1O7SA

High resolution structure of siglec-7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
121
structure length
112
Chain Sequence
KDYSLTMQSSVTVQEGMCVHVRCSFSYPVTDSDPVHGYWFRAKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structures of Siglec-7 - Insights Into Ligand Specificity in the Siglec Family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords SIALIC ACID BINDING IG-LIKE LECTIN 7
total genus 28
structure length 112
sequence length 121
ec nomenclature
pdb deposition date 2002-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1o7sA00
1A6AB 2DQEL 1MFDH 1SM3L 4KKNA 5EU6D 4BQCA 2W60A 1YA5A 5H8DA 4KRNA 2WIMA 3ZDZF 1F5WA 1G9NC 2YR3A 5IBLC 5SWZB 4PJHA 1IC5H 3CFKB 4X5LA 1P7KB 4YPGB 4OFDA 5E1AA 4NRXA 1KCSH 4M9PA 4PJDB 1FYTE 2QQQA 5LGJB 4NO0D 3FL7A 4Y4HC 3NA4A 3UPAA 1ZVHA 3E0GA 3MXWH 3REVB 3FOMB 4GBXD 1DFBH 4M6OH 1RK1A 2VDOH 4M62H 4IRJA 4NT6A 1NANI 4UNVA 5IMKB 2AV1B 4JKPH 3CUPA 1ADQH 1NL0L 2IAMC 1XF3B 3EJJX 3AS0A 5DMGC 5M95B 3DVIA 3V52H 2P5EE 3H2WA 4YO0B 3HLAB 4NQEA 5MENE 4QRRE 3BPNB 4DJMA 2NY3B 2VO5A 5TGBA 5C08D 2F15A 3F65A 2BXZA 4MA8H 4NCC2 2F5AL 1MFCH 4BKLB 2X4PB 4MCYA 1BVZA 4R4FH 3CH8A 3VXMD 3HG1E 4UNUA 3NAAH 1X5GA 3VFGL 2BRQA 5I18L 4I0PA 4HULB 3UC0L 2I27N 5I2IA 5C6PB 4P5TA 1GRWA 4WY7H 1K8DB 3VD5A 3PF2A 2BSTA 4D0CB 1A14L 3WFDL 5IFAL 3V6OA 1OD9A 3VWJC 2V5YA 4Z95L 3RBGA 1M7IB 3OR7B 3P4OA 1FFQA 3V0AC 4HK3N 3QO0B 5ENWB 43CAA 3GSNL 2QADB 1GPOH 4QRRB 1RZKC 5I1DB 1UZ8B 3WHXA 3EBAA 1IKNC 2EKSA 1HILA 1WF5A 4TQEL 1EDQA 3PNWB 3C6SA 3HUJB 1FGVH 1QHPA 4HZAA 3KPNB 2NNAB 5T1KB 4RGOL 1U95A 4PJDF 4H20L 4RZCA 4RFEA 5B38B 1QSEA 4JFXB 3WEXA 4HBCL 3TJHC 3BEWB 4Y2DD 1CFQB 3GKWH 3VDAA 1OSZA 1YY9C 1I8LA 1I9RH 5DQDH 2Q8AH 1A0QL 2DQUL 4M6AA 5MP6H 1S8DB 4U1KB 4NQDB 2OTWB 3BIBX 3RNKB 3T2OA 3O81A 2Z4QA 5EU4A 5C0NC 1UGNA 2M1KA 3SY0A 1E4XI 4LLVB 3QIUA 1MI5A 5D5ME 1CWVA 3HG1A 4WW2F 4FHBD 5ESVB 5MEQB 1Z2KA 4XGZB 5EZJA 1QVOB 4EN3B 4M6NL 5IEHB 5MEOA 2L7JA 1T03L 1UYWH 4G3YL 1JZ5A 3NIDE 2P5WB 5FA4B 1M7DA 4HK0A 5FO9A 3ZDXF 1J5OL 3HB3D 4JDTL 3ZYOA 2ERJC 3DO7A 2ED8A 5C0ND 1TZGH 3ZE2E 1C5CL 4JQIL 2N7AA 3MUJA 5C0CA 3H42L 1NDGB 4G8GB 3WHXB 1AQKH 5MEOB 1KJ3H 3TNNB 4YBHA 3TJHD 1RZIB 5JA8B 3JTSA 1G9NH 2VH5H 5KVFH 3VMNA 3RTQB 5GZND 1C08B 2Z4QB 5EU4B 3OKEA 3WXVL 2BSTB 3N0PB 1S8DA 4U1KA 1KJ3L 1DJSA 2KUTA 4AY0A 1KC5L 1LNUB 1W0YT 1VEPA 1CGVA 4H20H 2EKJA 4KUCD 1A7PL 3T04D 1Q8MA 3KYNB 4F7TB 3FRUA 1LDPH 5ETUB 1YEHH 2O5YL 2OXGA 2W1NA 4YFDB 2VSDA 15C8L 4P4KD 3BW9B 3IDUA 3QUYA 4PY8J 5EG6C 3Q0HA 4PJEA 1HK6A 1FCGA 2BNUB 5E70A 1CU4L 3S5LG 1MREH 3ARZA 3VGDA 3UBXG 1KEML 3TPUB 4POZD 2FJHA 1PG7W 2FX8H 4L3ED 5I1GL 1F00I 4PTUB 3O6FB 3W9DA 1NBVL 3CUPB 3R06B 2AEQH 2N7BA 1QD0A 5KJRL 2DRUA 4GBXB 4YIQA 4DEPC 2QQNH 3MUGB 2BERA 4TVPL 1A14H 3PE9A 1T0NA 4I5BA 3VG0L 5GRWA 5DUMH 4HFWA 3THMH 1F90H 4BH7B 4MB5A 5IV2A 4Z7UA 5IW3A 4F7CB 2DBLL 4RIRA 3U7WL 2ENYA 4K23L 4MQ7A 2X1PA 2JJTA 3RL2A 1LE5A 1F4WH 5SWZA 1C12A 3CFCL 1FLRH 3F5WA 3LPGA 3CZJA 1QSEE 4LCUB 5L88H 4GXUM 1M05A 4YZFF 4AT6A 1HZHL 1CK0L 3EFDH 2DQFB 3ALPA 4K3DL 4GQ9H 4F3FA 1U2CA 2VXUH 4LHJB 3TO4D 3UYRL 3CNKA 1D9KD 4BSWB 1B0WA 1BZ7B 3IDGB 1A9BA 1HKFA 4PJ8A 3JWOH 2HJLB 3FZUC 5T3ZE 4ZS6D 5ID0B 2VWEE 4FZEH 1OAXH 3UTSE 5FYKL 4RFNB 3ZYIA 3NCYP 6FABH 5HYSA 4GW5A 1NC2B 3H3PL 4HKZB 4LRNL 2ZPKH 4UINL 4LLWB 1S5IH 3O6LL 1I3RA 1KPUA 1YJDC 5ADOL 1EEYB 1Q0YL 4WENB 5GHWL 3HNSH 5T3ZH 5C1MB 5C09E 1D6EB 2Y06H 2H2PD 3R8QA 5DJ6B 4CN1A 2BVEA 2IG2L 1FIGL 3ULSA 3BEVB 3BKYH 4AG4H 4WNQA 3B9KC 4Z76A 3SDCA 5JW5A 1MJ8H 4Q6IB 1KLFA 2VC2L 3O0RH 3HMXL 5TQ0L 4JFQA 3AREC 3C5ZA 1VGKB 4LLQA 4QRSB 5K9QG 1A7OH 3ZE1F 3QEUA 1T2QL 3GSUA 4M93B 2X4TB 1U8IA 3FFCD 3MRRA 2CGRH 3ZTNH 5C8JB 4HIJB 1A4KB 3L3HB 3T2QA 1CZ8H 3WNLA 4GKZA 2L7UA 2D7TL 3IFLL 1QNZH 4PGEA 2ICEA 1ZS8A 4OCRH 1CBVL 4JFFA 3WIFB 1MEXL 3IJYB 5D9SB 1ED3A 5IJVA 4PJXF 1QACA 5LBSH 4IMKC 5C0RL 4EIZC 4S0SD 4DGVH 3EDJA 3FN0H 5E2WH 1F4XL 1UXSB 1I75A 2CUIA 3DSFL 1NFDA 4FNLH 1BBJA 4G6AD 5HDQL 1AGBB 2CLVB 3D5OF 3PIQA 2M8XA 3L7FB 2DQIH 1MWAL 1TDQA 4ZUVA 4OI8A 3VFUA 3CFEA 3K8LA 4MXQD 2AJUH 1T3FA 2FBJL 2V5TA 2BZDA 1ACYL 1T7YA 5H35B 1DANT 3W81A 3B3IA 3RVXC 5DD1H 3HC0A 4GAFB 4BUHA 2ZUQB 1BJ1J 4P2OC 2C3HA 3QEQB 4IRSA 2NPLX 4G42B 1T1XB 5DK2B 4HJ0D 2YPLE 5D1QB 3RWDB 4Q6IA 4Z78B 1WWCA 2CXGA 1UCBH 2O5XH 4UOW0 5IFHL 1ZTXL 2C4XA 3AUVA 4JDVA 3GMRA 1SEBB 2DLHA 4UUJB 1XGRB 3UTPE 3IXTB 4U1SA 1QRNE 3GSWB 3BAEH 5JXEA 1RJLA 3I3EA 3AB0C 4OT1H 5JW4M 1KPVA 2MWCA 4L9DA 4PJ7A 4U31A 3Q6GH 2XZQL 4LHUG 4HWBA 3T65B 3UJJH 3P0GB 3BO8A 2OMNA 3FHAA 3UJJL 1QPPA 3MOAL 1KPRB 1R6VA 5HYSB 4X9FA 1CDGA 3RWDA 2C3VB 3LEVH 1ADQA 3HE6D 4B0MM 5C6WH 2WINA 4M1CD 5DYOA 3IFPB 1CDJA 5EU6E 1KSRA 5JQ6L 4P2OB 5HVHB 3RU8H 3KYKL 4NZTL 5TE6H 2O5XL 5GGSB 3PV6B 1DQQA 4ZYKB 1RK0A 1FG2B 3D85A 4HKBB 2DQDL 2ZOLA 1L4IA 1LO5A 1M05B 1G0DA 2NXYD 3IU4H 1N6QH 3DI3B 2H2SC 5AZ2H 5FKPB 4XNXH 1RIHL 2VSCA 5EBLA 2V7NA 2CDFA 3J7HA 3HE6C 2XWBB 4NM4L 3MLSH 1D9KB 1XEDA 3DRQB 1FFNB 4CDHA 3VXMA 3TBVA 1ERNA 2OX5A 3ARDC 4LKXA 3C2SA 4OF8A 1YEGH 1LEIB 1FVDA 2I9LB 1LDSA 1TJIL 1DR9A 1MNUL 3DJ9A 5EORH 1FFPB 