1O7NB

Naphthalene 1,2-dioxygenase, ternary complex with dioxygen and indole
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
publication title Crystal Structure of Naphthalene Dioxygenase: Side-on Binding of Dioxygen to Iron
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 54
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1o7nB00
5AIGA 2RGQA 3BB9A 5JPPA 1OHPA 5D81A 5HGRA 4R9LA 4WYKB 5CXOA 3DMCA 3EX9A 3HX8A 1E3RA 3MG1A 1QJGA 3FF0A 1TUHA 2HMMB 3F8HA 3B7CA 1OCVA 2CHCA 1JB4A 3MG3A 3KZTA 2GXFA 3NBRA 4LEHA 1UUVB 3NXJA 5CLKA 3FGYA 2I9WA 6STDA 2XRXB 3GZBA 1NWWA 1GYBA 2Z76A 3DM8A 5AI1A 4PEJA 3K0ZA 4J9AA 4K1VA 1O7WB 3SOAA 2QIYA 5CK6A 2R4IA 3FZWA 3JUOA 1HKXA 1W00A 4FCMA 4WWUC 1CQSA 3EHCA 3JUPA 5AIFA 5AEWB 3ER7A 1NDOB 3BLZA 5DREA 7STDA 1JB2A 3NM2A 5IG0A 4HM7B 1OHOA 4ORLA 3NV0A 1STDA 5DRVA 3RGRA 3DXOA 3GZRA 4FCJA 2STDA 4LGQA 1VZZA 2YFIB 4R1KA 1GY7A 4HJLB 2BMQB 5IEOA 4STDA 3JUNA 1ZO2A 1IDPA 1Q42A 4HM8B 1OGZA 1JB5A 3B4OA 5KP1A 1JN5A 3GWRA 1DMMA 2YFLB 5CF1A 1O7PB 3FF2A 5IERA 4HKVB 3F14A 3OV4A 1TP6A 2A15A 3M8CA 2B24B 2UX0A 4XBYA 1Z1SA 2GBWB 3FKAA 3Q90A 3VSYA 1WQLB 1GY5A 1DMNA 1O7NB 2HMNB 3T8NA 2GBXB 2YFJB 1OGXA 2W2CA 1O7MB 3LYGA 5IF6A 1U5OA 4X2HA 3MHEA 2BMOB 2XR8B 4XB5A 3OX9A 3DZLA 5KP3A 1SJWA 4HZBB 4HM2B 4LMIA 4RZMA 5IENA 1BUQA 1OUNA 1OHSA 1C7HA 2CKFB 3D9RA 4XBXA 2HMLB 1O7HB 1Q40A 3FLJA 2BMRB 3NV0B 3H51A 2RCDA 3G8ZA 4OVMA 4L8OA 4IIAA 2OWPA 3CNXA 4XBTA 3H3HA 3EC9A 1ULIB 3EN8A 4CDLA 1E97A 3JUQA 2F98A 4I4KA 2F99A 4N3VA 5D82A 3F9SA 4HM5B 4HM1B 1K41A 3OWSA 3KSPA 5JPUA 1NU3A 3MG2A 1OF5A 3E99A 3UJMA 1OPYA 5IG3A 3EQQB 5IG4A 3UNLA 1JKGA 1UUWB 3SOYA 3MKIA 8CHOA 3G16A 3VGNA 5BVBA 1A2KA 1DMQA 3EJVA 3EF8A 4MJDA 3F8XA 3HK4A 1OH0A 2K54A 5STDA 1GY6A 5G2GA 2Z77A 3WMDA 4XM4A 4XDWA 1Q40B 1O7GB 2B1XB 1EG9B 5FW5A 5EVHA 3KKGA 3ROBA 2RFRA 3GZXB 3F7XA 3I0YA 1E3VA 3CNMA 3B8LA 2INXA 2JQ5A 2F86B 3S5CA 1QMAA 5AIIA 2IMJA 3CU3A 2GEXA 5TGNA 3CPOA 3NUVA 2Z7AA 5D83A 4HZ9B 1EA2A 1OF5B 3EBTA 1W02A 2QGUA 4HM3B 1ASKA 3OXAA 3OWYA 5CF2A 3F40A 5AEUB 3NHXA 3MSOA 4WYKA 4GB5A 2HMOB 3GRDA 1ULJB 4K1UA 2HMJB 2XSOB 1JKGB 4Q53A 5BXQA 3DUKA 2XSHB 3KE7A 4HM6B 4R9KA 3SEDA 4HM0B 1JN5B 2BNGA 1ISKA 3ECFA 1GS3A 3FSDA 5KP4A 5IG5A 3JUMA 1W6YA 4X2OA 1AR0A 3F7SA 1ZX2A 2PZVA 2HMKB 4XDVA 3K7CA 1W01A 4L7KA 3RGAA 4HM4B 4J8TA 3FH1A 4HVNA 3IPTA 4H3UA 2GEYA 4U13A 3OWUA 4WP5A 1S5AA 5IEPA 4L8PA 3A76A 3STDA 3T8UA 3HZPA 3EBYA 3MYTA 3B4PA 3GZYB 3G0KA 4OUQA 4KVHA 3LZAA 5AIHA 3EN1B
chains in the Genus database with same CATH superfamily
1JRQA 5AIGA 3G713 2RGQA 3BB9A 3URPA 8RNTA 2BU4A 1NB3I 5JPPA 3OW22 1OHPA 5D81A 1FUTA 3AMOA 5HGRA 3VF1A 4R9LA 1JJ22 4WYKB 1IVUA 2H0HA 5CXOA 3DMCA 3LXUX 4EBGA 1G96A 2QEX3 3EX9A 1SPUA 4FMBA 3HX8A 3KFQC 2KXGA 1E3RA 1UUGB 3MG1A 1QJGA 3FF0A 4KFEA 2H0GA 1JZDA 1BRJA 1TUHA 2HMMB 1YGEA 2YX9A 4OK0A 1LOYA 1TRPA 1NJI4 3F8HA 3B7CA 2IY2A 1DVCA 1EKMA 4N6LA 2SARA 1M1XB 1RN1A 1UI8A 4WFOA 1OCVA 3CCJ3 2K3DA 2CH9A 2KRTA 2CHCA 1JB4A 1WNHA 3Q2PA 1LVNA 4RBNA 3X40A 3MG3A 5RNTA 3QK9A 4EV5A 3KZTA 3V99A 1W4NA 3N9HA 2GXFA 2CK3H 1SIIA 2WOFA 1C54A 1B20A 1ZGXA 2WGQA 3HI7A 3NBRA 1BAOA 3PCRA 4LEHA 2HOHA 9RNTA 1MWTA 4N6UA 4AEQA 3CCU3 3X41A 1X1WA 2XGNA 1A2VA 1CYVA 1MWRA 1UUVB 3X42A 3NXJA 1IK3A 3HOHA 1VQP3 5M1AA 1LOXA 2CFDA 4BTYA 5CLKA 3FGYA 1D6UA 4HOHA 1A90A 3BNCA 3U1WA 2I9WA 3ZG0A 6STDA 5JBSA 1GMPA 2XRXB 1TFOA 3GZBA 1LOWA 1NWWA 1KWIA 1QAFA 5FGOA 1T2HA 1WTHA 3BIRA 1GYBA 2Z76A 3DM8A 3N8BA 4FR9A 1BNEA 2P38A 5AI1A 1TFKA 4PEJA 3U97A 3K0ZA 1VQ73 1VQL3 4EC6A 4RNZA 1FYSA 4J9AA 4K1VA 1O7WB 2FGTA 2KF4A 4N6V0 3SOAA 1VQ53 4N6NB 3WHOA 1UDII 2QIYA 5CK6A 3NQZA 2R4IA 1JNQA 1RMSA 1I8VA 1IT7A 3FZWA 1L5GB 3JUOA 1HKXA 1W00A 4FCMA 1B27A 4WWUC 1CQSA 4NPBA 1MNLA 2CWUA 2F56A 1PY3A 3EHCA 3JUPA 4CJNA 1KC84 3T0UA 1DE3A 5AIFA 5AEWB 1YIT3 1ROAA 2O9UX 3ER7A 3WA2X 1VQO3 1JBRA 4AKYA 2E2UA 3IMAB 1NDOB 3I563 3NX0A 3BLZA 5DREA 7STDA 2XEPA 1IVWA 3RNTA 1JB2A 1B2UA 1WMNA 3NM2A 1OACA 1JBSA 1IV7A 2IUJA 5IG0A 1Y4KA 1MGRA 1X1YA 1R4CA 2BHMA 1VQ93 2CWTA 3AMOB 4HM7B 2JDIH 3UL5A 1AVKA 1JBTA 1RGCA 2CX0A 1G02A 4RNYA 3G6E3 4O2HA 4ILFA 4BL3A 3CMA3 1X1XA 4FMCA 1OHOA 4N6MA 4ORLA 3LTCA 3NV0A 1VQN3 1STDA 3WODG 4EXRA 4HAAA 1RRHA 1V57A 1R4YA 5ELJA 1DVDA 5DRVA 1RGKA 3BU4A 1Q7HA 1BSEA 2ZA4A 1ROVA 3RGRA 4G1MB 1TJDA 