1O7MB

Naphthalene 1,2-dioxygenase, binary complex with dioxygen
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Naphthalene Dioxygenase: Side-on Binding of Dioxygen to Iron
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
total genus 52
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1o7mB00
5KP4A 3OWYA 1JB4A 1NWWA 2HMLB 4U13A 2BNGA 1NU3A 1SJWA 1ZX2A 3CNXA 3EX9A 3OV4A 3F8XA 4OUQA 3K7CA 3F40A 4HM1B 1OHSA 1GY6A 2F99A 3B4PA 5AEUB 4WP5A 5IG3A 4R9KA 5D83A 1GS3A 3ROBA 3UJMA 4XBTA 5AIIA 3B4OA 7STDA 2YFIB 4MJDA 4X2OA 4XBXA 1UUWB 4GB5A 4L7KA 4WYKA 1EG9B 4HM2B 1S5AA 1ULJB 3E99A 4XDWA 4HKVB 4L8PA 1JB2A 3F7XA 2BMRB 5AIGA 3JUOA 1O7PB 1W6YA 4KVHA 3G8ZA 1OF5A 1DMQA 5AEWB 5IG5A 3JUQA 1O7HB 1OCVA 3MKIA 6STDA 3MG1A 5BVBA 1HKXA 3KKGA 4H3UA 5AIHA 3ER7A 3VGNA 4FCMA 2GEXA 5IERA 3GZXB 5CXOA 3DM8A 3DMCA 3KSPA 1OPYA 3B8LA 4XBYA 4RZMA 5IG0A 3SEDA 1O7GB 2B1XB 2Z77A 4N3VA 1Z1SA 4HVNA 3VSYA 3EHCA 3B7CA 5DREA 5CF1A 4STDA 3G0KA 3GZYB 4HM6B 2HMMB 1A2KA 2XSHB 1K41A 2HMOB 2YFJB 3EJVA 3EN8A 3HX8A 4HM0B 2A15A 3HZPA 3FF2A 4HM4B 1JB5A 1W00A 1TP6A 3EC9A 3KE7A 4HM7B 3FLJA 3GZRA 3NXJA 3K0ZA 1OUNA 3BB9A 4K1UA 4LMIA 1ZO2A 2PZVA 5IEOA 2STDA 3FZWA 3GZBA 1TUHA 3JUNA 4PEJA 5IG4A 3JUMA 4Q53A 5CF2A 1JN5B 8CHOA 3F9SA 2GEYA 4LGQA 4OVMA 4WYKB 5JPUA 1Q40A 1W02A 2HMNB 1AR0A 3F8HA 5KP3A 3T8NA 1CQSA 3LZAA 2F86B 2CKFB 3OWSA 4LEHA 2Z76A 3EQQB 2IMJA 1EA2A 1GYBA 2GBXB 3EF8A 1IDPA 1O7NB 2RCDA 3NV0A 1QMAA 4HM8B 4WWUC 3SOYA 1OGZA 3HK4A 4HZBB 1JKGA 4HZ9B 5AIFA 5IEPA 2QGUA 1U5OA 2HMKB 3STDA 1QJGA 1ISKA 1WQLB 1E3VA 1Q42A 2R4IA 1VZZA 5DRVA 4XB5A 3RGRA 4J8TA 3FKAA 3NUVA 1C7HA 2Z7AA 3IPTA 4R1KA 1UUVB 2XRXB 4IIAA 5CK6A 4XDVA 5BXQA 3FSDA 5EVHA 3F7SA 1OH0A 1BUQA 2B24B 2I9WA 4R9LA 3FF0A 5CLKA 5FW5A 3T8UA 4CDLA 3H51A 4L8OA 4HJLB 1GY7A 3I0YA 3OWUA 2OWPA 4I4KA 1OHPA 2GXFA 3WMDA 2HMJB 5TGNA 2GBWB 5IENA 3BLZA 2QIYA 3OX9A 3DXOA 1DMNA 5JPPA 2JQ5A 3NHXA 1W01A 2K54A 2RGQA 3H3HA 3OXAA 1OF5B 3S5CA 3A76A 1Q40B 3FGYA 1GY5A 3LYGA 3M8CA 3RGAA 2F98A 3F14A 3ECFA 3NM2A 4HM5B 4HM3B 1NDOB 3G16A 4K1VA 3DZLA 2RFRA 3EBTA 3EN1B 1E3RA 3KZTA 1STDA 3MG2A 2XR8B 3MSOA 3NBRA 5D82A 1JN5A 5G2GA 5D81A 3JUPA 3CNMA 5KP1A 3Q90A 4J9AA 1E97A 3CPOA 3EBYA 3FH1A 1OGXA 1O7WB 3DUKA 3MG3A 3MHEA 3MYTA 2W2CA 2CHCA 4FCJA 5STDA 3D9RA 2YFLB 3GWRA 1OHOA 1DMMA 4ORLA 3UNLA 2BMOB 3GRDA 2UX0A 5HGRA 2INXA 3SOAA 2XSOB 5AI1A 5IF6A 3NV0B 1ULIB 3CU3A 1ASKA 2BMQB 4X2HA 4XM4A 1JKGB 1O7MB
chains in the Genus database with same CATH superfamily
1SARA 3OWYA 1JB4A 1NWWA 1RNBA 1S723 3U1WA 3S27A 3WDGB 3X3YA 3OV4A 2D42A 3FG3A 2C4BA 2L1SA 1UDII 3B4PA 1B2XA 1UCIA 3QK9A 2KAAA 4RNYA 5D83A 3KSED 1GS3A 3KIIA 3UJMA 7STDA 3CCE3 5JBSA 1IQ8A 1EG9B 4HM2B 3UL5A 1I3IA 3E99A 1LRAA 3NQZA 4XDWA 1W6GA 1W2B2 3NM7A 3F7XA 1FUSA 3Q2PA 3X40A 2C11A 3DH2A 3DGNA 3DY5A 1O7PB 1J2BA 2ZHXB 2OOVA 1W6YA 4KVHA 1W4NA 3G8ZA 1B3SA 5M19A 1IV7A 4BTYA 1IT8A 5AEWB 1HYFA 1WMPA 1STFI 1LNIA 3ZFZA 1LQMB 4HYZA 2GEXA 3HI7A 3GZXB 4NPBA 1LOWA 3DMCA 1RRLA 3AGOA 1YNVX 1TFKA 3AHSA 1FGRA 1RGCA 1UCKA 3J7Yd 4N3VA 2BU4A 4HVNA 1Q7Y4 3PCRA 1VQ93 3NX0A 2GU3A 1G02A 3B7CA 1V74A 4HM6B 3AHWA 1GOVA 4J9AA 3HX8A 2A15A 1BUQA 5IEPA 1W00A 4X2HA 2R41A 4HM7B 1YJW3 3GZRA 3K0ZA 4LMIA 2KXGA 2PZVA 4JRFA 2STDA 3CCQ3 3N9HA 8RNTA 1JN5B 3Q1CA 8CHOA 2OTJ3 2GEYA 4OVMA 1FUTA 3LH4A 2CWVA 1W02A 3F8HA 1AR0A 3Q3FA 3BNDA 4ILFA 4RNZA 4QWTA 3LZAA 5KP3A 3T8NA 4CJNA 1Q7HA 5I97A 3G6E3 2Z76A 3EQQB 3LT8A 1PY3A 1GYBA 3EF8A 3SOYA 1O7NB 1UCJA 4KFFA 3HK4A 3PYJA 4O02B 3CD63 1VQ53 2QGUA 2ML6A 1QJGA 1IQXA 1GMPA 1T2HA 5ELJA 2H0GA 1V58A 1VZZA 1IVUA 1GOYA 2PNCA 1RKYA 4R1KA 4IIAA 2H0IA 3ZG5A 4XDVA 1IU7A 5BXQA 1OH0A 1N9JA 1BRIA 1JZOA 2I9WA 3N8BA 2RBIA 4TX4A 1U8CB 3HOHA 1BSCA 3I0YA 2OWPA 1W2ZA 1GSPA 1YVSA 1OHPA 2GXFA 3WMDA 3LOYA 3LT9A 1RN7A 4HBRA 2JQ5A 1W01A 1SIIA 3H3HA 2WO0A 3UB1A 4IT7A 1OF5B 3CCM3 1QVF2 1BANA 1PYLA 3PCSA 2CFKA 2F98A 1UI7A 3F14A 4K1VA 1NDOB 3G16A 5BU4A 1YHQ3 1TFOA 1IV9A 5G2GA 2XR8B 1GMRA 3SXXA 1BNGA 3FH1A 1MWTA 3DUKA 3MG3A 2UUGC 1WTHA 2Y74A 1CYVA 2GSPA 4I5QA 3SYUA 4LZIA 5STDA 3GWRA 1B2ZA 1OHOA 1RN1A 1JV2B 1RDSA 3SOAA 1WNHA 3V98A 1K8A4 3CU3A 1TRQA 2IY2A 1UI8A 4MEIA 2BO9B 1CYUA 1GD3A 1NNVA 2W04A 2LYXA 1MWSA 2E2TA 2CK3H 1R4CA 3N54B 4NREA 4U13A 1ZX2A 3CNXA 3T0UA 2OQEA 3LTAA 3F8XA 6RNTA 3F40A 