3O11A 4TOYH 3LRSA 3EZ8A 4Z5RB 1HSBB 1IAIH 3MACL 1BGXH 3DX8A 1ETZA 3BSZL 3H9ZA 1T4KA 2ZWLT 3W11C 4XTRC 3D39D 5IM7A 2R0LL 4MJID 4KK8C 1WISA 3FRUB 1EHXA 1EEUA 4JR9L 4LQFL 5C0DA 5FUOH 5JHDB 2ZOKB 1RSFA 2P49B 3WJLA 3MV9D 5I71C 1D7FA 2EZ0C 5M7QA 5FYKD 2HVJB 4ODVL 3ARWA 2FEEL 1IBGH 3RTQD 5FUCE 1NJ9A 3LDBB 2RAMA 2XZQH 4B7IA 5E7BA 1QSED 4OV5A 3E6HA 5D6DC 1NC2A 3WL9B 1ULVA 2LE9A 1AGDA 3ARDA 5ISZD 4JPVL 1RMFL 5E94B 1OTSD 5ID0A 3NFNA 2XN9D 1NDGA 5C86A 2OK0H 1U8LA 1HH9A 1L6ZA 4LCCB 1U41A 3GMNB 4NSKB 4JFZL 1IQDA 4OM0H 2VDNH 2ICWI 1MSPA 4RMWA 4PRNA 4OLUH 3RRQA 2ORBH 3TCLA 4BK4A 1X6NA 1L7IL 1II4E 3NCYS 3BN9D 2LFGA 1U8PA 3TFKC 2P5EA 2C1PB 4P23A 1P4IH 2NLJA 3GBNL 5C0AA 1BZQK 1FBIL 2AVGA 3EHBC 4Z7VE 4PUBL 2X5PA 1D5IH 2X4QB 5D71H 2FEDC 3B2UD 1H15A 1YPZA 1DQDH 5HGAB 3ECBA 4QGYA 4ZOEA 3TYFB 3ZHLA 5J3HD 5E4EB 5D5MA 5I76A 1WV7T 3PDOB 2VTFA 4NQDD 5HYQB 4PJAA 5IOPB 1G7MA 4Z7WF 4YXLH 1ZA6B 5I1IH 1SY6L 1BQUA 3MZGB 2FJHB 3JWNC 3ZT6A 4H0HB 4NNYB 1YC8A 3HPJB 3HE7B 3S35H 4PJFF 4WW1B 2I9TA 2FSEA 1D5XA 1NGYA 2CDEB 3QQ3A 5KJRH 4OF6A 2AJZA 4PTTB 5DT1H 1IM9D 4LLAA 3X11A 4JB9H 4R90L 2JB6A 4UIKL 4Z7VB 4LAJH 5FECA 1NUDA 1JN6B 3FT4A 4LBEB 1OM3H 3TESA 2DQHL 4F15C 1EPFA 3EOTL 3MJ6A 5SWQB 3LPFA 2XN9A 3K3QA 4QXWA 4H26B 4G6MH 5HYJB 4U0RB 2EE6A 5D96C 3VFWA 3VXSB 4N90E 4ZDHB 4UT7H 2Z91A 3PQYB 4BZ2L 3AXLA 2YSSB 3JZ7A 4OF7A 5B39G 4HIHB 1RZIA 4IRZL 4LOUD 4Q9QL 4K3GA 4YFLF 1XGYH 5E8DL 4OD1L 1EHNA 3V9FA 1N0XH 2KZWA 5IIEB 3X13A 4TTDD 4XRCA 2P5EB 5FB8B 5DURD 5EO9B 1I8MA 1PG7X 2VAJA 4WTWA 1EO7A 3SJVD 2JELH 3G6DL 4MCYB 1OW0C 2UWEA 5CGYC 5FO9B 4HK0B 3EDFA 5T5FH 3OKMA 3EYQD 5F97E 4MVBD 1AXTL 1G6RH 4YO0A 4YQXL 3UCRA 1F6LL 5A3IC 4ZUUB 3BPOB 5E94A 8CGTA 3CZFA 4TTDC 3T09A 4ONFL 1AKJB 2IALB 4WHDA 5IW6B 5LWYH 1HZHH 3LN4B 2B8OT 4JY4B 4R7NA 4DN4L 2YS4A 3ULVD 3OXSA 4G3YH 5CJQL 4X7DC 3AM8A 3D9AH 5DRZA 3S36X 4JFPA 4HFUL 1PBYA 2Z92A 1HIML 5DJZB 1Y18A 3HMWH 2HTLC 4NQVB 4OFYD 4D3CL 4HPOH 4ODWB 3PP3K 2BRRL 5BV7C 5B38A 1XF2B 3QJHB 1LMKA 5KVMC 3O8XB 4LCYA 4G8GE 2OL3L 4EJ1C 2NTFA 1U36A 2ZG1A 1H3PL 4M7LL 1BOYA 3WMSA 2VLRA 1S5HB 2R0KH 4WO4D 2E8YA 3AGVA 5JUEH 1NQBA 1J1OH 3DX7A 4HBQA 3LRSB 5DTFB 4ZUTB 1ONQA 3GSRA 1BVLB 4LKCB 3LKPA 5EU3B 5HYJE 2AXFB 3RGVC 3OB0K 3AB0B 3P4OB 1BIHA 2BOBB 1EFQA 3IDYB 3VXMB 4LF3A 3SE8H 3DTXB 1HHHB 3MRMB 1DN0B 3DX9A 3B43A 4G6ML 4JLRA 3MRGB 5E8OB 4RX4D 2BSSA 1WZKA 1J1OL 1EVTC 4Y5VB 3KR3L 5DI8B 5BS0D 5ESAA 3DUSB 1KCUH 3TZVD 4Z7VF 2HH0H 3MRKB 2EEBA 2VXSH 5EN2A 3C6LA 5GJSH 3QUXA 5ADPH 1ZLWH 1G7IB 3JVGA 1GSMA 4JFEE 3MV8D 3ZKMC 1YNKH 3HLAA 3Q6FA 4ONHA 3BD3A 4TUOB 1IL1B 2QLVB 3ULVH 1XF3A 1SJXA 3T2NH 1G6VK 4YHLH 3KPMA 4N1CA 1GC1L 2YWYA 4F57H 3QEHA 1NCCH 1P2CB 2WBJA 1J5OH 4LMQE 4J1UA 4ZS7L 3N9GH 4JO2L 3ESVF 3O2WH 3HRZA 3U1SL 1OGTA 5ACZB 2FLRT 4YPJA 2ZG2A 2VQ1A 1FNEB 4TPRH 3OAZH 5E1AB 2Q7YB 1RJLB 1AY1L 4ZUSB 3IXTA 4ZODA 3V4UL 3CCHB 4OCYH 2Z8RA 1S7QB 4MSWA 4OQ1A 4H88L 4W81A 2H26A 1D5ZB 4YHZH 1KELH 4YHML 1NSNL 1KUMA 1AP2A 1MJUL 3B9AA 1P6AB 5IEKA 1NFIB 3MV8B 2H8PA 3O2DL 4OZIE 1O7VA 4WI2A 3G9VA 3RWEB 1HHIA 2JCCE 3VFPB 1CF8L 5H35A 1NMCB 4KTEH 3ARBD 4NZRH 4Y8AA 4CNIA 4CN6A 5CD3B 3K4ZA 5GS0D 4L8CA 3MGOA 3RDTD 4ALAH 1NFDB 4HS3B 4Y4HA 3V6OE 1YEFL 3SGJA 1A7BA 4CKVX 3UTTD 2IPKB 3PP3H 2P8MA 3GK8H 2IADB 1ZMYA 2DB8A 1MHCA 3MV7E 4NUGL 5GRVK 4OUOA 3I6GB 3MBEC 1MAKA 1JGUL 1JPSH 5FXCH 4PJGB 2C7UB 3OGCA 4XMKL 2AI0H 3OAZK 3RI5F 1YY9D 4KI5D 4KK6C 3NFPA 4EOWL 5C8JA 3DMMC 4Q9CA 4G8GD 3O3EB 5KN5A 4PD4K 1ZHNA 1WIUA 1NCDH 4XC3L 1ZVSA 4WTZG 3H9HA 9CGTA 4OGXL 2DL2A 4JZNA 1DSFH 4JAMB 4BQ8A 5DVLA 4EEEA 5GGTH 4KROD 4DVRL 3BQUD 4LSUH 4OCMC 1YEGL 3FQNB 4EVNA 1IGIL 1LQSR 2XY2A 5DD5L 4G8EA 1NDMA 1FL3B 4J3OC 1OLZA 4EN3D 2A74A 2ICES 3PWPB 4HF5L 1NKRA 4I48B 1JI1A 5D7JB 3H8NA 2KQMA 3H0TB 3QXWA 1NBZA 1KIUA 2CDGA 1T0MA 1DL7H 4NN7B 2H1PL 1RIUL 3TVMC 3U9UA 5EZOL 4MWFA 5JIPA 4F2MB 1G7LA 4YDKL 5CIPA 3IDIA 3C9NB 5TDNB 3D39E 1XGTA 3NABL 5D2NB 5FHBH 2E9WA 2CRIA 3BDYH 3MV8E 3V4VH 4MYWB 2V17H 5CSZB 4CVXB 2W9DL 4PY7B 3E1F1 4PGBA 1KENH 4G7VL 1SM3H 5MERA 5JW4Q 4XHJD 4HUXB 2DQCL 2ADGB 2CIIA 4OD2B 5A43C 3PWPE 3UO1L 1ZEAL 2CD0A 1NGWA 4Y5VC 4UB0H 3HC3H 1WFUA 4I18C 4LFHD 3VD7A 4MQ7B 3RL2B 2ADJA 1QRNA 3ARFB 4HZLB 4F7CA 2W9EH 5D8JL 3U7YL 4HLJA 2AAVA 1XAUA 2B20A 3MODH 4I5BB 5E56A 1QHOA 1TZHA 3PABA 4WEBL 5D2NE 4GMSH 4FQ2L 4DVBB 3BP7B 4L4VD 1JGDA 1IKNA 5J1TC 4L4VE 2BVPA 1AO7A 5BOPA 1KCRL 4PTUA 1VFMA 1X7QA 4RA3A 1JWMB 4NPYB 2ITDA 5FO8B 1JTOA 2PTVA 3QEQE 3FO1A 3KXFA 5GS1C 2AJSL 1MNUH 2I60L 1FVCB 2C1OA 3PJSA 1MCFA 3O4LD 1UJ3C 5KW9H 2GT9B 5C08B 3I9GH 4L3CA 2QHRL 4M4RA 2XPGB 4G6KH 3NPSC 2R2EB 5HI3C 1TTGA 1N7ML 4D9LH 1CGUA 4HIIA 5IBTL 5LAXA 2AQ1A 1T7VA 1R0AH 3UPRA 1EFXA 1JPGB 3HA0A 1JCKA 1NUNB 1TFHA 4XNXL 4KAQL 3FO0L 5D70H 2KKQA 1N8ZB 3QPQC 2J8UA 3I02A 5F1IB 2NY4C 1KTRL 3BT2L 2Z31D 5DJAA 5ICZB 4NWUL 1NMAH 1DEDA 4N0FB 5SWZD 5F9JB 5FKAB 1HYSC 4IJ3B 4HHAB 4B7LA 4UQ3A 5KSAB 4YC2C 1N3NA 5EU6B 3MYJB 4BFGA 3WFEH 5C70A 1D5BB 3MLTA 4MQTB 1NLDH 1HXYB 1A1OA 1JRHI 3D3VA 3ZT7A 4XNUH 4JRXD 4P4KB 1DBJH 4LCWD 4HH9A 2Q7NA 1IKFH 2V5SA 5IROC 2CQVA 3LEXA 3NTCL 1IM9A 1FL6B 2NY2D 2E27L 