2Z6BA 3DXOA 3GZRA 4FCJA 1LNIA 2STDA 1RDSA 3K63A 3UL6A 4CCVA 3DGMA 3Q1CA 3WR2A 1SARA 1Q864 7GSPA 3FG1A 1GD3A 4LGQA 1VZZA 1Q7Y4 2YFIB 4R1KA 2CW9A 3WOEB 1GY7A 4HJLB 1CEWI 2BMQB 5IEOA 2RBIA 4STDA 3JUNA 1ZO2A 1IDPA 1V74A 2WO0A 3X3XA 5HOHA 5GSPA 4BTXA 1YJW3 3SXXA 1Q42A 3UB1A 4HM8B 4JRFA 1AVLA 1GMRA 1LNHA 1RGGA 4MMZB 4DKIA 1S723 1FUWA 1HU9A 6RNTA 1OGZA 1JB5A 1T2IA 1US1A 3B4OA 1IQYA 5KP1A 1JN5A 3GWRA 1DMMA 3AGNA 2Y74A 2YFLB 5CF1A 1O7PB 1BVIA 3FF2A 2ZHXB 5IERA 4HKVB 4WHAA 1I3IA 5G1LA 3GSPA 1DETA 3D5IA 3F14A 3OV4A 1TU5A 1TP6A 1YJN3 1RNTA 2A15A 3M8CA 1GOUA 2B24B 4R4KA 3EB8A 2UX0A 4XBYA 1LXEA 1K9M4 1Z1SA 3FG4A 2GBWB 3FKAA 3Q90A 2R41A 2Q07A 1WQLB 1GY5A 3VSYA 3JVCA 1F8NA 2UGIA 1M1K4 1DMNA 3CCE3 1O7NB 3CME3 1BNFA 2HMNB 3T8NA 1MGWA 2GBXB 2GSPA 2YFJB 3TDGA 1OGXA 1BSBA 2W2CA 1Q814 3FG3A 3LTAA 1O7MB 3PXMA 3LYGA 5LC6A 5IF6A 2GU1A 3CCQ3 1U5OA 1BNGA 1BRSA 4X2HA 4EV2A 1VQ63 2MC8A 1RHLA 3FCSB 1I2FA 3MHEA 2Y73A 2BMOB 1PFPA 3ZG5A 2IUKA 3S28A 4BU4A 5M18A 1VQK3 2LQVA 1QVG2 1JZOA 3CD63 1YVSA 2XR8B 4XB5A 2K0MA 1BRIA 1BOXA 1IVVA 3OX9A 1IQ8A 3DZLA 5KP3A 3BNEA 1SJWA 1RLSA 4HZBB 1VQM3 1KD14 1IVXA 3DGOA 4MMYB 1K8A4 4HM2B 1I0XA 2XFTA 4LMIA 4RZMA 5IENA 1D6YA 1BUQA 1I70A 1OUNA 1OHSA 1C7HA 2CKFB 2XFSA 3D9RA 4XBXA 1M9GA 2HMLB 4N6OB 1GOYA 1O7HB 1Q40A 3FLJA 2BMRB 3NV0B 4J5GA 1GMQA 1RN4A 3H51A 1SQWA 2J8XB 2RCDA 3G8ZA 1NNVA 4L8OA 4OVMA 1RSNA 2XGLA 4I5QA 1UCJA 4IIAA 1RTUA 2KF6A 2C10A 2OWPA 3CNXA 4XBTA 4EW5A 1BSAA 3Q3FA 2QA43 4KFDA 4O3VA 4LYLB 4GL6A 3A5EA 3H3HA 2CG1A 1NB5I 1TTOA 3EC9A 1AQZA 3LT8A 1ULIB 2KCDA 3CC43 1BNRA 3EN8A 4CDLA 2OTL3 1FA3A 1IU7A 2ML5A 1E97A 3JUQA 1BU4A 1W2ZA 2F98A 4I4KA 2F99A 1N5HA 4NREA 4N3VA 5D82A 3K5TA 1UCLA 1G0TA 3F9SA 3CC73 4HM5B 4HYZA 2W56A 4HM1B 1K41A 3OWSA 3KSPA 2E2TA 5I97A 5JPUA 2FNQA 4O8SA 2M7OA 1DYUA 4NHFA 1NU3A 3MG2A 1OF5A 2WGOA 4GSPA 2OOVA 3E99A 3UJMA 3G4S3 2L4VA 1RRLA 1OPYA 4HBRA 5IG3A 3EQQB 1HYFA 5AYSC 5IG4A 1KQS2 1BRGA 1BRHA 3CCL3 2W03A 2CFGA 1STFI 3IJEB 1W6CA 1FZUA 2AADA 2C4BA 1CYUA 2OQEA 4J5KA 1EEJA 1MWSA 1J2BA 2D42A 3S27A 1FW7A 5LC7A 3UNLA 2OOVC 1I3FA 1X1UA 1M904 1I0VA 1JKGA 1UUWB 2H0IA 3AHSA 3SOYA 3QRDA 1RKYA 1VQ83 3MKIA 1A67A 1BIRA 8CHOA 3G16A 4LSOA 3VGNA 1QAKA 2LYXA 5BVBA 1A2KA 1CH0A 1DMQA 2W0QA 3EJVA 3J7Yd 3EF8A 1A2PA 2OQEC 3F8XA 4MJDA 4QWTA 1W5ZA 3HK4A 4GHOA 2W6JH 3LMLA 1OH0A 3S29A 1B2XA 1PYLA 3WOFB 2K54A 2KAAA 5STDA 3KCHA 2OCTA 1GY6A 1RCLA 5G2GA 1RGLA 1Q9EA 3CCR3 1ZS7A 3SVAA 1T5YA 2Z77A 3WMDA 4IT7A 4XM4A 4XDWA 2P0XA 2F4YA 2ML6A 3AGOA 1Q40B 3BNBA 1O7GB 3D79A 5IW9A 2B1XB 5A0OB 1FGQA 1BRNL 2UUGC 3LTDA 3S67A 1EG9B 1YHQ3 3CCM3 5FW5A 2FXTA 3V92A 2RSXA 1N5PA 3HIIA 3PCSA 5EEOA 1WMOA 1RGEA 3PGBA 5EVHA 2CFKA 3KKGA 3DH2A 4K90B 2D1WA 3ROBA 7RNTA 5ELUA 2CG0A 4JF8A 2RFRA 2P0MA 2OTJ3 1UGHI 3F7XA 3GZXB 3CCS3 3I0YA 1GD4A 4FMAA 1E3VA 1T3BA 1FGOA 3CNMA 1B3SA 2KF5A 1YJ93 3BNDA 3B8LA 2E2VA 3PS8A 2O3OA 2INXA 1BRKA 2JQ5A 1IQXA 3KIIA 4KT3B 2F86B 1TRQA 1UCIA 3S5CA 1QMAA 2F5MA 2GU3A 3LT9A 3LOYA 5AIIA 2P09A 2F5WA 1GSPA 2IMJA 3CU3A 4MMXB 1V58A 4N6TA 1LOVA 2GEXA 5TGNA 2XH9A 5BIRA 3D3LA 3PZWA 3CPOA 2W56B 3L0RA 6GSPA 3KSED 3I553 1MWUA 1UI7A 3CCV3 1N9JA 1K28A 1FGTA 3NUVA 1YNVX 2Z7AA 1RN7A 1PU4A 5D83A 4HZ9B 1EA2A 1OF5B 1LRAA 1VQQA 2CIUA 2CFWA 3EBTA 1W02A 3N54B 1BGSA 2QGUA 3NQYA 4HM3B 3SX1A 3MWZA 3ALAA 1ASKA 1BANA 3OXAA 1BSDA 3SYUA 1I2EA 1VQ43 2W9PA 3OWYA 5CF2A 2C11A 4KZ1A 5EQLA 3WA3A 1AY7A 1BNSA 3F40A 3MPHA 3X3ZA 3NHXA 3MSOA 1RGAA 3DGLA 5G1KA 5AEUB 1MOLA 1Q824 3D5GA 1QVF2 2WOHA 3NBJA 4WYKA 1W6GA 4R80A 1UCKA 4TX4A 2IYJA 2ZL8A 1RGFA 1UGIA 4GB5A 2HMOB 3GRDA 1W7CA 1ULJB 3LH4A 4K1UA 2W04A 3X3YA 2HMJB 3LTBA 2XSOB 1N8QA 4K61A 1BSCA 2L1SA 1JKGB 1YGWA 1UW1A 1FGMA 3RDEA 2BIRA 4Q53A 5BXQA 2PNCA 3DUKA 1TIJA 2XSHB 3CC23 1N8R4 3KE7A 4HM6B 1K734 5AYRB 4R9KA 1D6ZA 3SEDA 1B2ZA 4HM0B 1JN5B 1EUIC 2BNGA 1GOVA 2V1LA 4O02B 1ISKA 3DGYA 3ECFA 4H61A 3NBBA 1SIHA 4BTWA 1GS3A 1RCKA 1WMPA 3FSDA 4BIRA 4EYCA 5BU4A 5KP4A 3CXC2 1W2B2 5IG5A 2BO9B 2P05A 3JUMA 4KFFA 1W6YA 1KSIA 1RNBA 4X2OA 1B2SA 4FCZA 1YIJ3 1AR0A 4RNTA 1YI23 3F7SA 1NO3A 1RJOA 1ZX2A 1B2MA 2PZVA 4FMDA 2HMKB 3V98A 4XDVA 1QALA 2CX1A 1U8CB 3K7CA 5M19A 4ZM8A 1W01A 3NM7A 3GAXA 4L7KA 3RGAA 3WDGB 3SLUA 1BUJA 2KF3A 1EQKA 4LZIA 2CC3A 4HM4B 4BL2A 1IT8A 1BNIA 1FGRA 1YVBI 4J8TA 3FH1A 4HVNA 3IPTA 4H3UA 2GEYA 1BNJA 1IV9A 3OWUA 4U13A 4WP5A 1N9EA 2RNTA 1S5AA 2IA7A 3AHWA 2SBLA 2XF3A 2W9QA 3DY5A 1FUSA 5IEPA 3ZFZA 1I2GA 1JV2B 1LQGC 4L8PA 4MEIA 2CWVA 1RGHA 3A76A 1HZ1A 4IPBA 3EE1A 3STDA 1LQMB 3T8UA 3HZPA 3KN4A 3CPW2 1AV4A 2BT3A 3D4AA 3O8YA 2CFLA 1B21A 3HIGA 3DGNA 4AKZA 2MF7A 3EBYA 3MYTA 3K9MC 3B4PA 2AAEA 3GZYB 3G0KA 4OUQA 4KVHA 3LZAA 5AIHA 2ZDJA 4CPKA 3EN1B 3PYJA 1IYYA