1UCLA 3G4S3 4KT3B 5AEUB 4WP5A 4FMAA 5EEOA 3ROBA 3CC43 5AIIA 3B4OA 4EXRA 4XBXA 4X2OA 1AQZA 4WHAA 1IVXA 1FGTA 2KCDA 1X1WA 2CWTA 4HKVB 1JB2A 3CCV3 1I8VA 1A2VA 1D6YA 1LOXA 5AYSC 1K734 1YGWA 4LSOA 1DMQA 4H61A 4CCVA 1OCVA 2GU1A 1LOVA 3MKIA 2UGIA 2W9QA 4J5KA 3KKGA 1YIJ3 3KCHA 3ER7A 5M18A 3WA3A 1Q824 1LNHA 4NHFA 1FZUA 1OPYA 4RZMA 1VQN3 1T5YA 1NB3I 2Z77A 1RMSA 5RNTA 1KC84 3D4AA 1HU9A 2CC3A 2HMMB 2YFJB 2MC8A 3CCR3 3WR2A 1BRNL 3HZPA 1TP6A 2KF6A 4K1UA 1JBTA 3NQYA 1N5PA 1B20A 1OUNA 1RGKA 1ZO2A 3FZWA 1B27A 3D3LA 1B21A 3JUMA 2LQVA 3URPA 5CF2A 1N5HA 2CW9A 4RBNA 3CME3 2WGOA 1W5ZA 1B2MA 4LGQA 1CEWI 1UGIA 1TU5A 1BRHA 1N8R4 1CQSA 3OWSA 3BU4A 1UUGB 5EQLA 2GBXB 1UW1A 2P09A 2ZA4A 4KFEA 1BVIA 1BU4A 4OK0A 2F56A 3K5TA 1JKGA 1EQKA 4N6UA 1U5OA 3OW22 1ISKA 2F5WA 1Q42A 2O9UX 1RGLA 1B2UA 2R4IA 3X41A 3FKAA 3IPTA 1A90A 1UUVB 1UGHI 1FW7A 2B24B 3FF0A 3T8UA 4CDLA 1AY7A 2F5MA 5FGOA 1ROVA 2XFSA 4EV5A 4BTWA 5LC7A 2GBWB 3OX9A 3RDEA 5ELUA 1BRKA 2KF5A 4BL3A 5JPPA 3NHXA 1M904 1G0TA 2J8XB 3U97A 3AMOB 2CX1A 3TDGA 2AAEA 3A76A 3IMAB 4N6V0 1GY5A 4HM3B 3NM2A 2ZL8A 4BIRA 3GSPA 3KZTA 2MF7A 1STDA 3SX1A 5D81A 3AGNA 3JUPA 2RSXA 3EB8A 3EBYA 2Z6BA 3MHEA 1BNIA 3MYTA 2W2CA 1VQ83 6GSPA 3ZG0A 2YFLB 2W9PA 1DMMA 1YGEA 2BMOB 2P0MA 4N6MA 2KRTA 1SIHA 2OOVC 2XSOB 1TIJA 4GHOA 1X1YA 4LYLB 1VQ73 1A2PA 1ASKA 2BMQB 1K9M4 1FA3A 3KFQC 1BUJA 1JKGB 1O7MB 3BB9A 2H0HA 1GOUA 2ZDJA 3CCJ3 2QA43 1YIT3 1B2SA 2HMLB 3BNEA 1AVKA 2F4YA 2P05A 1NU3A 1BSDA 1BNFA 3EX9A 1VQL3 1VQ63 2L4VA 4OUQA 3K7CA 1YJN3 4ZM8A 1TTOA 1QVG2 1MGRA 3ALAA 1RGHA 5IG3A 4XBTA 2W03A 1M1K4 4N6OB 1CH0A 1VQP3 1S5AA 1ULJB 4L8PA 1N9EA 2XEPA 2BMRB 4FMCA 1RJOA 3K9MC 3DGLA 1IVVA 1OF5A 2YX9A 2XFTA 1DVDA 3BIRA 1O7HB 2CH9A 3WOEB 1M9GA 1X1UA 2CIUA 3KN4A 3VGNA 4HAAA 1IK3A 3DM8A 3KSPA 3B8LA 4XBYA 1Z1SA 1VQM3 2OTL3 2BIRA 4EC6A 1RGEA 1PU4A 1VQ43 1JBSA 3GZYB 1L5GB 1JNQA 2XSHB 4HM0B 1VQQA 4G1MB 3AMOA 1BNEA 1KWIA 1RGAA 1SQWA 1FGQA 3FF2A 3NBBA 5HGRA 1BSBA 2W56A 1KSIA 5IEOA 3NXJA 2Q07A 3VSYA 3HIIA 1JJ22 3CCS3 3GZBA 3JUNA 4FR9A 4PEJA 3CCL3 1RHLA 1QAFA 2CWUA 3F9SA 5JPUA 2HMNB 1I0XA 5GSPA 2F86B 2CKFB 3JVCA 4FMBA 1W6CA 1W7CA 2M7OA 1IT7A 1JZDA 3GAXA 4LEHA 1EA2A 1VQO3 3NV0A 1IDPA 2RCDA 1QMAA 3PGBA 3G713 2Y73A 1OGZA 4HZ9B 2HMKB 1I3FA 1Q864 4XB5A 4O8SA 1MGWA 4J8TA 2WOFA 2V1LA 3NUVA 1WMOA 2Z7AA 5CK6A 3DGYA 1AVLA 2FNQA 1F8NA 3F7SA 5EVHA 2CG1A 3V99A 1C54A 5FW5A 2E2VA 1MWRA 1KQS2 1Y4KA 5AYRB 1BOXA 4HJLB 1Q814 2WOHA 1ZGXA 4MMZB 4EBGA 3LTDA 3LXUX 5IENA 1BRJA 3BNBA 3L0RA 3DXOA 1DMNA 4BL2A 2W0QA 1JBRA 2K54A 3FG1A 3LTCA 3D5GA 3OXAA 2CX0A 3S5CA 3I553 5G1KA 2IUJA 3FGYA 1NO3A 3LYGA 3M8CA 4RNTA 3RGAA 3S67A 3CC73 3ECFA 4HM5B 2RFRA 1RRHA 3EBTA 1E3RA 3EN1B 3MG2A 2O3OA 4N6LA 1JN5A 1LOYA 1M1XB 5KP1A 3CNMA 4BU4A 4FMDA 1E97A 3CPOA 1EUIC 1FUWA 4K90B 2CG0A 1FYSA 1WMNA 1RCKA 3DGOA 3D9RA 3PZWA 1D6ZA 3PXMA 3UNLA 4EW5A 4AKYA 1LXEA 2INXA 1NB5I 1ZS7A 5AI1A 4GL6A 4MMXB 1T3BA 3NV0B 1ULIB 4GSPA 5IF6A 1HZ1A 1FGMA 1Q9EA 4FCZA 1PFPA 1BRGA 3EE1A 4J5GA 3X42A 5KP4A 1RLSA 2BHMA 2W6JH 2BNGA 1SJWA 1BNJA 9RNTA 2BT3A 1QALA 4R80A 1GD4A 1MWUA 4HM1B 4O3VA 1OHSA 1GY6A 1FGOA 2F99A 1K28A 2K0MA 3MPHA 1MNLA 2FGTA 1RGGA 3O8YA 3S29A 1GMQA 2OQEC 1RN4A 1MOLA 1X1XA 2YFIB 2XGNA 3K63A 1UUWB 4GB5A 4L7KA 4MJDA 4WYKA 2SARA 2C10A 1BSAA 2IYJA 2P38A 2E2UA 3LMLA 3JUOA 1I2FA 5AIGA 2D1WA 1T2IA 1BGSA 4WFOA 1BSEA 5IG5A 3JUQA 3I563 6STDA 4AKZA 3MG1A 5BVBA 1HKXA 4H3UA 1A67A 5AIHA 1EKMA 3FG4A 4EV2A 4FCMA 5IERA 5A0OB 5CXOA 1DVCA 1RSNA 2P0XA 5IG0A 3SEDA 1O7GB 1RGFA 2B1XB 3X3XA 1IVWA 1BNSA 3EHCA 5DREA 4BTXA 5CF1A 4STDA 3G0KA 2CFWA 3CCU3 1A2KA 1K41A 2HMOB 2KF4A 3EJVA 3EN8A 4R9KA 1BRSA 3VF1A 3UL6A 2HOHA 4HM4B 1JB5A 1JRQA 3EC9A 3KE7A 3BNCA 3WOFB 3DGMA 3FLJA 1VQK3 3CMA3 2OCTA 3D79A 3PS8A 5IG4A 1TUHA 2IA7A 4N6NB 2QEX3 1LVNA 4Q53A 4AEQA 1LQGC 1KD14 1IYYA 1I70A 1R4YA 1US1A 3WA2X 2IUKA 4WYKB 3MWZA 4CPKA 1Q40A 1AV4A 4HOHA 7RNTA 3FCSB 2CFGA 2ML5A 1YI23 3NBJA 1RTUA 1NJI4 2XH9A 5HOHA 2IMJA 3HIGA 1DETA 4HM8B 4WWUC 1YJ93 5IW9A 1G96A 1V57A 4HZBB 5AIFA 1N8QA 4KFDA 2SBLA 4N6TA 4KZ1A 3STDA 1I0VA 1WQLB 1E3VA 5G1LA 1RNTA 5DRVA 3RGRA 7GSPA 2K3DA 3X3ZA 1I2EA 1OACA 1C7HA 4EYCA 5M1AA 3V92A 3QRDA 2XRXB 3A5EA 3S28A 1YVBI 4O2HA 3FSDA 1D6UA 3CC23 1SPUA 4R9LA 3RNTA 5CLKA 3IJEB 3H51A 1TJDA 4L8OA 3WODG 1BAOA 1GY7A 2XF3A 3OWUA 4I4KA 5LC6A 2HMJB 5TGNA 5BIRA 2RNTA 3BLZA 2QIYA 3CXC2 4JF8A 1BIRA 1I2GA 2RGQA 2AADA 3LTBA 1Q40B 3CPW2 3WHOA 4R4KA 1DE3A 1EEJA 3DZLA 4K61A 3NBRA 2XGLA 3MSOA 1DYUA 5D82A 3D5IA 3Q90A 1TRPA 2CFLA 1OGXA 1O7WB 1IQYA 4DKIA 2CHCA 3SVAA 4FCJA 1BNRA 3SLUA 4MMYB 2FXTA 2JDIH 4ORLA 1QAKA 3GRDA 2UX0A 2WGQA 4XM4A 1ROAA 2W56B 1RCLA 4IPBA 2KF3A 2CFDA