5LQBL 3ZLQC 3RJDA 2V17L 4W4OA 1QVOA 4Y5YA 4FABL 4NN6B 2NXYB 1YNLL 2X44D 3SGKA 1A7RH 3GEWB 4PV9B 4NDMA 4UTBH 2OI9C 4QEGA 3HUJF 5ANMB 2HTKC 4G6FB 1ZHBA 2W65A 5ACMA 1CDIA 32C2A 1RZGA 3BIAX 4HIEB 2E6PA 1WBZB 1MCNA 2VZUA 3QCVH 3PXJA 2K9UA 3JXAA 2NX5A 3BGFC 4AEIL 3SDAC 2H32B 2GUOA 3IKKA 2GTZA 1CFVH 2R4RH 4U0QB 3RA7L 3RWIB 3JWOC 3NCMA 4C56B 3FQRA 3VRLF 1A6WH 2E5EA 5F7HA 3GI8L 5CMAA 2A83B 4NKOB 2PW1A 4LU5L 2Z31A 4LRIC 2P7TB 5MHSE 4R0LC 4WHTA 1QG3A 1RHHB 1ZLVK 1S7WB 4MJ6A 1YJDL 4PS4L 2LAGB 2ZNXA 3VW3L 4KKAC 5I1JL 3OL2A 4C4KT 2BX5A 1FGNL 1YYMH 1QO3B 3FB6A 4LU5H 1FPTH 2WANA 4HEME 4M1GL 4HCRA 1N59B 4G9FA 5FOBB 3CFIC 1OGAB 5CJXC 3RPIB 4JKKA 3MROA 2XTJE 4MD0B 1A5FL 1JL8A 1CFVL 1C1EL 1T2QH 5E2VL 2WW8A 4ZNCD 5I2IB 1PSKH 1P69B 3TH2T 4J3TA 4MQXD 3OQ3B 1A7QL 5IVNA 4POYA 2WBJC 4XI5C 3WLBA 1BFVL 1DQTA 1PYWB 4OKVA 3IU3B 2R23A 2ADIA 1DQML 4LQ1A 1S9KC 3M1BB 3SE3C 2E9JA 1BEYL 2VITB 1CT8A 4WO4A 2A6IA 5DJYA 3TA3C 4L8DA 2ARJA 3ZKNC 2R8SH 5JPNB 4NGHH 1EO8H 5F7YC 5T1MA 1B6UA 3FOMA 3QXUA 5IB3A 4JFDB 3R8BB 1RHFA 3BZFB 4N0UE 3TN0D 3RHWF 1KULA 3L5HA 4PG9A 3KPOB 1D6VH 1T1YA 3W9EB 2FWOA 4BFBD 1T5XB 3VXME 4DQOL 1QYGH 2KDGA 3AAZB 3T0BA 1FNGB 3CFKA 3LQAH 3GMMA 4KC3B 4POZC 1CR9H 4KRMB 3HAEB 2IBBA 2VB5A 3AY4C 1PZ5A 1WBYB 3RZWA 4WU7B 1QLFA 4I3RH 4RQQA 3S34H 2I5YL 2UUDK 4EI5A 1P84K 4K8RH 2Z35A 4F7EA 4ZFOL 4L9LB 4M61B 1Q94A 3BKJH 3FT2A 1JK8A 2XV6B 2D7MA 5C0BA 4CU7A 4KGLA 4L9LA 4K23H 4ZXBC 5FUCC 3MXVL 2GCYB 3QJFB 2H3NA 3TA3B 3BH8A 4K94L 2EDYA 1C7SA 2YXMA 4WTZA 2BRRH 2AABL 4RGNB 4OD3H 3QWRD 1YN6A 1RUPL 2NX5E 4PR5A 1MLBA 4JCMA 5I1LB 1JFQH 5L2KD 4V1DE 4GRWF 3QNXA 5D7IF 3TVMB 3LVEA 3D9AL 1I9JL 1RURH 2DQUH 1ZWIB 4PIRF 5GZOD 5HJ3A 5CJQH 4F7MA 3KPOA 3ZL4L 3EGSA 5IW1B 3OPZL 1HH6B 5B3NA 3UPCA 2BNRA 1GHFL 5LCVH 1KCLA 5BW7A 4K8RL 2FO4A 2I5YH 2OLDA 5IB3B 2VLKD 1NGXB 3GB7B 5ITBL 1RZ8B 2ATPB 1RZKH 4UT6L 3EZJB 1KJVA 3LB6D 5I1HL 1ZT1A 1XCQA 1I7TB 2HT4C 4HWZB 3QAZB 4JM2C 4MS8D 3HZKA 4X4ME 5TE4H 2WP3T 1NFDF 3DVGA 4GSDL 1RJYA 5E4EC 3SE4C 4JY6B 5BZDA 5GSRB 1KLUB 2CK0L 2JJVA 4DQOH 4XPTL 2WV3A 5DJ8A 5T33H 2NY6D 4M7LH 1I9EA 3WS6A 1I9JH 1RURL 3FQWB 2VXVL 3VJ6A 1T7ZA 3U0PB 1JFQL 5JOPD 1J0JA 3RDTA 4FQXC 4LCCC 3ARVA 2IANA 3QIWA 4ELKA 5CBAA 5CS7A 3QCTL 3QFJD 4P49A 5J6HA 4WDIB 1FO0H 3CH1B 1V3LA 3G04B 3CVHH 4IM8A 4TRPL 1FNHA 1I7UB 1N6VA 5I66B 1XZ0A 4JFEB 5F89A 4QXUH 3RWCB 4JDTH 2G75A 1QFWL 2ZCLL 1I1FB 1INEL 4LCWE 4MD5B 3LN5A 4M5ZH 3ARQA 4HT1H 3L3OB 3NN8A 1UYWL 1ZVYA 2P7TA 5GRYA 3B5TA 3CLEH 5IB2A 1VPOL 1OP5H 1AXTH 1G6RL 1MCLA 4YQXH 1RU9L 2B5IC 2VXQL 1T21A 4FQXA 3A0OA 2YPKA 3RGVB 1X5FA 3QHTC 3F7PC 4C59B 1N64L 4S2SA 5DMIH 2NX5B 3RX8A 1H9VA 4GAJL 5I8OH 5D1XC 3O6FD 3ZKQD 1JZ7A 5J8OA 1CYGA 5J11B 5D7LA 3B9VA 5DLMH 4UZGA 1UQSB 1UFUA 4N0RA 2FYYA 3ARTA 1J8KA 1RJZA 4Y5XA 3SDAD 4HWEH 1WIPA 4OZHA 2ZP0T 4L3EE 5E6IA 2A1WH 1A6ZA 2JLLA 2DQEH 4KVCH 2A77H 2WSKA 3VFSA 2AI0L 3QB7C 2CRMA 3P0YH 4X5WA 3NA9L 3AVEA 4IRJC 3MRDA 1DBBL 3VXQA 4KK5D 1KXVC 1UM4L 5KZCB 4PREB 1VFAB 3K80A 4HXAH 1EBPA 3F12B 5IVXA 5HPMA 4XZUB 4HXAL 3UTQA 4C58B 4OLUL 1UB6A 1K2DA 2HFEB 1N2RB 1QOKA 4K8RC 2XXCB 2ESVA 2VAAA 1YNTA 4OTXL 4JFZH 4A6YL 2P47B 3M17B 1I7RB 3CFDA 3MYJA 1GGYA 4JO1H 2X4RA 3MLZH 3MA9H 4PJIA 5J89A 1DBAL 1P4LA 1S3KL 4S1RL 3NCEB 1DUYA 3ARGB 3WNKA 3KLHC 2FR4A 4KK6D 1EGJL 4BA8A 1QBBA 3EOAA 4WI5A 1BX2A 1MAJA 5TDOA 3VXSD 3ARFD 2LABA 4M02A 4X4ZA 7CGTA 5H94A 3GMLB 4AMKH 4OZIB 3VA2C 1MF2H 3JUZA 4JZJB 5CP7A 2DWEB 2MQ3A 4R4ND 3ARYA 5CILH 4UTAL 4OB5H 4LGPB 3QDMD 5AUMA 3QXDB 5B4MC 4HQQH 4NHCL 2FEDD 3MFFA 2Z0BA 5HPMB 2NXZC 3RHWK 3BHBA 1WWWX 4OQTH 4LSRL 5HI3D 2ZCLH 2UVFA 3FQXB 3CLFL 1X7QB 4HUWA 4X5WB 5F9WB 4Z77B 5L8LB 3PWJA 3W39B 5ICYB 4J3SA 2W0KA 4XX1E 5F9OH 4JE4B 4LCWA 4PG2A 1OT1A 3HI5H 4AQ1B 1MJ7L 5TH2B 4XCEB 1LP9F 3T4YB 4GS7B 1LE9A 4NNPL 4XVUC 4DKFH 3DMMB 4QHUA 4APQC 4MA1C 2DI9A 3GRWA 1MCOH 3FQXA 3DYMA 1NLDL 3IJSA 1IQWL 2YKLH 1N6QL 3STBA 3BHBB 3WFCL 2I25N 5HVWA 2Q8BL 4PJAF 3KPSB 3QXTA 4X0KB 2XACC 3MRIB 5BVJB 2IBZY 4NWUH 3BX7C 1X4YA 5DDHB 3UEZA 4OZIA 4I13B 4NJAL 3N1FC 3QUMA 5DD0L 3IKCA 1FLTX 1OWWA 5HGBB 2YXFA 4XCFL 1Y0LB 4UU9B 1LO2L 1VFUA 4I2XB 2JK5A 2Q86B 4HS6B 3OKNB 1T66D 5D1XA 5HI5C 3OMZA 1HXMB 2N1KA 1DLHA 2HLFC 3K7UA 4WHCA 3P3YA 1MCQA 4X8XA 3Q6GL 1GGBL 1KTKE 1IE5A 4V2BA 3W0WB 5J6HB 2XRAH 4F37F 5BV7H 1P4LB 5DC0A 4RMUA 3BAEL 3O2DA 2A74B 5ALCH 3U30C 5KW9L 1KGCD 1E4XL 2X4RB 1A6PA 3KPSE 4X8JB 4YAQB 3FQWA 4FFZH 1XH3A 4X4XA 5K93A 2VAAB 5F9DC 4ENEC 3V2AR 3C60D 2F9BT 2XIDA 1WZ1L 2HFEA 1RIHH 4O9HH 1RIUH 3CSBA 3ALXA 3Q5YA 3TO4A 1JZ2A 1NGQH 1X4ZA 3ZT5A 2DQDH 1G0YR 5DEFB 1EUTA 5I0ZA 1OAKL 4H0IA 5CILL 3MRDB 3X3FH 3RJQB 4M48L 4Y5YC 2FL5B 4Y19B 2VDQH 1H3UA 4PJ9A 2ICWA 5IHUH 4J6RL 4KKLC 2Z8VC 3LKRB 4UQ2A 1C5DA 2FHFA 3GB7A 4PJGA 5K33A 1TJHL 1HHKA 3NGBB 4OLVH 1DQLH 5L6YL 3TBYB 3PHQB 5IW1A 3VXSE 3UO1H 5J9PB 4YX2L 4YEFA 1C5BH 1J1PL 3FHQA 3VFVA 2FECI 3HNVL 4FQ1H 2ZNWA 4G80A 1R3HB 2XTJB 1MLBB 4S2SB 3QEGH 5DMKA 3LKNB 2R8SL 4HGMA 1J10A 3QH3B 4CNIB 4XMKH 4LSPH 3V5DB 4GRWH 1EHLL 3TN0A 5IFHH 2CK2A 2C4FU 1DZBA 2EC8A 2H8PB 5INDB 3GK8L 5JO5B 1KG0A 4RNRA 3MV9B 3QA3B 3VDCA 5BCAA 