 1TFKA 3EC9A 3PGBA 3CCV3 3MPHA 1M9GA 2RSXA 3EN8A 4EXRA 3EF8A 2XEPA 3WA3A 3OX9A 3MKIA 3EHCA 5D83A 2Z77A 1VQ53 3DUKA 2BNGA 1UI8A 3MG2A 4HVNA 4MMZB 1EQKA 3V98A 3Q1CA 2F99A 2C10A 3NUVA 3LT8A 3LTAA 1ZX2A 1DMMA 4EV5A 4OVMA 4L8OA 2XSHB 3H3HA 1DVDA 3X41A 3DGNA 1O7NB 1WMOA 3LMLA 3UJMA 1E3VA 2GU1A 1YJN3 3JUPA 3DY5A 3FG1A 4FMCA 1FA3A 3DGOA 3PYJA 1O7HB 1W00A 3BNEA 1VQ63 2OQEC 1LXEA 2CHCA 3F9SA 4XBYA 1JB2A 1Y4KA 4L8PA 3NHXA 5CF2A 1VQ43 2O3OA 4BTWA 3I553 1PU4A 3UL5A 4EBGA 2GEYA 5IG0A 3N9HA 2CWUA 1Q42A 2XH9A 4KVHA 4BTYA 3DGMA 3CCQ3 5AYSC 3GRDA 4CDLA 1QJGA 4MJDA 3UB1A 4R4KA 1NO3A 4HM7B 5AEWB 3NV0A 1YVBI 1O7PB 4IT7A 1W4NA 2WOHA 3KN4A 2OTL3 4N6UA 4AEQA 1TIJA 3PS8A 2INXA 1KSIA 1IVUA 4AKZA 4HKVB 3KIIA 3G16A 2CG1A 5I97A 1DMQA 5KP1A 1VQO3 4XB5A 1CEWI 1K28A 2LQVA 4HZ9B 2LYXA 4O8SA 4TX4A 3EX9A 3OXAA 3I563 1O7GB 3FF2A 1W6CA 4R80A 4N6MA 3VSYA 1YHQ3 3HIIA 1FGMA 1JB4A 3GZBA 3G6E3 4O02B 3CC23 1KC84 3BNCA 1A67A 4GB5A 1N5HA 4N6V0 3U1WA 1OF5A 3S67A 2W2CA 2W04A 4XBXA 5LC7A 2RFRA 4L7KA 2MC8A 3CD63 3KSED 1WMPA 1IQ8A 3OV4A 3F14A 1M904 4X2OA 5IG4A 4KFFA 5D82A 3GZXB 1K8A4 5KP3A 1IVWA 1NWWA 1SJWA 5FGOA 3G8ZA 2WO0A 2XGNA 3BLZA 1GYBA 3SEDA 3BB9A 1NB3I 5CLKA 5AEUB 4H61A 2CFWA 1HKXA 3WDGB 2P09A 1LVNA 4KZ1A 3JVCA 5EEOA 3LZAA 4HM8B 3CCE3 1YI23 3MWZA 3WOFB 2WOFA 1OF5B 3DM8A 1ASKA 3ALAA 2E2TA 5IERA 3ECFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E97 A;  3DUK A;  3T8U A;  2BNG A;  3MG2 A;  4ORL A;  4HVN A;  1ISK A;  3RGR A;  1S5A A;  3MYT A;  1DMN A;  3SOY A;  5IG3 A;  1JN5 A;  2F99 A;  3NUV A;  3ER7 A;  4FCM A;  1VZZ A;  2RCD A;  3HZP A;  1GS3 A;  3Q90 A;  1ZX2 A;  4HM2 B;  4HM5 B;  4PEJ A;  1DMM A;  3WMD A;  1A2K A;  4OVM A;  4J8T A;  2I9W A;  4K1U A;  4XM4 A;  3VGN A;  4L8O A;  3B4P A;  2XSH B;  3FSD A;  3H3H A;  3EJV A;  1GY5 A;  3K0Z A;  5IEP A;  3CNM A;  1JN5 B;  1OH0 A;  5JPU A;  3UNL A;  3H51 A;  3JUM A;  1O7N B;  3FZW A;  3DXO A;  3UJM A;  4OUQ A;  4FCJ A;  1E3V A;  1W01 A;  2Z76 A;  1WQL B;  3B7C A;  4H3U A;  5EVH A;  3STD A;  1Q40 A;  1NDO B;  1OUN A;  4J9A A;  3JUP A;  3EN1 B;  1GY7 A;  1O7M B;  4XDW A;  4IIA A;  3A76 A;  1OHS A;  1ULI B;  1O7H B;  1W00 A;  3F8H A;  5DRV A;  2CHC A;  6STD A;  3F9S A;  3HK4 A;  4XBY A;  1TP6 A;  3ROB A;  1AR0 A;  1E3R A;  5AIG A;  1JB2 A;  1OCV A;  2GEX A;  2HMO B;  2OWP A;  2XR8 B;  3GWR A;  3JUN A;  3NHX A;  3NV0 B;  3F7S A;  4L8P A;  5CF2 A;  3NM2 A;  2PZV A;  2CKF B;  2GEY A;  4WWU C;  5IG0 A;  3KSP A;  3HX8 A;  5IEN A;  1Q42 A;  2QGU A;  4KVH A;  5CK6 A;  3GRD A;  4R9K A;  4U13 A;  5AIH A;  4CDL A;  1QJG A;  4MJD A;  4WYK B;  3M8C A;  4K1V A;  5IEO A;  1W02 A;  1ZO2 A;  2BMO B;  2XRX B;  3F8X A;  2GXF A;  3MHE A;  