chains in the Genus database with same CATH topology
3OWYA 1JB4A 1NWWA 1S723 3U1WA 3S27A 3WDGB 3X3YA 3OV4A 2D42A 3FG3A 3B4PA 3QK9A 4RNYA 5D83A 3KSED 1GS3A 3KIIA 3UJMA 7STDA 3CCE3 5JBSA 1IQ8A 1EG9B 4HM2B 3UL5A 3E99A 4XDWA 3NQZA 1W6GA 1W2B2 3NM7A 3F7XA 3Q2PA 3X40A 1J2BA 2C11A 3DGNA 3DY5A 1O7PB 2OOVA 1W6YA 4KVHA 1W4NA 3G8ZA 1IV7A 4BTYA 1IT8A 5AEWB 1WMPA 1STFI 4HYZA 2GEXA 3HI7A 3GZXB 3DMCA 1RRLA 1TFKA 1FGRA 3J7Yd 4N3VA 4HVNA 1Q7Y4 3PCRA 1VQ93 3NX0A 2GU3A 3B7CA 1V74A 4HM6B 4J9AA 3HX8A 2A15A 1BUQA 5IEPA 1W00A 4X2HA 4HM7B 1YJW3 3GZRA 3K0ZA 4LMIA 2KXGA 2PZVA 4JRFA 2STDA 3CCQ3 3N9HA 1JN5B 3Q1CA 8CHOA 2OTJ3 2GEYA 4OVMA 3LH4A 2CWVA 1W02A 3F8HA 1AR0A 4RNZA 3BNDA 4QWTA 5KP3A 3T8NA 3LZAA 5I97A 3G6E3 2Z76A 3EQQB 3LT8A 1GYBA 3EF8A 3SOYA 1O7NB 4KFFA 3HK4A 3PYJA 4O02B 3CD63 1VQ53 2QGUA 2ML6A 1QJGA 1IQXA 5ELJA 1VZZA 1IVUA 2PNCA 4R1KA 4IIAA 4XDVA 1IU7A 5BXQA 1OH0A 1N9JA 4TX4A 2I9WA 3N8BA 1U8CB 3I0YA 2OWPA 1W2ZA 1OHPA 2GXFA 3WMDA 3LOYA 3LT9A 1RN7A 4HBRA 2JQ5A 1W01A 1SIIA 3H3HA 2WO0A 3UB1A 4IT7A 1OF5B 3CCM3 1QVF2 3PCSA 2CFKA 2F98A 1UI7A 3F14A 4K1VA 1NDOB 3G16A 1YHQ3 1TFOA 1IV9A 5G2GA 2XR8B 3SXXA 3FH1A 3DUKA 3MG3A 1WTHA 2Y74A 1CYVA 4LZIA 5STDA 3GWRA 1OHOA 1JV2B 3SOAA 1K8A4 1WNHA 3V98A 3CU3A 1CYUA 1UI8A 4MEIA 2BO9B 1GD3A 2W04A 2LYXA 2E2TA 2CK3H 1R4CA 3N54B 4NREA 4U13A 1ZX2A 3CNXA 3T0UA 2OQEA 3LTAA 3F8XA 3F40A 3G4S3 5AEUB 4WP5A 4FMAA 5EEOA 3ROBA 3CC43 5AIIA 3B4OA 4EXRA 4XBXA 4X2OA 4WHAA 1IVXA 1FGTA 2KCDA 2CWTA 4HKVB 1JB2A 3CCV3 1A2VA 1D6YA 1LOXA 5AYSC 1K734 4LSOA 1DMQA 4H61A 4CCVA 1OCVA 2GU1A 3MKIA 1YIJ3 2W9QA 3KKGA 3ER7A 3WA3A 1Q824 1LNHA 4NHFA 1OPYA 4RZMA 1VQN3 1T5YA 1NB3I 2Z77A 1KC84 1HU9A 2CC3A 2HMMB 2YFJB 2MC8A 3CCR3 3HZPA 1TP6A 4K1UA 3NQYA 1N5PA 1OUNA 1ZO2A 3FZWA 3D3LA 3JUMA 2LQVA 5CF2A 1N5HA 2CW9A 4RBNA 3CME3 2WGOA 1W5ZA 4LGQA 1CEWI 1N8R4 1TU5A 1CQSA 3OWSA 5EQLA 2GBXB 1UW1A 2P09A 4KFEA 1EQKA 4OK0A 3K5TA 1JKGA 4N6UA 1U5OA 3OW22 1ISKA 1Q42A 2O9UX 2R4IA 3X41A 3FKAA 3IPTA 1A90A 1UUVB 2B24B 3FF0A 3T8UA 4CDLA 5FGOA 1ROVA 2XFSA 4EV5A 4BTWA 5LC7A 2GBWB 3OX9A 3RDEA 5ELUA 1M904 5JPPA 3NHXA 3U97A 3AMOB 3TDGA 3A76A 3IMAB 4N6V0 1GY5A 4HM3B 3NM2A 2ZL8A 3KZTA 2MF7A 1STDA 3SX1A 5D81A 3JUPA 2RSXA 3EB8A 3EBYA 2Z6BA 3MHEA 3MYTA 2W2CA 1VQ83 2YFLB 2W9PA 1DMMA 1YGEA 2BMOB 2P0MA 4N6MA 2KRTA 1SIHA 2OOVC 2XSOB 1TIJA 1FA3A 1VQ73 1ASKA 2BMQB 1K9M4 3KFQC 1JKGB 3BB9A 1O7MB 2QA43 2ZDJA 1YIT3 3BNEA 2HMLB 1AVKA 2P05A 1NU3A 3EX9A 1VQL3 1VQ63 2L4VA 4OUQA 3K7CA 1YJN3 4ZM8A 1QVG2 3ALAA 5IG3A 4XBTA 2W03A 1M1K4 4N6OB 1VQP3 1S5AA 1ULJB 4L8PA 1N9EA 2XEPA 2BMRB 4FMCA 1RJOA 3K9MC 3DGLA 1IVVA 1OF5A 2YX9A 2XFTA 1DVDA 1O7HB 2CH9A 3WOEB 1M9GA 2CIUA 3KN4A 3VGNA 1IK3A 3DM8A 3KSPA 3B8LA 4XBYA 1Z1SA 1VQM3 2OTL3 4EC6A 1PU4A 1VQ43 3GZYB 1L5GB 1JNQA 2XSHB 4HM0B 4G1MB 3AMOA 1SQWA 1KWIA 3NBBA 3FF2A 1FGQA 5HGRA 2W56A 1KSIA 5IEOA 3NXJA 2Q07A 3VSYA 3HIIA 3CCS3 3GZBA 3JUNA 4FR9A 4PEJA 3CCL3 1QAFA 2CWUA 3F9SA 5JPUA 2HMNB 2F86B 2CKFB 3JVCA 4FMBA 1W6CA 1W7CA 2M7OA 1IT7A 3GAXA 4LEHA 1EA2A 1VQO3 3NV0A 1IDPA 2RCDA 1QMAA 3PGBA 3G713 2Y73A 1OGZA 4HZ9B 2HMKB 1Q864 4XB5A 4O8SA 4J8TA 2WOFA 2V1LA 3NUVA 1WMOA 2Z7AA 5CK6A 1AVLA 2FNQA 1F8NA 3F7SA 5EVHA 2CG1A 3V99A 5FW5A 2E2VA 1KQS2 1Y4KA 5AYRB 4HJLB 1Q814 2WOHA 4MMZB 4EBGA 3LTDA 3LXUX 5IENA 3BNBA 3L0RA 3DXOA 1DMNA 2W0QA 2K54A 3FG1A 3LTCA 3OXAA 3S5CA 3I553 2IUJA 3FGYA 1NO3A 3LYGA 3M8CA 3CC73 3RGAA 3S67A 3ECFA 4HM5B 2RFRA 3EN1B 1RRHA 3EBTA 1E3RA 3MG2A 2O3OA 4N6LA 1JN5A 1M1XB 5KP1A 3CNMA 4FMDA 1E97A 3CPOA 1FUWA 4K90B 2CG0A 1WMNA 3DGOA 3PZWA 3D9RA 1D6ZA 3PXMA 3UNLA 4AKYA 1LXEA 2INXA 1NB5I 1RKYA 5AI1A 4GL6A 4MMXB 5IF6A 3NV0B 1ULIB 1FGMA 4FCZA 1PFPA 3EE1A 3X42A 5KP4A 2BHMA 2W6JH 2BNGA 1SJWA 2BT3A 1QALA 4R80A 1GD4A 4HM1B 4O3VA 1OHSA 1GY6A 1FGOA 2F99A 1K28A 2K0MA 3MPHA 1MNLA 2FGTA 3O8YA 3S29A 2OQEC 1MOLA 2YFIB 4MJDA 2XGNA 3K63A 1UUWB 4GB5A 4L7KA 4WYKA 2C10A 2P38A 2E2UA 3LMLA 3JUOA 5AIGA 2D1WA 4WFOA 5IG5A 