1ODAA 1OQXA 2HFGH 5C09A 2G75B 2VDMH 1TVBA 4I2XE 1OAZL 1AGFA 3VXUE 3GHBL 3B2VL 1JPST 3CPLB 3MUZ1 4Y1AA 3VG9B 4Z18A 1PGRB 1GAFL 3ULUF 4S10A 1U8MA 3D6GA 5CD5D 5GJTL 4PGCB 1JPFA 4F9PA 5I1JH 5IJKC 4Z7OE 1KJ2H 2X1OA 2NY5H 1OD7A 3FMGH 4HJJH 4APQA 4JDZA 4DFIA 5IB1A 4XT1C 1U3HD 1LK2A 1IC1A 4EDWL 1J88A 4HPYL 4IJ3C 1CT8B 4WO4B 3Q6FB 5KSAC 4O4YH 1T22A 4ZO8A 5C2BH 3T0ED 3O8XD 3IU3A 3T0VA 3Q1SL 2CIKA 1ZT1B 3C6LC 4M48H 2VLKA 3KLSA 1P4IL 2DWDA 3MRKA 5FYJL 1S9XA 1MUJA 2YD4A 4JO2H 2H45A 1NGXA 1NAMA 1L7IH 4XCCH 2IH3A 2BK8A 4NQEE 5EZLB 5DI8A 4Q74A 3HR5A 4MHHG 3EGSB 4I0KA 4RGNE 2AKRB 5EUOF 3GSNA 4QYOA 2CKBB 3S4SG 1KGCE 1AGEB 1F6AB 5FF6B 4JG0L 3CPLA 2OK0L 4PR5B 4PB9H 3HE6B 5E2UL 5DJCA 2XKUA 4OLEA 4PLKC 1INQB 1O0VA 4MZ2A 4YHYB 2Y25A 2VXSL 3CAFA 1YC7A 1MFAL 2XRAL 3TV3H 2AXFA 4RBPK 5HVFB 2PW2A 4R97B 2H3NB 2GCYA 2J12B 4JFYA 4HUVA 2B2XH 3NZHH 4ZFFA 3FO9B 5HHPA 1CU4H 3P30L 2VLRB 2P48B 2NY7L 3PHSA 4JRYE 3OAUH 3TN0B 3WFEL 4Y4KA 3GSOA 5KSBF 4AK1A 1AFVH 3BUTA 3FAWA 4HWNA 4OLWH 4RWYH 1OGAE 1P9MA 4K7PX 4GXVH 3MCG1 1B4JL 3NH7H 3ORJA 1XR8A 3VGAC 2G60H 4NM8L 2X4OA 3UBXI 4ACPA 1Q9OB 5A2FA 1A3LH 1PKQE 1ZHBB 3K1KC 5HGDA 3MRCB 4WWKA 3LKRA 1YNKL 3K74B 4WWID 4OCXH 2D4FA 1MCCA 2UZIH 4FXKA 5JPNA 3RWJA 3ZKXC 4JRYB 4OZGA 4S1DD 5MEND 2VXTH 3OKMB 5DEFA 2GSIB 4AQOA 5F7LB 2X09A 5IHZA 4OCWL 5IQ7L 4LPVA 4DAGL 3CC5B 1DVFB 3DOSA 2IH1A 1P1ZA 4S11A 2FJFB 4MJIA 3U0TB 3HG1D 1X44A 4KRLB 2JCCB 2IPTH 2MSPA 1XH3B 4X4XB 4YHNB 4WW2B 2CLRB 5F70A 1DBMH 1QFOA 15C8H 1I8IA 5GGUB 4YC2B 4RWYL 2O5YH 3X13B 1WC7B 2XWJB 3RZCD 3W2DL 3JV5A 3UZQA 3KHQA 3STLB 3OKKA 4FMFA 1W0WA 1OARL 1C16A 3KPPB 4P4KC 5T5FL 5CWSA 5AAWA 2YSSA 5I75C 2ESVD 2V9TA 3O45B 3FB6B 4MXQC 2PR4L 3ARDD 5ISZA 1VB9A 3WKMH 1MIEL 4P9HH 3UPRB 1K5NA 4LOUC 1QR4A 1S7WA 4PJGE 4MHHI 1IT9H 3MTRA 4WHTB 2SEBA 2VLJB 5DDHA 2XG4A 3VXOA 5I1EL 3HAEH 3GJEA 4D3CH 2IGFL 3ROLB 4OI7A 1HHJA 4GJTB 5EU5A 3VMOA 4NO0A 5FO7A 5DR5L 3TCXA 2H2SD 4BZ2H 1BFTA 2GTZB 4XP6L 1JWUA 4NNYA 5T3ZD 2V2WA 2ITDB 5A40E 4R96A 2HJKB 3CVHA 5DZOA 5EU7E 3O41B 1SJEB 2PYED 1X5ZA 3O2VH 1JNHB 1IZKA 2HT3C 3WJLC 3MJ9L 5FEBA 5TH2A 5I74C 2J88H 5SV4A 5E03A 3RL1B 1JYVA 4J4PA 1PKQB 3ARED 5IFJA 4LCWB 1U8QA 2AV7A 2NY0B 2Q6WB 5D93B 3QIBA 3PHOB 3VH8B 4K71C 1WLHA 1Q1JH 4OI9A 3W39A 1TNNA 3B9KD 1QBLH 3BKCL 4DGIL 1P7QB 1UJ3B 5GRJL 1SY6H 3L6FB 5I8EB 1E6OH 1KB5A 1T7WA 2K3TA 4X9GA 2Q8AL 1F4XH 3O3AA 4MAYB 3FQTA 3D39B 5GGTL 3LQZB 3ROOB 2DOCA 3QDMA 1HXYA 3SKJL 5MERB 5BS0E 1MCSA 4QRTB 1QA9A 4LDOB 3BN9C 2DQJL 1V3KA 7FABH 5JPMA 5KSAA 3MGTB 4YHIA 2VISA 4KHXH 1VADA 3N1QC 4P57A 3PV7A 4QCIB 5CIPB 4L3EB 4QWWD 4AEIH 5BVPH 3IDJA 1AGDB 3WJJA 5DJ2A 4P2RB 5B8CB 3MJ9H 4AIOA 3U9UB 5FYJE 2R69H 4X6BA 4F8QA 3KYAA 5FYJD 4ZMAT 4LPTA 3HMXH 5GS0H 1UZ6F 1EA9C 2R9HD 4OLYH 3ARGA 1BAFH 1IGJB 2AK4D 1EUUA 5FOJA 4EI5C 4ELMA 1A2YB 3NA9H 3G08A 4XP6H 43C9B 2AXHA 3D69A 3CFBB 1S7VB 1WAAF 1FL3A 3LKSA 5F7EH 3S8WA 2DQJH 4L4VB 4WU5A 4JPVH 5KVEL 3QCTH 4G8FA 5ID1A 4AIZB 3EYVB 4QXTA 4J4PD 4N8VA 2HA1A 3OKYA 3UAJC 4PRDA 5GS3A 3BRDA 1ND0B 1VEOA 1MJUH 4J3VA 1U8HA 4LRNH 5GSVA 5BJTB 4P2RE 1DQLL 1JWMA 5AD0A 5F9WC 3BKCH 4TUJA 3PGDB 1J1XL 3CX5K 1GGUA 2E7HA 2I9LA 1FVDB 3SKNA 3TNMA 5I1AB 3ARRA 3BKML 4TULH 1D5MB 5D1XD 5E6IB 4OCLC 3V8OA 4K3DH 2NYYC 1JI2A 3MR9B 1DFBL 1ZT7A 4M6OL 4PRIA 5GRZA 1NGQL 1PDKA 1ZA3B 2P8MB 3D0VA 2P24B 3DV4A 5ITBH 3C8KA 1PLGL 5F71A 1U3HB 5K9KB 4HS3A 1IAIL 1P5VA 1A4JA 2P43B 3MACH 3OPZH 2R29H 3QUYC 2XZAH 5FKPA 5CZVL 2JJUA 4ZAKA 1N7MH 3QUZB 3UTOA 5ACLA 5I17B 5DJDA 5E8EA 1ES0A 2H6PB 3F58L 1K6QL 1UM6L 4PJ9C 4MDJB 5GZNC 1XGPA 2OR7A 1SJVA 4P99A 4PJXB 1JV5B 1LVEA 2E6QA 2YZ8A 4KPHL 1U8NB 2QQNL 4QTIL 5IBUG 2VR5A 5LVEA 3SEPA 1X5AA 1BFSA 5H2BB 4Z7WB 3VI3E 1B0GA 2C3VA 1UH4A 1LO2H 5EO1B 1D5ZA 5I66A 4KI5C 2V5RA 4GRLA 4FP8L 1HCFX 2IEPA 4AM0B 5DD6A 1TTFA 1U91B 4EUPG 1AE6H 2Y6SC 3UROR 2QQKH 5L2KA 1T0MB 3OTTA 4I3RL 2MKWA 4MAUL 1W72H 2FDBP 1I85A 1BVKB 4MD4A 5T3XE 4NQXA 2PO6A 2Q8BH 5DUBA 5DFVD 3RKDD 1NDMB 1WWBX 3MLWL 3UXFA 1QTYT 5J11C 3HRZB 2OJEB 5IMMB 4LLMA 4JJ5A 4QRRD 5HI4C 4ETQB 3QRFM 4JZJC 2IPTL 2YD9A 4KK9C 2VDRH 4YDIH 5CEXB 3RPKA 3QZWA 5J4MA 1UM5L 4M7LT 2ZCHL 3S3SA 1IAKB 4N1EA 3TH3T 1RJYB 3LS4L 5EBWB 1GZQA 4PJ5D 2GIYA 4G7VH 1WQVT 2BHYA 1YMHA 2OQJB 3HPLA 3EOBB 3HMWL 4JPWH 2EIEA 3VE0A 3WD5H 3TM6A 4JFED 1SHMA 5DJXB 1E28B 3KPLA 1KB5H 1IAOB 2VLLB 1HH6A 1DUZA 3QIWD 1KJMA 2GK0B 5EZOH 2YZ1A 5D7SL 3MMEB 1FZJA 3WIHL 1ZWIA 1S7UB 2G60L 3VFOB 4GFTB 4QNPF 2D0FA 1CLOH 3T0EA 4WJ5A 4X83A 1VFBA 4GXVL 5I1LA 1S7XB 4PJ8C 1ZS8B 1S78D 1DDHA 5E08H 1HOCB 5CD3A 3VMPA 3TYGL 2DQGL 3DX6B 1MF2L 4KDWA 4ORGA 4OLZH 3RNQA 2VQTA 3K2UL 1Z5LA 2WP3O 4APQD 1R3LA 5C08E 3DYPA 3L5XL 3GSRB 5JOFB 3PL6D 4BSVB 4NQTA 4Y19E 4FNLL 5DC4B 1GIGL 5CD5C 2LTQC 1JMZA 5GGQL 2GSGA 3ZKMD 2P1YA 3EJYC 3VA6A 1S9YB 2BY2A 4PS4H 1R3JB 1WK0A 1YJDH 2ATKB 3HKFA 1H0DB 3O8XA 4LCYB 4Z7WE 3RKPA 5IVZA 1MFEL 4KUCF 4GRMA 3EAKA 4U1HB 5JW5B 3RI5K 4XCYA 4NRYA 2OR8A 2JB5H 4YHKH 1N0XL 4JFOA 3PWLA 5DJZA 4LLUB 5E1HB 4KK9D 1ZTXH 4IRZH 1A6WL 4Q9QH 1G9MH 3OB0H 3BJLA 1DQMH 5I9QB 4NKIL 5C0JB 1TNMA 4N0UB 2UVEA 4Y2OA 1FGVL 5ACZA 1MIMH 3PL6B 5F7MC 1A7QH 