1O7QA

Roles of individual residues of alpha-1,3 galactosyltransferases in substrate binding and catalysis
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
287
structure length
287
Chain Sequence
KLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQTKEYNVVRNNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Roles of Individual Enzyme-Substrate Interactions by Alpha-1,3-Galactosyltransferase in Catalysis and Specificity.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 102
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2002-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1o7qA00
3USQA 1XHBA 1H7FA 2V0JA 4AYJA 1V83A 4KC2A 4FRAA 4BMAA 3V91A 3OH3A 1JVGA 2YC3A 3D98A 1WVCA 1HJJA 2P72A 4KT7A 3CKOA 2Y6PA 2QKXA 4M2BA 3ST8A 3I0IX 4NAIA 1VICA 4B42A 4LW6A 1ZJ3A 5DDVA 4HO2A 5C1HA 5C4FA 3CKQA 5C49A 3OH1A 2QH5A 1LL2A 2Y7AA 5CMFX 2OI5A 2AESA 2RJ6A 2XWMA 3CKJA 4DDZA 3OH2A 1PZTA 5C4BA 5C1LA 3ZGGA 2OI7A 1H5RA 3USRA 3N9WA 5C4EA 5CMJA 3SXDA 1H5RB 1VGZA 3PKQA 3SX5A 4C2SA 2D0JA 2GGOA 4G3QA 1FZWA 5FU0A 1H7TA 4FRBA 2X65A 1YP2A 3F1YA 1HM0A 5C3DA 2AECA 2FY7A 4EEGA 1ZCTA 4HOCA 1H4CA 5CQMX 3KIAA 1FWYA 1O7QA 2DPWA 2FYCB 5CMIA 1QGQA 4AYLA 4Y6UA 3GUEA 2RJ1A 1GX4A 1ZJOA 2X60A 1R7VA 2YQJA 4KPZA 2NXVA 3T7NA 1VZXA 1R7UA 4DECA 1QGSA 5C8RA 1W57A 1FRWA 2P6WA 3OH0A 1TW1A 1YROB 5C47A 5C1GA 1NWGB 3V0MA 2E3DA 3QVBA 2PGVA 4NANA 3ZF8A 1G3LA 1ZJPA 2WVKA 1VH3A 5C48A 1JV1A 2P73A 4EVWA 1LZ7A 2WEEA 4LW3A 2XMHA 5C38A 3E25A 2ZU9A 2RIYA 4Y6NA 1FXOA 3U0YA 4Y62A 3Q7UA 4B4GA 2O1FA 2Y4MA 1ON8A 1NKHB 4MYBA 2OEGA 3V90A 4D48A 4D0ZA 1LZJA 2VSIA 2ZU7A 1FO8A 3V0NA 4FRDA 4CJBA 2VS5A 4AC3A 2RJ7A 4M2AA 1VM8A 4Y7UA 1H5TA 1ZJ0A 4YS8A 2D7IA 1VGWA 3OAMA 1G9RA 1LZ0A 3I0HA 4JD0A 1H5TB 2RJ4A 5I1FA 4G87A 5DDTA 2X5ZA 2O1HA 5AJNA 1ZJ2A 2APCA 1WT0A 4B4BA 1WT1A 2XWLA 1G93A 2GGQA 3CU0A 1H7GA 4B3UA 4B2XA 1GX0A 5CQOA 4ARWA 2FFUA 1LL0A 3U0XA 2FYDB 4CJCA 3K8DA 4KRVA 4Y9XA 4CVHA 4GBPA 1H5SB 4EE4A 5FU8A 1FGXA 4ASJA 3JUKA 2YQHA 3I0GA 5FV9A 1H4EA 2Y4LA 3T7MA 4XWIA 3SX8A 2AM3A 2AGDA 2V0HA 2BO6A 3R3IA 4J18A 4L41C 2VFZA 5FTVA 1HM8A 1W55A 1JV3A 1E5KA 2I7BA 2W0VA 5FTSA 3U2XA 5EIYA 3OKRA 3I0LA 1H5SC 1R7XA 2ICYA 4P02A 3D8VA 2XMEA 1OQMB 2E8BA 3SXGA 2ZU8A 4MNDA 1LL3A 1QG8A 5CQLX 2QGIA 1VGTA 2A8UA 5CMGX 1PZYB 3OGZA 1YP3A 3DK5A 4CJ8A 1ZCUA 3T7OA 1G8OA 4KNXA 2CU2A 2Z86A 1FXJA 5C4CA 1O7OA 2JCJA 3DJ4A 3V0PA 2X5SA 4G3SA 4HO6A 5IDTA 1ZDFA 4B2WA 2V0LA 5IFYA 1NQIB 5IDSA 3LW6A 1YP4A 4M28A 3SXAA 5C4DA 1H4DA 1H3MA 2A8WA 1WSZA 2WAWA 2RJ0A 1O23B 3U2UA 2RJ9A 1K4VA 1R7TA 4EE5A 1ZI4A 3FWWA 3U2TA 1GQCA 5J49A 1S4PA 4KC4A 2AM5A 2VD4A 2PGYA 3PKPA 4FRQA 3TQDA 3IOHA 1TVYA 3FOQA 4Y7FA 3NGWA 1ZCVA 1WT2A 2WVMA 5JQQA 1G1LA 2Y4JA 2PA4A 3IOJA 1ZIZA 2V0IA 4B4MA 1MP3A 2OEFA 5C3BA 5CMHA 3BCVA 2BO4A 1JVDA 4FRHA 3OC9A 3Q80A 4R7PA 4M4KA 4IRPA 3TZTA 4HCQA 3EE5A 1IINA 2RJ8A 1LZIA 1GA8A 3ZLLA 1G23A 1G95A 3I0EA 2D7RA 4D11C 2RIXA 3OH4A 1S4NA 2BO7A 2VSHA 3K8EA 1H7EA 1H7QA 3JTJA 2WE9A 3I0CA 2AM4A 4HO0A 3U2VA 4AAWA 4BQHA 4ECMA 1EYRA 1H5SA 3Q4SA 3ZLKA 3V0QA 1R7YA 1FG5N 1R82A 4FRMA 1MP4A 4KQLA 4HO4A 1W77A 2AE7A 3U2WA 1H5SD 2I5EA 2BO8A 3ZGFA 4EE3A 3I0FA 4EEMA 3SXCA 2UX8A 2RJ5A 5BXCA 4HO9A 4Y63A 4FQWA 1SS9A 2FFVA 3RMWA 1ZI3A 2JCKA 3D5NA 1ON6A 4UEGA 4KPXA 4KNRA 3IOIA 4FCEA 1I52A 3SX3A 3BRKX 2YQSA 5EJ1A 3CKVA 3SX7A 1ZJ1A 3SXEA 1ZDGA 1VGUA 5CQPA 1NMMB 3HL3A 3SPTA 1ZI5A 5HS2A 4Y64A 1V84A 1MP5A 1VH1A 4FRPA 3F1CA 4Y7TA 3SXBA 2YCMA 1JYKA 1INJA 1FR9A 5C3AA 2VS4A 2JCLA 1OMZA 3CGXA 3I0JA 1OMXA 4EEAA 4ZDQA 1G0RA 3RSBA 1JYLA 4DE7A 2AH9A 5FUHA 2W0WA 