4Q53 A;  4HM7 B;  3T8N A;  5AEW B;  3NV0 A;  1NU3 A;  1JKG A;  1O7P B;  4N3V A;  1OPY A;  1OHP A;  1OGX A;  3GZY B;  2GBW B;  1IDP A;  4LGQ A;  3KKG A;  5TGN A;  5G2G A;  3LYG A;  4HM0 B;  4RZM A;  3CPO A;  4STD A;  2STD A;  2INX A;  2R4I A;  5IF6 A;  2HML B;  3FH1 A;  1Q40 B;  2HMM B;  4HZB B;  4HKV B;  2F86 B;  3JUQ A;  5BXQ A;  3I0Y A;  3B4O A;  1EA2 A;  3G16 A;  1K41 A;  3MG1 A;  1DMQ A;  1OGZ A;  4R9L A;  5KP1 A;  3FLJ A;  3OWS A;  4XB5 A;  2JQ5 A;  5CXO A;  3K7C A;  3DZL A;  3EBT A;  1EG9 B;  3NXJ A;  3FKA A;  3MG3 A;  2XSO B;  4HZ9 B;  5HGR A;  1TUH A;  3JUO A;  3EX9 A;  3IPT A;  2GBX B;  3OXA A;  3NBR A;  5IG5 A;  5JPP A;  1O7G B;  2B1X B;  1O7W B;  1STD A;  1UUW B;  2IMJ A;  2K54 A;  3E99 A;  3F7X A;  3FF2 A;  4R1K A;  3GZR A;  4XBT A;  5AIF A;  1JB4 A;  1ULJ B;  2F98 A;  5D81 A;  3GZB A;  5BVB A;  3KE7 A;  1CQS A;  1U5O A;  4HJL B;  3F40 A;  1JB5 A;  3FGY A;  5AI1 A;  4GB5 A;  3RGA A;  1OF5 A;  2BMQ B;  3D9R A;  2W2C A;  3CNX A;  3FF0 A;  4XBX A;  5STD A;  2RFR A;  4L7K A;  2B24 B;  3CU3 A;  3S5C A;  5KP4 A;  4WP5 A;  3OV4 A;  3F14 A;  2YFJ B;  1JKG B;  4LEH A;  4X2O A;  3B8L A;  5IG4 A;  5D82 A;  3GZX B;  3OWY A;  5KP3 A;  4LMI A;  7STD A;  4HM3 B;  3SOA A;  1GY6 A;  4WYK A;  4HM6 B;  1OHO A;  5FW5 A;  2YFI B;  1NWW A;  2UX0 A;  1SJW A;  1QMA A;  1Z1S A;  8CHO A;  5DRE A;  2YFL B;  4HM4 B;  4X2H A;  3G8Z A;  1BUQ A;  2QIY A;  3EBY A;  3OWU A;  2RGQ A;  1GYB A;  3BLZ A;  4I4K A;  3SED A;  3BB9 A;  2Z7A A;  5CLK A;  4HM1 B;  5AEU B;  3MSO A;  2A15 A;  1HKX A;  1UUV B;  5CF1 A;  3EQQ B;  2HMJ B;  2HMN B;  3EC9 A;  4XDV A;  1C7H A;  3LZA A;  3EN8 A;  4HM8 B;  3VSY A;  3EF8 A;  3G0K A;  5AII A;  2HMK B;  3MKI A;  3OX9 A;  1OF5 B;  3DM8 A;  3EHC A;  1ASK A;  3DMC A;  3KZT A;  2Z77 A;  2BMR B;  1W6Y A;  5D83 A;  5IER A;  3ECF A; 
#chains in the Genus database with same CATH topology
 1YGE A;  1E97 A;  3T8U A;  2CG0 A;  1B21 A;  1EEJ A;  3CCR 3;  4ORL A;  3GSP A;  2M7O A;  3MYT A;  4HAA A;  3SVA A;  1DMN A;  2OTJ 3;  1I8V A;  2P0X A;  1D6Y A;  4HM2 B;  1BOX A;  1GS3 A;  1R4C A;  4K90 B;  3RDE A;  5BIR A;  3FG4 A;  4N6T A;  1YJW 3;  1M1K 4;  3VGN A;  1V74 A;  3LT9 A;  1CYU A;  3FSD A;  2OOV C;  3K0Z A;  1IT7 A;  1JN5 B;  1OH0 A;  5JPU A;  1IT8 A;  1I0V A;  1Q82 4;  1FW7 A;  1W01 A;  1D6U A;  3STD A;  1Q86 4;  3S27 A;  3UL6 A;  4J5G A;  1FGR A;  4QWT A;  1DET A;  1SAR A;  3A76 A;  3BIR A;  1JRQ A;  2K3D A;  1KQS 2;  1M1X B;  1N9J A;  1FZU A;  2W56 B;  5GSP A;  2XR8 B;  3JUN A;  2HMO B;  3SOY A;  1B2U A;  1QAL A;  5IW9 A;  6RNT A;  3AHW A;  1MNL A;  3L0R A;  3HX8 A;  8RNT A;  2QGU A;  3ZFZ A;  3IJE B;  1RMS A;  4R9K A;  4U13 A;  