1O7SA

High resolution structure of siglec-7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
121
structure length
112
Chain Sequence
KDYSLTMQSSVTVQEGMCVHVRCSFSYPVTDSDPVHGYWFRAKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structures of Siglec-7 - Insights Into Ligand Specificity in the Siglec Family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords SIALIC ACID BINDING IG-LIKE LECTIN 7
total genus 28
structure length 112
sequence length 121
ec nomenclature
pdb deposition date 2002-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1o7sA00
4WFGE 1YC8A 4K8RC 1KXVC 3SQBA 1GYAA 3RZCA 2GK0B 4R26H 1PSKL 2E6QA 1A3LL 1FHGA 4OF8A 1IKFH 3FO1B 4Q6IB 3H9HB 5HGAB 2YEZB 1XIWB 1FDLL 4RMUA 1MAMH 5IHUH 4HJ0C 1EFXA 1K4CB 2YHGA 4QXWA 1OCWH 3FB6A 3BVNB 4HJ0D 1EFXB 3U2SB 4OV5B 2R1WB 1HI6B 2VWEC 3AS1A 3T04D 4KVNH 2BC4A 2UWEE 4BK4A 1HHJA 4J6RH 1PKQB 2Q87A 2ADFH 2FATH 3QWOB 4B41A 3MNVA 1A0QH 5I1JH 4P4KC 4X6CE 5J3HC 3UTSA 4AK1A 1N2RA 5FGCB 3NPZB 1F13A 2XRAH 1A3RL 5DD1H 2QSQA 4H25B 1HK6A 5F6HJ 5J3HD 4PGDA 4OLVL 3U7WL 4BELD 1D5ZB 5CIPH 3SHSA 3AB0C 4XX1E 3ALXA 2OZ4L 4KI5C 2HT4C 4HBCH 5DYOB 4H88L 4PGJA 5J1AB 3FQRA 3DETC 1VDGA 4GXVL 3FRPG 1RZJH 3OAYH 1AR2A 1D9KB 3MLXH 5AG8A 1A1OB 4M6NL 3WHXA 4EZMA 2J8HA 2G60H 1P7QB 1R3JA 4PTUA 5FV2A 1GCFA 4ZUVA 3GSNL 1P7QA 1A7OL 5ALBH 4ETQA 3TC9A 3OPZH 3BIBX 3L3DA 1EXUA 3U30B 5FA4A 5IMLB 4PJBB 2YUWA 5GS1C 1V3LA 3QDAA 2CO6B 3GJFB 5EIQA 1W2KT 4NO0D 3VDAA 1F2QA 2BXYA 3BX7C 5TH2B 4FTVD 1JPGA 4HKZA 4XXDB 2DS4A 5D70L 5BV7C 3HS0B 2GT9A 4JG1H 4E42A 3VMOA 4LRNL 5HHQB 4L8SA 4HUUA 4HW6A 1EVUA 3C8KB 4L5FH 4KRPB 2CGRH 5E2VH 3ULVH 5I1EL 4EDXB 5KTEH 1XZ0A 1FQ9C 3S96B 3EYSH 1F4XH 4XMKH 5CGTA 4DK6A 2CKBB 4HBCL 4HKJB 4K8RL 4XVUC 1ADQH 1OTUD 3EGSB 1B4JL 3UZQA 1ACYL 4MXWH 4OLWH 4P9HH 4K3JH 4XNUL 4PFEA 1CDCA 2GITB 1LWRA 3U83A 1TCRB 4BZ1H 2VLRE 2JJTC 1R3IL 2IMMA 1FV1A 2APWA 1FFOB 3MUHL 4KFZC 3IS0X 4XP5L 4NHCL 4KJWC 4FQXD 5CS7A 2X4QB 4QXGH 1HZHH 