3E26A 3V8YA 2FYAA 1VPAA 3DUVA 5AJOA 1ZCYA 3I0KA 4EEOA 1MC3A 1G97A 2VXLA 1S4OA 4D0TA 2WGZA 2MZBA 2PX7A 4B5BA 1GWWA 4KXOA 1H7LA 4HO5A 3PNNA 1HM9A 1R81A 4NALA 5C36A 4HO8A 4P00A 3R2WA 1LVWA 4NAKA 3O3PA 5L6VA 2OI6A 5EJZA 3V8ZA 1ZHJA 4HG6A 2Z87A 1HJLA 2RIZA 4D11A 4JISA 4E1KA 1NHEB 2YC5A 1QWJA 1VZTA 1HV9A 1IIMA 1TW5A 5L6SA 2V0KA 5CQNX 4Y7GA 2Q4JA 4KC1A 5FYEA 4HO3A 2VXMA 4FCUA 4IRQA 4K6RA 2YESA 3I0DA 1VZUA 1TZFA 1KWSA 1H7HA 4Y7VA 1WT3A 1FGGA 3JUJA 1R80A 3RMVA 2Y4KA 1XZ6A 3V0OA 4FRLA 1EZIA 1G2VA 3POLA 4ASYA 2FYBA 4FREA 2JCOA 2XWNA 4G3PA 1ZI1A 2YQCA 2I5KA 1FO9A 2VS3A 1O0RA 1INIA 5AJPA 1NF5B 1GQ9A 2O1GA 1GWVA 4FROA 1FOAA 3CKNA 1V82A 3V0LA 1FR8A 1Z90A 2RITA 2WVLA 2ICXA
chains in the Genus database with same CATH superfamily
3USQA 1XHBA 1H7FA 2V0JA 4AYJA 1V83A 4KC2A 4FRAA 4BMAA 4Q7CA 3V91A 3OH3A 1JVGA 2YC3A 3D98A 1WVCA 1HJJA 2P72A 4KT7A 3CKOA 2Y6PA 2QKXA 4M2BA 3ST8A 3I0IX 4NAIA 1VICA 4B42A 2VK9A 4LW6A 1ZJ3A 5DDVA 4HO2A 5C1HA 5C4FA 3CKQA 5C49A 3OH1A 2QH5A 1LL2A 2Y7AA 5CMFX 2OI5A 2AESA 2RJ6A 2XWMA 3CKJA 4DDZA 3OH2A 1PZTA 5C4BA 5C1LA 3ZGGA 2OI7A 1H5RA 3USRA 3N9WA 5C4EA 5CMJA 3SXDA 1H5RB 1VGZA 3PKQA 3SX5A 4C2SA 2D0JA 2GGOA 4G3QA 1FZWA 5FU0A 1H7TA 4FRBA 2X65A 1YP2A 3F1YA 1HM0A 5C3DA 2AECA 2FY7A 4EEGA 1ZCTA 4HOCA 1H4CA 5CQMX 3KIAA 1FWYA 1O7QA 2C0NA 2DPWA 2FYCB 5CMIA 1QGQA 4AYLA 4Y6UA 3GUEA 2RJ1A 1GX4A 1ZJOA 2X60A 1R7VA 2YQJA 4KPZA 2NXVA 3T7NA 1VZXA 1R7UA 4DECA 1QGSA 5C8RA 1W57A 1FRWA 2P6WA 2J0AA 3OH0A 1TW1A 1YROB 5C47A 5C1GA 1NWGB 3V0MA 2E3DA 3QVBA 2PGVA 4NANA 3ZF8A 1G3LA 1ZJPA 2WVKA 1VH3A 5C48A 1JV1A 2P73A 4EVWA 1LZ7A 2WEEA 4LW3A 2XMHA 5C38A 3E25A 2ZU9A 2RIYA 4Y6NA 1FXOA 3U0YA 4Y62A 3Q7UA 4B4GA 2O1FA 2Y4MA 1ON8A 1NKHB 4MYBA 2OEGA 3V90A 4D48A 4D0ZA 1LZJA 2VSIA 2ZU7A 1FO8A 3V0NA 4FRDA 4CJBA 2VS5A 4AC3A 2RJ7A 4M2AA 1VM8A 4Y7UA 1H5TA 1ZJ0A 4YS8A 2D7IA 1VGWA 3OAMA 1G9RA 1LZ0A 3I0HA 4JD0A 1H5TB 2RJ4A 5I1FA 4G87A 5DDTA 2X5ZA 2O1HA 5AJNA 1ZJ2A 2APCA 1WT0A 4B4BA 1WT1A 2XWLA 1G93A 2GGQA 3CU0A 1H7GA 4B3UA 4B2XA 1GX0A 5CQOA 4ARWA 2FFUA 1LL0A 3U0XA 2FYDB 4CJCA 3K8DA 4KRVA 4Y9XA 4CVHA 2J0BA 4GBPA 1H5SB 4EE4A 5FU8A 1FGXA 4ASJA 3JUKA 2YQHA 4O6MA 3I0GA 5FV9A 1H4EA 2Y4LA 3T7MA 4XWIA 3SX8A 2AM3A 2AGDA 2V0HA 2BO6A 3R3IA 4J18A 4L41C 2VFZA 5FTVA 1HM8A 1W55A 1JV3A 1E5KA 2I7BA 2W0VA 5FTSA 3U2XA 5EIYA 3OKRA 3I0LA 1H5SC 1R7XA 2ICYA 4P02A 3D8VA 2XMEA 1OQMB 2E8BA 3SXGA 2ZU8A 4MNDA 4FIYA 1LL3A 1QG8A 5CQLX 2QGIA 1VGTA 2A8UA 5CMGX 1PZYB 3OGZA 1YP3A 3DK5A 4CJ8A 1ZCUA 3T7OA 1G8OA 4KNXA 2CU2A 2Z86A 1FXJA 5C4CA 1O7OA 2JCJA 3DJ4A 3V0PA 2X5SA 4G3SA 4HO6A 5IDTA 1ZDFA 4B2WA 2V0LA 5IFYA 1NQIB 5IDSA 3LW6A 1YP4A 4M28A 3SXAA 5C4DA 1H4DA 1H3MA 2A8WA 1WSZA 2WAWA 2RJ0A 1O23B 3U2UA 2RJ9A 1K4VA 1R7TA 4EE5A 1ZI4A 3FWWA 3U2TA 1GQCA 5J49A 1S4PA 4KC4A 2AM5A 2VD4A 2PGYA 3PKPA 4FRQA 3TQDA 3IOHA 1TVYA 3FOQA 4Y7FA 3NGWA 1ZCVA 1WT2A 2WVMA 5JQQA 1G1LA 2Y4JA 4MIXA 2PA4A 3IOJA 1ZIZA 2V0IA 4B4MA 1MP3A 2OEFA 5C3BA 5CMHA 3BCVA 2BO4A 1JVDA 4FRHA 3OC9A 3Q80A 4R7PA 4M4KA 4IRPA 3TZTA 4HCQA 3EE5A 1IINA 2RJ8A 1LZIA 1GA8A 3ZLLA 1G23A 1G95A 3I0EA 2D7RA 4D11C 2RIXA 3OH4A 1S4NA 2BO7A 2VSHA 3K8EA 1H7EA 1H7QA 3JTJA 2WE9A 3I0CA 2AM4A 4HO0A 3U2VA 4AAWA 4BQHA 4ECMA 1EYRA 1H5SA 3Q4SA 3ZLKA 3V0QA 1R7YA 1FG5N 1R82A 4FRMA 1MP4A 4KQLA 4HO4A 1W77A 2AE7A 3U2WA 1H5SD 2I5EA 2BO8A 3ZGFA 4EE3A 3I0FA 4EEMA 3SXCA 2UX8A 2RJ5A 5BXCA 4HO9A 4Y63A 4FQWA 1SS9A 2FFVA 3RMWA 1ZI3A 2JCKA 3D5NA 1ON6A 4UEGA 4KPXA 4KNRA 3IOIA 4FCEA 1I52A 3SX3A 3BRKX 4FIXA 2YQSA 5EJ1A 3CKVA 3SX7A 1ZJ1A 3SXEA 1ZDGA 1VGUA 5CQPA 1NMMB 3HL3A 3SPTA 1ZI5A 5HS2A 4Y64A 