2GU3 A;  3X3Y A;  2P05 A;  3SXX A;  1RCK A;  1LRA A;  3M8C A;  4K1V A;  1ZO2 A;  2XRX B;  3AHS A;  2GXF A;  1BUJ A;  1NU3 A;  2FGT A;  4N3V A;  1OPY A;  1OGX A;  2Z6B A;  1I3I A;  3CME 3;  1SQW A;  3WOD G;  1FUW A;  1IDP A;  1TU5 A;  5JBS A;  3KKG A;  5A0O B;  5TGN A;  1MWU A;  1UW1 A;  2BU4 A;  1B27 A;  1YNV X;  2H0I A;  4O2H A;  4STD A;  1BSC A;  2D42 A;  1DVC A;  2KXG A;  1GOV A;  1RGC A;  3JUQ A;  2J8X B;  1IV9 A;  4R9L A;  5G1K A;  1RJO A;  3FLJ A;  2CC3 A;  2ZHX B;  4RNY A;  3KFQ C;  4FMB A;  1UGH I;  3NXJ A;  3FKA A;  1Q81 4;  1BGS A;  4BTX A;  3A5E A;  1BIR A;  1W6G A;  2IYJ A;  3BNB A;  3JUO A;  3LXU X;  2GBX B;  5IG5 A;  1G02 A;  5JPP A;  1QVF 2;  2B1X B;  1GD4 A;  1O7W B;  1STD A;  2IMJ A;  1V58 A;  1U8C B;  3F7X A;  1BSB A;  1ULJ B;  1IVV A;  1BAO A;  3KE7 A;  5AIG A;  1N8R 4;  1CQS A;  3KCH A;  2IA7 A;  2MF7 A;  1I3F A;  3AMO A;  3G4S 3;  1US1 A;  3FGY A;  3RGA A;  2OOV A;  3EB8 A;  1UGI A;  2BMQ B;  2W03 A;  3FF0 A;  1JBT A;  1BNS A;  4BL2 A;  5KP4 A;  4HOH A;  3PCS A;  1B2S A;  2YFJ B;  3URP A;  5ELJ A;  1TRQ A;  4DKI A;  1WTH A;  1S72 3;  2SAR A;  7STD A;  1X1W A;  1FGT A;  1TRP A;  1EUI C;  2FXT A;  2P38 A;  1RNB A;  2D1W A;  2UX0 A;  3K63 A;  1QMA A;  1KWI A;  4WHA A;  1LOW A;  2XGL A;  2RGQ A;  3SLU A;  4CCV A;  3FG3 A;  5ELU A;  1NJI 4;  1N8Q A;  4MMY B;  2P0M A;  1LOY A;  1SIH A;  2HMN B;  1C7H A;  3X40 A;  4EV2 A;  3G0K A;  3SYU A;  5AII A;  2HMK B;  3WA2 X;  6STD A;  3KZT A;  4NRE A;  2BMR B;  2KF6 A;  4CPK A;  1VQK 3;  1ROV A;  2OCT A;  4I5Q A;  1IVX A;  3CPW 2;  1ISK A;  1S5A A;  1FYS A;  2E2V A;  2XFT A;  1W7C A;  1JN5 A;  3LTC A;  3SOA A;  3ER7 A;  4FCM A;  3Q90 A;  2W6J H;  2F4Y A;  3AGN A;  4O3V A;  1VQ8 3;  4PEJ A;  2UUG C;  1MOL A;  1A2K A;  2CFL A;  4J8T A;  2I9W A;  4K1U A;  4XM4 A;  1L5G B;  3S28 A;  3CCM 3;  3B4P A;  4EYC A;  1RRL A;  1LNI A;  2ML5 A;  4LSO A;  4KFE A;  2KRT A;  3H51 A;  3JUM A;  4HYZ A;  1NNV A;  4RNZ A;  4OUQ A;  4FCJ A;  1I2E A;  3B7C A;  4H3U A;  3X3Z A;  1NDO B;  1OUN A;  1BRI A;  2CWV A;  1GY7 A;  1O7M B;  4XDW A;  4IIA A;  7GSP A;  2RBI A;  3CC4 3;  1OHS A;  1VQL 3;  1RGF A;  3HK4 A;  3ROB A;  1TP6 A;  1E3R A;  2WGO A;  3K9M C;  1UCL A;  1BSD A;  1OCV A;  2GEX A;  1BU4 A;  3GWR A;  1G0T A;  4NHF A;  3NX0 A;  3T0U A;  3J7Y d;  3NQY A;  1V57 A;  1SII A;  2C11 A;  1PYL A;  1OAC A;  3NM2 A;  2PZV A;  1UCK A;  3ZG5 A;  3CMA 3;  4GHO A;  1YJ9 3;  1JJ2 2;  1RGH A;  1UUG B;  5CK6 A;  1YIT 3;  5G1L A;  1A2P A;  3O8Y A;  1RN1 A;  4WYK B;  4K61 A;  1W02 A;  2BMO B;  4KFD A;  5IEO A;  1B2X A;  2CFK A;  3T8N A;  3WR2 A;  1GMP A;  3DGL A;  2CX0 A;  3GZY B;  1PY3 A;  2GBW B;  5M1A A;  