chains in the Genus database with same CATH topology
1JRQA 5AIGA 3G713 2RGQA 3BB9A 1NB3I 5JPPA 3OW22 1OHPA 5D81A 3AMOA 5HGRA 3VF1A 4R9LA 1JJ22 4WYKB 1IVUA 5CXOA 3DMCA 3LXUX 4EBGA 1G96A 2QEX3 3EX9A 1SPUA 4FMBA 3HX8A 3KFQC 2KXGA 1E3RA 3MG1A 1QJGA 3FF0A 4KFEA 1TUHA 2HMMB 1YGEA 2YX9A 4OK0A 1NJI4 3F8HA 3B7CA 1DVCA 1EKMA 4N6LA 1M1XB 1UI8A 4WFOA 1OCVA 3CCJ3 2CH9A 2KRTA 2CHCA 1JB4A 1WNHA 3Q2PA 1LVNA 4RBNA 3X40A 3MG3A 3QK9A 4EV5A 3KZTA 3V99A 1W4NA 3N9HA 2GXFA 2CK3H 1SIIA 2WOFA 2WGQA 3HI7A 3NBRA 3PCRA 4LEHA 4N6UA 4AEQA 3CCU3 3X41A 2XGNA 1A2VA 1CYVA 1UUVB 3X42A 3NXJA 1IK3A 1VQP3 4BTYA 1LOXA 2CFDA 5CLKA 3FGYA 1D6UA 1A90A 3BNCA 3U1WA 2I9WA 6STDA 5JBSA 2XRXB 1TFOA 3GZBA 1NWWA 1KWIA 1QAFA 5FGOA 1WTHA 1GYBA 2Z76A 3DM8A 3N8BA 4FR9A 2P38A 1VQ73 5AI1A 1TFKA 4PEJA 3U97A 3K0ZA 1VQL3 4EC6A 4RNZA 4J9AA 4K1VA 1O7WB 2FGTA 4N6V0 3SOAA 1VQ53 4N6NB 2QIYA 5CK6A 3NQZA 2R4IA 1JNQA 3FZWA 1IT7A 1L5GB 3JUOA 1HKXA 1W00A 4FCMA 4WWUC 1CQSA 1MNLA 2CWUA 3EHCA 3JUPA 1KC84 3T0UA 5AIFA 5AEWB 1YIT3 1ROAA 2O9UX 3ER7A 3WA2X 1VQO3 4AKYA 2E2UA 3IMAB 1NDOB 3I563 3NX0A 3BLZA 5DREA 7STDA 2XEPA 1IVWA 1JB2A 1WMNA 3NM2A 1OACA 1IV7A 2IUJA 5IG0A 1Y4KA 1VQ93 1R4CA 2BHMA 2CWTA 3AMOB 4HM7B 2JDIH 3UL5A 1AVKA 4RNYA 3G6E3 4O2HA 3CMA3 4FMCA 1OHOA 4N6MA 4ORLA 3LTCA 3NV0A 1VQN3 1STDA 3WODG 4EXRA 1RRHA 5ELJA 5DRVA 1ROVA 3RGRA 4G1MB 2Z6BA 3DXOA 3GZRA 4FCJA 2STDA 3K63A 3UL6A 4CCVA 3DGMA 3Q1CA 1Q864 3FG1A 1GD3A 4LGQA 1VZZA 1Q7Y4 2YFIB 4R1KA 2CW9A 3WOEB 1GY7A 4HJLB 1CEWI 2BMQB 5IEOA 3X3XA 4STDA 3JUNA 1ZO2A 1IDPA 1V74A 2WO0A 4BTXA 1YJW3 3SXXA 1Q42A 3UB1A 4HM8B 4JRFA 1AVLA 1LNHA 4MMZB 1S723 1FUWA 1HU9A 1OGZA 1JB5A 1US1A 3B4OA 1IQYA 5KP1A 1JN5A 3GWRA 1DMMA 2Y74A 2YFLB 5CF1A 1O7PB 3FF2A 5IERA 4HKVB 4WHAA 3F14A 3OV4A 1TU5A 1TP6A 1YJN3 2A15A 3M8CA 2B24B 4R4KA 3EB8A 2UX0A 4XBYA 1LXEA 1K9M4 1Z1SA 3FG4A 2GBWB 3FKAA 3Q90A 2Q07A 1WQLB 1GY5A 3VSYA 3JVCA 1F8NA 1M1K4 1DMNA 3CCE3 1O7NB 3CME3 2HMNB 3T8NA 2GBXB 3TDGA 2YFJB 1OGXA 2W2CA 3FG3A 3LTAA 1O7MB 3PXMA 3LYGA 5LC6A 5IF6A 2GU1A 3CCQ3 1U5OA 1VQ63 4X2HA 4EV2A 2MC8A 3FCSB 3MHEA 2Y73A 2BMOB 1PFPA 1VQK3 2IUKA 3S28A 1QVG2 3CD63 2LQVA 2XR8B 4XB5A 2K0MA 1IVVA 3OX9A 1IQ8A 3DZLA 5KP3A 3BNEA 1SJWA 4HZBB 1VQM3 1KD14 1IVXA 3DGOA 4MMYB 1K8A4 4HM2B 2XFTA 4LMIA 4RZMA 5IENA 1DVDA 1D6YA 1BUQA 1OUNA 1OHSA 1C7HA 2CKFB 2XFSA 3D9RA 4XBXA 1M9GA 2HMLB 4N6OB 1O7HB 1Q40A 3FLJA 2BMRB 3NV0B 3H51A 1SQWA 2RCDA 3G8ZA 4OVMA 4L8OA 2XGLA 4IIAA 2C10A 2OWPA 3CNXA 4XBTA 2QA43 4KFDA 4O3VA 4GL6A 3H3HA 2CG1A 1NB5I 3EC9A 3LT8A 3CC43 1ULIB 2KCDA 3EN8A 4CDLA 2OTL3 1FA3A 1IU7A 2ML5A 1E97A 3JUQA 1W2ZA 2F98A 4I4KA 2F99A 1N5HA 4NREA 4N3VA 5D82A 3K5TA 3F9SA 3CC73 4HM5B 4HYZA 2W56A 4HM1B 1K41A 3OWSA 3KSPA 2E2TA 5I97A 5JPUA 2FNQA 4O8SA 2M7OA 1DYUA 4NHFA 1NU3A 3MG2A 1OF5A 2WGOA 2OOVA 3E99A 3UJMA 3G4S3 2L4VA 1RRLA 1OPYA 4HBRA 5IG3A 3EQQB 5AYSC 5IG4A 1KQS2 3CCL3 2W03A 2CFGA 1STFI 3IJEB 1W6CA 1CYUA 2OQEA 1J2BA 2D42A 3S27A 5LC7A 3UNLA 2OOVC 1M904 1JKGA 1UUWB 3SOYA 1RKYA 3QRDA 1VQ83 3MKIA 1A67A 8CHOA 3G16A 4LSOA 3VGNA 1QAKA 2LYXA 5BVBA 1A2KA 1DMQA 2W0QA 3J7Yd 3EJVA 3EF8A 2OQEC 4MJDA 3F8XA 4QWTA 1W5ZA 3HK4A 2W6JH 3LMLA 1OH0A 3S29A 3WOFB 2K54A 5STDA 2OCTA 1GY6A 5G2GA 3CCR3 3SVAA 1T5YA 2Z77A 3WMDA 4IT7A 4XM4A 4XDWA 2P0XA 2ML6A 1Q40B 3BNBA 1O7GB 5IW9A 2B1XB 5A0OB 1FGQA 3LTDA 3S67A 1EG9B 1YHQ3 3CCM3 5FW5A 2FXTA 3V92A 2RSXA 1N5PA 3HIIA 3PCSA 5EEOA 1WMOA 3PGBA 5EVHA 2CFKA 3KKGA 4K90B 2D1WA 3ROBA 5ELUA 2CG0A 4JF8A 2RFRA 2P0MA 2OTJ3 3GZXB 3F7XA 3CCS3 3I0YA 1GD4A 4FMAA 1E3VA 1FGOA 3CNMA 1YJ93 3BNDA 3B8LA 2E2VA 3PS8A 2O3OA 2INXA 2JQ5A 1IQXA 3KIIA 1Q814 2F86B 3S5CA 1QMAA 3LT9A 2GU3A 3LOYA 5AIIA 2P09A 2IMJA 3CU3A 4MMXB 4N6TA 2GEXA 5TGNA 2XH9A 3D3LA 3PZWA 3CPOA 2W56B 3L0RA 3I553 3KSED 1UI7A 3CCV3 1N9JA 1K28A 1FGTA 3NUVA 2Z7AA 1RN7A 1PU4A 5D83A 4HZ9B 1EA2A 1OF5B 2CIUA 3N54B 2CFWA 3EBTA 1W02A 2QGUA 3NQYA 4HM3B 3SX1A 3MWZA 3ALAA 1ASKA 