1V84A 1MP5A 1VH1A 4FRPA 3F1CA 4Y7TA 5D92A 3SXBA 2YCMA 1JYKA 1INJA 1FR9A 5C3AA 2VS4A 2JCLA 1OMZA 3CGXA 3I0JA 1OMXA 4EEAA 4ZDQA 1G0RA 3RSBA 1JYLA 4DE7A 2AH9A 5FUHA 2W0WA 3E26A 3V8YA 2FYAA 1VPAA 3DUVA 5AJOA 1ZCYA 3I0KA 4EEOA 1MC3A 1G97A 2VXLA 1S4OA 4D0TA 2WGZA 2MZBA 2PX7A 4B5BA 1GWWA 4KXOA 1H7LA 4HO5A 3PNNA 1HM9A 1R81A 4NALA 5C36A 4HO8A 4P00A 3R2WA 1LVWA 4NAKA 3O3PA 5L6VA 4O6NA 2OI6A 5EJZA 3V8ZA 1ZHJA 4HG6A 2Z87A 1HJLA 2RIZA 4D11A 4JISA 4E1KA 1NHEB 2YC5A 1QWJA 1VZTA 1HV9A 1IIMA 1TW5A 5L6SA 2V0KA 5CQNX 4Y7GA 2Q4JA 4KC1A 5FYEA 4HO3A 2VXMA 4FCUA 4IRQA 4K6RA 2YESA 3I0DA 1VZUA 1TZFA 1KWSA 1H7HA 4Y7VA 1WT3A 1FGGA 3JUJA 1R80A 3RMVA 2Y4KA 1XZ6A 3V0OA 4FRLA 1EZIA 1G2VA 3POLA 4ASYA 2FYBA 4FREA 2JCOA 2XWNA 4G3PA 1ZI1A 2YQCA 2I5KA 1FO9A 2VS3A 1O0RA 1INIA 5AJPA 1NF5B 1GQ9A 2O1GA 1GWVA 4FROA 5D91A 1FOAA 3CKNA 1V82A 3V0LA 1FR8A 1Z90A 2RITA 2WVLA 2ICXA
chains in the Genus database with same CATH topology
3USQA 1XHBA 1H7FA 2V0JA 4AYJA 1V83A 4KC2A 4FRAA 4BMAA 4Q7CA 3V91A 3OH3A 1JVGA 2YC3A 3D98A 1WVCA 1HJJA 2P72A 4KT7A 3CKOA 2Y6PA 2QKXA 4M2BA 3ST8A 3I0IX 4NAIA 1VICA 4B42A 2VK9A 4LW6A 1ZJ3A 5DDVA 4HO2A 5C1HA 5C4FA 3CKQA 5C49A 3OH1A 2QH5A 1LL2A 2Y7AA 5CMFX 2OI5A 2AESA 2RJ6A 2XWMA 3CKJA 4DDZA 3OH2A 1PZTA 5C4BA 5C1LA 3ZGGA 2OI7A 1H5RA 3USRA 3N9WA 5C4EA 5CMJA 3SXDA 1H5RB 1VGZA 3PKQA 3SX5A 4C2SA 2D0JA 2GGOA 4G3QA 1FZWA 5FU0A 1H7TA 4FRBA 2X65A 1YP2A 3F1YA 1HM0A 5C3DA 2AECA 2FY7A 4EEGA 1ZCTA 4HOCA 1H4CA 5CQMX 3KIAA 1FWYA 1O7QA 2C0NA 2DPWA 2FYCB 5CMIA 1QGQA 4AYLA 4Y6UA 3GUEA 2RJ1A 1GX4A 1ZJOA 2X60A 1R7VA 2YQJA 4KPZA 2NXVA 3T7NA 1VZXA 1R7UA 4DECA 1QGSA 5C8RA 1W57A 1FRWA 2P6WA 2J0AA 3OH0A 1TW1A 1YROB 5C47A 5C1GA 1NWGB 3V0MA 2E3DA 3QVBA 2PGVA 4NANA 3ZF8A 1G3LA 1ZJPA 2WVKA 1VH3A 5C48A 1JV1A 2P73A 4EVWA 1LZ7A 2WEEA 4LW3A 2XMHA 5C38A 3E25A 2ZU9A 2RIYA 4Y6NA 1FXOA 3U0YA 4Y62A 3Q7UA 4B4GA 2O1FA 2Y4MA 1ON8A 1NKHB 4MYBA 2OEGA 3V90A 4D48A 4D0ZA 1LZJA 2VSIA 2ZU7A 1FO8A 3V0NA 4FRDA 4CJBA 2VS5A 4AC3A 2RJ7A 4M2AA 1VM8A 4Y7UA 1H5TA 1ZJ0A 4YS8A 2D7IA 1VGWA 3OAMA 1G9RA 1LZ0A 3I0HA 4JD0A 1H5TB 2RJ4A 5I1FA 4G87A 5DDTA 2X5ZA 2O1HA 5AJNA 1ZJ2A 2APCA 1WT0A 4B4BA 1WT1A 2XWLA 1G93A 2GGQA 3CU0A 1H7GA 4B3UA 4B2XA 1GX0A 5CQOA 4ARWA 2FFUA 1LL0A 3U0XA 2FYDB 4CJCA 3K8DA 4KRVA 4Y9XA 4CVHA 2J0BA 4GBPA 1H5SB 4EE4A 5FU8A 1FGXA 4ASJA 3JUKA 2YQHA 4O6MA 3I0GA 5FV9A 1H4EA 2Y4LA 3T7MA 4XWIA 3SX8A 2AM3A 2AGDA 2V0HA 2BO6A 3R3IA 4J18A 4L41C 2VFZA 5FTVA 1HM8A 1W55A 1JV3A 1E5KA 2I7BA 2W0VA 5FTSA 3U2XA 5EIYA 3OKRA 3I0LA 1H5SC 1R7XA 2ICYA 4P02A 3D8VA 2XMEA 1OQMB 2E8BA 3SXGA 2ZU8A 4MNDA 4FIYA 1LL3A 1QG8A 5CQLX 2QGIA 1VGTA 2A8UA 5CMGX 1PZYB 3OGZA 1YP3A 3DK5A 4CJ8A 1ZCUA 3T7OA 1G8OA 4KNXA 2CU2A 2Z86A 1FXJA 5C4CA 1O7OA 2JCJA 3DJ4A 3V0PA 2X5SA 4G3SA 4HO6A 5IDTA 1ZDFA 4B2WA 2V0LA 5IFYA 1NQIB 5IDSA 3LW6A 1YP4A 4M28A 3SXAA 5C4DA 1H4DA 1H3MA 2A8WA 1WSZA 2WAWA 2RJ0A 1O23B 3U2UA 2RJ9A 1K4VA 1R7TA 4EE5A 1ZI4A 3FWWA 3U2TA 1GQCA 5J49A 1S4PA 4KC4A 2AM5A 2VD4A 2PGYA 3PKPA 4FRQA 3TQDA 3IOHA 1TVYA 3FOQA 4Y7FA 3NGWA 1ZCVA 1WT2A 2WVMA 5JQQA 1G1LA 2Y4JA 4MIXA 2PA4A 3IOJA 1ZIZA 2V0IA 4B4MA 1MP3A 2OEFA 5C3BA 5CMHA 3BCVA 2BO4A 1JVDA 4FRHA 3OC9A 3Q80A 4R7PA 4M4KA 4IRPA 3TZTA 4HCQA 3EE5A 1IINA 2RJ8A 1LZIA 1GA8A 3ZLLA 1G23A 1G95A 3I0EA 2D7RA 4D11C 2RIXA 3OH4A 1S4NA 2BO7A 2VSHA 3K8EA 1H7EA 1H7QA 3JTJA 2WE9A 3I0CA 2AM4A 4HO0A 3U2VA 4AAWA 4BQHA 4ECMA 1EYRA 1H5SA 3Q4SA 3ZLKA 3V0QA 1R7YA 1FG5N 1R82A 4FRMA 1MP4A 4KQLA 4HO4A 1W77A 2AE7A 3U2WA 1H5SD 2I5EA 2BO8A 3ZGFA 4EE3A 3I0FA 4EEMA 3SXCA 2UX8A 2RJ5A 5BXCA 4HO9A 4Y63A 4FQWA 1SS9A 