3X3X A;  1RLS A;  4MEI A;  1JZO A;  1LOX A;  4LYL B;  3LOY A;  4G1M B;  1VQ9 3;  2KCD A;  4RZM A;  2L1S A;  2R41 A;  2HML B;  2YX9 A;  2ZDJ A;  1AVK A;  1Q40 B;  4FMD A;  4N6O B;  5EQL A;  3VF1 A;  3WOE B;  1Q7Y 4;  5BXQ A;  3I0Y A;  1AV4 A;  2W9P A;  1K41 A;  2Q07 A;  2CK3 H;  1OGZ A;  2WGQ A;  3CXC 2;  3PZW A;  1FUS A;  1GOY A;  2IY2 A;  3EBT A;  1EG9 B;  2C4B A;  4ZM8 A;  2AAD A;  2OQE A;  2BT3 A;  2XSO B;  3OW2 2;  5HGR A;  3BND A;  3NBR A;  1CYV A;  3NQZ A;  1B3S A;  2K54 A;  3E99 A;  1X1Y A;  1JZD A;  2F98 A;  1BRN L;  5D81 A;  1Q9E A;  1UI7 A;  2CX1 A;  4HJL B;  1ROA A;  7RNT A;  2ZL8 A;  1C54 A;  1W5Z A;  3F40 A;  1JB5 A;  5AI1 A;  2IUK A;  3CNX A;  1MGR A;  3K5T A;  5STD A;  4FMA A;  3CCL 3;  1VQP 3;  1K73 4;  3S29 A;  3EE1 A;  1CH0 A;  2O9U X;  4WP5 A;  2CIU A;  1GMQ A;  4LEH A;  1SPU A;  3D3L A;  3PCR A;  3RNT A;  3V92 A;  3OWY A;  4LMI A;  1IK3 A;  2Y73 A;  1GY6 A;  4WYK A;  2K0M A;  1OHO A;  1T3B A;  2W9Q A;  5FW5 A;  4X2H A;  1Q7H A;  1BUQ A;  1RN7 A;  3OWU A;  1I70 A;  2W56 A;  4I4K A;  2JDI H;  4HM1 B;  5CF1 A;  4J5K A;  1UUV B;  2CFD A;  1G96 A;  3NM7 A;  4WFO A;  2HMJ B;  2XFS A;  4XDV A;  3TDG A;  1A90 A;  1BNF A;  2IUJ A;  1BSA A;  3Q2P A;  2QA4 3;  1N5P A;  1STF I;  3DMC A;  3N8B A;  2CFG A;  1RGK A;  1W6Y A;  3IMA B;  1AQZ A;  5HOH A;  3HOH A;  1RGL A;  1RNT A;  1MGW A;  2W0Q A;  4FR9 A;  1JV2 B;  3RGR A;  1RGE A;  2F56 A;  5IG3 A;  4HM5 B;  1VZZ A;  2RCD A;  3HZP A;  1VQN 3;  3WMD A;  1J2B A;  1R4Y A;  1WNH A;  1GY5 A;  3EJV A;  3G71 3;  3V99 A;  3CCU 3;  5IEP A;  3CNM A;  1B2M A;  1JBR A;  1IU7 A;  3UNL A;  3FZW A;  3QRD A;  3DXO A;  3FCS B;  2KF5 A;  2CW9 A;  2Z76 A;  1WQL B;  5EVH A;  1ZGX A;  1Q40 A;  4J9A A;  5LC6 A;  3EN1 B;  1IV7 A;  3SX1 A;  1HYF A;  3LTB A;  1B2Z A;  1ULI B;  4MMX B;  3F8H A;  5DRV A;  1BNG A;  2RNT A;  1N9E A;  1JBS A;  1AR0 A;  1YIJ 3;  1FGO A;  1WMN A;  2OWP A;  1T2I A;  3NV0 B;  4ILF A;  3NBB A;  3F7S A;  3N54 B;  1KD1 4;  2HOH A;  2QEX 3;  3GAX A;  5AYR B;  2CKF B;  4WWU C;  3KSP A;  5IEN A;  1BRH A;  2XF3 A;  4EC6 A;  5AIH A;  1IYY A;  1ZS7 A;  1QAK A;  3F8X A;  1GSP A;  3MHE A;  4Q53 A;  1IQX A;  1BRG A;  1I0X A;  1X1X A;  1A2V A;  1JKG A;  1UDI I;  1RDS A;  1QAF A;  1OHP A;  1D6Z A;  3CCS 3;  1BVI A;  4LGQ A;  4LZI A;  2FNQ A;  5G2G A;  2ML6 A;  1GD3 A;  3LYG A;  4HM0 B;  3LTD A;  3CPO A;  4JRF A;  5RNT A;  3CCJ 3;  2STD A;  5IF6 A;  2R4I A;  4RNT A;  3FH1 A;  2HMM B;  3AMO B;  3HI7 A;  4HZB B;  2F86 B;  2UGI A;  2V1L A;  1EA2 A;  3B4O A;  1LNH A;  3MG1 A;  2KAA A;  2L4V A;  3OWS A;  4BU4 A;  2JQ5 A;  5CXO A;  3U97 A;  3K7C A;  1NB5 I;  3DZL A;  3BU4 A;  1TFO A;  3DGY A;  