3JUQA 3I563 6STDA 4AKZA 3MG1A 5BVBA 1HKXA 4H3UA 1A67A 5AIHA 1EKMA 3FG4A 4EV2A 4FCMA 5IERA 5A0OB 5CXOA 1DVCA 2P0XA 5IG0A 3SEDA 1O7GB 2B1XB 3X3XA 1IVWA 3EHCA 5DREA 4BTXA 5CF1A 4STDA 3G0KA 2CFWA 3CCU3 1A2KA 1K41A 2HMOB 3EJVA 3EN8A 4R9KA 3VF1A 3CCJ3 3UL6A 4HM4B 3WOFB 1JB5A 1JRQA 3EC9A 3KE7A 3BNCA 1VQK3 3DGMA 3FLJA 1JJ22 3CMA3 2OCTA 5IG4A 3PS8A 1TUHA 2IA7A 4N6NB 2QEX3 1LVNA 4Q53A 4AEQA 1KD14 1US1A 3WA2X 2IUKA 4WYKB 3MWZA 1Q40A 1AV4A 3FCSB 2CFGA 2ML5A 1YI23 3NBJA 1NJI4 2XH9A 2IMJA 3HIGA 4HM8B 4WWUC 1YJ93 5IW9A 1G96A 4HZBB 5AIFA 1N8QA 4KFDA 2SBLA 4N6TA 4KZ1A 3STDA 1WQLB 1E3VA 5DRVA 3RGRA 3X3ZA 1OACA 1C7HA 4EYCA 3V92A 3QRDA 2XRXB 3S28A 1YVBI 4O2HA 3FSDA 1D6UA 3CC23 1SPUA 4R9LA 5CLKA 3IJEB 3H51A 4L8OA 3WODG 1GY7A 2XF3A 3OWUA 4I4KA 5LC6A 2HMJB 5TGNA 3BLZA 2QIYA 3CXC2 4JF8A 2RGQA 3LTBA 1Q40B 3CPW2 4R4KA 3DZLA 4K61A 3NBRA 2XGLA 3MSOA 1DYUA 5D82A 3Q90A 2CFLA 1OGXA 1O7WB 1IQYA 2CHCA 3SVAA 4FCJA 3SLUA 4MMYB 2FXTA 2JDIH 4ORLA 1QAKA 3GRDA 2UX0A 2WGQA 4XM4A 1ROAA 2W56B 4IPBA 2CFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KP4 A;  3OWY A;  1JB4 A;  1NWW A;  2HML B;  4U13 A;  2BNG A;  1NU3 A;  1SJW A;  1ZX2 A;  3CNX A;  3EX9 A;  3OV4 A;  3F8X A;  4OUQ A;  3K7C A;  3F40 A;  4HM1 B;  1OHS A;  1GY6 A;  2F99 A;  3B4P A;  5AEU B;  4WP5 A;  5IG3 A;  4R9K A;  5D83 A;  1GS3 A;  3ROB A;  3UJM A;  4XBT A;  5AII A;  3B4O A;  7STD A;  2YFI B;  4MJD A;  4X2O A;  4XBX A;  1UUW B;  4GB5 A;  4L7K A;  4WYK A;  1EG9 B;  4HM2 B;  1S5A A;  1ULJ B;  3E99 A;  4XDW A;  4HKV B;  4L8P A;  1JB2 A;  3F7X A;  2BMR B;  5AIG A;  3JUO A;  1O7P B;  1W6Y A;  4KVH A;  3G8Z A;  1OF5 A;  1DMQ A;  5AEW B;  5IG5 A;  3JUQ A;  1O7H B;  1OCV A;  3MKI A;  6STD A;  3MG1 A;  5BVB A;  1HKX A;  3KKG A;  4H3U A;  5AIH A;  3ER7 A;  3VGN A;  4FCM A;  2GEX A;  5IER A;  3GZX B;  5CXO A;  3DM8 A;  3DMC A;  3KSP A;  1OPY A;  3B8L A;  4XBY A;  4RZM A;  5IG0 A;  3SED A;  1O7G B;  2B1X B;  2Z77 A;  4N3V A;  1Z1S A;  4HVN A;  3VSY A;  3EHC A;  3B7C A;  5DRE A;  5CF1 A;  4STD A;  3G0K A;  3GZY B;  4HM6 B;  2HMM B;  1A2K A;  2XSH B;  1K41 A;  2HMO B;  2YFJ B;  3EJV A;  3EN8 A;  3HX8 A;  4HM0 B;  2A15 A;  3HZP A;  3FF2 A;  4HM4 B;  1JB5 A;  1W00 A;  1TP6 A;  3EC9 A;  3KE7 A;  4HM7 B;  3FLJ A;  3GZR A;  3NXJ A;  3K0Z A;  1OUN A;  3BB9 A;  4K1U A;  4LMI A;  1ZO2 A;  2PZV A;  5IEO A;  2STD A;  3FZW A;  3GZB A;  1TUH A;  3JUN A;  4PEJ A;  5IG4 A;  3JUM A;  4Q53 A;  5CF2 A;  1JN5 B;  8CHO A;  3F9S A;  2GEY A;  4LGQ A;  4OVM A;  4WYK B;  5JPU A;  1Q40 A;  1W02 A;  2HMN B;  1AR0 A;  3F8H A;  5KP3 A;  3T8N A;  1CQS A;  3LZA A;  2F86 B;  2CKF B;  3OWS A;  4LEH A;  2Z76 A;  3EQQ B;  2IMJ A;  1EA2 A;  1GYB A;  2GBX B;  3EF8 A;  1IDP A;  1O7N B;  2RCD A;  3NV0 A;  1QMA A;  4HM8 B;  4WWU C;  3SOY A;  1OGZ A;  3HK4 A;  4HZB B;  1JKG A;  4HZ9 B;  5AIF A;  5IEP A;  2QGU A;  1U5O A;  2HMK B;  3STD A;  1QJG A;  1ISK A;  1WQL B;  1E3V A;  1Q42 A;  2R4I A;  1VZZ A;  5DRV A;  4XB5 A;  3RGR A;  4J8T A;  3FKA A;  3NUV A;  1C7H A;  2Z7A A;  3IPT A;  4R1K A;  1UUV B;  2XRX B;  4IIA A;  5CK6 A;  4XDV A;  5BXQ A;  3FSD A;  5EVH A;  3F7S A;  1OH0 A;  1BUQ A;  2B24 B;  2I9W A;  4R9L A;  3FF0 A;  5CLK A;  5FW5 A;  3T8U A;  4CDL A;  3H51 A;  4L8O A;  4HJL B;  1GY7 A;  3I0Y A;  3OWU A;  2OWP A;  4I4K A;  1OHP A;  2GXF A;  3WMD A;  2HMJ B;  5TGN A;  2GBW B;  5IEN A;  3BLZ A;  2QIY A;  3OX9 A;  3DXO A;  1DMN A;  5JPP A;  2JQ5 A;  3NHX A;  1W01 A;  2K54 A;  2RGQ A;  3H3H A;  3OXA A;  1OF5 B;  3S5C A;  3A76 A;  1Q40 B;  3FGY A;  1GY5 A;  3LYG A;  3M8C A;  3RGA A;  2F98 A;  3F14 A;  3ECF A;  3NM2 A;  4HM5 B;  4HM3 B;  1NDO B;  3G16 A;  4K1V A;  3DZL A;  2RFR A;  3EBT A;  3EN1 B;  1E3R A;  3KZT A;  1STD A;  3MG2 A;  2XR8 B;  3MSO A;  3NBR A;  5D82 A;  1JN5 A;  5G2G A;  5D81 A;  3JUP A;  3CNM A;  5KP1 A;  3Q90 A;  4J9A A;  1E97 A;  3CPO A;  3EBY A;  3FH1 A;  1OGX A;  1O7W B;  3DUK A;  3MG3 A;  3MHE A;  3MYT A;  2W2C A;  2CHC A;  4FCJ A;  5STD A;  3D9R A;  2YFL B;  3GWR A;  1OHO A;  1DMM A;  4ORL A;  3UNL A;  2BMO B;  3GRD A;  2UX0 A;  5HGR A;  2INX A;  3SOA A;  2XSO B;  5AI1 A;  5IF6 A;  3NV0 B;  1ULI B;  3CU3 A;  1ASK A;  2BMQ B;  4X2H A;  4XM4 A;  1JKG B;  1O7M B; 