2FFVA 3RMWA 1ZI3A 2JCKA 3D5NA 1ON6A 4UEGA 4KPXA 4KNRA 3IOIA 4FCEA 1I52A 3SX3A 3BRKX 4FIXA 2YQSA 5EJ1A 3CKVA 3SX7A 1ZJ1A 3SXEA 1ZDGA 1VGUA 5CQPA 1NMMB 3HL3A 3SPTA 1ZI5A 5HS2A 4Y64A 1V84A 1MP5A 1VH1A 4FRPA 3F1CA 4Y7TA 5D92A 3SXBA 2YCMA 1JYKA 1INJA 1FR9A 5C3AA 2VS4A 2JCLA 1OMZA 3CGXA 3I0JA 1OMXA 4EEAA 4ZDQA 1G0RA 3RSBA 1JYLA 4DE7A 2AH9A 5FUHA 2W0WA 3E26A 3V8YA 2FYAA 1VPAA 3DUVA 5AJOA 1ZCYA 3I0KA 4EEOA 1MC3A 1G97A 2VXLA 1S4OA 4D0TA 2WGZA 2MZBA 2PX7A 4B5BA 1GWWA 4KXOA 1H7LA 4HO5A 3PNNA 1HM9A 1R81A 4NALA 5C36A 4HO8A 4P00A 3R2WA 1LVWA 4NAKA 3O3PA 5L6VA 4O6NA 2OI6A 5EJZA 3V8ZA 1ZHJA 4HG6A 2Z87A 1HJLA 2RIZA 4D11A 4JISA 4E1KA 1NHEB 2YC5A 1QWJA 1VZTA 1HV9A 1IIMA 1TW5A 5L6SA 2V0KA 5CQNX 4Y7GA 2Q4JA 4KC1A 5FYEA 4HO3A 2VXMA 4FCUA 4IRQA 4K6RA 2YESA 3I0DA 1VZUA 1TZFA 1KWSA 1H7HA 4Y7VA 1WT3A 1FGGA 3JUJA 1R80A 3RMVA 2Y4KA 1XZ6A 3V0OA 4FRLA 1EZIA 1G2VA 3POLA 4ASYA 2FYBA 4FREA 2JCOA 2XWNA 4G3PA 1ZI1A 2YQCA 2I5KA 1FO9A 2VS3A 1O0RA 1INIA 5AJPA 1NF5B 1GQ9A 2O1GA 1GWVA 4FROA 5D91A 1FOAA 3CKNA 1V82A 3V0LA 1FR8A 1Z90A 2RITA 2WVLA 2ICXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3USQ A;  1XHB A;  1H7F A;  2V0J A;  4AYJ A;  1V83 A;  4KC2 A;  4FRA A;  4BMA A;  3V91 A;  3OH3 A;  1JVG A;  2YC3 A;  3D98 A;  1WVC A;  1HJJ A;  2P72 A;  4KT7 A;  3CKO A;  2Y6P A;  2QKX A;  4M2B A;  3ST8 A;  3I0I X;  4NAI A;  1VIC A;  4B42 A;  4LW6 A;  1ZJ3 A;  5DDV A;  4HO2 A;  5C1H A;  5C4F A;  3CKQ A;  5C49 A;  3OH1 A;  2QH5 A;  1LL2 A;  2Y7A A;  5CMF X;  2OI5 A;  2AES A;  2RJ6 A;  2XWM A;  3CKJ A;  4DDZ A;  3OH2 A;  1PZT A;  5C4B A;  5C1L A;  3ZGG A;  2OI7 A;  1H5R A;  3USR A;  3N9W A;  5C4E A;  5CMJ A;  3SXD A;  1H5R B;  1VGZ A;  3PKQ A;  3SX5 A;  4C2S A;  2D0J A;  2GGO A;  4G3Q A;  1FZW A;  5FU0 A;  1H7T A;  4FRB A;  2X65 A;  1YP2 A;  3F1Y A;  1HM0 A;  5C3D A;  2AEC A;  2FY7 A;  4EEG A;  1ZCT A;  4HOC A;  1H4C A;  5CQM X;  3KIA A;  1FWY A;  1O7Q A;  2DPW A;  2FYC B;  5CMI A;  1QGQ A;  4AYL A;  4Y6U A;  3GUE A;  2RJ1 A;  1GX4 A;  1ZJO A;  2X60 A;  1R7V A;  2YQJ A;  4KPZ A;  2NXV A;  3T7N A;  1VZX A;  1R7U A;  4DEC A;  1QGS A;  5C8R A;  1W57 A;  1FRW A;  2P6W A;  3OH0 A;  1TW1 A;  1YRO B;  5C47 A;  5C1G A;  1NWG B;  3V0M A;  2E3D A;  3QVB A;  2PGV A;  4NAN A;  3ZF8 A;  1G3L A;  1ZJP A;  2WVK A;  1VH3 A;  5C48 A;  1JV1 A;  2P73 A;  4EVW A;  1LZ7 A;  2WEE A;  4LW3 A;  2XMH A;  5C38 A;  3E25 A;  2ZU9 A;  2RIY A;  4Y6N A;  1FXO A;  3U0Y A;  4Y62 A;  3Q7U A;  4B4G A;  2O1F A;  2Y4M A;  1ON8 A;  1NKH B;  4MYB A;  2OEG A;  3V90 A;  4D48 A;  4D0Z A;  1LZJ A;  2VSI A;  2ZU7 A;  1FO8 A;  3V0N A;  4FRD A;  4CJB A;  2VS5 A;  4AC3 A;  2RJ7 A;  4M2A A;  1VM8 A;  4Y7U A;  1H5T A;  1ZJ0 A;  4YS8 A;  2D7I A;  1VGW A;  3OAM A;  1G9R A;  1LZ0 A;  3I0H A;  4JD0 A;  1H5T B;  2RJ4 A;  5I1F A;  4G87 A;  5DDT A;  2X5Z A;  2O1H A;  5AJN A;  1ZJ2 A;  2APC A;  1WT0 A;  4B4B A;  1WT1 A;  2XWL A;  1G93 A;  2GGQ A;  3CU0 A;  1H7G A;  4B3U A;  4B2X A;  1GX0 A;  5CQO A;  4ARW A;  2FFU A;  1LL0 A;  3U0X A;  2FYD B;  4CJC A;  3K8D A;  4KRV A;  4Y9X A;  4CVH A;  4GBP A;  1H5S B;  4EE4 A;  5FU8 A;  1FGX A;  4ASJ A;  3JUK A;  2YQH A;  3I0G A;  5FV9 A;  1H4E A;  2Y4L A;  3T7M A;  4XWI A;  3SX8 A;  2AM3 A;  2AGD A;  2V0H A;  2BO6 A;  3R3I A;  4J18 A;  4L41 C;  2VFZ A;  5FTV A;  1HM8 A;  1W55 A;  1JV3 A;  1E5K A;  2I7B A;  2W0V A;  5FTS A;  3U2X A;  5EIY A;  3OKR A;  3I0L A;  1H5S C;  1R7X A;  2ICY A;  4P02 A;  3D8V A;  2XME A;  1OQM B;  2E8B A;  3SXG A;  2ZU8 A;  4MND A;  1LL3 A;  1QG8 A;  5CQL X;  2QGI