2UZIL 3QT2A 2FSEB 1K4CA 1JZ6A 4O5LL 2VDRH 3RNQA 5DD6A 5H2BB 3KYOA 5A2KH 5JXED 4TNWK 2AP2A 3NA4A 4XNYL 1OW0C 1TJIL 4LAQL 1QLEH 4HUKB 5I66A 2Z0BA 1FFNA 1QO3B 3GMNB 3O6FD 4QY8B 1KIPB 2VSCA 2FHBA 5CSZB 2ZOKA 2Y5EA 3QJFB 2ILLA 2A6DA 5DEFA 4X98A 4LLVA 2X4OA 2IFGA 5F1NA 3UPCA 3ZT5A 1I8MA 4LAJH 4Y5VB 4P5KA 3JWOH 3CDYA 1REIA 1F4XL 2J5LB 4N9GA 4YE4H 4RBPH 2GQHA 2H3NA 5IEKB 1QFPA 1EHAA 4P2QD 4FZEL 4YHNB 2YUZA 1JI1A 2BVYA 5I8OL 2NW2A 1WFNA 5CJ8A 3FT4B 1FYTD 3HG1D 3HNSL 5GISL 1HOCB 5CSGA 3CSGA 4MSWA 3KPQA 3D0VB 4PJ9B 3K2MC 3UZEA 5SWQB 2IBBA 3GGWA 4HV8B 1LO4L 2CLZA 5DJ6B 4NQTA 1RFDL 2BOCA 4U7MA 5ICXB 3HI1B 4NQUA 3P30L 2VIRB 3MJ8A 4APQC 3OAYK 5CZXD 5KJRH 1U58B 5F89B 3S35L 5INDA 4X99B 5LWYH 2CKNA 4OB5H 1JMXA 2DIAA 3P4NB 5TE4L 4MQ7B 1KPVA 3DUHA 3EUUA 5DK2A 4P46C 3D39D 1DBBL 1RU9L 1TZHA 4QF1A 2IMNA 5D96B 2OYPA 5FV1L 2NY7L 3V4VH 5F7LB 3ARBB 5CIPB 3MLRL 1AIFA 3SKJH 5FUZL 4J3OC 4YJZL 2YKLH 4XTRC 4XPTL 3ZDXF 2ZPKH 3VMNA 4Z95H 4OBSA 3ARPA 3RVUC 2XZQL 1CLOH 3TIDB 3OR7B 4HBQA 4ZNEA 5ADPL 5KOMC 2CDFA 3FFDB 4OUOA 5IBUB 4ELMF 1A6TA 1D5MA 3F5WA 3U7AA 3V7MA 1Y0LB 1LP9A 4QRUA 2UWEB 3WJLC 1U8QA 2W38A 3P9LA 1F6AA 1KCRH 1JGDB 4Q97A 2I9TB 5CJQH 2VXQL 3RU8L 1LO2L 5EULV 1NBYA 1JF1A 1UB5B 1YMME 4OGAD 2B7DT 3WEXB 5KAQF 4ELMA 1MFCH 2DMCA 4J3VA 5JW3H 5KS9E 3BEVB 3IDJB 3MV8A 4JFPB 5J12C 1LP9F 4GG6B 3P9MA 4L3ED 2E6JA 1VSCA 3D25A 5IK3A 1DBJL 4CVUA 2CLVA 3MRJA 2WUBH 3TA3A 2X44D 2BNRD 3U4EA 4WI8A 5FUCE 4HC1L 2OL3A 3FQTA 1IAIM 4TQEH 3KPLB 3AY4A 1QSFA 3O3AB 4K3DH 4M7LH 3MRLA 4J4PD 4K23H 4ZUSB 4KQ4H 5DD0L 2P48B 5EBWA 4AH2B 4DTGH 5JW4Q 1MQKL 1JK8A 3HI6L 1ZLUH 4KXZI 1CFVH 4GAJL 3EZ8A 1G84A 1NGXB 5TPWL 1AJ7L 1X5GA 3BPCB 2VAAA 1A6WH 3WFHA 3WNMA 3ULUH 3LKQA 3DTXA 3HZVB 1WGOA 1WJ3A 3ZKXB 3O8XA 1QHPA 3VXMB 1A02N 2BNRB 1MQ8A 4K3EH 1YEGH 1NFIA 3C08H 3L5WB 1C12A 4WNQB 5EUOF 3U9PL 3RWFB 3GI9H 4GXUN 5IQ7L 3P4OB 3T2QA 3HLAB 1NCUA 4XNZB 1LEKB 2ADFL 2FATL 3FCTA 5EU6B 3QCTH 3X12A 3GJFK 4FQCL 1Q9OB 1X4ZA 2VXTL 1VHPA 