#chains in the Genus database with same CATH topology
 1SAR A;  3OWY A;  1JB4 A;  1NWW A;  1RNB A;  1S72 3;  3U1W A;  3S27 A;  3WDG B;  3X3Y A;  3OV4 A;  2D42 A;  3FG3 A;  2C4B A;  2L1S A;  1UDI I;  3B4P A;  1B2X A;  1UCI A;  3QK9 A;  2KAA A;  4RNY A;  5D83 A;  3KSE D;  1GS3 A;  3KII A;  3UJM A;  7STD A;  3CCE 3;  5JBS A;  1IQ8 A;  1EG9 B;  4HM2 B;  3UL5 A;  1I3I A;  3E99 A;  1LRA A;  3NQZ A;  4XDW A;  1W6G A;  1W2B 2;  3NM7 A;  3F7X A;  1FUS A;  3Q2P A;  3X40 A;  2C11 A;  3DH2 A;  3DGN A;  3DY5 A;  1O7P B;  1J2B A;  2ZHX B;  2OOV A;  1W6Y A;  4KVH A;  1W4N A;  3G8Z A;  1B3S A;  5M19 A;  1IV7 A;  4BTY A;  1IT8 A;  5AEW B;  1HYF A;  1WMP A;  1STF I;  1LNI A;  3ZFZ A;  1LQM B;  4HYZ A;  2GEX A;  3HI7 A;  3GZX B;  4NPB A;  1LOW A;  3DMC A;  1RRL A;  3AGO A;  1YNV X;  1TFK A;  3AHS A;  1FGR A;  1RGC A;  1UCK A;  3J7Y d;  4N3V A;  2BU4 A;  4HVN A;  1Q7Y 4;  3PCR A;  1VQ9 3;  3NX0 A;  2GU3 A;  1G02 A;  3B7C A;  1V74 A;  4HM6 B;  3AHW A;  1GOV A;  4J9A A;  3HX8 A;  2A15 A;  1BUQ A;  5IEP A;  1W00 A;  4X2H A;  2R41 A;  4HM7 B;  1YJW 3;  3GZR A;  3K0Z A;  4LMI A;  2KXG A;  2PZV A;  4JRF A;  2STD A;  3CCQ 3;  3N9H A;  8RNT A;  1JN5 B;  3Q1C A;  8CHO A;  2OTJ 3;  2GEY A;  4OVM A;  1FUT A;  3LH4 A;  2CWV A;  1W02 A;  3F8H A;  1AR0 A;  3Q3F A;  3BND A;  4ILF A;  4RNZ A;  4QWT A;  3LZA A;  5KP3 A;  3T8N A;  4CJN A;  1Q7H A;  5I97 A;  3G6E 3;  2Z76 A;  3EQQ B;  3LT8 A;  1PY3 A;  1GYB A;  3EF8 A;  3SOY A;  1O7N B;  1UCJ A;  4KFF A;  3HK4 A;  3PYJ A;  4O02 B;  3CD6 3;  1VQ5 3;  2QGU A;  2ML6 A;  1QJG A;  1IQX A;  1GMP A;  1T2H A;  5ELJ A;  2H0G A;  1V58 A;  1VZZ A;  1IVU A;  1GOY A;  2PNC A;  1RKY A;  4R1K A;  4IIA A;  2H0I A;  3ZG5 A;  4XDV A;  1IU7 A;  5BXQ A;  1OH0 A;  1N9J A;  1BRI A;  1JZO A;  2I9W A;  3N8B A;  2RBI A;  4TX4 A;  1U8C B;  3HOH A;  1BSC A;  3I0Y A;  2OWP A;  1W2Z A;  1GSP A;  1YVS A;  1OHP A;  2GXF A;  3WMD A;  3LOY A;  3LT9 A;  1RN7 A;  4HBR A;  2JQ5 A;  1W01 A;  1SII A;  3H3H A;  2WO0 A;  3UB1 A;  4IT7 A;  1OF5 B;  3CCM 3;  1QVF 2;  1BAN A;  1PYL A;  3PCS A;  2CFK A;  2F98 A;  1UI7 A;  3F14 A;  4K1V A;  1NDO B;  3G16 A;  5BU4 A;  1YHQ 3;  1TFO A;  1IV9 A;  5G2G A;  2XR8 B;  1GMR A;  3SXX A;  1BNG A;  3FH1 A;  1MWT A;  3DUK A;  3MG3 A;  2UUG C;  1WTH A;  2Y74 A;  1CYV A;  2GSP A;  4I5Q A;  3SYU A;  4LZI A;  5STD A;  3GWR A;  1B2Z A;  1OHO A;  1RN1 A;  1JV2 B;  1RDS A;  3SOA A;  1WNH A;  3V98 A;  1K8A 4;  3CU3 A;  1TRQ A;  2IY2 A;  1UI8 A;  4MEI A;  2BO9 B;  1CYU A;  1GD3 A;  1NNV A;  2W04 A;  2LYX A;  1MWS A;  2E2T A;  2CK3 H;  1R4C A;  3N54 B;  4NRE A;  4U13 A;  1ZX2 A;  3CNX A;  3T0U A;  2OQE A;  3LTA A;  3F8X A;  6RNT A;  3F40 A;  1UCL A;  3G4S 3;  4KT3 B;  5AEU B;  4WP5 A;  4FMA A;  5EEO A;  3ROB A;  3CC4 3;  5AII A;  3B4O A;  4EXR A;  4XBX A;  4X2O A;  1AQZ A;  4WHA A;  1IVX A;  1FGT A;  2KCD A;  1X1W A;  2CWT A;  4HKV B;  1JB2 A;  3CCV 3;  1I8V A;  1A2V A;  1D6Y A;  1LOX A;  5AYS C;  1K73 4;  1YGW A;  4LSO A;  1DMQ A;  4H61 A;  4CCV A;  1OCV A;  2GU1 A;  1LOV A;  3MKI A;  2UGI A;  2W9Q A;  4J5K A;  3KKG A;  1YIJ 3;  3KCH A;  3ER7 A;  5M18 A;  3WA3 A;  1Q82 4;  1LNH A;  4NHF A;  1FZU A;  1OPY A;  4RZM A;  1VQN 3;  1T5Y A;  1NB3 I;  2Z77 A;  1RMS A;  5RNT A;  1KC8 4;  3D4A A;  1HU9 A;  2CC3 A;  2HMM B;  2YFJ B;  2MC8 A;  3CCR 3;  3WR2 A;  1BRN L;  3HZP A;  1TP6 A;  2KF6 A;  4K1U A;  1JBT A;  3NQY A;  1N5P A;  1B20 A;  1OUN A;  1RGK A;  1ZO2 A;  3FZW A;  1B27 A;  3D3L A;  1B21 A;  3JUM A;  2LQV A;  3URP A;  5CF2 A;  1N5H A;  2CW9 A;  4RBN A;  3CME 3;  2WGO A;  1W5Z A;  1B2M A;  4LGQ A;  1CEW I;  1UGI A;  1TU5 A;  1BRH A;  1N8R 4;  1CQS A;  3OWS A;  3BU4 A;  1UUG B;  5EQL A;  2GBX B;  1UW1 A;  2P09 A;  2ZA4 A;  4KFE A;  1BVI A;  1BU4 A;  4OK0 A;  2F56 A;  3K5T A;  1JKG A;  1EQK A;  4N6U A;  1U5O A;  3OW2 2;  1ISK A;  2F5W A;  1Q42 A;  2O9U X;  1RGL A;  1B2U A;  2R4I A;  3X41 A;  3FKA A;  3IPT A;  1A90 A;  1UUV B;  1UGH I;  1FW7 A;  2B24 B;  3FF0 A;  3T8U A;  4CDL A;  1AY7 A;  2F5M A;  5FGO A;  1ROV A;  2XFS A;  4EV5 A;  4BTW A;  5LC7 A;  2GBW B;  3OX9 A;  3RDE A;  5ELU A;  1BRK A;  2KF5 A;  4BL3 A;  5JPP A;  3NHX A;  1M90 4;  1G0T A;  2J8X B;  3U97 A;  3AMO B;  2CX1 A;  3TDG A;  2AAE A;  3A76 A;  3IMA