A;  1VGT A;  2A8U A;  5CMG X;  1PZY B;  3OGZ A;  1YP3 A;  3DK5 A;  4CJ8 A;  1ZCU A;  3T7O A;  1G8O A;  4KNX A;  2CU2 A;  2Z86 A;  1FXJ A;  5C4C A;  1O7O A;  2JCJ A;  3DJ4 A;  3V0P A;  2X5S A;  4G3S A;  4HO6 A;  5IDT A;  1ZDF A;  4B2W A;  2V0L A;  5IFY A;  1NQI B;  5IDS A;  3LW6 A;  1YP4 A;  4M28 A;  3SXA A;  5C4D A;  1H4D A;  1H3M A;  2A8W A;  1WSZ A;  2WAW A;  2RJ0 A;  1O23 B;  3U2U A;  2RJ9 A;  1K4V A;  1R7T A;  4EE5 A;  1ZI4 A;  3FWW A;  3U2T A;  1GQC A;  5J49 A;  1S4P A;  4KC4 A;  2AM5 A;  2VD4 A;  2PGY A;  3PKP A;  4FRQ A;  3TQD A;  3IOH A;  1TVY A;  3FOQ A;  4Y7F A;  3NGW A;  1ZCV A;  1WT2 A;  2WVM A;  5JQQ A;  1G1L A;  2Y4J A;  2PA4 A;  3IOJ A;  1ZIZ A;  2V0I A;  4B4M A;  1MP3 A;  2OEF A;  5C3B A;  5CMH A;  3BCV A;  2BO4 A;  1JVD A;  4FRH A;  3OC9 A;  3Q80 A;  4R7P A;  4M4K A;  4IRP A;  3TZT A;  4HCQ A;  3EE5 A;  1IIN A;  2RJ8 A;  1LZI A;  1GA8 A;  3ZLL A;  1G23 A;  1G95 A;  3I0E A;  2D7R A;  4D11 C;  2RIX A;  3OH4 A;  1S4N A;  2BO7 A;  2VSH A;  3K8E A;  1H7E A;  1H7Q A;  3JTJ A;  2WE9 A;  3I0C A;  2AM4 A;  4HO0 A;  3U2V A;  4AAW A;  4BQH A;  4ECM A;  1EYR A;  1H5S A;  3Q4S A;  3ZLK A;  3V0Q A;  1R7Y A;  1FG5 N;  1R82 A;  4FRM A;  1MP4 A;  4KQL A;  4HO4 A;  1W77 A;  2AE7 A;  3U2W A;  1H5S D;  2I5E A;  2BO8 A;  3ZGF A;  4EE3 A;  3I0F A;  4EEM A;  3SXC A;  2UX8 A;  2RJ5 A;  5BXC A;  4HO9 A;  4Y63 A;  4FQW A;  1SS9 A;  2FFV A;  3RMW A;  1ZI3 A;  2JCK A;  3D5N A;  1ON6 A;  4UEG A;  4KPX A;  4KNR A;  3IOI A;  4FCE A;  1I52 A;  3SX3 A;  3BRK X;  2YQS A;  5EJ1 A;  3CKV A;  3SX7 A;  1ZJ1 A;  3SXE A;  1ZDG A;  1VGU A;  5CQP A;  1NMM B;  3HL3 A;  3SPT A;  1ZI5 A;  5HS2 A;  4Y64 A;  1V84 A;  1MP5 A;  1VH1 A;  4FRP A;  3F1C A;  4Y7T A;  3SXB A;  2YCM A;  1JYK A;  1INJ A;  1FR9 A;  5C3A A;  2VS4 A;  2JCL A;  1OMZ A;  3CGX A;  3I0J A;  1OMX A;  4EEA A;  4ZDQ A;  1G0R A;  3RSB A;  1JYL A;  4DE7 A;  2AH9 A;  5FUH A;  2W0W A;  3E26 A;  3V8Y A;  2FYA A;  1VPA A;  3DUV A;  5AJO A;  1ZCY A;  3I0K A;  4EEO A;  1MC3 A;  1G97 A;  2VXL A;  1S4O A;  4D0T A;  2WGZ A;  2MZB A;  2PX7 A;  4B5B A;  1GWW A;  4KXO A;  1H7L A;  4HO5 A;  3PNN A;  1HM9 A;  1R81 A;  4NAL A;  5C36 A;  4HO8 A;  4P00 A;  3R2W A;  1LVW A;  4NAK A;  3O3P A;  5L6V A;  2OI6 A;  5EJZ A;  3V8Z A;  1ZHJ A;  4HG6 A;  2Z87 A;  1HJL A;  2RIZ A;  4D11 A;  4JIS A;  4E1K A;  1NHE B;  2YC5 A;  1QWJ A;  1VZT A;  1HV9 A;  1IIM A;  1TW5 A;  5L6S A;  2V0K A;  5CQN X;  4Y7G A;  2Q4J A;  4KC1 A;  5FYE A;  4HO3 A;  2VXM A;  4FCU A;  4IRQ A;  4K6R A;  2YES A;  3I0D A;  1VZU A;  1TZF A;  1KWS A;  1H7H A;  4Y7V A;  1WT3 A;  1FGG A;  3JUJ A;  1R80 A;  3RMV A;  2Y4K A;  1XZ6 A;  3V0O A;  4FRL A;  1EZI A;  1G2V A;  3POL A;  4ASY A;  2FYB A;  4FRE A;  2JCO A;  2XWN A;  4G3P A;  1ZI1 A;  2YQC A;  2I5K A;  1FO9 A;  2VS3 A;  1O0R A;  1INI A;  5AJP A;  1NF5 B;  1GQ9 A;  2O1G A;  1GWV A;  4FRO A;  1FOA A;  3CKN A;  1V82 A;  3V0L A;  1FR8 A;  1Z90 A;  2RIT A;  2WVL A;  2ICX A; 
#chains in the Genus database with same CATH topology