3MG3 A;  3LH4 A;  1DYU A;  1TUH A;  4FCZ A;  3IPT A;  4GL6 A;  3HIG A;  1UUW B;  4XBT A;  5AIF A;  4R1K A;  5BVB A;  1EKM A;  1B20 A;  1GMR A;  2Y74 A;  3GZR A;  2SBL A;  1IQY A;  2BO9 B;  1U5O A;  1HU9 A;  2E2U A;  1QVG 2;  4N6N B;  1RHL A;  2H0H A;  4OK0 A;  4AKY A;  1BNJ A;  4BIR A;  1VQ7 3;  1T5Y A;  1RRH A;  2PNC A;  3D9R A;  1HZ1 A;  2B24 B;  3CU3 A;  3S5C A;  1BAN A;  1FGQ A;  1W2Z A;  1AVL A;  1JKG B;  2CH9 A;  1RN4 A;  1RSN A;  3B8L A;  4JF8 A;  4IPB A;  1RKY A;  4HM3 B;  1F8N A;  4HM6 B;  1VQM 3;  2BHM A;  2YFI B;  1Z1S A;  1PFP A;  8CHO A;  1JNQ A;  2YFL B;  5DRE A;  3NBJ A;  4HM4 B;  3CC7 3;  2QIY A;  3EBY A;  3QK9 A;  1W2B 2;  4HBR A;  3X42 A;  1DE3 A;  2Z7A A;  2CWT A;  3PXM A;  4BL3 A;  3MSO A;  2A15 A;  1BRJ A;  4N6L A;  4RBN A;  1YGW A;  5M18 A;  3EQQ B;  1TFK A;  3EC9 A;  3PGB A;  3CCV 3;  3MPH A;  1M9G A;  2RSX A;  3EN8 A;  4EXR A;  3EF8 A;  2XEP A;  3WA3 A;  1RGA A;  3D5G A;  3MKI A;  3OX9 A;  1LOV A;  3EHC A;  5D83 A;  2Z77 A;  1RTU A;  1VQ5 3;  3D4A A;  3DUK A;  2BNG A;  1UI8 A;  3MG2 A;  2AAE A;  5M19 A;  4HVN A;  4MMZ B;  1EQK A;  3V98 A;  3Q1C A;  2F99 A;  2C10 A;  3NUV A;  1TJD A;  3LT8 A;  3LTA A;  1ZX2 A;  1DMM A;  1LQM B;  4EV5 A;  4OVM A;  1UCJ A;  4L8O A;  1BNR A;  2XSH B;  3H3H A;  4EW5 A;  1MWT A;  2F5M A;  1DVD A;  3X41 A;  2GSP A;  3DGN A;  1O7N B;  1WMO A;  3LML A;  3DH2 A;  3UJM A;  1E3V A;  1LQG C;  2GU1 A;  1I2G A;  1YJN 3;  3JUP A;  4GSP A;  3DY5 A;  3FG1 A;  4FMC A;  1FA3 A;  2H0G A;  3DGO A;  1X1U A;  2KF3 A;  1O7H B;  1W00 A;  3PYJ A;  3BNE A;  1VQ6 3;  2OQE C;  1LXE A;  2CHC A;  3F9S A;  4CJN A;  4XBY A;  3AGO A;  1JB2 A;  1Y4K A;  4L8P A;  3NHX A;  5CF2 A;  3WHO A;  2O3O A;  4BTW A;  1VQ4 3;  3I55 3;  1PU4 A;  3UL5 A;  4EBG A;  2GEY A;  5IG0 A;  3D79 A;  2CWU A;  3N9H A;  1Q42 A;  2XH9 A;  4KVH A;  4BTY A;  3DGM A;  3CCQ 3;  5AYS C;  3GRD A;  1MWS A;  1T2H A;  4CDL A;  1QJG A;  4MJD A;  3UB1 A;  1RGG A;  1UCI A;  1AY7 A;  1NO3 A;  4HM7 B;  4R4K A;  5AEW B;  3NV0 A;  2BIR A;  1YVB I;  1O7P B;  4IT7 A;  1GOU A;  1W4N A;  1VQQ A;  2WOH A;  3KN4 A;  4KT3 B;  2OTL 3;  4N6U A;  4NPB A;  4AEQ A;  1TIJ A;  3PS8 A;  2INX A;  1KSI A;  1IVU A;  9RNT A;  4AKZ A;  4HKV B;  6GSP A;  3KII A;  3G16 A;  2CG1 A;  5I97 A;  1DMQ A;  5KP1 A;  1VQO 3;  4XB5 A;  1CEW I;  1FUT A;  1K28 A;  2LQV A;  4HZ9 B;  2LYX A;  4O8S A;  4TX4 A;  3EX9 A;  3OXA A;  3I56 3;  1O7G B;  3FF2 A;  1W6C A;  4R80 A;  4N6M A;  3VSY A;  1YHQ 3;  3HII A;  1FGM A;  1JB4 A;  5BU4 A;  3GZB A;  1MWR A;  3G6E 3;  4O02 B;  3CC2 3;  1KC8 4;  3BNC A;  1A67 A;  4GB5 A;  1I2F A;  1N5H A;  4N6V 0;  3U1W A;  1OF5 A;  3S67 A;  2W2C A;  2W04 A;  