4LPYA 3KYMB 1Z0MA 2GJZB 4J8RA 12E8H 3MV9A 1J8HA 5E8PA 5HHMD 2DQJL 5JIKA 3HNVL 3O3BB 2YPLE 4QT5A 4MNGA 5JA9A 1ZOXA 2AVGA 4PJCA 3KPSB 1FZOB 4O58H 3AREA 2J5LC 5DJDB 1KT2B 1UB6B 2F8VA 3CDGA 5EA0L 3MGTB 4KI1A 1Z0NA 2ARJB 3U46A 2XG5A 4N0UA 1A5FH 5DRZB 4JGMA 2I60L 1S7WA 3NCJH 3DGGB 1NDMA 1F90H 4OKDA 5SWSA 5C0NC 1F3DJ 2K9UA 4PRPE 3AS0A 1KB9J 4QRPE 4ZQKB 3VFMA 2MMXA 1KB5A 3MLSH 4YPJA 3UXFA 4JFHE 2W0PA 5TF1H 4KKBC 1LD9B 2WZPD 2EYSA 3MNZB 3UAJC 1I9JL 2VWEE 5C2UB 2ESVD 4APQB 4LVOB 1KPVB 4LVOC 5DLML 1JPTL 2VDNH 3RX7A 2F5AH 1IGML 4GRLD 4NKOA 1NGYA 4JM4H 5A2FA 5CILL 1KN2L 4TUKH 3HLAA 3I9GH 3O4LB 1J1PL 3D85B 1QUNA 1T0MB 4WI2A 2OLDA 4P2QB 4D3CH 1OTUC 4XC3L 4PJ5B 5GZOD 5MENA 2DKSA 4R0LC 5E2TH 2PYEA 3X14B 5LGKA 4H1LG 5GZOC 4D0CB 1UXWA 4MS8D 3VXQA 2BJML 5SWZA 3IFPA 3LB6C 5IG7B 4F7CB 4S1DD 3GEWB 3H2WA 3IDXL 1OCWL 1C5DB 4M1CD 2NXZC 3BGAA 3LKSB 4L1HA 5F71A 4OAWB 5CHNA 5IHZA 1YA5A 1LGVA 1YY9D 2O5ZH 2GFBA 4BQ6A 3IVKB 3BD5A 2E7LC 1YY9C 2A74A 4Y4HC 1ACZA 2CLRA 5D9SB 3VFTA 4PRIE 1N26A 1C08A 4G42B 4Y4HD 5FCUH 1CICB 1S7RA 1MJ8H 4XMPH 3HFMH 2XN9E 1IGMH 4M7LT 4NOFA 5EUOE 1I7UA 5CEYA 1IC7H 5E9DD 3NA9H 1RZKH 4LRIA 3DX9A 2XV6B 1CR9L 1NCAL 1X9QA 2D03H 3X3GH 2DOCA 4ORZC 1M7DA 1SBSH 3K4ZA 4JHAH 1Q1JH 4H88H 3S36X 4X8JB 3DOSA 5D1XD 1ZANH 4NKDB 4EIGB 2YPVL 1N64H 1OGAE 4JFDA 2DM2A 1DLHB 3CZFB 3QEHB 5EU5A 3BD3A 2YXMA 2Y25A 1A4KA 2DQCH 4Z7UB 5GS0H 5FKAB 2G60L 5F44A 2PO6A 4YH6A 1CGTA 5D6CB 4R3SA 3FT2B 3UDWC 3EOTL 2ITCA 1DSFL 5IQ7H 3SDXE 1UADC 4FS0A 2Q20A 1J0HA 1YEDB 1K4DA 2R0ZL 1T22A 3QQ4A 4YHIB 1UA6H 1EHXA 4NQEE 2F54A 1HYRC 2KKQA 5D6CA 5LWYL 3HE7D 5L8JB 3LN4A 3LHPH 2NNAB 3QEQE 1I1AA 1YNTA 4Y1AD 5CLWA 3BKJL 5C0BB 1U58A 4NWTH 1ZT7A 2IQ9H 2MQ0A 4OM0H 4H0GA 2MKWA 3GMPB 4OLZH 5BJTA 3DROA 2AK1H 5EFIB 1F42A 1YDPB 3MXWH 4P23A 2F54D 5F6IB 1A9BA 3BE1L 4L4TA 1ADQL 1AXTH 5DQDL 2Z8SA 1T7YA 4F57L 4F7MB 1A4JA 2BHUA 5GJSH 3ZDZF 4KI5D 4MCZA 1E6JL 1BHGA 2XTLA 3H9ZA 3R4DA 1W0VB 1FGNH 3DETD 4MX7A 4X6DF 3TO2B 3WKNA 