2Z93B 3GMOA 1J8HB 4Y88A 3EKCA 5CEZH 3OKDA 3CZFB 1R5IB 2AJUL 4WV1A 4HKXB 1YECH 1X5YA 4K3HA 4Y4HD 4YHOH 4OQTA 1A9BB 3G9AB 4H0GA 1A7RL 4O4YL 4PJ8B 2H32H 2V2TA 5IFAH 2W59A 3M1BA 2BVQA 2LTQB 3EO9L 1FG9C 4FQIH 1UACH 4M1GH 4WY7L 4Y2DC 2EEAA 3TO2A 4W6XB 5EZIL 4TYUA 2BVTA 1ZLUH 4YX2H 4NYLB 4Y5VA 4WCYH 3NGBC 3L3IA 3ZE0E 1IEAB 1YMMA 2FB4L 4XNUL 5GJTH 5JDJA 1C12B 3Q48A 3OJ2C 1A6UL 5C9KA 3MRGA 3JUYA 4GKNA 1JUFB 5IV2B 5H37H 2DM4A 5KANG 3QQ9D 3B2VH 4LVHB 2Z91B 3HZYB 4WFFD 4GBXA 2QSTA 5KS9F 4H26A 3K0WA 3QPXL 3U4EB 1ONQB 1PZUB 1FLRL 2VDLL 4KAQH 5F6HJ 3V5HB 2FB4H 1NAML 1I4FB 1NEZG 5GRXG 2I24N 4POUB 4PJEB 5F7UA 4IHOB 2OZ4A 3GI9H 2ERJB 2NTFB 3CVHL 2AJZB 2F53A 2BXYA 1KYOJ 4QRQA 4WW1A 5IP4A 1LD9A 4PGDB 2QHRH 3GSXB 3D2UB 3ILQC 4K55A 3QZWG 3QO1A 2UZXB 2WIIA 3HNVH 4FQ1L 1ZV5A 1KCUL 1QRND 2LU7A 4N0YH 4KZEH 5F88A 4OFVA 3FQUB 2ICCA 1WBZA 1J0KA 5I1KL 2Z8WC 4M5YL 4RDQG 5HHXH 4U3XA 3OXSB 3IJHA 2F58H 3B4NA 4KJPD 4O5LH 4R7NB 1MQKH 2WBKA 1OF2B 4NDMB 4PV9A 1YQ2A 3VG9C 5KZCD 4WGVB 5DHVA 1J8HE 2O5ZL 4GMSL 4Y2DA 5C0EA 4NKIH 1CE6A 3KPQB 1U58B 2G5RA 3QIWC 2PYEA 5SX5H 2MJWA 1I1AA 4ODUB 4DGYL 1RZ7H 4ZAKC 1SVCP 1KC5H 5IK3A 2UWEB 2YD1A 4Q9BA 4CADA 2DLFH 3NZ8B 3FFDB 4OBSA 5CZXC 1SYSB 3SGJC 5H37G 4G9DB 1OCWH 1WTLA 2OL3H 2Y07H 4JFDE 3K8KA 4TVSa 5EOCL 5J1SC 3MRLA 1OTUD 1TQCC 4U7KA 1ZLWK 1M1SA 2A0LC 4TSCL 4JFHE 3MLYL 2VKWA 4KJQC 4FQHB 2QBWA 4YGVA 4FS0A 5ITFB 2FD6H 1SYVB 3G5VB 4JQIH 5HI4D 3PQYA 2FX8L 3TLRA 4ZDHA 1JPGA 2WM0A 4C57C 1VCAA 1MH5B 3REWA 2FH6A 1JNJA 3GO1L 5F88B 3S34L 2IFFL 4X6FA 3BXNA 1JHKH 3QO1B 5CSBA 1TTUA 4FQLL 3VRJA 3BEWA 4EKXA 3QRGL 2DD8H 2JB6B 1QBMH 2VLRE 1SJHA 4UTAH 1EMTL 1CN4A 4Y16D 4R26L 1MWAB 1NGYB 1D5XB 1FVCA 1W8OA 2C1OB 4BFIA 5JR1H 1T4KB 4NZUH 2FX7H 4U2YA 3UTSD 1HN1A 3OR6A 3MLRL 4I0CC 3CSPA 4MDIA 3LEVL 2XTJC 4G43A 1AC0A 1I1RA 4QT5A 3V5HA 1G9NL 1G7MB 1UZ8A 4JRXE 2VZOA 1WCQA 2VDKH 3VRIA 2YRZA 1FNFA 1YPZB 2XXMB 1LO4H 3QUKB 1IGTB 2P8PA 3RTQC 4PJHE 4LVOC 4XXDA 4WI9A 2NZ9C 3GGWA 2VLJE 4JJHA 2R1YA 3LQAC 4TSBL 2VLJD 5F44A 4D0CA 2XWBA 1IGML 2GI7A 4KK5C 3GM8A 5C07A 4NKMB 2NX5D 3QP3A 4NUGH 2ZUTA 4MJ2A 5L2KE 4G8IA 2EDNA 1HI6B 3LKOA 3SJVE 5IR1A 1LO5B 5DQJB 3W11D 1LP9A 3TCLB 1O5DT 4NHCH 3TO2B 1T1ZB 4BKLA 4NFDA 4O51A 5T1LD 5GGSA 2O93L 3TIEA 4CVUA 4NSKA 1UWXK 5CSZA 4CVXA 4X9BA 4R4BB 3HNTH 2ITCB 4WV1B 4JM2F 1HSAB 1MWAH 4PGJA 1KIRA 4MNGB 1ZAGA 3IXAA 3Q2CA 2VL5B 3I2CH 5B3JF 3EJZC 5F8RC 1RZFH 3RKDC 3T8XA 2AJ3B 5INCB 4YHZL 3U7AA 1NGZA 1MEXH 3S6CA 4NFCA 3GKZA 2BY1A 4U6HA 5D96B 2EIZA 1N64H 1QNZL 2OMBA 4GBXC 4K7PL 3MA9L 4LLYA 4UUJA 4OCYL 2ILLA 1YDPA 4JDVB 1HQRA 4EDXA 1HNFA 4KTDL 3U46B 4MJ5B 4MQXC 1JPSL 4A6YH 1JZ4A 3C8HA 2BNQD 1VSCA 4GRMB 2IPUG 1QRKA 3MXWL 2R56L 4O02L 5I8KL 5TQ0H 1R5WA 1YEDA 2QKIB 2WUCH 5GXBB 4QXUL 2ENSA 3AU1B 2F19H 3ULVL 4DCQB 2J2ZA 2GTWA 1KYOK 3KVQA 3MV7B 4N5ED 1B3JA 3D18B 4MMXC 3IFOA 5E6IC 1AGBA 2CLVA 3NOIA 4P9MH 3OKOB 5D4QA 1KXTB 1FFNA 5LJYH 1KEGL 3I3DA 5GJSL 5GHWH 1IT9L 2NY5C 4HS8L 2ZJSL 1RQ5A 1IEHA 2B1AH 3S35X 3KJ6L 1KELL 4YHMH 2IMNA 4XWOD 4JPKL 4GAJH 3L3GB 1IAOA 1R3KB 5HDBE 5DK0B 2N56A 1J0ZA 1RPQA 1L0XA 2EDFA 4LQFH 4XHQA 1RK0B 4PP1C 5DXWA 3GJFK 1XMWA 3OBAA 3ES6B 3MA7A 3GSUB 1T20B 7FABL 2WWMC 5IEKB 2GAZA 1A6VL 4M5ZL 1DBML 2N4IA 3AS2A 2G9HA 1INEH 5I73B 4H5SA 5JHLL 1GC1H 2XNAB 4MJ5A 4R2GD 3BWAA 3KJ4C 4KFZC 2H9GA 4F58H 3LPWA 1F3JB 5KTEH 4FQCH 1CDCA 1M4KA 3WUWG 2GFBA 5J06A 5CIPH 3FB7B 1WT5A 3SCMC 3VFRA 2R1WA 3GMRB 3PP4L 2NW3A 1AHWC 1G1CA 4N8CH 3F7VA 4NP4H 4J1UB 1MCPL 2VL5A 4OZFH 5KS9A 4H5SB 4Z9KB 1B0GB 3O3BA 3EYOB 4PPTA 2DLIA 2R4SL 3OHXA 4CU8A 4AJ0A 2C3GA 1OTTD 1CD0A 1AD9B 3QXVA 4WEBH 4DK3A 3DETD 1SBSH 4LVOB 4MDJA 1TJGL 3BPLC 3NCBB 2FECL 3QUZA 5HHQA 3S98A 4UT6H 3MV9E 3TZVA 1TZIB 4P46A 4X98A 1KCVH 5ESAB 1CXLA 2XQBL 2NY2B 4NKMA 3QUXD 1ZK9A 2R0KL 4JHBA 2GQHA 3P11L 4RIRB 2ARJQ 2BMKB 5IJVB 3QNZB 1CE1H 2A6KB 5ISZE 5EC2B 1CGSL 5IWLA 2ICEB 5F7NC 2BOBA 3DV6A 5L7XH 4OD3L 1SBBA 4FTVD 2QHLA 3MUGA 4WTXA 3BDYL 3RWGB 2VERN 1KN4L 2VRAA 3V4VL 3BESR 4LKCA 1KIQB 4RMSA 4JY5H 3MRRB 4FFYH 2WZPD 5AD0B 4PJXE 2QKIA 5HGGS 1A3RL 2X6MA 1MRFL 3ZTJG 3H9SB 2PN5A 1IEBA 4AIZA 3H3KA 1XF2A 1OPGH 1P4BL 3U46A 1UVQB 1UADC 3RAJH 1ZGLA 5DJ6A 3D69B 3CSYA 1QYGL 3N1GC 1NGPL 4U6HB 4OGAC 1IGJA 4LASH 3R1GL 3SDXE 4PGZA 2VMFA 1IMHC 4ZO9A 3FCTA 4LVNB 4HXBL 4U1JB 1GGTA 1KV3A 1MCRA 2HT2C 2FHBA 5GIRB 2YN3A 4JZOA 4M43H 2Q1EA 5FYLH 4ZTOH 4I77H 4S0TD 3MLVH 2YHGA 3GI8H 2FJGB 1BQSA 1FAIH 1T66C 4R4BA 3OKLA 4JPIB 1WZLA 4AH2B 3TIEB 1AFVL 2CRYA 1IAII 2NTSP 3ROOA 2VDML 5IESH 4Y4KD 3GJFA 1CDBA 4MAYA 4FTVA 3ILPB 4U33A 1I8MB 4GW4B 3ULVE 3GSNH 4N90D 2AJYH 4ZFOB 3IVKA 1AQDB 1U58A 5CFHA 1XGUA 1L0QA 3BKYL 4GXUN 4NFBA 5DT1L 5C0GA 3MLXH 4XXDB 1EHLH 5ESQB 4IOSD 3OX8B 3BQUC 1U8QB 4L5FH 1NC4A 4YHKL 2F8OA 1Q72H 5KBNC 4M9OA 1NBYB 4MNHB 3DGCR 4UINH 1MHPL 3BUYB 3R06A 1SJEA 2AXJA 1C5BL 1CL7I 4X7CC 3DMMD 5EWIL 2HJKA 4L9LC 2AJYL 1LO0L 2AERT 3TPUA 1CFQA 1YEIL 4XH2B 3FOLB 1JN6A 1GIGH 1U3JA 2HRPL 5FK9A 3JSSA 3BMVA 4S1QL 3H9YA 2F54B 4RFEB 2EH7L 4U1NA 3T3MF 2ADFH 3O4LB 3MRQA 4PRPD 2P42B 2YEZB 1BHGA 1T89A 3Q1SH 4PJHF 4BQ6A 1N26A 3ROLA 5CKAA 3VXUB 