3OXAA 1VQ43 2W9PA 3OWYA 5CF2A 2C11A 4KZ1A 5EQLA 3WA3A 3F40A 5AEUB 3MPHA 3X3ZA 3NHXA 3MSOA 1Q824 3DGLA 1MOLA 1QVF2 2WOHA 3NBJA 4WYKA 1W6GA 4R80A 4TX4A 2ZL8A 4GB5A 2HMOB 3GRDA 1W7CA 1ULJB 3LH4A 4K1UA 2W04A 3X3YA 2HMJB 3LTBA 2XSOB 1N8QA 4K61A 1JKGB 1UW1A 1FGMA 3RDEA 4Q53A 5BXQA 2PNCA 3DUKA 1TIJA 2XSHB 3CC23 1N8R4 3KE7A 4HM6B 1K734 5AYRB 4R9KA 1D6ZA 3SEDA 4HM0B 1JN5B 2BNGA 2V1LA 4O02B 1ISKA 3ECFA 4H61A 3NBBA 1SIHA 4BTWA 1GS3A 3FSDA 1WMPA 4EYCA 3CXC2 5KP4A 1W2B2 5IG5A 2BO9B 2P05A 3JUMA 4KFFA 1W6YA 1KSIA 4X2OA 4FCZA 1YIJ3 1AR0A 1YI23 3F7SA 1NO3A 1RJOA 1ZX2A 2PZVA 4FMDA 2HMKB 3V98A 4XDVA 1QALA 1U8CB 3K7CA 4ZM8A 1W01A 3NM7A 3GAXA 4L7KA 3RGAA 3WDGB 3SLUA 1EQKA 4LZIA 2CC3A 4HM4B 1IT8A 1FGRA 1YVBI 4J8TA 3FH1A 4HVNA 3IPTA 4H3UA 2GEYA 1IV9A 3OWUA 4U13A 4WP5A 1N9EA 1S5AA 2IA7A 2SBLA 2XF3A 2W9QA 3DY5A 5IEPA 1JV2B 4L8PA 4MEIA 3A76A 2CWVA 4IPBA 3EE1A 3STDA 3T8UA 3HZPA 3KN4A 3CPW2 1AV4A 2BT3A 3O8YA 2CFLA 3HIGA 3DGNA 4AKZA 2MF7A 3EBYA 3MYTA 3K9MC 3B4PA 3GZYB 3G0KA 4OUQA 4KVHA 3LZAA 5AIHA 2ZDJA 3EN1B 3PYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIG A;  2RGQ A;  3BB9 A;  5JPP A;  1OHP A;  5D81 A;  5HGR A;  4R9L A;  4WYK B;  5CXO A;  3DMC A;  3EX9 A;  3HX8 A;  1E3R A;  3MG1 A;  1QJG A;  3FF0 A;  1TUH A;  2HMM B;  3F8H A;  3B7C A;  1OCV A;  2CHC A;  1JB4 A;  3MG3 A;  3KZT A;  2GXF A;  3NBR A;  4LEH A;  1UUV B;  3NXJ A;  5CLK A;  3FGY A;  2I9W A;  6STD A;  2XRX B;  3GZB A;  1NWW A;  1GYB A;  2Z76 A;  3DM8 A;  5AI1 A;  4PEJ A;  3K0Z A;  4J9A A;  4K1V A;  1O7W B;  3SOA A;  2QIY A;  5CK6 A;  2R4I A;  3FZW A;  3JUO A;  1HKX A;  1W00 A;  4FCM A;  4WWU C;  1CQS A;  3EHC A;  3JUP A;  5AIF A;  5AEW B;  3ER7 A;  1NDO B;  3BLZ A;  5DRE A;  7STD A;  1JB2 A;  3NM2 A;  5IG0 A;  4HM7 B;  1OHO A;  4ORL A;  3NV0 A;  1STD A;  5DRV A;  3RGR A;  3DXO A;  3GZR A;  4FCJ A;  2STD A;  4LGQ A;  1VZZ A;  2YFI B;  4R1K A;  1GY7 A;  4HJL B;  2BMQ B;  5IEO A;  4STD A;  3JUN A;  1ZO2 A;  1IDP A;  1Q42 A;  4HM8 B;  1OGZ A;  1JB5 A;  3B4O A;  5KP1 A;  1JN5 A;  3GWR A;  1DMM A;  2YFL B;  5CF1 A;  1O7P B;  3FF2 A;  5IER A;  4HKV B;  3F14 A;  3OV4 A;  1TP6 A;  2A15 A;  3M8C A;  2B24 B;  2UX0 A;  4XBY A;  1Z1S A;  2GBW B;  3FKA A;  3Q90 A;  3VSY A;  1WQL B;  1GY5 A;  1DMN A;  1O7N B;  2HMN B;  3T8N A;  2GBX B;  2YFJ B;  1OGX A;  2W2C A;  1O7M B;  3LYG A;  5IF6 A;  1U5O A;  4X2H A;  3MHE A;  2BMO B;  2XR8 B;  4XB5 A;  3OX9 A;  3DZL A;  5KP3 A;  1SJW A;  4HZB B;  4HM2 B;  4LMI A;  4RZM A;  5IEN A;  1BUQ A;  1OUN A;  1OHS A;  1C7H A;  2CKF B;  3D9R A;  4XBX A;  2HML B;  1O7H B;  1Q40 A;  3FLJ A;  2BMR B;  3NV0 B;  3H51 A;  2RCD A;  3G8Z A;  4OVM A;  4L8O A;  4IIA A;  2OWP A;  3CNX A;  4XBT A;  3H3H A;  3EC9 A;  1ULI B;  3EN8 A;  4CDL A;  1E97 A;  3JUQ A;  2F98 A;  4I4K A;  2F99 A;  4N3V A;  5D82 A;  3F9S A;  4HM5 B;  4HM1 B;  1K41 A;  3OWS A;  3KSP A;  5JPU A;  1NU3 A;  3MG2 A;  1OF5 A;  3E99 A;  3UJM A;  1OPY A;  5IG3 A;  3EQQ B;  5IG4 A;  3UNL A;  1JKG A;  1UUW B;  3SOY A;  3MKI A;  8CHO A;  3G16 A;  3VGN A;  5BVB A;  1A2K A;  1DMQ A;  3EJV A;  3EF8 A;  4MJD A;  3F8X A;  3HK4 A;  1OH0 A;  2K54 A;  5STD A;  1GY6 A;  5G2G A;  2Z77 A;  3WMD A;  4XM4 A;  4XDW A;  1Q40 B;  1O7G B;  2B1X B;  1EG9 B;  5FW5 A;  5EVH A;  3KKG A;  3ROB A;  2RFR A;  3GZX B;  3F7X A;  3I0Y A;  1E3V A;  3CNM A;  3B8L A;  2INX A;  2JQ5 A;  2F86 B;  3S5C A;  1QMA A;  5AII A;  2IMJ A;  3CU3 A;  2GEX A;  5TGN A;  3CPO A;  3NUV A;  2Z7A A;  5D83 A;  4HZ9 B;  1EA2 A;  1OF5 B;  3EBT A;  1W02 A;  2QGU A;  4HM3 B;  1ASK A;  3OXA A;  3OWY A;  5CF2 A;  3F40 A;  5AEU B;  3NHX A;  3MSO A;  4WYK A;  4GB5 A;  2HMO B;  3GRD A;  1ULJ B;  4K1U A;  2HMJ B;  2XSO B;  1JKG B;  4Q53 A;  5BXQ A;  3DUK A;  2XSH B;  3KE7 A;  4HM6 B;  4R9K A;  3SED A;  4HM0 B;  1JN5 B;  2BNG A;  1ISK A;  3ECF A;  1GS3 A;  3FSD A;  5KP4 A;  5IG5 A;  3JUM A;  1W6Y A;  4X2O A;  1AR0 A;  3F7S A;  1ZX2 A;  2PZV A;  2HMK B;  4XDV A;  3K7C A;  1W01 A;  4L7K A;  3RGA A;  4HM4 B;  4J8T A;  3FH1 A;  4HVN A;  3IPT A;  4H3U A;  2GEY A;  4U13 A;  3OWU A;  4WP5 A;  1S5A A;  5IEP A;  4L8P A;  3A76 A;  3STD A;  3T8U A;  3HZP A;  3EBY A;  3MYT A;  3B4P A;  3GZY B;  3G0K A;  4OUQ A;  4KVH A;  3LZA A;  5AIH A;  3EN1 B; 