1AY1H 1AQKH 5CWSB 3ARGC 3TT1H 4OI7A 4NQSA 3RJQB 2PUQT 3HHRB 2W0FB 2X10A 2DLFL 3I6LD 4P2RD 4CW1A 3V52H 3RVWD 3CIQA 1MRCL 4ZTPL 2YK1H 5KSBE 3MNWA 5EOTB 3TO2A 2YBRB 15C8H 2A0LD 3MBXH 3QYCA 5C9KA 1MFDH 3NOIA 2CDGB 4DKFH 3WUZA 5BZDB 1JHKL 4HGWB 1CLZL 5LAXB 4I2XE 3D39E 4XNYH 5IIEA 2NZ9C 1G7IA 4GQ9L 4OM0L 3MLWL 2NPLX 1UG9A 5IJKA 1WIOA 3SCMC 3O0RH 4AIZB 4B0MM 2YPKB 1A6WL 3VXUE 2Q7NA 4KROD 5C9JA 1YEKH 3S8WA 4U1NA 1W72B 3MLXL 4PRBA 1CFVL 1MEXH 2W65A 3TGXA 4NM8H 1NGYB 3EO9L 5C0JA 2C26A 5DQJA 1BPVA 4XNQB 3ARFA 4AM0A 5BS0A 4I18A 5CGMA 2QHLA 1EEYB 1UM5H 1JPSH 3WIHL 4JVUA 1FLTX 5KW9L 4QO1A 3L3KA 5B4MD 2X4TA 5B39B 2HH0H 4ALAL 4FQXC 4JKMA 3ARDC 3REWA 3S96A 3TNMA 3GSXB 2KH2B 3BP6A 4WU7A 5JO5A 2Q8AH 4YIQB 5EUKA 5C6PB 1N6VA 1T2QL 4HC1A 3T08A 5E6ID 4JFED 2HMIC 5FUOH 3WEXA 5HHQA 4AEHL 1MREL 5J1SC 2IH3B 2V2TB 4OZFG 3EYSL 4HDIB 1RHHB 3OX8A 4XVTL 1X5KA 1D5BA 1MY7A 3V0VA 1FG2A 3MGTA 2CUIA 3VWJD 3CLFH 3OR7A 4LKCB 4GKNB 5E6IA 2E6PA 4YR6B 4PJXA 4MAUL 1NEUA 5T1KD 2BSTB 4TNVK 3GNML 3P11H 1T5WB 1YNLL 3D1MC 3SKJL 1MFAH 1TMCB 2IGFL 4LVNB 1C08B 4G42A 4LCWE 2DLHA 5J1AA 2NTFB 3MUGA 4CU6A 2G75B 4FMFA 5DHVA 3MRQA 5E5MB 1I1FA 5FYJU 2WWMD 4F37K 4GKOA 1BM3H 1LE5A 4WJ5A 1AXIB 2BSSB 3TV3H 1CXEA 4DGIL 5KOVC 3LD8C 3M17B 5SX5H 5I9QB 5ADOH 1KJ2L 1CD1A 3SQOL 3LHPL 3OB8A 2CLZB 1E6OH 2XTJB 5GGQL 1S5HA 2D7TH 4YXKH 4QOKD 4IRJB 1UVQB 4I77L 4KKAC 2FZ3A 3EHBD 4K3DL 2VAAB 1BOYA 1UACH 1K8DA 1AGFA 4XCFL 3T4YA 1V3KA 3C6LC 4LSSL 2QKIB 3VXUD 4JDTH 5ELIA 3RAJL 1NC2B 2WLYA 4PJAB 2J4WH 2NXYC 5DRWB 3GIVB 5F9AC 1RK1B 1QFHA 1UEMA 2EDFA 3TBYA 1GGIH 1OAYH 4PG9B 3RVUD 3GSOB 4KMQA 4GS7B 3UTZB 3E3QC 4KY1L 1VADA 1KIQA 1AQKL 1U3HB 4I9WE 1LO4H 2HFGL 4LEXL 2LVCA 2CK0L 2ZOKB 3LIZL 4HWNA 2O5ZL 1MAJA 2D7QA 4DW2L 1I8LC 5I2IB 5FOBA 2MSPA 5I66B 4JEGB 3JWNC 3AB0B 4HAFA 3IXTA 4IJ3C 5HYQA 3UTZA 5JIHA 4IRSC 3RTQD 4OFYD 5BO1L 4J3UA 2L0DA 1ZGLM 2JB6B 1OF2B 3ARED 1MCRA 1X7QB 3WHE0 1RPQA 1NBYB 2XQYG 3SCMA 4M6ML 3LAFA 5IROA 4XZUB 1HILB 