B;  4N6V 0;  1GY5 A;  4HM3 B;  3NM2 A;  2ZL8 A;  4BIR A;  3GSP A;  3KZT A;  2MF7 A;  1STD A;  3SX1 A;  5D81 A;  3AGN A;  3JUP A;  2RSX A;  3EB8 A;  3EBY A;  2Z6B A;  3MHE A;  1BNI A;  3MYT A;  2W2C A;  1VQ8 3;  6GSP A;  3ZG0 A;  2YFL B;  2W9P A;  1DMM A;  1YGE A;  2BMO B;  2P0M A;  4N6M A;  2KRT A;  1SIH A;  2OOV C;  2XSO B;  1TIJ A;  4GHO A;  1X1Y A;  4LYL B;  1VQ7 3;  1A2P A;  1ASK A;  2BMQ B;  1K9M 4;  1FA3 A;  3KFQ C;  1BUJ A;  1JKG B;  1O7M B;  3BB9 A;  2H0H A;  1GOU A;  2ZDJ A;  3CCJ 3;  2QA4 3;  1YIT 3;  1B2S A;  2HML B;  3BNE A;  1AVK A;  2F4Y A;  2P05 A;  1NU3 A;  1BSD A;  1BNF A;  3EX9 A;  1VQL 3;  1VQ6 3;  2L4V A;  4OUQ A;  3K7C A;  1YJN 3;  4ZM8 A;  1TTO A;  1QVG 2;  1MGR A;  3ALA A;  1RGH A;  5IG3 A;  4XBT A;  2W03 A;  1M1K 4;  4N6O B;  1CH0 A;  1VQP 3;  1S5A A;  1ULJ B;  4L8P A;  1N9E A;  2XEP A;  2BMR B;  4FMC A;  1RJO A;  3K9M C;  3DGL A;  1IVV A;  1OF5 A;  2YX9 A;  2XFT A;  1DVD A;  3BIR A;  1O7H B;  2CH9 A;  3WOE B;  1M9G A;  1X1U A;  2CIU A;  3KN4 A;  3VGN A;  4HAA A;  1IK3 A;  3DM8 A;  3KSP A;  3B8L A;  4XBY A;  1Z1S A;  1VQM 3;  2OTL 3;  2BIR A;  4EC6 A;  1RGE A;  1PU4 A;  1VQ4 3;  1JBS A;  3GZY B;  1L5G B;  1JNQ A;  2XSH B;  4HM0 B;  1VQQ A;  4G1M B;  3AMO A;  1BNE A;  1KWI A;  1RGA A;  1SQW A;  1FGQ A;  3FF2 A;  3NBB A;  5HGR A;  1BSB A;  2W56 A;  1KSI A;  5IEO A;  3NXJ A;  2Q07 A;  3VSY A;  3HII A;  1JJ2 2;  3CCS 3;  3GZB A;  3JUN A;  4FR9 A;  4PEJ A;  3CCL 3;  1RHL A;  1QAF A;  2CWU A;  3F9S A;  5JPU A;  2HMN B;  1I0X A;  5GSP A;  2F86 B;  2CKF B;  3JVC A;  4FMB A;  1W6C A;  1W7C A;  2M7O A;  1IT7 A;  1JZD A;  3GAX A;  4LEH A;  1EA2 A;  1VQO 3;  3NV0 A;  1IDP A;  2RCD A;  1QMA A;  3PGB A;  3G71 3;  2Y73 A;  1OGZ A;  4HZ9 B;  2HMK B;  1I3F A;  1Q86 4;  4XB5 A;  4O8S A;  1MGW A;  4J8T A;  2WOF A;  2V1L A;  3NUV A;  1WMO A;  2Z7A A;  5CK6 A;  3DGY A;  1AVL A;  2FNQ A;  1F8N A;  3F7S A;  5EVH A;  2CG1 A;  3V99 A;  1C54 A;  5FW5 A;  2E2V A;  1MWR A;  1KQS 2;  1Y4K A;  5AYR B;  1BOX A;  4HJL B;  1Q81 4;  2WOH A;  1ZGX A;  4MMZ B;  4EBG A;  3LTD A;  3LXU X;  5IEN A;  1BRJ A;  3BNB A;  3L0R A;  3DXO A;  1DMN A;  4BL2 A;  2W0Q A;  1JBR A;  2K54 A;  3FG1 A;  3LTC A;  3D5G A;  3OXA A;  2CX0 A;  3S5C A;  3I55 3;  5G1K A;  2IUJ A;  3FGY A;  1NO3 A;  3LYG A;  3M8C A;  4RNT A;  3RGA A;  3S67 A;  3CC7 3;  3ECF A;  4HM5 B;  2RFR A;  1RRH A;  3EBT A;  1E3R A;  3EN1 B;  3MG2 A;  2O3O A;  4N6L A;  1JN5 A;  1LOY A;  1M1X B;  5KP1 A;  3CNM A;  4BU4 A;  4FMD A;  1E97 A;  3CPO A;  1EUI C;  1FUW A;  4K90 B;  2CG0 A;  1FYS A;  1WMN A;  1RCK A;  3DGO A;  3D9R A;  3PZW A;  1D6Z A;  3PXM A;  3UNL A;  4EW5 A;  4AKY A;  1LXE A;  2INX A;  1NB5 I;  1ZS7 A;  5AI1 A;  4GL6 A;  4MMX B;  1T3B A;  3NV0 B;  1ULI B;  4GSP A;  5IF6 A;  1HZ1 A;  1FGM A;  1Q9E A;  4FCZ A;  1PFP A;  1BRG A;  3EE1 A;  4J5G A;  3X42 A;  5KP4 A;  1RLS A;  2BHM A;  2W6J H;  2BNG A;  1SJW A;  1BNJ A;  9RNT A;  2BT3 A;  1QAL A;  4R80 A;  1GD4 A;  1MWU A;  4HM1 B;  4O3V A;  1OHS A;  1GY6 A;  1FGO A;  2F99 A;  1K28 A;  2K0M A;  3MPH A;  1MNL A;  2FGT A;  1RGG A;  3O8Y A;  3S29 A;  1GMQ A;  2OQE C;  1RN4 A;  1MOL A;  1X1X A;  2YFI B;  2XGN A;  3K63 A;  1UUW B;  4GB5 A;  4L7K A;  4MJD A;  4WYK A;  2SAR A;  2C10 A;  1BSA A;  2IYJ A;  2P38 A;  2E2U A;  3LML A;  3JUO A;  1I2F A;  5AIG A;  2D1W A;  1T2I A;  1BGS A;  4WFO A;  1BSE A;  5IG5 A;  3JUQ A;  3I56 3;  6STD A;  4AKZ A;  3MG1 A;  5BVB A;  1HKX A;  4H3U A;  1A67 A;  5AIH A;  1EKM A;  3FG4 A;  4EV2 A;  4FCM A;  5IER A;  5A0O B;  5CXO A;  1DVC A;  1RSN A;  2P0X A;  5IG0 A;  3SED A;  1O7G B;  1RGF A;  2B1X B;  3X3X A;  1IVW A;  1BNS A;  3EHC A;  5DRE A;  4BTX A;  5CF1 A;  4STD A;  3G0K A;  2CFW A;  3CCU 3;  1A2K A;  1K41 A;  2HMO B;  2KF4 A;  3EJV A;  3EN8 A;  4R9K A;  1BRS A;  3VF1 A;  3UL6 A;  2HOH A;  4HM4 B;  1JB5 A;  1JRQ A;  3EC9 A;  3KE7 A;  3BNC A;  3WOF B;  3DGM A;  3FLJ A;  1VQK 3;  3CMA 3;  2OCT A;  3D79 A;  3PS8 A;  5IG4 A;  1TUH A;  2IA7 A;  4N6N B;  2QEX 3;  1LVN A;  4Q53 A;  4AEQ A;  1LQG C;  1KD1 4;  1IYY A;  1I70 A;  1R4Y A;  1US1 A;  3WA2 X;  2IUK A;  4WYK B;  3MWZ A;  4CPK A;  1Q40 A;  1AV4 A;  4HOH A;  7RNT A;  3FCS B;  2CFG A;  2ML5 A;  1YI2 3;  3NBJ A;  