#chains in the Genus database with same CATH topology
 1JRQ A;  5AIG A;  3G71 3;  2RGQ A;  3BB9 A;  3URP A;  8RNT A;  2BU4 A;  1NB3 I;  5JPP A;  3OW2 2;  1OHP A;  5D81 A;  1FUT A;  3AMO A;  5HGR A;  3VF1 A;  4R9L A;  1JJ2 2;  4WYK B;  1IVU A;  2H0H A;  5CXO A;  3DMC A;  3LXU X;  4EBG A;  1G96 A;  2QEX 3;  3EX9 A;  1SPU A;  4FMB A;  3HX8 A;  3KFQ C;  2KXG A;  1E3R A;  1UUG B;  3MG1 A;  1QJG A;  3FF0 A;  4KFE A;  2H0G A;  1JZD A;  1BRJ A;  1TUH A;  2HMM B;  1YGE A;  2YX9 A;  4OK0 A;  1LOY A;  1TRP A;  1NJI 4;  3F8H A;  3B7C A;  2IY2 A;  1DVC A;  1EKM A;  4N6L A;  2SAR A;  1M1X B;  1RN1 A;  1UI8 A;  4WFO A;  1OCV A;  3CCJ 3;  2K3D A;  2CH9 A;  2KRT A;  2CHC A;  1JB4 A;  1WNH A;  3Q2P A;  1LVN A;  4RBN A;  3X40 A;  3MG3 A;  5RNT A;  3QK9 A;  4EV5 A;  3KZT A;  3V99 A;  1W4N A;  3N9H A;  2GXF A;  2CK3 H;  1SII A;  2WOF A;  1C54 A;  1B20 A;  1ZGX A;  2WGQ A;  3HI7 A;  3NBR A;  1BAO A;  3PCR A;  4LEH A;  2HOH A;  9RNT A;  1MWT A;  4N6U A;  4AEQ A;  3CCU 3;  3X41 A;  1X1W A;  2XGN A;  1A2V A;  1CYV A;  1MWR A;  1UUV B;  3X42 A;  3NXJ A;  1IK3 A;  3HOH A;  1VQP 3;  5M1A A;  1LOX A;  2CFD A;  4BTY A;  5CLK A;  3FGY A;  1D6U A;  4HOH A;  1A90 A;  3BNC A;  3U1W A;  2I9W A;  3ZG0 A;  6STD A;  5JBS A;  1GMP A;  2XRX B;  1TFO A;  3GZB A;  1LOW A;  1NWW A;  1KWI A;  1QAF A;  5FGO A;  1T2H A;  1WTH A;  3BIR A;  1GYB A;  2Z76 A;  3DM8 A;  3N8B A;  4FR9 A;  1BNE A;  2P38 A;  5AI1 A;  1TFK A;  4PEJ A;  3U97 A;  3K0Z A;  1VQ7 3;  1VQL 3;  4EC6 A;  4RNZ A;  1FYS A;  4J9A A;  4K1V A;  1O7W B;  2FGT A;  2KF4 A;  4N6V 0;  3SOA A;  1VQ5 3;  4N6N B;  3WHO A;  1UDI I;  2QIY A;  5CK6 A;  3NQZ A;  2R4I A;  1JNQ A;  1RMS A;  1I8V A;  1IT7 A;  3FZW A;  1L5G B;  3JUO A;  1HKX A;  1W00 A;  4FCM A;  1B27 A;  4WWU C;  1CQS A;  4NPB A;  1MNL A;  2CWU A;  2F56 A;  1PY3 A;  3EHC A;  3JUP A;  4CJN A;  1KC8 4;  3T0U A;  1DE3 A;  5AIF A;  5AEW B;  1YIT 3;  1ROA A;  2O9U X;  3ER7 A;  3WA2 X;  1VQO 3;  1JBR A;  4AKY A;  2E2U A;  3IMA B;  1NDO B;  3I56 3;  3NX0 A;  3BLZ A;  5DRE A;  7STD A;  2XEP A;  1IVW A;  3RNT A;  1JB2 A;  1B2U A;  1WMN A;  3NM2 A;  1OAC A;  1JBS A;  1IV7 A;  2IUJ A;  5IG0 A;  1Y4K A;  1MGR A;  1X1Y A;  1R4C A;  2BHM A;  1VQ9 3;  2CWT A;  3AMO B;  4HM7 B;  2JDI H;  3UL5 A;  1AVK A;  1JBT A;  1RGC A;  2CX0 A;  1G02 A;  4RNY A;  3G6E 3;  4O2H A;  4ILF A;  4BL3 A;  3CMA 3;  1X1X A;  4FMC A;  1OHO A;  4N6M A;  4ORL A;  3LTC A;  3NV0 A;  1VQN 3;  1STD A;  3WOD G;  4EXR A;  4HAA A;  1RRH A;  1V57 A;  1R4Y A;  5ELJ A;  1DVD A;  5DRV A;  1RGK A;  3BU4 A;  1Q7H A;  1BSE A;  2ZA4 A;  1ROV A;  3RGR A;  4G1M B;  1TJD A;  2Z6B A;  3DXO A;  3GZR A;  4FCJ A;  1LNI A;  2STD A;  1RDS A;  3K63 A;  3UL6 A;  4CCV A;  3DGM A;  3Q1C A;  3WR2 A;  1SAR A;  1Q86 4;  7GSP A;  3FG1 A;  1GD3 A;  4LGQ A;  1VZZ A;  1Q7Y 4;  2YFI B;  4R1K A;  2CW9 A;  3WOE B;  1GY7 A;  4HJL B;  1CEW I;  2BMQ B;  5IEO A;  2RBI A;  4STD A;  3JUN A;  1ZO2 A;  1IDP A;  1V74 A;  2WO0 A;  3X3X A;  5HOH A;  5GSP A;  4BTX A;  1YJW 3;  3SXX A;  1Q42 A;  3UB1 A;  4HM8 B;  4JRF A;  1AVL A;  1GMR A;  1LNH A;  1RGG A;  4MMZ B;  4DKI A;  1S72 3;  1FUW A;  1HU9 A;  6RNT A;  1OGZ A;  1JB5 A;  1T2I A;  1US1 A;  3B4O A;  1IQY A;  5KP1 A;  1JN5 A;  3GWR A;  1DMM A;  3AGN A;  2Y74 A;  2YFL B;  5CF1 A;  1O7P B;  1BVI A;  3FF2 A;  2ZHX B;  5IER A;  4HKV B;  4WHA A;  1I3I A;  5G1L A;  3GSP A;  1DET A;  3D5I A;  3F14 A;  3OV4 A;  1TU5 A;  1TP6 A;  1YJN 3;  1RNT A;  2A15 A;  3M8C A;  1GOU A;  2B24 B;  4R4K A;  3EB8 A;  2UX0 A;  4XBY A;  1LXE A;  1K9M 4;  1Z1S A;  3FG4 A;  2GBW B;  3FKA A;  3Q90 A;  2R41 A;  2Q07 A;  1WQL B;  1GY5 A;  3VSY A;  3JVC A;  1F8N A;  2UGI A;  1M1K 4;  1DMN A;  3CCE 3;  1O7N B;  3CME 3;  1BNF A;  2HMN B;  3T8N A;  1MGW A;  2GBX B;  2GSP A;  2YFJ B;  3TDG A;  1OGX A;  1BSB A;  2W2C A;  1Q81 4;  3FG3 A;  3LTA A;  1O7M B;  3PXM A;  3LYG A;  5LC6 A;  5IF6 A;  2GU1 A;  3CCQ 3;  1U5O A;  1BNG A;  1BRS A;  4X2H A;  4EV2 A;  1VQ6 3;  2MC8 A;  1RHL A;  3FCS B;  1I2F A;  3MHE A;  2Y73 A;  2BMO B;  1PFP A;  3ZG5 A;  2IUK A;  3S28 A;  4BU4 A;  5M18 A;  1VQK 3;  2LQV A;  1QVG 2;  1JZO A;  3CD6 3;  1YVS A;  2XR8 B;  4XB5 A;  2K0M A;  1BRI A;  1BOX A;  1IVV A;  3OX9 A;  1IQ8 