2AGJH 1KF9B 2UWEE 3KDMA 3KAAA 4F9LC 1FAIL 3UBXB 1HILB 4ZPVA 5GS0C 4ZTOL 3AROA 1HQ4A 5I1DA 4NBZB 3REWB 2WLYA 3MNVB 3I6LE 2PYFA 1OQOA 4NCC1 3OX8A 2MTPA 2H41A 5CWSB 2V7HA 1KACB 3ARFC 2MOVA 4U6VL 1FZMA 4HV8A 5E8PA 3GMQA 3MV11 4GG8B 4UDTA 5I6XC 4Z0XA 2DJUA 3KPRE 4IOFC 2EDJA 4YHOL 1I8IB 5A2KH 2AEQL 4NQSA 2YMXH 2PTTB 1FRGH 3ULUH 1IFHL 4W4NA 5F8QC 5JW3H 2HFGL 3DO7B 1DVFA 3NBNA 3RY6A 5HXMA 1JNNL 3PWUA 1VESA 2DQTL 1U8LB 4XX1G 1KT2B 1QR1A 3E3QE 2B4CH 3OKDB 3RWJB 3SGEI 4Y2DB 5C0EB 4GOSA 3QQ4B 3NIFE 3E6HB 4CN4A 1BOGB 4L4TE 2J5LB 2BVYA 2EC9U 1NC4B 3SY0B 4RGMB 4Y4FD 3T4AB 3MJ8A 3P9WB 4PJEF 4CRPA 2OTWA 2W0FA 4HXBH 2XKNB 3JWDL 5D2LA 3MOQA 1YPZE 3B9KA 4KJYA 4HJGA 4D2NA 1OSZB 1NUFA 4GAYB 3RY4A 4N0CD 3SOBH 4ZFOA 1UWGH 1QQDA 4FG6C 3D2UA 1C8PA 4JFXA 3WEXB 4KI5F 4X80H 2VOTA 1LD9B 1GH7A 3SHSA 3O4LE 3K2UH 5F7WC 1G7QB 3PDDA 2R1XA 3C08L 5T1KA 4PB0L 5T1LA 5ERWA 4KKBC 3JV0A 4Q9RL 4N8VG 3PNWA 4V1DB 1NCBL 2EKSB 4Q0XH 1WCBB 4A2LA 1NAKH 4YXKL 1EVUA 3MRFB 4WFGD 3RWGA 4ONFH 1T5WB 2DAVA 4X7FC 4FFZL 3HZYA 3LS5H 2Y6SD 4MNGE 3C5JB 2BP3A 3L7EA 4X6DA 1YMME 4NN6C 4AMKL 2NW2B 4Z0BL 3UTTB 2UWEF 4X6CF 5F72S 5L0QB 1A7NL 1S7UA 3VFTA 4P5TB 2KQNA 4DTGH 4Z7QE 2R2BB 1Q0XH 3FRPA 4JN2B 4LIQL 1NAMB 3CMOH 5M94B 1BREA 1CFTA 4ZQKB 3QWRA 2QV2A 3JWDH 3HRPA 2COQA 3EOBA 3MLUH 1KENL 4IRSD 1G7JA 1MVFA 5HD8C 2WINB 2CGRL 5HDLA 1R5IA 2NXZD 3O3BB 2ZCKL 2AV1A 5IB1B 2QQLL 2VDPL 1KIQA 3S97C 4CVWA 4GS7C 4ZTPH 3UTTE 4MS8C 3DV6B 4Y1AD 1LEKA 3S4SB 1TQCB 4HH8A 5F7FA 1UH2A 3AS1A 2B1AL 5C0JA 4NNPH 5GRUL 3F7YB 3WFDH 4P3DA 2P4AB 2AEIT 1K9TA 1OLLA 4OGYL 3MRNB 5JZ7D 2VR9A 3NIFF 4JGUA 4F58L 5FGRA 5IVZB 3NIGE 4QHLA 2NXZB 3G5ZB 3QA3A 4XVSH 4L8BB 4YWGL 1NSNH 1HCVA 4R3SB 5J1AA 3F6IA 2D9CA 1DSFL 3KPTA 3CLFH 5MHSD 5DRNA 1Y6MR 2R0ZH 4H88H 4XBPB 4ZSOE 1DQJB 4YNYB 3WN5A 3MNZA 1RUKH 1EBAA 5HHVH 1NMBH 3EYOA 5DJDB 5E8EB 4AIXA 2VXQH 5E2TH 4Q7DA 4KXZH 3T1FA 3L7FA 3PIQB 4PRBA 3DIFB 3DVFA 5SWSD 3C87A 4D0DB 1JF1B 4LHQB 4CAGA 2D7OA 3MSPA 3O2VL 1MHHA 3FB7A 3O0RL 4KTYA 4CJ1A 4DFHA 4K2UH 3LV3B 3Q3GB 4MB3A 4F57L 2H9GB 1OWRM 3V6ZB 3SJVB 2W07A 1E28A 3H7LA 5DJXA 4TRPH 3WDIA 1GCFA 4L4JA 1A4KA 3L3HA 3SKNB 1IGYA 1VGEH 2OJZH 2ED7A 4DCQA 1FO0L 1FC2D 4Y19A 2DN7A 1SEQL 4QRUB 3MLZL 3QI9B 5EBWA 1IARB 3V5KB 3FONA 3QEUB 3WSQH 4X6CE 2W91A 4Y5XC 1AD0B 4QRSA 5GRUH 5J57B 1I7ZA 5IF0A 2HH0L 2HJFA 4ELMF 1SY6A 5EH1A 5E6ID 4K2UL 5I1GH 4OLYL 1JGEA 4IRSC 5CSGA 5IMMA 4RDQF 5SX5K 3V6ZA 4O00A 3ULSB 4ODXB 3SKUD 1XGQA 4U1IB 1FZOA 3V4UH 3T1WA 3E8UH 4ZG1A 4UDUB 1MCWM 1AXSB 1BVKA 1JF1A 4D0DA 5KSUB 2NCMA 2AP2A 3JBG7 1NMBL 3FZUD 2HFFA 3J8F7 4P0DA 1OGAD 3KWWB 1CI5A 2PXYB 4NHUA 1K4DA 2XICA 4LLDA 4ZXBA 3MJ9A 4HKZA 4ZS7H 5L8JB 5DJ2B 2B1HH 3IXAB 3WXVH 5C6TH 2GTWB 2F74B 3TT1H 4F8TA 4DAGH 3VGAB 1PJ9A 5EIQA 1UC6A 3VU2A 4LNRB 4OSUH 1G9EA 5HHOD 1QBLL 1BQHB 3MRIA 4X7TA 1YEJH 5L9DH 1RU9H 3W82A 5BO1H 2EDWA 5EUOE 2A9NH 3UTZA 3RAJL 3DURA 3S37X 1GGIH 4MMZC 4IRJD 2NY4B 2X4UB 4QHUB 2HKHL 3G5XB 1FAKT 4M8QA 5ELIA 4XPFH 1DBKH 2HWZH 5IUSA 2RGSA 1MCKA 3GRWH 2OBGA 2W9LA 4XBGA 1LEKB 5F1SA 3T8XB 1OVZA 4HJ0C 2Y4SA 4XXCA 5ICYA 1JNHA 5KVDL 3CD4A 1P7HL 3O9WB 3MNWA 1P7QD 5GPRA 2EE9A 4KDTC 1D6VL 1Q9LB 2V2WB 1G7JB 5FHAH 2IAND 1PFCA 3V4PL 3P73A 2LAAA 3BW9A 3SCMD 4URTB 4O58L 1VKXB 4RA0C 4HGWB 1MWAA 4TSAH 3FAXA 3RIAK 4ZXBD 4ZQKA 4L4VA 4WU5B 2R2BA 4JN2A 4X9IA 4E42B 2YPVL 1RAMA 5J56B 1BECA 5IVXE 2XTJD 3CXHJ 43C9A 1K5NB 3AM8C 3VFTB 2FZ3A 3MLPA 3V7AG 4I1NB 2CKBH 4OFIA 4TQEH 1IGTA 2IC2A 1KJ2B 4PV8B 3JTSB 4P2QD 2FIKA 4PJFB 3BGAA 5ITFA 1DVFC 4XWGH 1T5WA 2OL3A 2JJTC 5HHXL 4DUWA 1ZHLA 4NC1C 5DA0B 2KPNA 1T03H 1MAMH 1F8TL 3L9RB 1BJMA 5C2BL 1VACA 3TN0C 4V1DA 5DRWA 2WMPA 1G7PA 5AAMA 5D7LD 5K59E 5D7LE 3OR6B 3S35L 4WW2A 4YHNA 5FCSH 1KBGL 3FFDA 1N2RA 4K3EH 2XFXA 2F53E 1W8NA 3D39A 4FA8A 4RMVA 4M7KL 4WFHE 3D0LA 3L6FA 5I8EA 1B0RA 5J13C 5MI0B 4ONGH 1P7QA 1JNLL 4HJGB 4OAWA 1RZ7L 5EZJB 4OD1H 3TBTA 2XKNA 1Q38A 3VFSB 3PHOA 4UMGA 2CMRH 5CCKL 5D71L 1T04A 1B4RA 4RGOH 3FFCE 4Y5XB 5IT2L 1SYVA 3G5VA 3HE7C 3S37H 3OJDB 5FA3B 5B39A 3QBTB 4U1LB 1A6UH 2PCPB 4YDLC 5D7LB 4KKLD 4LL9A 3O9WD 1YEIH 5C0FB 1OM3L 4P3CH 5I1KH 2UV3A 4P2CG 3GSOB 4UTBL 1Z0NA 1IC5L 5IBUB 4Y4FA 1FNSH 4JRXA 1KEGH 4FABH 2A2QT 5IK3B 2Q3ZA 1WIOA 4RWHA 3GJEB 4NQSB 4ODUA 1DE4A 3EO0B 2EIBA 3UC0H 2Y36L 4WUKH 4ZFFB 5HGHA 4ETYA 4EUPB 2VE6A 2BVOA 4P3CL 2RIKA 1FZMB 4ZFZB 1OF2A 2F5AH 4FQQB 4N68A 3RZCC 1TJHH 3VWJA 5FYJH 1JTPA 1X6LA 5IT2H 2DLEA 3V52L 4OZFA 2CUHA 2X1QA 1XIWC 4X5XB 4JO3L 2AKRA 4BQ9A 2CMRL 5CCKH 3UBXA 3L3IB 4M3JA 4HPYH 5F7DB 5GGVH 1OP5K 2IH3B 4EDWH 5L88L 3IFNH 3KJ4B 4UOJA 1FGNH 1OW0A 2UYLB 3ZKND 1FZKB 2DWDB 5DMGD 3F6LA 2NZ9D 2YEZA 2F53B 5CHNB 3I6KB 4HG4J 4NQEB 4D8PB 3DSNA 1I4FA 4JRYD 4XH2A 4HKXA 4DKAA 3HZKB 1KLGA 3FRPG 1NLBH 1EXUB 5D93C 4KMTH 2HN7B 2Z93A 4AENA 5E5RB 4U2ZA 3N85L 3QCUL 3GSQB 3NCJL 2DYPA 3FFCB 1G9MC 4LNVA 4ODVH 4RGMC 4LSVL 4PJBA 4YPGA 3VXNA 1UA6H 3DHMA 3MBED 3QAZC 2EDQA 1AIFB 4PJHB 3BZEB 1IEAA 1YMMB 4XB7A 3P2TA 4NRYB 2F54E 2EDBA 3UJTH 1TVBB 1ZT4B 3WDHA 2BHZA 3P9MB 5IG7A 4I77L 4RSVA 3B6SA 3S96B 4LVNC 4R7DB 1M7XA 1CICC 2CXKA 5HHPB 3NTCH 4YE4L 1DLFL 4L4TB 1BLNA 