4PJEB 3WBDA 3V4VL 2PKDA 1LP9B 3ROLB 3WNPA 5DFTA 1XCQA 1BGXL 3V8CA 2BFVH 5E03A 4FTVE 2R56L 3K80A 5T3XD 2VLKD 4QRSB 5IB1B 1DQQA 2VR5A 5I1IH 4JHAL 3BRFA 3DHJA 1E4WH 5LGHH 4NM8L 3QIBD 3BMVA 4RISH 3BIAX 1I3RB 5LQBH 2YN5A 3AY4C 5CINH 2GCYB 5E2WH 4K8RD 3TN0B 2P45B 4MMZC 4DQOH 1L7TL 4KWUA 4H20H 3D39B 4HJGA 3IU3B 3TEUA 4I0PD 4NKQB 1QZ1A 2JIXD 1IL1B 2EE2A 4PLKD 3SDDB 4CJ0A 1D5IL 1DBKH 2MQCA 2O5YH 3VI3F 4ZOBA 1HH9A 4Z0BL 1UCBH 3O3DA 2X1OA 4IIQA 1I7RB 5FYKH 4CKVX 2NLJB 2FEDC 1H8NA 5E99L 3E6HB 4YHYC 1NAKH 4L8DA 5J8OA 1B0RB 2XZAL 2J88H 2FJGB 2YPLA 4S0SD 5JHLH 4K7FB 5E56A 3WUWG 3GBLA 3AC0A 3MLSL 4G9FB 5C09D 4ZPTA 2P8MA 1VENA 3ULVF 4ZAKB 1NPUA 3GSNB 3KPNA 5D7IA 3RWEA 2X1XR 2WUBL 3GMLB 1YEHH 4JLRB 1QR1B 4RMQA 2FX7L 4HWZA 1A6UL 2AQ3A 1YEFL 3CCHA 3BE1H 1N5AB 4IRSA 4LLMA 2EYTB 2EH8H 3NABH 4P5KB 4IOSD 4N90E 4F7EB 3V4UL 1KCKA 2E9IA 2PNDA 5TQ0H 1DUZB 2JJSA 5J9PA 1I9EA 1NCBL 3QJFA 5GS3A 1A8JH 2RB8A 4NNXB 3QWOA 4YDLB 3GMNA 1V3MA 2ZNXA 4LCYA 1ZSDA 3JV5A 4W68A 43C9B 3H8NA 5BZWA 5HYJB 1MCFA 3C09B 3R06A 1NCNA 3RWHA 3TV3L 2Q86A 1EAPA 3BEWA 3VXSB 4XNQA 5BS0B 5CEZH 3NZ8B 4F8TA 3TBWB 2V6HA 2UWEF 2HKHL 4X6CA 3MJ7A 4TUOB 4ODHL 3DXAA 2C1PA 5BOZG 2H1PL 4WFHD 2EO1A 5E00A 1MCWW 3U7YL 3G6DH 1HHIB 4RA3A 4NBXB 2A1WH 5I0DA 2HWZH 1U9KA 5T3XE 3O45B 1Z9LA 1CE6B 2VXTH 3UTTD 1K3IA 1FIEA 4OLYL 5J6HB 5HYSB 1YEEL 4Y5XC 4GW4A 1OAUH 4NN5C 1OP5H 3T4AA 3B5HA 2PTTA 3KWWB 1OGTA 4EDXA 1WISA 2BSSA 4OCWL 5ECJE 4NRXB 4KK9C 2JELL 4NQDD 5EC2A 3P4NA 4FQ1H 4NQDB 1H3PL 1DDHB 2JCCB 4HUUB 4M7ZC 3KPRB 3ZKSD 1J8HD 1TXKA 2NTFA 1LEGA 3I6GB 1KBGH 1MVUA 1MPAL 4Y1AA 5DO2C 3U82B 3N9GL 1HCVA 2XQYK 3G5XA 3LB6D 1C5BL 3BDYL 5D2NB 3S3JA 1PEWA 2YUVA 1MJJB 4PJ9C 3WFZA 5E8NA 4R97B 3DYPA 3OGCB 1GAFH 4CVXA 3C87A 3LS5L 3P73B 3R8BB 5E6ZA 2X9WA 4MJ6A 2IPKA 1CDJA 5BMFL 5F7NC 1D5BB 2Y7QA 3BWAA 3DROB 4NBYB 2CXGA 4FRWA 4JQVC 3Q2CA 1I9IL 2YD4A 2EC9U 5AYUL 3UTTE 2WBJA 4GRMB 4JRXD 5D1ZC 3LN4B 3BP7B 5C0DA 4KQ3H 2ED8A 1BX2B 1NMAH 3KPMB 5DGRA 3FFCA 