1RTU A;  1NJI 4;  2XH9 A;  5HOH A;  2IMJ A;  3HIG A;  1DET A;  4HM8 B;  4WWU C;  1YJ9 3;  5IW9 A;  1G96 A;  1V57 A;  4HZB B;  5AIF A;  1N8Q A;  4KFD A;  2SBL A;  4N6T A;  4KZ1 A;  3STD A;  1I0V A;  1WQL B;  1E3V A;  5G1L A;  1RNT A;  5DRV A;  3RGR A;  7GSP A;  2K3D A;  3X3Z A;  1I2E A;  1OAC A;  1C7H A;  4EYC A;  5M1A A;  3V92 A;  3QRD A;  2XRX B;  3A5E A;  3S28 A;  1YVB I;  4O2H A;  3FSD A;  1D6U A;  3CC2 3;  1SPU A;  4R9L A;  3RNT A;  5CLK A;  3IJE B;  3H51 A;  1TJD A;  4L8O A;  3WOD G;  1BAO A;  1GY7 A;  2XF3 A;  3OWU A;  4I4K A;  5LC6 A;  2HMJ B;  5TGN A;  5BIR A;  2RNT A;  3BLZ A;  2QIY A;  3CXC 2;  4JF8 A;  1BIR A;  1I2G A;  2RGQ A;  2AAD A;  3LTB A;  1Q40 B;  3CPW 2;  3WHO A;  4R4K A;  1DE3 A;  1EEJ A;  3DZL A;  4K61 A;  3NBR A;  2XGL A;  3MSO A;  1DYU A;  5D82 A;  3D5I A;  3Q90 A;  1TRP A;  2CFL A;  1OGX A;  1O7W B;  1IQY A;  4DKI A;  2CHC A;  3SVA A;  4FCJ A;  1BNR A;  3SLU A;  4MMY B;  2FXT A;  2JDI H;  4ORL A;  1QAK A;  3GRD A;  2UX0 A;  2WGQ A;  4XM4 A;  1ROA A;  2W56 B;  1RCL A;  4IPB A;  2KF3 A;  2CFD A; 
#chains in the Genus database with same CATH homology
 3OWY A;  1JB4 A;  1NWW A;  1S72 3;  3U1W A;  3S27 A;  3WDG B;  3X3Y A;  3OV4 A;  2D42 A;  3FG3 A;  3B4P A;  3QK9 A;  4RNY A;  5D83 A;  3KSE D;  1GS3 A;  3KII A;  3UJM A;  7STD A;  3CCE 3;  5JBS A;  1IQ8 A;  1EG9 B;  4HM2 B;  3UL5 A;  3E99 A;  4XDW A;  3NQZ A;  1W6G A;  1W2B 2;  3NM7 A;  3F7X A;  3Q2P A;  3X40 A;  1J2B A;  2C11 A;  3DGN A;  3DY5 A;  1O7P B;  2OOV A;  1W6Y A;  4KVH A;  1W4N A;  3G8Z A;  1IV7 A;  4BTY A;  1IT8 A;  5AEW B;  1WMP A;  1STF I;  4HYZ A;  2GEX A;  3HI7 A;  3GZX B;  3DMC A;  1RRL A;  1TFK A;  1FGR A;  3J7Y d;  4N3V A;  4HVN A;  1Q7Y 4;  3PCR A;  1VQ9 3;  3NX0 A;  2GU3 A;  3B7C A;  1V74 A;  4HM6 B;  4J9A A;  3HX8 A;  2A15 A;  1BUQ A;  5IEP A;  1W00 A;  4X2H A;  4HM7 B;  1YJW 3;  3GZR A;  3K0Z A;  4LMI A;  2KXG A;  2PZV A;  4JRF A;  2STD A;  3CCQ 3;  3N9H A;  1JN5 B;  3Q1C A;  8CHO A;  2OTJ 3;  2GEY A;  4OVM A;  3LH4 A;  2CWV A;  1W02 A;  3F8H A;  1AR0 A;  4RNZ A;  3BND A;  4QWT A;  5KP3 A;  3T8N A;  3LZA A;  5I97 A;  3G6E 3;  2Z76 A;  3EQQ B;  3LT8 A;  1GYB A;  3EF8 A;  3SOY A;  1O7N B;  4KFF A;  3HK4 A;  3PYJ A;  4O02 B;  3CD6 3;  1VQ5 3;  2QGU A;  2ML6 A;  1QJG A;  1IQX A;  5ELJ A;  1VZZ A;  1IVU A;  2PNC A;  4R1K A;  4IIA A;  4XDV A;  1IU7 A;  5BXQ A;  1OH0 A;  1N9J A;  4TX4 A;  2I9W A;  3N8B A;  1U8C B;  3I0Y A;  2OWP A;  1W2Z A;  1OHP A;  2GXF A;  3WMD A;  3LOY A;  3LT9 A;  1RN7 A;  4HBR A;  2JQ5 A;  1W01 A;  1SII A;  3H3H A;  2WO0 A;  3UB1 A;  4IT7 A;  1OF5 B;  3CCM 3;  1QVF 2;  3PCS A;  2CFK A;  2F98 A;  1UI7 A;  3F14 A;  4K1V A;  1NDO B;  3G16 A;  1YHQ 3;  1TFO A;  1IV9 A;  5G2G A;  2XR8 B;  3SXX A;  3FH1 A;  3DUK A;  3MG3 A;  1WTH A;  2Y74 A;  1CYV A;  4LZI A;  5STD A;  3GWR A;  1OHO A;  1JV2 B;  3SOA A;  1K8A 4;  1WNH A;  3V98 A;  3CU3 A;  1CYU A;  1UI8 A;  4MEI A;  2BO9 B;  1GD3 A;  2W04 A;  2LYX A;  2E2T A;  2CK3 H;  1R4C A;  3N54 B;  4NRE A;  4U13 A;  1ZX2 A;  3CNX A;  3T0U A;  2OQE A;  3LTA A;  3F8X A;  3F40 A;  3G4S 3;  5AEU B;  4WP5 A;  4FMA A;  5EEO A;  3ROB A;  3CC4 3;  5AII A;  3B4O A;  4EXR A;  4XBX A;  4X2O A;  4WHA A;  1IVX A;  1FGT A;  2KCD A;  2CWT A;  4HKV B;  1JB2 A;  3CCV 3;  1A2V A;  1D6Y A;  1LOX A;  5AYS C;  1K73 4;  4LSO A;  1DMQ A;  4H61 A;  4CCV A;  1OCV A;  2GU1 A;  3MKI A;  1YIJ 3;  2W9Q A;  3KKG A;  3ER7 A;  3WA3 A;  1Q82 4;  1LNH A;  4NHF A;  1OPY A;  4RZM A;  1VQN 3;  1T5Y A;  1NB3 I;  2Z77 A;  1KC8 4;  1HU9 A;  2CC3 A;  2HMM B;  2YFJ B;  2MC8 A;  3CCR 3;  3HZP A;  1TP6 A;  4K1U A;  3NQY A;  1N5P A;  1OUN A;  1ZO2 A;  3FZW A;  3D3L A;  3JUM A;  2LQV A;  5CF2 A;  1N5H A;  2CW9 A;  4RBN A;  3CME 3;  2WGO A;  1W5Z A;  4LGQ A;  1CEW I;  1N8R 4;  1TU5 A;  1CQS A;  3OWS A;  5EQL A;  2GBX B;  1UW1 A;  2P09 A;  4KFE A;  1EQK A;  4OK0 A;  3K5T A;  1JKG A;  4N6U A;  1U5O A;  3OW2 2;  1ISK A;  1Q42 A;  2O9U X;  2R4I A;  3X41 A;  3FKA A;  3IPT A;  1A90 A;  1UUV B;  2B24 B;  3FF0 A;  3T8U A;  4CDL A;  5FGO A;  1ROV A;  2XFS A;  4EV5 A;  4BTW A;  5LC7 A;  2GBW B;  3OX9 A;  3RDE A;  5ELU A;  1M90 4;  5JPP A;  3NHX A;  3U97 A;  3AMO B;  3TDG A;  3A76 A;  3IMA B;  4N6V 