2JJSA 1OOAA 3C8DA 1T2JA 4OJFH 1JZ8A 4P46D 1PZ5B 1INQA 4QRPE 4ZD3L 1U92A 1HOCA 3MLRH 2IBZX 3HAEA 4JFFD 5CBEB 1DP0A 4NZUL 2I26N 3MJGX 1VFBB 2G5BB 1AGEA 3IDMA 1UT9A 4JHZA 4ODHH 1TZGL 1JWSB 4CUCA 4ODTH 1XIWA 1DEEB 1WJ3A 5J9PA 1URLA 3BPCB 3X12B 4PG9B 1KJMB 3KPRB 3PHQA 3ZYJA 2ZSWA 3FFCA 3H6JA 1U3YA 4JFOB 1RFDH 2BJML 3L5WA 3I75A 1C5DB 5AZ2L 4EZMA 4U3CA 2F5BH 5IB4B 5BZWA 2ATKA 2APXA 2A6IB 5DJYB 1RULH 1PD6A 2FD6L 4RRPG 3K2MC 3UZVB 5EOTA 3EIFA 3AC0A 1WVZA 4OIAA 1GJIA 1R3LB 4OSUL 5MP6L 5IMLA 2I60H 2JJSC 3DSFH 1BQLL 3O3DA 3CK0H 4KQ4L 4NN5B 3T3ME 5JZ7C 1MY7A 1CGXA 1R24A 3MJ7B 4M4PA 1S7XA 5DSCB 1KXQE 1U8MB 1TVHB 3OV6A 4OZFB 3QPQD 4MD0A 3CDGB 2XKSA 2FCBA 1ZE3C 1W2KT 5MEPA 5IHLB 3VXRA 4AZ8A 1HXMA 5C09D 4KV5F 4DKEH 4NUJB 1AGFB 4MGXA 5EBGA 2HMIC 3TZVB 5D8JH 5KSVB 1XT5A 3WO4B 3LD8B 3NCCB 4OF5A 2R4SH 3HPLB 4QTHA 4MJ6B 3LAFA 3BPLB 3VI3F 4D9RE 4O5LL 5EOQL 1DE4B 1UH3A 1YEFH 4L3AA 4LPYA 5FUZL 2DKUA 4NKOA 1XF5B 1XGPB 3VRLE 4JRXB 5JW4R 4HG4K 3U30B 4X6CB 4X6DF 4WO4C 4UV4H 5E8NB 3QH3A 5KVEH 1NLBL 2BCKB 3F58H 1A4JB 5C0FA 2QSVA 5FHBL 5JIKA 4GAGL 4DGVL 1RZJH 5C9JA 4E41A 1H3GA 3H3PH 2WUCL 4L8SB 3SBWA 1ZSDA 5L2KB 4M00A 5FGSA 5FYKH 4P5KB 4O02H 3D85D 5JNYA 3TNMB 4AM0A 3IGAB 5JLZB 3OG4B 3QNYA 3SDXA 2D2OA 4F15B 5DWUL 2YRPA 4PJ9B 3RVUC 4TULL 5BS0B 2VXUL 1X5IA 5E95B 2GAZB 1MCJA 4YHYC 1GZPB 2ZSVB 1T20A 1BMGA 3O2WL 3U1SH 5C92A 3FT3B 3DWTA 1AI1L 3S88H 4Y16B 3EYQC 2X1WL 4E0RB 1NCCL 4JM2D 2CUMA 1CICA 1IM3A 1RZJL 4BQBA 3QUZD 4NNXB 1WICA 5D1ZD 1AKJD 5JDSA 4QNPE 4M1DL 4JZJA 5DK0A 4RAVB 1N3NB 4KDTA 4JHAH 4XC3H 2V2XA 3WV0A 4N0CC 4DGIH 4B50A 2GJZA 1K8IB 4PBXA 4PJCE 1K3IA 3OAYH 1NEUA 5F7EL 2OP4H 3EO9H 4Y4FC 4F33B 5FM5M 2F19L 1QSZA 3RX7A 3SDAA 3D25B 3KPSD 5GGRA 2YK1L 3MRHB 3PWNA 1BAFL 4F7PA 1YN7A 4K7FB 3MV7A 4UU9A 6FABL 2FZ3B 4NQCD 3MRBB 1PY4A 5I8KH 4FZEL 1FDLL 5CUSL 4NJ9L 3S37L 1DBBH 2Y9RT 3CFDB 4DKEL 4UAOC 5DFWH 4KTDH 1GOGA 1W72A 1YNTB 2I07B 1ND0A 4P4RA 4QOKD 4NO3B 3SKJH 4WVRA 3KNBB 3IJSB 3P73B 4PRHA 2ZUXA 1TCRA 1TPXC 1JF6A 4P2QE 2APFA 1S7VA 2YOCA 5HBBA 5JA9A 1LE9B 2EIZB 3OWEA 2AXGA 3T4YA 1PEWA 2YD7A 2Q6WA 3V4PH 4MCZA 5LKNA 5IVOA 4UV7H 2FGWL 4XBGB 2F54D 3QXAA 4K7PY 1KNOA 5K9QI 5DD3H 3ULUC 3L95B 1OSPH 3ARFA 1OP9A 1KTDA 4PJFE 3RDTC 2P5ED 1X5JA 4YHIB 5DJ0B 3MGTA 3D2UD 4I8DA 4TNVF 5BMFL 4NN5C 3WFHA 2CIIB 2X41A 4X6EA 3U6RA 1E27A 3U4BH 4D9QE 1MLCA 2HKHH 4QOKB 2EC9T 2J8UF 4NO0B 5FO7B 2B4CC 3QDMB 1TVDA 1MQ8A 2VN4A 5DQJA 4C56D 5IR1B 4UILL 1BQHA 1WGOA 3PWVB 4MAYD 2A9NL 1JTTA 3ME0A 1XR9A 3NIGF 4NQCA 1UJ3A 3DXAD 2CLZA 2J6EA 2WNGA 4D0BB 2FGWH 1LO3H 4P9HC 3FB5B 1UWGL 5DO2D 1J12A 5F89B 3EOAB 3EOYG 4GT7A 3IRZA 3O45A 3HI6L 4NHUB 1G0XA 3G04A 3TT1L 1YY8B 4RFNC 1UM5H 3NIDF 3V7MA 1RZJC 2APTA 4WFED 4PLNC 1CD1B 5I74B 2XWJA 3BZDA 4KKAD 1Z0MA 4JN1H 3RDTB 2NY1C 5FCUL 3H42H 3CFJA 1EHAA 1BEYH 4YHPA 3VJ6B 3V8CA 2PXYC 4MXWL 4PD4J 4CU6A 2J6EL 2FJFA 4MJIB 5DJ8B 3EDEA 4MAUH 1K2DB 2RCSH 3U2SB 3QG6B 5DQ9A 5IVXB 2I07A 2HJFB 1ZLSL 1SJHB 3QIBD 3LY6A 1MCWW 1GZPA 4MVBC 5BXFA 4P2RD 1N5AA 1IC7H 3VRJB 4M5YH 5IHBA 2VLJA 3V5KA 3ARXA 2APBA 1J87A 2YMXL 4NP4L 4FXKB 5TPWH 2VXTL 4JKLA 3RFZC 4JKMA 5CGTA 4PJ7E 3SDCD 2YD5A 3AFLA 4NRZA 3MRCA 1YEJL 4MNQE 4PB9L 3SDAB 3UTPD 3Q3GA 1I9IH 3C5ZD 1CFNB 1K6QH 1UM6H 2X4NA 4LP4A 1ZKAA 4F33A 3UX9B 3GI9L 3LH2L 4HKJA 3RY6C 3NAAL 3GFUA 3G6AB 2IJ0C 4CVZB 5E0QA 4KMQA 3S88L 4S1SL 3RGVD 4KMLB 4Y8DC 4G6JL 3P40A 4QOKE 2M2DA 1LEGB 4CADB 3TT3L 3SGDI 4XI5D 3MNZB 3T08A 3F7RA 3O9WC 1FBIH 1BD2B 4WHYH 2AK4A 2GSIA 4U1MB 2ADFL 3LQAL 3L3JB 5SX4I 4XP5H 4G5ZL 4OZGB 4WEMB 1YZZA 3G5ZA 4QWWC 1ORQB 2HRPH 4WU7A 4RAHA 4RGND 5DHVB 3G6DH 2OS7A 1KCSL 3QSKB 4OFYA 4NUJA 4WWKB 1JGLL 4Z95H 4X7EC 4DUXA 5EZIH 3IS0X 4V2CB 3MREB 4OZ4B 2VQUA 1UXWA 3JV6A 3DROB 4I4WB 1E4JA 5IMOB 3QIWB 2EXYC 5CBAB 2R0WL 1G6RB 3MBEA 5CJXA 5EZLA 1ACZA 1NCUA 3IB4A 4YH6A 5HYIA 3K1DA 2YD3A 4E9LA 1OAZH 4D9QD 1BD2E 5IMLB 5EO0A 1HE7A 2VLKB 3MOBL 1S9WA 4R97C 1S7TB 3KPMB 3FJTA 4X6CA 4ZNEA 5IGXL 2ARJB 3QPXH 4WI6A 4F37K 1QFUL 4HK3J 5HHOB 1C1EH 3CDCA 1BJ1H 2ZCKH 4NOFA 1PYWA 4OKVB 1Z6JT 4XB8A 2EDKA 1X9QA 4M62L 3BP6A 2IF7A 3IF1A 3S5LB 2D3VA 3I75B 4W6YB 4O2CB 5DMYA 1BGXL 2V9QA 1MPAL 1INDL 2ZSWB 4WCYL 4Q6IC 4PLJD 5I1IL 4GKNB 2C26A 5BQ7B 3TC9A 1DEEA 1RZFL 3CMOL 4OBRA 1RVFH 3PWPD 1JYNA 1TJIH 2G5BA 2NY2C 3QWOB 1OGAA 4P3WA 3RPIA 4OLVL 1UACL 4PJEE 1DQDL 3L3DA 4GRLD 1CXFA 1FH5H 1IAIM 1NCWL 1CD9B 5EU3A 2ARWA 3HNTL 5C0BE 1AR1D 1GXEA 3A6CH 3ZDZE 4UNTA 2XN9E 1BLNB 1KG0B 5IWLC 1HNGA 2YUVA 1G7HB 3WS6C 5F6IB 4M61A 5ERWB 4RFOL 5CJBA 2VZTA 3HZMA 1MRFH 3B6SB 1RFDL 2BJMH 3V5DA 1JRHL 2VDNL 4JFDD 3RWIA 4Q9RH 2DM2A 4ZNEE 1R3HA 5I16A 4RCAA 1AO7E 2ZUWA 3X12A 3AAZA 2IGFH 3DROA 2XQYG 4YDVA 4ODBD 2D0HA 3SOBL 4IDJL 3PWLB 5CINL 4H1LG 1F4AA 4YFEA 1IBGL 5L2JB 3NPSB 4XCYB 5LG1A 5IW6A 4Y5YB 1KTLB 1MCHA 1ORQA 4L8DB 3L5XH 1KT2A 1QR1B 3HZMB 3MV9A 4RNRB 5I15H 1ZGLP 3PWUB 4D94A 4O2FB 4X9HA 1OARH 4LGSB 3GM0A 4FTVE 1LWRA 3AMLA 3UJTL 3TWCL 1F97A 4XNYH 2GJ6D 2XI9A 2B4CL 1JMXA 3GRWL 2VABB 3QRGH 3D3VB 3HFMH 3RNQB 4PJBF 4BYHA 3WIHH 1UA6L 1L7TH 5F7DA 12E8L 4M6ML 3U83A 1CGYA 2E7CA 1HWGB 3T0EB 4FRWA 1RIVL 1FRGL 