A;  3DZL A;  5KP3 A;  3BNE A;  1SJW A;  1RLS A;  4HZB B;  1VQM 3;  1KD1 4;  1IVX A;  3DGO A;  4MMY B;  1K8A 4;  4HM2 B;  1I0X A;  2XFT A;  4LMI A;  4RZM A;  5IEN A;  1D6Y A;  1BUQ A;  1I70 A;  1OUN A;  1OHS A;  1C7H A;  2CKF B;  2XFS A;  3D9R A;  4XBX A;  1M9G A;  2HML B;  4N6O B;  1GOY A;  1O7H B;  1Q40 A;  3FLJ A;  2BMR B;  3NV0 B;  4J5G A;  1GMQ A;  1RN4 A;  3H51 A;  1SQW A;  2J8X B;  2RCD A;  3G8Z A;  1NNV A;  4L8O A;  4OVM A;  1RSN A;  2XGL A;  4I5Q A;  1UCJ A;  4IIA A;  1RTU A;  2KF6 A;  2C10 A;  2OWP A;  3CNX A;  4XBT A;  4EW5 A;  1BSA A;  3Q3F A;  2QA4 3;  4KFD A;  4O3V A;  4LYL B;  4GL6 A;  3A5E A;  3H3H A;  2CG1 A;  1NB5 I;  1TTO A;  3EC9 A;  1AQZ A;  3LT8 A;  1ULI B;  2KCD A;  3CC4 3;  1BNR A;  3EN8 A;  4CDL A;  2OTL 3;  1FA3 A;  1IU7 A;  2ML5 A;  1E97 A;  3JUQ A;  1BU4 A;  1W2Z A;  2F98 A;  4I4K A;  2F99 A;  1N5H A;  4NRE A;  4N3V A;  5D82 A;  3K5T A;  1UCL A;  1G0T A;  3F9S A;  3CC7 3;  4HM5 B;  4HYZ A;  2W56 A;  4HM1 B;  1K41 A;  3OWS A;  3KSP A;  2E2T A;  5I97 A;  5JPU A;  2FNQ A;  4O8S A;  2M7O A;  1DYU A;  4NHF A;  1NU3 A;  3MG2 A;  1OF5 A;  2WGO A;  4GSP A;  2OOV A;  3E99 A;  3UJM A;  3G4S 3;  2L4V A;  1RRL A;  1OPY A;  4HBR A;  5IG3 A;  3EQQ B;  1HYF A;  5AYS C;  5IG4 A;  1KQS 2;  1BRG A;  1BRH A;  3CCL 3;  2W03 A;  2CFG A;  1STF I;  3IJE B;  1W6C A;  1FZU A;  2AAD A;  2C4B A;  1CYU A;  2OQE A;  4J5K A;  1EEJ A;  1MWS A;  1J2B A;  2D42 A;  3S27 A;  1FW7 A;  5LC7 A;  3UNL A;  2OOV C;  1I3F A;  1X1U A;  1M90 4;  1I0V A;  1JKG A;  1UUW B;  2H0I A;  3AHS A;  3SOY A;  3QRD A;  1RKY A;  1VQ8 3;  3MKI A;  1A67 A;  1BIR A;  8CHO A;  3G16 A;  4LSO A;  3VGN A;  1QAK A;  2LYX A;  5BVB A;  1A2K A;  1CH0 A;  1DMQ A;  2W0Q A;  3EJV A;  3J7Y d;  3EF8 A;  1A2P A;  2OQE C;  3F8X A;  4MJD A;  4QWT A;  1W5Z A;  3HK4 A;  4GHO A;  2W6J H;  3LML A;  1OH0 A;  3S29 A;  1B2X A;  1PYL A;  3WOF B;  2K54 A;  2KAA A;  5STD A;  3KCH A;  2OCT A;  1GY6 A;  1RCL A;  5G2G A;  1RGL A;  1Q9E A;  3CCR 3;  1ZS7 A;  3SVA A;  1T5Y A;  2Z77 A;  3WMD A;  4IT7 A;  4XM4 A;  4XDW A;  2P0X A;  2F4Y A;  2ML6 A;  3AGO A;  1Q40 B;  3BNB A;  1O7G B;  3D79 A;  5IW9 A;  2B1X B;  5A0O B;  1FGQ A;  1BRN L;  2UUG C;  3LTD A;  3S67 A;  1EG9 B;  1YHQ 3;  3CCM 3;  5FW5 A;  2FXT A;  3V92 A;  2RSX A;  1N5P A;  3HII A;  3PCS A;  5EEO A;  1WMO A;  1RGE A;  3PGB A;  5EVH A;  2CFK A;  3KKG A;  3DH2 A;  4K90 B;  2D1W A;  3ROB A;  7RNT A;  5ELU A;  2CG0 A;  4JF8 A;  2RFR A;  2P0M A;  2OTJ 3;  1UGH I;  3F7X A;  3GZX B;  3CCS 3;  3I0Y A;  1GD4 A;  4FMA A;  1E3V A;  1T3B A;  1FGO A;  3CNM A;  1B3S A;  2KF5 A;  1YJ9 3;  3BND A;  3B8L A;  2E2V A;  3PS8 A;  2O3O A;  2INX A;  1BRK A;  2JQ5 A;  1IQX A;  3KII A;  4KT3 B;  2F86 B;  1TRQ A;  1UCI A;  3S5C A;  1QMA A;  2F5M A;  2GU3 A;  3LT9 A;  3LOY A;  5AII A;  2P09 A;  2F5W A;  1GSP A;  2IMJ A;  3CU3 A;  4MMX B;  1V58 A;  4N6T A;  1LOV A;  2GEX A;  5TGN A;  2XH9 A;  5BIR A;  3D3L A;  3PZW A;  3CPO A;  2W56 B;  3L0R A;  6GSP A;  3KSE D;  3I55 3;  1MWU A;  1UI7 A;  3CCV 3;  1N9J A;  1K28 A;  1FGT A;  3NUV A;  1YNV X;  2Z7A A;  1RN7 A;  1PU4 A;  5D83 A;  4HZ9 B;  1EA2 A;  1OF5 B;  1LRA A;  1VQQ A;  2CIU A;  2CFW A;  3EBT A;  1W02 A;  3N54 B;  1BGS A;  2QGU A;  3NQY A;  4HM3 B;  3SX1 A;  3MWZ A;  3ALA A;  1ASK A;  1BAN A;  3OXA A;  1BSD A;  3SYU A;  1I2E A;  1VQ4 3;  2W9P A;  3OWY A;  5CF2 A;  2C11 A;  4KZ1 A;  5EQL A;  3WA3 A;  1AY7 A;  1BNS A;  3F40 A;  3MPH A;  3X3Z A;  3NHX A;  3MSO A;  1RGA A;  3DGL A;  5G1K A;  5AEU B;  1MOL A;  1Q82 4;  3D5G A;  1QVF 2;  2WOH A;  3NBJ A;  4WYK A;  1W6G A;  4R80 A;  1UCK A;  4TX4 A;  2IYJ A;  2ZL8 A;  1RGF A;  1UGI A;  4GB5 A;  2HMO B;  3GRD A;  1W7C A;  1ULJ B;  3LH4 A;  4K1U A;  2W04 A;  3X3Y A;  2HMJ B;  3LTB A;  2XSO B;  1N8Q A;  4K61 A;  1BSC A;  2L1S A;  1JKG B;  1YGW A;  1UW1 A;  1FGM A;  3RDE A;  2BIR A;  4Q53 A;  5BXQ A;  2PNC A;  3DUK A;  1TIJ A;  2XSH B;  3CC2 3;  1N8R 4;  3KE7 A;  4HM6 B;  1K73 4;  5AYR B;  4R9K A;  1D6Z A;  3SED A;  1B2Z A;  4HM0 B;  1JN5 B;  1EUI C;  2BNG A;  1GOV A;  2V1L A;  4O02 B;  1ISK A;  3DGY A;  3ECF A;  4H61 A;  3NBB A;  1SIH A;  4BTW A;  1GS3 A;  1RCK A;  1WMP A;  3FSD A;  4BIR A;  4EYC A;  5BU4 A;  5KP4 A;  3CXC 2;  