 3USQ A;  1XHB A;  1H7F A;  2V0J A;  4AYJ A;  1V83 A;  4KC2 A;  4FRA A;  4BMA A;  4Q7C A;  3V91 A;  3OH3 A;  1JVG A;  2YC3 A;  3D98 A;  1WVC A;  1HJJ A;  2P72 A;  4KT7 A;  3CKO A;  2Y6P A;  2QKX A;  4M2B A;  3ST8 A;  3I0I X;  4NAI A;  1VIC A;  4B42 A;  2VK9 A;  4LW6 A;  1ZJ3 A;  5DDV A;  4HO2 A;  5C1H A;  5C4F A;  3CKQ A;  5C49 A;  3OH1 A;  2QH5 A;  1LL2 A;  2Y7A A;  5CMF X;  2OI5 A;  2AES A;  2RJ6 A;  2XWM A;  3CKJ A;  4DDZ A;  3OH2 A;  1PZT A;  5C4B A;  5C1L A;  3ZGG A;  2OI7 A;  1H5R A;  3USR A;  3N9W A;  5C4E A;  5CMJ A;  3SXD A;  1H5R B;  1VGZ A;  3PKQ A;  3SX5 A;  4C2S A;  2D0J A;  2GGO A;  4G3Q A;  1FZW A;  5FU0 A;  1H7T A;  4FRB A;  2X65 A;  1YP2 A;  3F1Y A;  1HM0 A;  5C3D A;  2AEC A;  2FY7 A;  4EEG A;  1ZCT A;  4HOC A;  1H4C A;  5CQM X;  3KIA A;  1FWY A;  1O7Q A;  2C0N A;  2DPW A;  2FYC B;  5CMI A;  1QGQ A;  4AYL A;  4Y6U A;  3GUE A;  2RJ1 A;  1GX4 A;  1ZJO A;  2X60 A;  1R7V A;  2YQJ A;  4KPZ A;  2NXV A;  3T7N A;  1VZX A;  1R7U A;  4DEC A;  1QGS A;  5C8R A;  1W57 A;  1FRW A;  2P6W A;  2J0A A;  3OH0 A;  1TW1 A;  1YRO B;  5C47 A;  5C1G A;  1NWG B;  3V0M A;  2E3D A;  3QVB A;  2PGV A;  4NAN A;  3ZF8 A;  1G3L A;  1ZJP A;  2WVK A;  1VH3 A;  5C48 A;  1JV1 A;  2P73 A;  4EVW A;  1LZ7 A;  2WEE A;  4LW3 A;  2XMH A;  5C38 A;  3E25 A;  2ZU9 A;  2RIY A;  4Y6N A;  1FXO A;  3U0Y A;  4Y62 A;  3Q7U A;  4B4G A;  2O1F A;  2Y4M A;  1ON8 A;  1NKH B;  4MYB A;  2OEG A;  3V90 A;  4D48 A;  4D0Z A;  1LZJ A;  2VSI A;  2ZU7 A;  1FO8 A;  3V0N A;  4FRD A;  4CJB A;  2VS5 A;  4AC3 A;  2RJ7 A;  4M2A A;  1VM8 A;  4Y7U A;  1H5T A;  1ZJ0 A;  4YS8 A;  2D7I A;  1VGW A;  3OAM A;  1G9R A;  1LZ0 A;  3I0H A;  4JD0 A;  1H5T B;  2RJ4 A;  5I1F A;  4G87 A;  5DDT A;  2X5Z A;  2O1H A;  5AJN A;  1ZJ2 A;  2APC A;  1WT0 A;  4B4B A;  1WT1 A;  2XWL A;  1G93 A;  2GGQ A;  3CU0 A;  1H7G A;  4B3U A;  4B2X A;  1GX0 A;  5CQO A;  4ARW A;  2FFU A;  1LL0 A;  3U0X A;  2FYD B;  4CJC A;  3K8D A;  4KRV A;  4Y9X A;  4CVH A;  2J0B A;  4GBP A;  1H5S B;  4EE4 A;  5FU8 A;  1FGX A;  4ASJ A;  3JUK A;  2YQH A;  4O6M A;  3I0G A;  5FV9 A;  1H4E A;  2Y4L A;  3T7M A;  4XWI A;  3SX8 A;  2AM3 A;  2AGD A;  2V0H A;  2BO6 A;  3R3I A;  4J18 A;  4L41 C;  2VFZ A;  5FTV A;  1HM8 A;  1W55 A;  1JV3 A;  1E5K A;  2I7B A;  2W0V A;  5FTS A;  3U2X A;  5EIY A;  3OKR A;  3I0L A;  1H5S C;  1R7X A;  2ICY A;  4P02 A;  3D8V A;  2XME A;  1OQM B;  2E8B A;  3SXG A;  2ZU8 A;  4MND A;  4FIY A;  1LL3 A;  1QG8 A;  5CQL X;  2QGI A;  1VGT A;  2A8U A;  5CMG X;  1PZY B;  3OGZ A;  1YP3 A;  3DK5 A;  4CJ8 A;  1ZCU A;  3T7O A;  1G8O A;  4KNX A;  2CU2 A;  2Z86 A;  1FXJ A;  5C4C A;  1O7O A;  2JCJ A;  3DJ4 A;  3V0P A;  2X5S A;  4G3S A;  4HO6 A;  5IDT A;  1ZDF A;  4B2W A;  2V0L A;  5IFY A;  1NQI B;  5IDS A;  3LW6 A;  1YP4 A;  4M28 A;  3SXA A;  5C4D A;  1H4D A;  1H3M A;  2A8W A;  1WSZ A;  2WAW A;  2RJ0 A;  1O23 B;  3U2U A;  2RJ9 A;  1K4V A;  1R7T A;  4EE5 A;  1ZI4 A;  3FWW A;  3U2T A;  1GQC A;  5J49 A;  1S4P A;  4KC4 A;  2AM5 A;  2VD4 A;  2PGY A;  3PKP A;  4FRQ A;  3TQD A;  3IOH A;  1TVY A;  3FOQ A;  4Y7F A;  3NGW A;  1ZCV A;  1WT2 A;  2WVM A;  5JQQ A;  1G1L A;  2Y4J A;  4MIX A;  2PA4 A;  3IOJ A;  1ZIZ A;  2V0I A;  4B4M A;  1MP3 A;  2OEF A;  5C3B A;  5CMH A;  3BCV A;  2BO4 A;  1JVD A;  4FRH A;  3OC9 A;  3Q80 A;  4R7P A;  4M4K A;  4IRP A;  3TZT A;  4HCQ A;  3EE5 A;  1IIN A;  2RJ8 A;  1LZI A;  1GA8 A;  3ZLL A;  1G23 A;  1G95 A;  3I0E A;  2D7R A;  4D11 C;  2RIX A;  3OH4 A;  1S4N A;  2BO7 A;  2VSH A;  3K8E A;  1H7E A;  1H7Q A;  3JTJ A;  2WE9 A;  3I0C A;  2AM4 A;  4HO0 A;  3U2V A;  4AAW A;  4BQH A;  4ECM A;  1EYR A;  1H5S A;  3Q4S A;  3ZLK A;  3V0Q A;  1R7Y A;  1FG5 N;  1R82 A;  4FRM A;  1MP4 A;  4KQL A;  4HO4 A;  1W77 A;  2AE7 A;  3U2W A;  1H5S D;  2I5E A;  2BO8 A;  3ZGF A;  4EE3 A;  3I0F A;  4EEM A;  3SXC A;  2UX8 A;  2RJ5 A;  5BXC A;  4HO9 A;  4Y63 A;  4FQW A;  1SS9 A;  2FFV A;  3RMW A;  1ZI3 A;  2JCK A;  3D5N A;  1ON6 A;  4UEG A;  4KPX A;  4KNR A;  3IOI A;  4FCE A;  1I52 A;  3SX3 A;  3BRK X;  4FIX A;  2YQS