4ODTL 1FZJB 3MROB 3NPZB 1DUZB 1CFNA 2QEJA 3OJMB 5D6CB 3AXLB 3IS1X 3BQUA 1I1YB 3I9GL 4KKCC 2DQIL 1MFBL 1QO3A 3VXSA 2Q86A 4I2XA 4UQ2B 1P6FA 2UZIL 2VE6B 4U6VH 5HGBA 2ICWB 1RVFL 2R29L 4Y19D 4KY1H 1WBXB 2NYYD 1OCWL 3EO0A 1B2WH 1OAYH 4Z7VA 2YUZA 5FECB 4L3CB 1QP1A 4PTTA 1A6TA 3BN3B 3QG6A 3KPSA 3MLWH 5DQ9B 4NC2B 2CDEA 1CLYL 4PYHA 4KWUA 5A2IH 2Y5TB 3KYKH 5IQ9B 3U36B 4U6YB 4RMQA 1EERB 5GISL 1IGCL 5TDPA 4P5TD 2VUOA 2AW2A 4BK5A 5AZEH 5B39B 3RBSA 4MNHA 3OAYK 1KN2H 1EGJH 5ANMA 4LFHG 1Q9WB 5CINH 5DD6B 3WNOA 3WSQL 4DUVA 4Q6YA 3VCLA 4KTEL 5EO1A 4OAWB 4Z77A 2Y06L 4AEFA 1CF8H 3W5NA 2VR4A 4JG0H 1V7NH 3L3JA 3O2DH 5HYSG 3MLXL 3GDBA 1FN4A 1JV5A 1E6JH 3LEXB 3LOWA 1A21A 1MELA 5GRVL 3KLAB 1YEEL 1K4CA 5AUMB 3NMEA 4Y16C 5GS0L 5SX4H 3BDXA 4W70A 4LSRH 2EDHA 5HDBF 3SKOB 3MLTB 3JWOL 3OKLB 1HH9B 3DLQR 5DRWB 5F7KC 2NY4D 4CW1A 3L9RA 1AO7D 1KTDB 2YA2A 4KHXL 4HKJB 1Z3GH 1G7LB 1ZA3A 2Y7QB 3D0VB 2ID5A 3LQMA 5GIRA 3ISWA 5SV3A 4P2QB 5B4MD 1KJ2A 2A1WL 2GITA 1S9VA 1V5JA 3BGMB 3X14A 2ZKHL 1UEMA 2O61B 4M43L 4KJQD 5HD8D 1OAQL 2AXGB 2R2HB 1GYAA 4KJWC 3T2NL 3HZVB 4EQ3A 5GRJH 1S3KH 1NCDL 4S1RH 2EDRA 2XPGA 1UVQA 4NBXB 1U8HB 1HYRC 3IT8D 3C60A 4BJLA 4PRDB 1ZANL 3ZTNL 5CZXD 4P59H 3H9SA 5D7JD 5I71B 1P4BH 3FO1B 3KXFB 5BV7B 1PQZA 1I3UA 4UIMB 3H9HB 4Z5RA 5CJ5A 1E0OB 2MNUA 3NFPB 1UM4H 1MJ8L 2VDPH 2O61A 2C7UA 2BNQA 2CH8A 2DYPD 3BWUC 4JY5L 25C8L 1P9MC 4KVCL 4P2RA 5B8CA 2IPKA 3ARGD 1OL0A 2HVKB 3FB5A 3G5XA 4M8QB 3WBDA 2ADJB 3QI9D 4HAFA 4L3EA 3V6BR 1RI8A 3O6KH 4L8SC 1NGWB 2D31A 4OUUB 2XOTA 1I7RA 5EBMB 3PWVA 1H3PH 2RFXB 3UTZB 3M17A 3P11H 2X9XA 3QHZH 3WKML 4WEUD 5C0IB 4F9LA 1FG2A 4X7TB 3ZDYF 5KAQG 2QSCL 5FGCE 1NGPH 3QEQD 4Q2ZA 5JQHC 3WFHB 1Q1JL 4LPUA 4G5ZH 4MJIE 4GG6E 1KB5B 1U8JB 4LNRA 1HIMH 1AY1H 1T2XA 4UI2A 3VXQB 2QADC 4YBQD 5IHUL 4JVPA 1Z9SA 4XVTL 4UILH 5GS2D 3BOVA 4DK6A 3ZZ1A 4YLQT 4G6JH 2PXYD 3BO8B 3E3QC 2CO6B 3VD9A 4PJ7B 4L8SA 5GGTA 5E9DA 1AXSA 5D7JA 3CDYA 3WJJC 1JPTL 5EDXA 2FGZA 1KB5L 3U7WH 1I1AC 5BO1L 2X4UA 2YPVH 1FSKB 1E4XH 4PRHB 5GGRY 4WRLA 4M7ZC 5IQ9A 3B8YA 4JEGB 2L4OA 2BNQE 4A6YA 5E8NA 5BRZA 5IBLD 5DO2C 4NO3A 2AJVH 4TSAL 1CE1L 5EUOB 5EU5B 4PJIE 4G42A 5L0QC 2HYMA 4TUOA 2ZCHH 4K94C 4OCSH 4QHKJ 3BP5B 3MA7B 3MUY1 3HC0B 3QI9A 4M8VA 4QRUA 4DN3H 1WBXA 4GMTL 3O3EA 1T3FB 5JTWA 1I1FA 5DD0H 1FNAA 5ISZB 1YEHL 5KSVA 2A9MH 3PWNB 3SJVA 1A3QA 1I1YA 4XXCC 3L3GA 1BBJB 1UG9A 5MEPB 3EYUH 2BSSB 4NJ9H 3OKKB 4W68A 3TVMA 3PGFL 2GJZB 1QEWB 5DS8B 2O26U 3DIFA 1UB5B 4PRBB 4XP1L 4R90H 1V3MA 3H9SE 3WNNA 2CLRA 3O3DB 1KB9K 1CICB 4JVUA 2CR6A 2LVEA 1JGEB 4IDLA 3PG2A 1N0LA 1DQJA 4P9ML 2B0SL 4JVWA 1HHIB 4K3JL 3STZA 5C0CE 3G5YB 3MXVH 3Q5TA 4YXLL 1JPTH 1CGWA 4JFQB 4AEHH 5BZWB 5I19H 1MRCH 3QQNA 3QI9C 3NFSL 1EV2E 4HCRH 4NM8H 4UAOB 3SDXB 3QNYB 1G84A 2ATPA 3T77B 5JNYB 2APVA 5DVMA 1B4JH 3NH7L 1Z9OA 4P3DB 1QKZH 2Z92B 4JHWL 4PBWD 4ZUSA 4XVTH 3T0AA 3BPCA 5I6XB 4GG6F 2BFVH 1ADQL 5C0BD 2VQ1B 4Y4KC 1I3RB 4MXVE 3T0WA 1U92B 2BCKA 5HY9B 3FMGL 4WGWB 3QHZL 3V79C 3BH8B 5TQ2H 1I9RL 4YNYA 3WN5B 5ALBL 3JV4B 1BZ7A 3IDGA 3QYCA 3QISA 3INUL 4RX4A 5D1ZC 2R23B 1H3VA 2HT2D 4MA7L 1J7VR 4QTHB 3C6LB 2PW2B 4JM2A 3WLBB 4Z8FH 4QHLB 1AJ7H 2OJZL 3S7GA 3GZKA 1HI6A 5DJCB 4UT7L 3VDBA 2XY1A 2JJWA 4MNQB 3GIZH 3QWOA 1NANH 4PJIF 4X4MA 5CUSH 3EDDA 3ZMRA 1JHLH 4C83A 1AIFA 4KZDH 4PJ5B 2CPCA 1GPOL 4JLRB 4PJBB 4GUPA 4WIQA 5FDWB 3BMWA 1VENA 1FO0B 4HFWB 3C5JA 5ICXA 3HCVA 5BVPL 3GSQA 2ZUVA 3EUUA 1V3JA 3IETB 2R0LH 4AENB 5E5UB 5DURB 3TPKA 4IBLT 2GJ6E 1UJTA 3MGAA 1Y6KR 2M26A 1RHHA 4NZJA 2Q20A 1GC1C 5EOTB 1A8JH 3KPRD 3FT4B 5HHOA 1MFEH 2WQRA 4MDIB 1J1PH 4OZGE 2DIJA 3BPNC 1NPUA 5JORB 3QWQB 4FQXD 3RIFK 1RUAH 1YQVL 2CKNA 3HE7A 5HYJD 2NR6D 2H32A 4NQVA 5FGBC 3L5WB 4JANB 1QQDB 1JPFB 3V6OC 3BXNB 3EJZD 3WDJA 1CLZL 5I30H 4PG2C 1RULL 4JFPB 1SMOA 4KGJA 1KOAA 4I4WA 4PJAB 3KXFD 4X5XA 3MLSL 2VJXA 1VPOH 4P5TC 2XTLA 2DD8L 2VIRA 3MREA 4KKBD 4OZ4A 3OKEB 2EE3A 1CLOL 1KCKA 3VWJB 3FO0H 1CVRA 1N59A 1NAKL 3FO2B 4YXKH 2ORBL 3LN4A 4PBVC 3DYOA 1YEEH 3TNNA 3VH8G 4QHMB 5A2JH 5EUKA 5TE6L 1CS6A 1ZHKB 5A16A 3HR6A 1U8OA 2QR0A 3O6FC 1PX3A 5JW4N 3RVXD 3C09B 1LEGA 4OJFL 5CGMA 1GOHA 1SMAA 1L0YA 2VXVH 1UKQA 1J0IA 5DMKB 5DRXB 4IDJH 1OP3H 5CLWA 5IJKA 5T33L 4Z0XB 2XZZA 3G6AA 4CVZA 1XCTA 1CE6B 2X70B 4GW1A 5IEHA 3VXNB 2PCPA 2FX7L 5ICZA 3WL9A 4J3UA 1CFSB 4J6RH 3RWHA 5E7FA 2C4FT 32C2B 3GUTB 3MJ8B 1MI5B 4QHKI 3QIUB 2E3VA 2W65B 1HHKB 2YWZA 2VKXA 1EFXB 1CLYH 5EA0L 3RP1A 3QFJE 3DPBA 2HN7A 4WWKD 3HE7D 5HYJA 4JKWA 2WWMD 1HWHB 1QFHA 4J3WA 2IFFH 2XN9B 4XPGH 3SPVA 4HIIB 2EDTA 3P4NA 4LHUD 3CXDL 4LBEA 1CIUA 5EULV 3GIVB 4PP1D 1B0RB 5JW3L 1R0AL 4D8PA 2HAZA 4YUEL 4XCNA 1BQLH 3N85H 3QCUH 4PGDA 2GT9A 5C08A 2IWGA 1ZXQA 1WUNT 3BYYA 2FSEB 1F42A 1M71A 3QDHA 4QRPB 2PO6C 4BZ1L 3VFNA 3MLYH 2FO1A 2A73B 1JZ3A 2AABH 1J05A 2IQ9H 4LSSL 4UQ3B 1AO7B 1JGVH 3U4EA 4N0FA 5F9JA 4XC1H 3P0VL 2D03H 3ZE1E 2OL3B 3OR7A 1S7RA 4LDEB 1N8ZA 4PJCB 3RUGA 3KS0J 1U6AH 1DLHB 1WFTA 3H9SD 4ZFZA 3HFML 1FE8L 1OTTC 2MKLC 4XNYL 4D0BA 4R6UA 2X7LB 5EPMA 4OLWL 4EUPA 1AQDA 2C5DC 5C0AB 4ZPVB 2CLZB 4NBYB 3QUMH 4XNMA 4JFFE 2IPUK 2YN5A 5I15L 3QIUC 3HS0B 4OM1L 3B5HA 4FTVB 1QFUH 4ZD3H