0;  1GY5 A;  4HM3 B;  3NM2 A;  2ZL8 A;  3KZT A;  2MF7 A;  1STD A;  3SX1 A;  5D81 A;  3JUP A;  2RSX A;  3EB8 A;  3EBY A;  2Z6B A;  3MHE A;  3MYT A;  2W2C A;  1VQ8 3;  2YFL B;  2W9P A;  1DMM A;  1YGE A;  2BMO B;  2P0M A;  4N6M A;  2KRT A;  1SIH A;  2OOV C;  2XSO B;  1TIJ A;  1FA3 A;  1VQ7 3;  1ASK A;  2BMQ B;  1K9M 4;  3KFQ C;  1JKG B;  3BB9 A;  1O7M B;  2QA4 3;  2ZDJ A;  1YIT 3;  3BNE A;  2HML B;  1AVK A;  2P05 A;  1NU3 A;  3EX9 A;  1VQL 3;  1VQ6 3;  2L4V A;  4OUQ A;  3K7C A;  1YJN 3;  4ZM8 A;  1QVG 2;  3ALA A;  5IG3 A;  4XBT A;  2W03 A;  1M1K 4;  4N6O B;  1VQP 3;  1S5A A;  1ULJ B;  4L8P A;  1N9E A;  2XEP A;  2BMR B;  4FMC A;  1RJO A;  3K9M C;  3DGL A;  1IVV A;  1OF5 A;  2YX9 A;  2XFT A;  1DVD A;  1O7H B;  2CH9 A;  3WOE B;  1M9G A;  2CIU A;  3KN4 A;  3VGN A;  1IK3 A;  3DM8 A;  3KSP A;  3B8L A;  4XBY A;  1Z1S A;  1VQM 3;  2OTL 3;  4EC6 A;  1PU4 A;  1VQ4 3;  3GZY B;  1L5G B;  1JNQ A;  2XSH B;  4HM0 B;  4G1M B;  3AMO A;  1SQW A;  1KWI A;  3NBB A;  3FF2 A;  1FGQ A;  5HGR A;  2W56 A;  1KSI A;  5IEO A;  3NXJ A;  2Q07 A;  3VSY A;  3HII A;  3CCS 3;  3GZB A;  3JUN A;  4FR9 A;  4PEJ A;  3CCL 3;  1QAF A;  2CWU A;  3F9S A;  5JPU A;  2HMN B;  2F86 B;  2CKF B;  3JVC A;  4FMB A;  1W6C A;  1W7C A;  2M7O A;  1IT7 A;  3GAX A;  4LEH A;  1EA2 A;  1VQO 3;  3NV0 A;  1IDP A;  2RCD A;  1QMA A;  3PGB A;  3G71 3;  2Y73 A;  1OGZ A;  4HZ9 B;  2HMK B;  1Q86 4;  4XB5 A;  4O8S A;  4J8T A;  2WOF A;  2V1L A;  3NUV A;  1WMO A;  2Z7A A;  5CK6 A;  1AVL A;  2FNQ A;  1F8N A;  3F7S A;  5EVH A;  2CG1 A;  3V99 A;  5FW5 A;  2E2V A;  1KQS 2;  1Y4K A;  5AYR B;  4HJL B;  1Q81 4;  2WOH A;  4MMZ B;  4EBG A;  3LTD A;  3LXU X;  5IEN A;  3BNB A;  3L0R A;  3DXO A;  1DMN A;  2W0Q A;  2K54 A;  3FG1 A;  3LTC A;  3OXA A;  3S5C A;  3I55 3;  2IUJ A;  3FGY A;  1NO3 A;  3LYG A;  3M8C A;  3CC7 3;  3RGA A;  3S67 A;  3ECF A;  4HM5 B;  2RFR A;  3EN1 B;  1RRH A;  3EBT A;  1E3R A;  3MG2 A;  2O3O A;  4N6L A;  1JN5 A;  1M1X B;  5KP1 A;  3CNM A;  4FMD A;  1E97 A;  3CPO A;  1FUW A;  4K90 B;  2CG0 A;  1WMN A;  3DGO A;  3PZW A;  3D9R A;  1D6Z A;  3PXM A;  3UNL A;  4AKY A;  1LXE A;  2INX A;  1NB5 I;  1RKY A;  5AI1 A;  4GL6 A;  4MMX B;  5IF6 A;  3NV0 B;  1ULI B;  1FGM A;  4FCZ A;  1PFP A;  3EE1 A;  3X42 A;  5KP4 A;  2BHM A;  2W6J H;  2BNG A;  1SJW A;  2BT3 A;  1QAL A;  4R80 A;  1GD4 A;  4HM1 B;  4O3V A;  1OHS A;  1GY6 A;  1FGO A;  2F99 A;  1K28 A;  2K0M A;  3MPH A;  1MNL A;  2FGT A;  3O8Y A;  3S29 A;  2OQE C;  1MOL A;  2YFI B;  4MJD A;  2XGN A;  3K63 A;  1UUW B;  4GB5 A;  4L7K A;  4WYK A;  2C10 A;  2P38 A;  2E2U A;  3LML A;  3JUO A;  5AIG A;  2D1W A;  4WFO A;  5IG5 A;  3JUQ A;  3I56 3;  6STD A;  4AKZ A;  3MG1 A;  5BVB A;  1HKX A;  4H3U A;  1A67 A;  5AIH A;  1EKM A;  3FG4 A;  4EV2 A;  4FCM A;  5IER A;  5A0O B;  5CXO A;  1DVC A;  2P0X A;  5IG0 A;  3SED A;  1O7G B;  2B1X B;  3X3X A;  1IVW A;  3EHC A;  5DRE A;  4BTX A;  5CF1 A;  4STD A;  3G0K A;  2CFW A;  3CCU 3;  1A2K A;  1K41 A;  2HMO B;  3EJV A;  3EN8 A;  4R9K A;  3VF1 A;  3CCJ 3;  3UL6 A;  4HM4 B;  3WOF B;  1JB5 A;  1JRQ A;  3EC9 A;  3KE7 A;  3BNC A;  1VQK 3;  3DGM A;  3FLJ A;  1JJ2 2;  3CMA 3;  2OCT A;  5IG4 A;  3PS8 A;  1TUH A;  2IA7 A;  4N6N B;  2QEX 3;  1LVN A;  4Q53 A;  4AEQ A;  1KD1 4;  1US1 A;  3WA2 X;  2IUK A;  4WYK B;  3MWZ A;  1Q40 A;  1AV4 A;  3FCS B;  2CFG A;  2ML5 A;  1YI2 3;  3NBJ A;  1NJI 4;  2XH9 A;  2IMJ A;  3HIG A;  4HM8 B;  4WWU C;  1YJ9 3;  5IW9 A;  1G96 A;  4HZB B;  5AIF A;  1N8Q A;  4KFD A;  2SBL A;  4N6T A;  4KZ1 A;  3STD A;  1WQL B;  1E3V A;  5DRV A;  3RGR A;  3X3Z A;  1OAC A;  1C7H A;  4EYC A;  3V92 A;  3QRD A;  2XRX B;  3S28 A;  1YVB I;  4O2H A;  3FSD A;  1D6U A;  3CC2 3;  1SPU A;  4R9L A;  5CLK A;  3IJE B;  3H51 A;  4L8O A;  3WOD G;  1GY7 A;  2XF3 A;  3OWU A;  4I4K A;  5LC6 A;  2HMJ B;  5TGN A;  3BLZ A;  2QIY A;  3CXC 2;  4JF8 A;  2RGQ A;  3LTB A;  1Q40 B;  3CPW 2;  4R4K A;  3DZL A;  4K61 A;  3NBR A;  2XGL A;  3MSO A;  1DYU A;  5D82 A;  3Q90 A;  2CFL A;  1OGX A;  1O7W B;  1IQY A;  2CHC A;  3SVA A;  4FCJ A;  3SLU A;  4MMY B;  2FXT A;  2JDI H;  4ORL A;  1QAK A;  3GRD A;  2UX0 A;  2WGQ A;  4XM4 A;  1ROA A;  2W56 B;  4IPB A;  2CFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...