4XBX A;  5LC7 A;  2RFR A;  4L7K A;  2MC8 A;  3D5I A;  3CD6 3;  3KSE D;  1BRS A;  1WMP A;  1YVS A;  1IQ8 A;  3OV4 A;  3F14 A;  1M90 4;  4X2O A;  3ZG0 A;  5IG4 A;  4KFF A;  1BRK A;  5D82 A;  3GZX B;  2ZA4 A;  5KP3 A;  1K8A 4;  1BNE A;  1IVW A;  1BNI A;  1NWW A;  1SJW A;  1K9M 4;  5FGO A;  3G8Z A;  2WO0 A;  2XGN A;  3BLZ A;  1GYB A;  3SED A;  3Q3F A;  3BB9 A;  1NB3 I;  5CLK A;  5AEU B;  4H61 A;  2CFW A;  1HKX A;  3WDG B;  1TTO A;  2P09 A;  1LVN A;  4KZ1 A;  3JVC A;  5EEO A;  3LZA A;  1BSE A;  1RCL A;  4HM8 B;  2F5W A;  3CCE 3;  3MWZ A;  1YI2 3;  2KF4 A;  3WOF B;  2WOF A;  1OF5 B;  3DM8 A;  1ASK A;  3ALA A;  2E2T A;  5IER A;  3ECF A; 
#chains in the Genus database with same CATH homology
 1YGE A;  1E97 A;  3T8U A;  2CG0 A;  3CCR 3;  4ORL A;  2M7O A;  3MYT A;  3SVA A;  1DMN A;  2OTJ 3;  2P0X A;  4HM2 B;  1D6Y A;  4K90 B;  1GS3 A;  1R4C A;  3RDE A;  1YJW 3;  1M1K 4;  3FG4 A;  4N6T A;  3VGN A;  1V74 A;  3LT9 A;  1CYU A;  3FSD A;  2OOV C;  3K0Z A;  1IT7 A;  1JN5 B;  1OH0 A;  5JPU A;  1IT8 A;  1Q82 4;  1W01 A;  1D6U A;  3STD A;  1Q86 4;  3S27 A;  3UL6 A;  1FGR A;  4QWT A;  3A76 A;  1JRQ A;  1KQS 2;  1M1X B;  1N9J A;  2W56 B;  2XR8 B;  3JUN A;  2HMO B;  3SOY A;  1QAL A;  5IW9 A;  1MNL A;  3L0R A;  3HX8 A;  2QGU A;  3IJE B;  4R9K A;  4U13 A;  2GU3 A;  3X3Y A;  2P05 A;  3SXX A;  3M8C A;  4K1V A;  1ZO2 A;  2XRX B;  2GXF A;  1NU3 A;  2FGT A;  4N3V A;  1OPY A;  1OGX A;  2Z6B A;  3CME 3;  1SQW A;  3WOD G;  1FUW A;  1IDP A;  1TU5 A;  5JBS A;  3KKG A;  5A0O B;  5TGN A;  1UW1 A;  4O2H A;  4STD A;  2D42 A;  1DVC A;  2KXG A;  3JUQ A;  1IV9 A;  4R9L A;  1RJO A;  3FLJ A;  2CC3 A;  4RNY A;  3KFQ C;  4FMB A;  3NXJ A;  3FKA A;  1Q81 4;  4BTX A;  1W6G A;  3BNB A;  3JUO A;  3LXU X;  2GBX B;  5IG5 A;  5JPP A;  1QVF 2;  2B1X B;  1GD4 A;  1O7W B;  1STD A;  2IMJ A;  3F7X A;  1U8C B;  1ULJ B;  1IVV A;  3KE7 A;  1N8R 4;  1CQS A;  2IA7 A;  2MF7 A;  3G4S 3;  3AMO A;  1US1 A;  3FGY A;  3RGA A;  2OOV A;  3EB8 A;  2BMQ B;  2W03 A;  3FF0 A;  5KP4 A;  3PCS A;  2YFJ B;  5ELJ A;  1WTH A;  1S72 3;  7STD A;  1FGT A;  2P38 A;  2FXT A;  2D1W A;  2UX0 A;  3K63 A;  1QMA A;  1KWI A;  4WHA A;  2XGL A;  2RGQ A;  3SLU A;  4CCV A;  3FG3 A;  5ELU A;  1NJI 4;  1N8Q A;  4MMY B;  2P0M A;  1SIH A;  2HMN B;  1C7H A;  3X40 A;  4EV2 A;  3G0K A;  5AII A;  2HMK B;  3WA2 X;  6STD A;  3KZT A;  4NRE A;  2BMR B;  1VQK 3;  1ROV A;  2OCT A;  3CPW 2;  1IVX A;  1ISK A;  1S5A A;  2E2V A;  2XFT A;  1W7C A;  1JN5 A;  3LTC A;  3SOA A;  3ER7 A;  4FCM A;  3Q90 A;  2W6J H;  4O3V A;  1VQ8 3;  4PEJ A;  1MOL A;  1A2K A;  2CFL A;  4J8T A;  2I9W A;  4K1U A;  4XM4 A;  1L5G B;  3S28 A;  3CCM 3;  3B4P A;  4EYC