1W2B 2;  5IG5 A;  2BO9 B;  2P05 A;  3JUM A;  4KFF A;  1W6Y A;  1KSI A;  1RNB A;  4X2O A;  1B2S A;  4FCZ A;  1YIJ 3;  1AR0 A;  4RNT A;  1YI2 3;  3F7S A;  1NO3 A;  1RJO A;  1ZX2 A;  1B2M A;  2PZV A;  4FMD A;  2HMK B;  3V98 A;  4XDV A;  1QAL A;  2CX1 A;  1U8C B;  3K7C A;  5M19 A;  4ZM8 A;  1W01 A;  3NM7 A;  3GAX A;  4L7K A;  3RGA A;  3WDG B;  3SLU A;  1BUJ A;  2KF3 A;  1EQK A;  4LZI A;  2CC3 A;  4HM4 B;  4BL2 A;  1IT8 A;  1BNI A;  1FGR A;  1YVB I;  4J8T A;  3FH1 A;  4HVN A;  3IPT A;  4H3U A;  2GEY A;  1BNJ A;  1IV9 A;  3OWU A;  4U13 A;  4WP5 A;  1N9E A;  2RNT A;  1S5A A;  2IA7 A;  3AHW A;  2SBL A;  2XF3 A;  2W9Q A;  3DY5 A;  1FUS A;  5IEP A;  3ZFZ A;  1I2G A;  1JV2 B;  1LQG C;  4L8P A;  4MEI A;  2CWV A;  1RGH A;  3A76 A;  1HZ1 A;  4IPB A;  3EE1 A;  3STD A;  1LQM B;  3T8U A;  3HZP A;  3KN4 A;  3CPW 2;  1AV4 A;  2BT3 A;  3D4A A;  3O8Y A;  2CFL A;  1B21 A;  3HIG A;  3DGN A;  4AKZ A;  2MF7 A;  3EBY A;  3MYT A;  3K9M C;  3B4P A;  2AAE A;  3GZY B;  3G0K A;  4OUQ A;  4KVH A;  3LZA A;  5AIH A;  2ZDJ A;  4CPK A;  3EN1 B;  3PYJ A;  1IYY A; 
#chains in the Genus database with same CATH homology
 1JRQ A;  5AIG A;  3G71 3;  2RGQ A;  3BB9 A;  1NB3 I;  5JPP A;  3OW2 2;  1OHP A;  5D81 A;  3AMO A;  5HGR A;  3VF1 A;  4R9L A;  1JJ2 2;  4WYK B;  1IVU A;  5CXO A;  3DMC A;  3LXU X;  4EBG A;  1G96 A;  2QEX 3;  3EX9 A;  1SPU A;  4FMB A;  3HX8 A;  3KFQ C;  2KXG A;  1E3R A;  3MG1 A;  1QJG A;  3FF0 A;  4KFE A;  1TUH A;  2HMM B;  1YGE A;  2YX9 A;  4OK0 A;  1NJI 4;  3F8H A;  3B7C A;  1DVC A;  1EKM A;  4N6L A;  1M1X B;  1UI8 A;  4WFO A;  1OCV A;  3CCJ 3;  2CH9 A;  2KRT A;  2CHC A;  1JB4 A;  1WNH A;  3Q2P A;  1LVN A;  4RBN A;  3X40 A;  3MG3 A;  3QK9 A;  4EV5 A;  3KZT A;  3V99 A;  1W4N A;  3N9H A;  2GXF A;  2CK3 H;  1SII A;  2WOF A;  2WGQ A;  3HI7 A;  3NBR A;  3PCR A;  4LEH A;  4N6U A;  4AEQ A;  3CCU 3;  3X41 A;  2XGN A;  1A2V A;  1CYV A;  1UUV B;  3X42 A;  3NXJ A;  1IK3 A;  1VQP 3;  4BTY A;  1LOX A;  2CFD A;  5CLK A;  3FGY A;  1D6U A;  1A90 A;  3BNC A;  3U1W A;  2I9W A;  6STD A;  5JBS A;  2XRX B;  1TFO A;  3GZB A;  1NWW A;  1KWI A;  1QAF A;  5FGO A;  1WTH A;  1GYB A;  2Z76 A;  3DM8 A;  3N8B A;  4FR9 A;  2P38 A;  1VQ7 3;  5AI1 A;  1TFK A;  4PEJ A;  3U97 A;  3K0Z A;  1VQL 3;  4EC6 A;  4RNZ A;  4J9A A;  4K1V A;  1O7W B;  2FGT A;  4N6V 0;  3SOA A;  1VQ5 3;  4N6N B;  2QIY A;  5CK6 A;  3NQZ A;  2R4I A;  1JNQ A;  3FZW A;  1IT7 A;  1L5G B;  3JUO A;  1HKX A;  1W00 A;  4FCM A;  4WWU C;  1CQS A;  1MNL A;  2CWU A;  3EHC A;  3JUP A;  1KC8 4;  3T0U A;  5AIF A;  5AEW B;  1YIT 3;  1ROA A;  2O9U X;  3ER7 A;  3WA2 X;  1VQO 3;  4AKY A;  2E2U A;  3IMA B;  1NDO B;  3I56 3;  3NX0 A;  3BLZ A;  5DRE A;  7STD A;  2XEP A;  1IVW A;  1JB2 A;  1WMN A;  3NM2 A;  1OAC A;  1IV7 A;  2IUJ A;  5IG0 A;  1Y4K A;  1VQ9 3;  1R4C A;  2BHM A;  2CWT A;  3AMO B;  4HM7 B;  2JDI H;  3UL5 A;  1AVK A;  4RNY A;  3G6E 3;  4O2H A;  3CMA 3;  4FMC A;  1OHO A;  4N6M A;  4ORL A;  3LTC A;  3NV0 A;  1VQN 3;  1STD A;  3WOD G;  4EXR A;  1RRH A;  5ELJ A;  5DRV A;  1ROV A;  3RGR A;  4G1M B;  2Z6B A;  3DXO A;  3GZR A;  4FCJ A;  2STD A;  3K63 A;  3UL6 A;  4CCV A;  3DGM A;  3Q1C A;  1Q86 4;  3FG1 A;  1GD3 A;  4LGQ A;  1VZZ A;  1Q7Y 4;  2YFI B;  4R1K A;  2CW9 A;  3WOE B;  1GY7 A;  4HJL B;  1CEW I;  2BMQ B;  5IEO A;  3X3X A;  4STD A;  3JUN A;  1ZO2 A;  1IDP A;  1V74 A;  2WO0 A;  4BTX A;  1YJW 3;  3SXX A;  1Q42 A;  3UB1 A;  4HM8 B;  4JRF A;  1AVL A;  1LNH A;  4MMZ B;  1S72 3;  1FUW A;  1HU9 A;  1OGZ A;  1JB5 A;  1US1 A;  3B4O A;  1IQY A;  5KP1 A;  1JN5 A;  3GWR A;  1DMM A;  2Y74 A;  2YFL B;  5CF1 A;  1O7P B;  3FF2 A;  5IER A;  4HKV B;  4WHA A;  3F14 A;  3OV4 A;  1TU5 A;  1TP6 A;  1YJN 3;  2A15 A;  3M8C A;  2B24 B;  4R4K A;  3EB8 A;  2UX0 A;  4XBY A;  1LXE A;  1K9M 4;  1Z1S A;  3FG4 A;  2GBW B;  3FKA A;  3Q90 A;  2Q07 A;  1WQL B;  1GY5 A;  3VSY A;  3JVC A;  1F8N A;  1M1K 4;  1DMN A;  3CCE 3;  1O7N B;  3CME 3;  2HMN B;  3T8N A;  2GBX B;  3TDG A;  2YFJ B;  1OGX A;  2W2C A;  3FG3 A;  3LTA A;  1O7M B;  3PXM A;  3LYG A;  5LC6 A;  5IF6 A;  2GU1 A;  3CCQ 3;  1U5O A;  1VQ6 3;  4X2H A;  4EV2 A;  2MC8 A;  3FCS B;  3MHE A;  2Y73 A;  2BMO B;  1PFP A;  1VQK 3;  2IUK A;  3S28 A;  1QVG 2;  3CD6 3;  