A;  5EJ1 A;  3CKV A;  3SX7 A;  1ZJ1 A;  3SXE A;  1ZDG A;  1VGU A;  5CQP A;  1NMM B;  3HL3 A;  3SPT A;  1ZI5 A;  5HS2 A;  4Y64 A;  1V84 A;  1MP5 A;  1VH1 A;  4FRP A;  3F1C A;  4Y7T A;  5D92 A;  3SXB A;  2YCM A;  1JYK A;  1INJ A;  1FR9 A;  5C3A A;  2VS4 A;  2JCL A;  1OMZ A;  3CGX A;  3I0J A;  1OMX A;  4EEA A;  4ZDQ A;  1G0R A;  3RSB A;  1JYL A;  4DE7 A;  2AH9 A;  5FUH A;  2W0W A;  3E26 A;  3V8Y A;  2FYA A;  1VPA A;  3DUV A;  5AJO A;  1ZCY A;  3I0K A;  4EEO A;  1MC3 A;  1G97 A;  2VXL A;  1S4O A;  4D0T A;  2WGZ A;  2MZB A;  2PX7 A;  4B5B A;  1GWW A;  4KXO A;  1H7L A;  4HO5 A;  3PNN A;  1HM9 A;  1R81 A;  4NAL A;  5C36 A;  4HO8 A;  4P00 A;  3R2W A;  1LVW A;  4NAK A;  3O3P A;  5L6V A;  4O6N A;  2OI6 A;  5EJZ A;  3V8Z A;  1ZHJ A;  4HG6 A;  2Z87 A;  1HJL A;  2RIZ A;  4D11 A;  4JIS A;  4E1K A;  1NHE B;  2YC5 A;  1QWJ A;  1VZT A;  1HV9 A;  1IIM A;  1TW5 A;  5L6S A;  2V0K A;  5CQN X;  4Y7G A;  2Q4J A;  4KC1 A;  5FYE A;  4HO3 A;  2VXM A;  4FCU A;  4IRQ A;  4K6R A;  2YES A;  3I0D A;  1VZU A;  1TZF A;  1KWS A;  1H7H A;  4Y7V A;  1WT3 A;  1FGG A;  3JUJ A;  1R80 A;  3RMV A;  2Y4K A;  1XZ6 A;  3V0O A;  4FRL A;  1EZI A;  1G2V A;  3POL A;  4ASY A;  2FYB A;  4FRE A;  2JCO A;  2XWN A;  4G3P A;  1ZI1 A;  2YQC A;  2I5K A;  1FO9 A;  2VS3 A;  1O0R A;  1INI A;  5AJP A;  1NF5 B;  1GQ9 A;  2O1G A;  1GWV A;  4FRO A;  5D91 A;  1FOA A;  3CKN A;  1V82 A;  3V0L A;  1FR8 A;  1Z90 A;  2RIT A;  2WVL A;  2ICX A; 
#chains in the Genus database with same CATH homology
 3USQ A;  1XHB A;  1H7F A;  2V0J A;  4AYJ A;  1V83 A;  4KC2 A;  4FRA A;  4BMA A;  4Q7C A;  3V91 A;  3OH3 A;  1JVG A;  2YC3 A;  3D98 A;  1WVC A;  1HJJ A;  2P72 A;  4KT7 A;  3CKO A;  2Y6P A;  2QKX A;  4M2B A;  3ST8 A;  3I0I X;  4NAI A;  1VIC A;  4B42 A;  2VK9 A;  4LW6 A;  1ZJ3 A;  5DDV A;  4HO2 A;  5C1H A;  5C4F A;  3CKQ A;  5C49 A;  3OH1 A;  2QH5 A;  1LL2 A;  2Y7A A;  5CMF X;  2OI5 A;  2AES A;  2RJ6 A;  2XWM A;  3CKJ A;  4DDZ A;  3OH2 A;  1PZT A;  5C4B A;  5C1L A;  3ZGG A;  2OI7 A;  1H5R A;  3USR A;  3N9W A;  5C4E A;  5CMJ A;  3SXD A;  1H5R B;  1VGZ A;  3PKQ A;  3SX5 A;  4C2S A;  2D0J A;  2GGO A;  4G3Q A;  1FZW A;  5FU0 A;  1H7T A;  4FRB A;  2X65 A;  1YP2 A;  3F1Y A;  1HM0 A;  5C3D A;  2AEC A;  2FY7 A;  4EEG A;  1ZCT A;  4HOC A;  1H4C A;  5CQM X;  3KIA A;  1FWY A;  1O7Q A;  2C0N A;  2DPW A;  2FYC B;  5CMI A;  1QGQ A;  4AYL A;  4Y6U A;  3GUE A;  2RJ1 A;  1GX4 A;  1ZJO A;  2X60 A;  1R7V A;  2YQJ A;  4KPZ A;  2NXV A;  3T7N A;  1VZX A;  1R7U A;  4DEC A;  1QGS A;  5C8R A;  1W57 A;  1FRW A;  2P6W A;  2J0A A;  3OH0 A;  1TW1 A;  1YRO B;  5C47 A;  5C1G A;  1NWG B;  3V0M A;  2E3D A;  3QVB A;  2PGV A;  4NAN A;  3ZF8 A;  1G3L A;  1ZJP A;  2WVK A;  1VH3 A;  5C48 A;  1JV1 A;  2P73 A;  4EVW A;  1LZ7 A;  2WEE A;  4LW3 A;  2XMH A;  5C38 A;  3E25 A;  2ZU9 A;  2RIY A;  4Y6N A;  1FXO A;  3U0Y A;  4Y62 A;  3Q7U A;  4B4G A;  2O1F A;  2Y4M A;  1ON8 A;  1NKH B;  4MYB A;  2OEG A;  3V90 A;  4D48 A;  4D0Z A;  1LZJ A;  2VSI A;  2ZU7 A;  1FO8 A;  3V0N A;  4FRD A;  4CJB A;  2VS5 A;  4AC3 A;  2RJ7 A;  4M2A A;  1VM8 A;  4Y7U A;  1H5T A;  1ZJ0 A;  4YS8 A;  2D7I A;  1VGW A;  3OAM A;  1G9R A;  1LZ0 A;  3I0H A;  4JD0 A;  1H5T B;  2RJ4 A;  5I1F A;  4G87 A;  5DDT A;  2X5Z A;  2O1H A;  5AJN A;  1ZJ2 A;  2APC A;  1WT0 A;  4B4B A;  1WT1 A;  2XWL A;  1G93 A;  2GGQ A;  3CU0 A;  1H7G A;  4B3U A;  4B2X A;  1GX0 A;  5CQO A;  4ARW A;  2FFU A;  1LL0 A;  3U0X A;  2FYD B;  4CJC A;  3K8D A;  4KRV A;  4Y9X A;  4CVH A;  2J0B A;  4GBP A;  1H5S B;  4EE4 A;  5FU8 A;  1FGX A;  4ASJ A;  3JUK A;  2YQH A;  4O6M A;  3I0G A;  5FV9 A;  1H4E A;  2Y4L A;  3T7M A;  4XWI A;  3SX8 A;  2AM3 A;  2AGD A;  2V0H A;  2BO6 A;  3R3I A;  4J18 A;  4L41 C;  2VFZ A;  5FTV A;  1HM8 A;  1W55 A;  1JV3 A;  1E5K A;  2I7B A;  2W0V A;  5FTS A;  3U2X A;  5EIY A;  3OKR A;  3I0L A;  1H5S C;  1R7X A;  2ICY A;  4P02 A;  3D8V A;  2XME A;  1OQM B;  2E8B A;  3SXG A;  2ZU8 A;  4MND A;  4FIY A;  1LL3 A;  1QG8 A;  5CQL X;  2QGI A;  1VGT A;  2A8U A;  5CMG X;  1PZY B;  3OGZ A;  1YP3 A;  3DK5 A;  4CJ8 A;  1ZCU A;  3T7O A;  1G8O A;  4KNX A;  2CU2 A;  2Z86 A;  1FXJ A;  5C4C A;  1O7O A;  2JCJ A;  3DJ4 A;  3V0P A;  2X5S A;  4G3S A;  4HO6 A;  5IDT A;  1ZDF A;  4B2W A;  2V0L A;  5IFY A;  1NQI B;  5IDS A;  3LW6 A;  1YP4 A;  4M28 A;  3SXA A;  5C4D A;  1H4D A;  1H3M A;  2A8W A;  1WSZ A;  2WAW A;  2RJ0 A;  1O23 B;  3U2U A;  2RJ9 A;  1K4V A;  1R7T A;  4EE5 A;  1ZI4 A;  3FWW A;  3U2T A;  1GQC A;  5J49 A;  1S4P A;  4KC4 A;  2AM5 A;  2VD4 A;  2PGY A;  3PKP A;  4FRQ A;  3TQD A;  3IOH A;  1TVY A;  3FOQ A;  4Y7F A;  3NGW A;  1ZCV A;  1WT2 A;  2WVM A;  5JQQ A;  1G1L A;  2Y4J A;  4MIX A;  2PA4 A;  3IOJ A;  1ZIZ A;  2V0I A;  4B4M A;  1MP3 A;  2OEF A;  5C3B A;  5CMH A;  3BCV A;  2BO4 A;  1JVD A;  4FRH A;  3OC9 A;  3Q80 A;  4R7P A;  4M4K A;  4IRP A;  3TZT A;  4HCQ A;  3EE5 A;  1IIN A;  2RJ8 A;  1LZI A;  1GA8 A;  3ZLL A;  1G23 A;  1G95 A;  3I0E A;  2D7R A;  4D11 C;  2RIX A;  3OH4 A;  1S4N A;  2BO7 A;  2VSH A;  3K8E A;  1H7E A;  1H7Q A;  3JTJ A;  2WE9 A;  3I0C A;  2AM4 A;  4HO0 A;  3U2V A;  4AAW A;  4BQH A;  4ECM A;  1EYR A;  1H5S A;  3Q4S A;  3ZLK A;  3V0Q A;  1R7Y A;  1FG5 N;  1R82 A;  4FRM A;  1MP4 A;  4KQL A;  4HO4 A;  1W77 A;  2AE7 A;  3U2W A;  1H5S D;  2I5E A;  2BO8 A;  3ZGF A;  4EE3 A;  3I0F A;  4EEM A;  3SXC A;  2UX8 A;  2RJ5 A;  5BXC A;  4HO9 A;  4Y63 A;  4FQW A;  1SS9 A;  2FFV A;  3RMW A;  1ZI3 A;  2JCK A;  3D5N A;  1ON6 A;  4UEG A;  4KPX A;  4KNR A;  3IOI A;  4FCE A;  1I52 A;  3SX3 A;  3BRK X;  4FIX A;  2YQS A;  5EJ1 A;  3CKV A;  3SX7 A;  1ZJ1 A;  3SXE A;  1ZDG A;  1VGU A;  5CQP A;  1NMM B;  3HL3 A;  3SPT A;  1ZI5 A;  5HS2 A;  4Y64 A;  1V84 A;  1MP5 A;  1VH1 A;  4FRP A;  3F1C A;  4Y7T A;  5D92 A;  3SXB A;  2YCM A;  1JYK A;  1INJ A;  1FR9 A;  5C3A A;  2VS4 A;  2JCL A;  1OMZ A;  3CGX A;  3I0J A;  1OMX A;  4EEA A;  4ZDQ A;  1G0R A;  3RSB A;  1JYL A;  4DE7 A;  2AH9 A;  5FUH A;  2W0W A;  3E26 A;  3V8Y A;  2FYA A;  1VPA A;  3DUV A;  5AJO A;  1ZCY A;  3I0K A;  4EEO A;  1MC3 A;  1G97 A;  2VXL A;  1S4O A;  4D0T A;  2WGZ A;  2MZB A;  2PX7 A;  4B5B A;  1GWW A;  4KXO A;  1H7L A;  4HO5 A;  3PNN A;  1HM9 A;  1R81 A;  4NAL A;  5C36 A;  4HO8 A;  4P00 A;  3R2W A;  1LVW A;  4NAK A;  3O3P A;  5L6V A;  4O6N A;  2OI6 A;  5EJZ A;  3V8Z A;  1ZHJ A;  4HG6 A;  2Z87 A;  1HJL A;  2RIZ A;  4D11 A;  4JIS A;  4E1K A;  1NHE B;  2YC5 A;  1QWJ A;  1VZT A;  1HV9 A;  1IIM A;  1TW5 A;  5L6S A;  2V0K A;  5CQN X;  4Y7G A;  2Q4J A;  4KC1 A;  5FYE A;  4HO3 A;  2VXM A;  4FCU A;  4IRQ A;  4K6R A;  2YES A;  3I0D A;  1VZU A;  1TZF A;  1KWS A;  1H7H A;  4Y7V A;  1WT3 A;  1FGG A;  3JUJ A;  1R80 A;  3RMV A;  2Y4K A;  1XZ6 A;  3V0O A;  4FRL A;  1EZI A;  1G2V A;  3POL A;  4ASY A;  2FYB A;  4FRE A;  2JCO A;  2XWN A;  4G3P A;  1ZI1 A;  2YQC A;  2I5K A;  1FO9 A;  2VS3 A;  1O0R A;  1INI A;  5AJP A;  1NF5 B;  1GQ9 A;  2O1G A;  1GWV A;  4FRO A;  5D91 A;  1FOA A;  3CKN A;  1V82 A;  3V0L A;  1FR8 A;  1Z90 A;  2RIT A;  2WVL A;  2ICX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...