3BAEL 5F7DA 3DSFL 2I27N 1MF2H 2OMNA 3TNMB 2DRUA 3O4LE 3EOBB 2XPGA 5IMKB 1DUYA 3IDXH 1AO7E 3F8UB 3MYJB 2EDDA 2A2QT 4MAYB 2V17H 4MNHA 1BLNA 2R0LH 3L7EB 4XRCB 5K9JL 1RSFA 4EXKA 5D7JC 4AQ1B 1RJZB 1JWSA 4IS6A 5DJ8B 3C2SA 1UJ3B 3D2UD 4OI8A 4JZJC 3GMOA 1H3XA 1RIHL 3OKLB 2OXGA 3QXAB 5AYQA 1GGUA 3HUJE 1MHCA 5TDOA 3UROR 4Z78B 3CFKB 1SJVA 3TBVA 3GSVA 5ID1B 3MRIB 3DWTA 3OF6D 3RY5A 4QRQA 4LPCA 5JR1L 2D03L 3GM0A 3EHBC 3W9EB 3X3GL 2F19H 5IJVB 4M48H 4NM4L 3RGHA 2B1AH 3BH9B 4XCFH 3ARDB 3C6LD 4JJ5A 2PW2B 4IHOB 3W11C 4YX2H 2UYLB 5DRXB 1XZ0B 4HFWA 3W11D 4JHZA 1A21A 5E94B 3MJGX 2NXYD 3QUYD 4M1GL 4OCRL 2OXHA 4XTRD 3BXNB 3TVMD 3PGFL 4F7EA 3QI9A 2OQJA 4YBLC 5DVKA 4K7PY 4Q0XH 4UAOB 4FXGB 4QNPE 4ZNCD 3CCHB 5EDXA 1KN4H 4GW1A 4YK4C 4BM7A 5HDLA 1XGYH 4KAQH 3OJ2C 4Y16A 3EJYD 4NO0A 5ICZB 2NZIA 2DQFB 4W6WB 3AM8A 3VXQB 1UXWB 4F58H 1BZ9B 1NEZB 3HPLA 3QB7C 1JPFB 2YWZA 2WAHA 3HN3A 2WUCH 4M62H 3FONA 3O6KL 4POZC 5E8OA 1ZLSH 1ZGLP 3E6HA 4OCLC 3IGAB 1CBVH 3Q6GH 3WHXB 4U1SB 3UYOD 2R29L 4FXLA 3WXVL 3QEQB 5BVJA 4S1RL 3PV7A 3S4SB 4DUWA 2DYPA 2VDPH 3UTQB 4Z7OE 2RCSL 5I1IL 3LRSB 4NM4H 4D9RD 4FG6C 3X13B 3UCRA 2FX8L 2OI9B 1RUAH 4QRRE 2ARWA 4YX2L 3NAAL 4RWYL 4U3CA 5DD1L 4AG4H 4P4KB 1XCTA 3QULB 3KWWA 4EQ2A 2X5PA 1K4DB 3PHQA 7FABH 3BKCH 4GG8A 4NC1C 4AMKH 4Y7MA 1I1YA 3R0MA 2FGWH 3CLFL 4QRSA 4JREB 1LK3H 1HEZB 4QWWC 2GTWA 4R7DB 2ADGA 4NKMB 2C4XA 3TFKC 3TZVD 3SKUD 1ROWA 4R4BA 3CZFA 3QEHA 4FQQA 5F8QC 5IMOA 2NR6C 3BVNA 3BQUA 1NCCL 3MRNA 4U33A 3QCVL 3C60A 5I75C 5B4MC 4PJDE 4M03A 3STLB 3ZO0A 4GMSL 4V2CB 2R1XA 4AENB 2C1OA 1INQB 1KC5H 3I2CL 1INEH 3G08B 1YMHA 3BEWB 1JNHA 3B9EA 1UWXK 5D5MA 3TN0C 2CO7B 4U0RB 4PJCB 1JV5A 3Q3GA 5AYUH 1KTRL 1JNLL 2ADIA 5J6GB 1WZLA 1IGJB 1MI5E 2FHCA 4KUCF 3IF1A 4LCCB 1FYTA 3HG1A 4RZCA 1OB1B 1IQWL 1EMTH 1IC4L 2CMRH 2VSDA 3OG6B 2A74B 1WBYA 3RVXC 2B8OT 4CNIA 3RVXD 5GIRB 4AEEA 4KRLB 3GSWA 1J87A 3O2VL 1T04A 3PNWB 2R4RH 1H3TA 3GMLA 1VA9A 1JYVA 4QHNA 4UILH 2QQLH 3I50L 5EZLA 1A3LH 5KVDL 5IESH 