A;  1RRL A;  2ML5 A;  4LSO A;  4KFE A;  2KRT A;  3H51 A;  3JUM A;  4HYZ A;  4RNZ A;  4OUQ A;  4FCJ A;  3B7C A;  4H3U A;  3X3Z A;  1NDO B;  1OUN A;  2CWV A;  1GY7 A;  1O7M B;  4XDW A;  4IIA A;  3CC4 3;  1OHS A;  1VQL 3;  3HK4 A;  3ROB A;  1TP6 A;  1E3R A;  2WGO A;  3K9M C;  5AIG A;  1OCV A;  2GEX A;  4NHF A;  3GWR A;  3T0U A;  3J7Y d;  1K9M 4;  3NX0 A;  3NQY A;  1SII A;  2C11 A;  1OAC A;  3NM2 A;  2PZV A;  3CMA 3;  1YJ9 3;  1JJ2 2;  5CK6 A;  1YIT 3;  3O8Y A;  4WYK B;  4K61 A;  1W02 A;  2BMO B;  4KFD A;  5IEO A;  2CFK A;  3T8N A;  3DGL A;  3GZY B;  2GBW B;  3X3X A;  4MEI A;  1LOX A;  3LOY A;  4G1M B;  1VQ9 3;  2KCD A;  4RZM A;  2HML B;  2YX9 A;  2ZDJ A;  1AVK A;  1Q40 B;  4FMD A;  4N6O B;  5EQL A;  3VF1 A;  3WOE B;  1Q7Y 4;  5BXQ A;  3I0Y A;  1AV4 A;  2W9P A;  1K41 A;  2Q07 A;  2CK3 H;  1OGZ A;  2WGQ A;  3CXC 2;  3PZW A;  3EBT A;  1EG9 B;  4ZM8 A;  2OQE A;  2BT3 A;  2XSO B;  3OW2 2;  5HGR A;  3BND A;  3NBR A;  1CYV A;  3NQZ A;  2K54 A;  3E99 A;  2F98 A;  5D81 A;  1UI7 A;  4HJL B;  1ROA A;  2ZL8 A;  1W5Z A;  3F40 A;  1JB5 A;  5AI1 A;  2IUK A;  3CNX A;  3CCL 3;  3K5T A;  5STD A;  4FMA A;  1VQP 3;  1K73 4;  3S29 A;  3EE1 A;  2O9U X;  4WP5 A;  2CIU A;  4LEH A;  1SPU A;  3D3L A;  3PCR A;  3V92 A;  3OWY A;  4LMI A;  1IK3 A;  2Y73 A;  1GY6 A;  4WYK A;  2K0M A;  1OHO A;  2W9Q A;  5FW5 A;  4X2H A;  1BUQ A;  1RN7 A;  3OWU A;  2W56 A;  4I4K A;  2JDI H;  4HM1 B;  5CF1 A;  1UUV B;  2CFD A;  1G96 A;  3NM7 A;  4WFO A;  2HMJ B;  2XFS A;  4XDV A;  3TDG A;  1A90 A;  2IUJ A;  3Q2P A;  2QA4 3;  1N5P A;  1STF I;  3DMC A;  3N8B A;  2CFG A;  1W6Y A;  3IMA B;  4FR9 A;  2W0Q A;  1JV2 B;  3RGR A;  5IG3 A;  4HM5 B;  1VZZ A;  2RCD A;  3HZP A;  1VQN 3;  3WMD A;  1J2B A;  1WNH A;  1GY5 A;  3EJV A;  3G71 3;  3V99 A;  3CCU 3;  5IEP A;  3CNM A;  1IU7 A;  3UNL A;  3FZW A;  3QRD A;  3DXO A;  3FCS B;  2CW9 A;  2Z76 A;  1WQL B;  5EVH A;  1Q40 A;  4J9A A;  5LC6 A;  3EN1 B;  1IV7 A;  3SX1 A;  3LTB A;  1ULI B;  4MMX B;  3F8H A;  5DRV A;  1N9E A;  1AR0 A;  1YIJ 3;  1FGO A;  1WMN A;  2OWP A;  3NV0 B;  3NBB A;  3F7S A;  3N54 B;  1KD1 4;  2QEX 3;  3GAX A;  5AYR B;  2CKF B;  4WWU C;  3KSP A;  5IEN A;  2XF3 A;  4EC6 A;  5AIH A;  1QAK A;  3F8X A;  3MHE A;  4Q53 A;  1IQX A;  1A2V A;  1JKG A;  1QAF A;  1OHP A;  1D6Z A;  3CCS 3;  4LGQ A;  4LZI A;  2FNQ A;  5G2G A;  2ML6 A;  1GD3 A;  3LYG A;  4HM0 B;  3LTD A;  3CPO A;  4JRF A;  3CCJ 3;  2STD A;  5IF6 A;  2R4I A;  3FH1 A;  2HMM B;  3AMO B;  3HI7 A;  4HZB B;  2F86 B;  2V1L A;  1EA2 A;  3B4O A;  1LNH A;  3MG1 A;  2L4V A;  3OWS A;  2JQ5 A;  5CXO A;  3U97 A;  3K7C A;  1NB5 I;  3DZL A;  1TFO A;  3MG3 A;  3LH4 A;  1DYU A;  1TUH A;  4FCZ A;  3IPT A;  4GL6 A;  3HIG A;  1UUW B;  4XBT A;  5AIF A;  4R1K A;  5BVB A;  1EKM A;  3GZR A;  2Y74 A;  2SBL A;  1IQY A;  2BO9 B;  1U5O A;  1HU9 A;  2E2U A;  1QVG 2;  4N6N B;  4OK0 A;  4AKY A;  1VQ7 3;  1T5Y A;  1RRH A;  2PNC A;  3D9R A;  2B24 B;  3CU3 A;  3S5C A;  1FGQ A;  1W2Z A;  1AVL A;  1JKG B;  2CH9 A;  3B8L A;  4JF8 A;  4IPB A;  1RKY A;  4HM3 B;  1F8N A;  4HM6 B;  1VQM 3;  2BHM A;  2YFI B;  1Z1S A;  1PFP A;  8CHO A;  1JNQ A;  2YFL B;  5DRE A;  3NBJ A;  4HM4 B;  3CC7 3;  2QIY A;  3EBY A;  3QK9 A;  1W2B 2;  4HBR A;  3X42 A;  2Z7A A;  2CWT A;  3PXM A;  3MSO A;  2A15 A;  4N6L A;  4RBN A;  3EQQ B;  1TFK A;  3EC9 A;  3PGB A;  3CCV 3;  3MPH A;  1M9G A;  2RSX A;  3EN8 A;  4EXR A;  3EF8 A;  2XEP A;  3WA3 A;  3OX9 A;  3MKI A;  3EHC A;  5D83 A;  2Z77 A;  1VQ5 3;  3DUK A;  2BNG A;  1UI8 A;  3MG2 A;  4HVN A;  4MMZ B;  1EQK A;  3V98 A;  3Q1C A;  2F99 A;  2C10 A;  3NUV A;  3LT8 A;  3LTA A;  1ZX2 A;  1DMM A;  4EV5 A;  4OVM A;  4L8O A;  2XSH B;  3H3H A;  1DVD A;  3X41 A;  3DGN A;  1O7N B;  1WMO A;  3LML A;  3UJM A;  1E3V A;  2GU1 A;  1YJN 3;  3JUP A;  3DY5 A;  3FG1 A;  4FMC A;  1FA3 A;  3DGO A;  3PYJ A;  1O7H B;  1W00 A;  3BNE A;  1VQ6 3;  2OQE C;  1LXE A;  2CHC A;  3F9S A;  4XBY A;  1JB2 A;  1Y4K A;  4L8P A;  3NHX A;  5CF2 A;  1VQ4 3;  2O3O A;  4BTW A;  3I55 3;  1PU4 A;  3UL5 A;  4EBG A;  2GEY A;  5IG0 A;  3N9H A;  2CWU A;  1Q42 A;  2XH9 A;  4KVH A;  4BTY A;  3DGM A;  3CCQ 3;  5AYS C;  3GRD A;  4CDL A;  1QJG A;  4MJD A;  3UB1 A;  4R4K A;  1NO3 A;  4HM7 B;  5AEW B;  3NV0 A;  1YVB I;  1O7P B;  4IT7 A;  1W4N A;  2WOH A;  3KN4 A;  2OTL 3;  4N6U A;  4AEQ A;  1TIJ A;  3PS8 A;  2INX A;  1KSI A;  1IVU A;  4AKZ A;  4HKV B;  3KII A;  3G16 A;  2CG1 A;  5I97 A;  1DMQ A;  5KP1 A;  1VQO 3;  4XB5 A;  1CEW I;  1K28 A;  2LQV A;  4HZ9 B;  2LYX A;  4O8S A;  4TX4 A;  3EX9 A;  3OXA A;  3I56 3;  1O7G B;  3FF2 A;  1W6C A;  4R80 A;  4N6M A;  3VSY A;  1YHQ 3;  3HII A;  1FGM A;  1JB4 A;  3GZB A;  3G6E 3;  4O02 B;  3CC2 3;  1KC8 4;  3BNC A;  1A67 A;  4GB5 A;  1N5H A;  4N6V 0;  3U1W A;  1OF5 A;  3S67 A;  2W2C A;  2W04 A;  4XBX A;  5LC7 A;  2RFR A;  4L7K A;  2MC8 A;  3CD6 3;  3KSE D;  1WMP A;  1IQ8 A;  3OV4 A;  3F14 A;  1M90 4;  4X2O A;  5IG4 A;  4KFF A;  5D82 A;  3GZX B;  1K8A 4;  5KP3 A;  1IVW A;  1NWW A;  1SJW A;  5FGO A;  3G8Z A;  2WO0 A;  2XGN A;  3BLZ A;  1GYB A;  3SED A;  3BB9 A;  1NB3 I;  5CLK A;  5AEU B;  4H61 A;  2CFW A;  1HKX A;  3WDG B;  2P09 A;  1LVN A;  4KZ1 A;  3JVC A;  5EEO A;  3LZA A;  4HM8 B;  3CCE 3;  1YI2 3;  3MWZ A;  3WOF B;  2WOF A;  1OF5 B;  3DM8 A;  1ASK A;  3ALA A;  2E2T A;  5IER A;  3ECF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...