2LQV A;  2XR8 B;  4XB5 A;  2K0M A;  1IVV A;  3OX9 A;  1IQ8 A;  3DZL A;  5KP3 A;  3BNE A;  1SJW A;  4HZB B;  1VQM 3;  1KD1 4;  1IVX A;  3DGO A;  4MMY B;  1K8A 4;  4HM2 B;  2XFT A;  4LMI A;  4RZM A;  5IEN A;  1DVD A;  1D6Y A;  1BUQ A;  1OUN A;  1OHS A;  1C7H A;  2CKF B;  2XFS A;  3D9R A;  4XBX A;  1M9G A;  2HML B;  4N6O B;  1O7H B;  1Q40 A;  3FLJ A;  2BMR B;  3NV0 B;  3H51 A;  1SQW A;  2RCD A;  3G8Z A;  4OVM A;  4L8O A;  2XGL A;  4IIA A;  2C10 A;  2OWP A;  3CNX A;  4XBT A;  2QA4 3;  4KFD A;  4O3V A;  4GL6 A;  3H3H A;  2CG1 A;  1NB5 I;  3EC9 A;  3LT8 A;  3CC4 3;  1ULI B;  2KCD A;  3EN8 A;  4CDL A;  2OTL 3;  1FA3 A;  1IU7 A;  2ML5 A;  1E97 A;  3JUQ A;  1W2Z A;  2F98 A;  4I4K A;  2F99 A;  1N5H A;  4NRE A;  4N3V A;  5D82 A;  3K5T A;  3F9S A;  3CC7 3;  4HM5 B;  4HYZ A;  2W56 A;  4HM1 B;  1K41 A;  3OWS A;  3KSP A;  2E2T A;  5I97 A;  5JPU A;  2FNQ A;  4O8S A;  2M7O A;  1DYU A;  4NHF A;  1NU3 A;  3MG2 A;  1OF5 A;  2WGO A;  2OOV A;  3E99 A;  3UJM A;  3G4S 3;  2L4V A;  1RRL A;  1OPY A;  4HBR A;  5IG3 A;  3EQQ B;  5AYS C;  5IG4 A;  1KQS 2;  3CCL 3;  2W03 A;  2CFG A;  1STF I;  3IJE B;  1W6C A;  1CYU A;  2OQE A;  1J2B A;  2D42 A;  3S27 A;  5LC7 A;  3UNL A;  2OOV C;  1M90 4;  1JKG A;  1UUW B;  3SOY A;  1RKY A;  3QRD A;  1VQ8 3;  3MKI A;  1A67 A;  8CHO A;  3G16 A;  4LSO A;  3VGN A;  1QAK A;  2LYX A;  5BVB A;  1A2K A;  1DMQ A;  2W0Q A;  3J7Y d;  3EJV A;  3EF8 A;  2OQE C;  4MJD A;  3F8X A;  4QWT A;  1W5Z A;  3HK4 A;  2W6J H;  3LML A;  1OH0 A;  3S29 A;  3WOF B;  2K54 A;  5STD A;  2OCT A;  1GY6 A;  5G2G A;  3CCR 3;  3SVA A;  1T5Y A;  2Z77 A;  3WMD A;  4IT7 A;  4XM4 A;  4XDW A;  2P0X A;  2ML6 A;  1Q40 B;  3BNB A;  1O7G B;  5IW9 A;  2B1X B;  5A0O B;  1FGQ A;  3LTD A;  3S67 A;  1EG9 B;  1YHQ 3;  3CCM 3;  5FW5 A;  2FXT A;  3V92 A;  2RSX A;  1N5P A;  3HII A;  3PCS A;  5EEO A;  1WMO A;  3PGB A;  5EVH A;  2CFK A;  3KKG A;  4K90 B;  2D1W A;  3ROB A;  5ELU A;  2CG0 A;  4JF8 A;  2RFR A;  2P0M A;  2OTJ 3;  3GZX B;  3F7X A;  3CCS 3;  3I0Y A;  1GD4 A;  4FMA A;  1E3V A;  1FGO A;  3CNM A;  1YJ9 3;  3BND A;  3B8L A;  2E2V A;  3PS8 A;  2O3O A;  2INX A;  2JQ5 A;  1IQX A;  3KII A;  1Q81 4;  2F86 B;  3S5C A;  1QMA A;  3LT9 A;  2GU3 A;  3LOY A;  5AII A;  2P09 A;  2IMJ A;  3CU3 A;  4MMX B;  4N6T A;  2GEX A;  5TGN A;  2XH9 A;  3D3L A;  3PZW A;  3CPO A;  2W56 B;  3L0R A;  3I55 3;  3KSE D;  1UI7 A;  3CCV 3;  1N9J A;  1K28 A;  1FGT A;  3NUV A;  2Z7A A;  1RN7 A;  1PU4 A;  5D83 A;  4HZ9 B;  1EA2 A;  1OF5 B;  2CIU A;  3N54 B;  2CFW A;  3EBT A;  1W02 A;  2QGU A;  3NQY A;  4HM3 B;  3SX1 A;  3MWZ A;  3ALA A;  1ASK A;  3OXA A;  1VQ4 3;  2W9P A;  3OWY A;  5CF2 A;  2C11 A;  4KZ1 A;  5EQL A;  3WA3 A;  3F40 A;  5AEU B;  3MPH A;  3X3Z A;  3NHX A;  3MSO A;  1Q82 4;  3DGL A;  1MOL A;  1QVF 2;  2WOH A;  3NBJ A;  4WYK A;  1W6G A;  4R80 A;  4TX4 A;  2ZL8 A;  4GB5 A;  2HMO B;  3GRD A;  1W7C A;  1ULJ B;  3LH4 A;  4K1U A;  2W04 A;  3X3Y A;  2HMJ B;  3LTB A;  2XSO B;  1N8Q A;  4K61 A;  1JKG B;  1UW1 A;  1FGM A;  3RDE A;  4Q53 A;  5BXQ A;  2PNC A;  3DUK A;  1TIJ A;  2XSH B;  3CC2 3;  1N8R 4;  3KE7 A;  4HM6 B;  1K73 4;  5AYR B;  4R9K A;  1D6Z A;  3SED A;  4HM0 B;  1JN5 B;  2BNG A;  2V1L A;  4O02 B;  1ISK A;  3ECF A;  4H61 A;  3NBB A;  1SIH A;  4BTW A;  1GS3 A;  3FSD A;  1WMP A;  4EYC A;  3CXC 2;  5KP4 A;  1W2B 2;  5IG5 A;  2BO9 B;  2P05 A;  3JUM A;  4KFF A;  1W6Y A;  1KSI A;  4X2O A;  4FCZ A;  1YIJ 3;  1AR0 A;  1YI2 3;  3F7S A;  1NO3 A;  1RJO A;  1ZX2 A;  2PZV A;  4FMD A;  2HMK B;  3V98 A;  4XDV A;  1QAL A;  1U8C B;  3K7C A;  4ZM8 A;  1W01 A;  3NM7 A;  3GAX A;  4L7K A;  3RGA A;  3WDG B;  3SLU A;  1EQK A;  4LZI A;  2CC3 A;  4HM4 B;  1IT8 A;  1FGR A;  1YVB I;  4J8T A;  3FH1 A;  4HVN A;  3IPT A;  4H3U A;  2GEY A;  1IV9 A;  3OWU A;  4U13 A;  4WP5 A;  1N9E A;  1S5A A;  2IA7 A;  2SBL A;  2XF3 A;  2W9Q A;  3DY5 A;  5IEP A;  1JV2 B;  4L8P A;  4MEI A;  3A76 A;  2CWV A;  4IPB A;  3EE1 A;  3STD A;  3T8U A;  3HZP A;  3KN4 A;  3CPW 2;  1AV4 A;  2BT3 A;  3O8Y A;  2CFL A;  3HIG A;  3DGN A;  4AKZ A;  2MF7 A;  3EBY A;  3MYT A;  3K9M C;  3B4P A;  3GZY B;  3G0K A;  4OUQ A;  4KVH A;  3LZA A;  5AIH A;  2ZDJ A;  3EN1 B;  3PYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...