1OP3K 4XB8A 1FDLH 3IETB 1MCBA 5KVGL 5T3ZH 3DI2B 3CD4A 2ITDA 4N0RA 4X9GA 3VFGL 4L8DB 4U1GC 4PJ5A 5DDHB 5F88B 4KKBD 3FHQA 4AH2A 2IFFH 2WP3O 2Q3AA 1U3HC 3SN6N 4Y19D 1HDMB 5T1LD 1T66D 4GLRI 2H32B 5L7XL 4J23A 3QISA 5CJOL 1YEEH 1QTYT 3MLYH 3CGTA 5I75B 4MDJB 5JPNA 3K7UA 3PP4L 5HHOB 2YD7A 4YPGB 3UPRB 4GRWF 1I9RH 1U8JB 2Z31D 2XXMB 2BY3A 3V6ZA 1JV5B 2VLKE 3Q3GB 1HSBB 3HC4L 4PJXB 4HG4K 2BVQB 5TFSL 5L8LB 4JFEB 1SYSB 5IVXE 3KLAA 4R0LB 3QNYB 4UTAL 1T21B 4M6AA 2DKMA 3CNKA 4G6AD 4XX1G 4P5MB 1ETZB 5GRUL 1RHHA 4HDIA 5HGHB 2I9TA 3BQUB 5BV7B 1IVLA 5IBTH 1HHGA 3N85L 3RJDA 4KUZH 2GI7A 4E41B 3S37X 2QSTA 1WWAX 3D3VE 1T21A 2MKLC 1YN6A 4R0LA 4ELKA 4JDZA 3VE0B 3ARZA 4U6XB 4R7DA 5HYQB 3M1BA 4IRSD 4OUUA 1VEPA 4J4PA 3GSXA 5FOBB 5I8KL 5HVHC 1I1YB 4MNGB 4M43L 3GSUA 5F96L 4HX1B 1Q38A 5HVWA 1AGDB 5HHPA 3IU4L 1GGCH 4R6UA 4I13B 5L0QC 1S78D 5IB4A 5GQBA 4OZGF 5DUBB 4OD1H 5DFVD 4JM2D 3V2AR 5GSRA 4JGUA 2J12B 5LJYH 3PL6D 4HH9A 2DMKA 1F3RB 1O7SA 1I1CA 3VXNB 3U79A 3ESVF 5E4IA 2AEPH 5K9OB 2EDHA 4Q9RH 1E4XH 1CFTA 3UYPA 1NFIB 4DUXA 3KPPA 1SBSL 4AIZA 3GJEB 4DJMA 3QIBC 4PREB 2DICA 3UTPD 5DVOA 4KI5E 3QA3A 1MFBH 4KV5E 5IM7B 2F8OA 4JE4B 1E27A 4X4ME 4QGYA 1IZKA 3EJZD 5T3XL 4CMHC 3BISA 4TSAL 1KC5L 3M17A 4W4OC 1BBJA 4PJXE 4R2GD 4ZG1A 4KKNA 4X5XB 5AAWA 4UBDD 3SY0B 4RNRA 3RIFK 4HXAL 4U1JA 1BZQK 3PDOA 4HH9B 1KB5H 1TQBB 4YAQB 4LLQA 5EZIH 1OTSC 2P8PB 2DN7A 4N9OB 3PP3K 5L6YL 3BPLB 1HKLL 3O8XD 1NDGA 3QQNA 4JFEE 4OLYH 1GGCL 3NFPB 3KVQA 5DRXA 3MRJB 1A22B 3CFDA 4Y4KC 4UNUA 2DKUA 3RWDB 5I1JL 1RY7B 4WWID 4JFFD 3U7YH 1BIIB 4KV5F 2L7UA 4JO1L 5KSBA 3N50A 3LDBB 1DEDA 1JGUH 4L8CA 2IAMA 3T0BA 4LKCA 4XPHL 4Y5YC 4ELMB 5K59F 1QFOA 3C5SB 2JJVA 2O5XH 3MBEC 4K7PX 1FYTE 2EDRA 3HG1E 4WHTB 5DK0A 1GIGL 4AL8H 5JA8B 1MRFL 4XCNB 3ULUL 5HD8D 1IGYA 4MNGE 2UWEA 3EYFA 4FQQB 1ZEAL 1OARH 3ARGD 4YDIH 1GPOH 1AO7B 1IT9H 5L2JB 2CDFB 1BVKA 5J4MA 4D9LL 1P2CB 2APTA 4OF3A 4MAYA 3RVWC 3LZFL 3V0AC 5JHLL 4MNQD 3GRWH 4Z0BH 1KLFA 4IOFD 2A0LC 4HXAH 1N4XL 3D0LA 2DI9A 4K94L 4P2OD 3A6BH 1D3CA 4PRDA 4L9LC 5BQ7B 6FABL 4R3SB 3GJFH 2XZAH 1T4KB 2PETA 4R9HA 2WBWB 2RBLA 1NFKA 5KVMC 5D7SH 4UZGA 3HS0A 4WW1B 5F6IC 4LSUL 5FO7A 3S7GA 2DYPB 5LGJB 1RIUH 1TNMA 4Z95L 2J7LA 2X70B 4KROC 4P2OA 4JRXE 4AT6A 1EFXD 2APXA 2EEAA 4DKEH 2IPKB 5MHSE 4KRMB 3OGOE 3P77A 4XPAL 2BNUA 4PJ9A 1NEZA 3HPLB 1OP5K 2Y07L 4NO5B 4NP4L 1DN2A 1GZPA 1KJ2B 4Y4KA 1MFCL 4HJJH 4F2MB 4ZOAA 3ARDD 3ES6B 5IV2B 1DQJA 4LDOB 1DANT 5MEND 4RIRA 3PHOB 3G6DL 4M43H 1MIML 2IG2L 3RX5A 2MPAL 5B38B 4HMCA 3SE3C 3WIHA 2PW2A 4OD1L 5J6GA 3MNVB 4LLDB 4EDWH 1PX4A 4M6MH 4S11A 4AJ0A 4OCYL 3EYOB 1D6EB 4M1GH 2N1KA 4OCRH 3IDMA 4GFTB 4R4FL 3SDYL 2G2RA 1N7MH 3AMLA 2XWJB 1PZ5B 5DD6B 5H2BA 3QIWB 5DUML 3HAEA 4G80A 2NY0B 2XKNB 4URTB 3WDJA 2IQAB 3ZYOA 5KVGH 3FOMB 3WFCL 5ITFA 1HYSC 3FN0L 5JHDB 3KLDA 3L3GB 3NZ8A 5D93C 3SKNA 1EEUA 1IAKA 4JRXB 1WBXA 2I5YH 2YA2A 1L7TH 2WV3A 4L4VD 4K9EH 2VISA 4NZJA 1T89A 1C5BH 2B5IC 4JPVH 1RJLA 3CH8A 1BM3L 1R5IA 1J86A 3S4SG 3BPNB 1QA9A 1DUZA 4KRPC 5FYKE 3VH8G 1A47A 1NBZA 1OQXA 4TRPL 4ELKB 2Y5TB 5JOEA 4F7PA 1ES0B 2DQHH 2M1KA 3GIZL 1DLHA 4PJ8B 4QXTA 1XH3A 5TH2A 1RU9H 1QP1A 1VKXA 3L5JA 4S1RH 1AGCB 4UB0L 2ORBH 5KSVB 5EU7C 5IGXH 3BZFA 1YECH 2COQA 1KEGH 1SEBB 3DURA 1MHPL 3QFDA 2OR9L 3FHAA 2P5EA 4LL9A 1KYOJ 1FSKC 4P2RA 4NQCE 3DVIA 1R24B 1MFNA 1U8JA 2A6KA 2NLJA 3FN0H 1MCJA 1LEIA 3TWCL 2APBA 1J8HB 1F90L 2XKUA 3NFPA 2YD1A 1LEGB 5EU3A 1NMBH 2D31A 1V8HA 4Z7VB 3S34L 4I1NB 4D0BB 4DKAA 4GG6F 1IEHA 4OGYH 5EWIL 4TTGA 5FDWA 5CHNB 4NT6B 4JPVL 3QI9B 4U05A 1G6RB 3CH1B 2QADD 3IDYC 3W81A 2P8LA 2C7UB 2ATKB 2XZZA 1Q9KB 1I1RA 1QFWM 3FL7A 4LMQE 5ETUA 3UTSB 2ESVE 1PVHA 3MR9B 5CD3A 3SO3C 4DWHA 3D69A 3QJHA 5D7SL 1QBAA 3NCEB 4KJQC 1ZK9A 5D93B 5DFVC 3I9GL 4FG6D 5BS0D 2F58L 1CN4A 1A7QL 4HKBB 5T1DL 3SE9H 2XKSA 2NCMA 3OHXB 2WINB 1X3DA 2QL1A 3VFOB 4AT6B 2E9WA 5T1KA 1CFTB 4MD4A 3MRRB 2QQLL 2K3TA 4DFIA 2A83A 2AJSL 2CJUH 3WNKA 4GW5A 5DXWA 3WIIL 3ZE2F 1S7SA 4UMGA 5DZLA 1UH3A 3LMJL 1WBYB 1RJZA 3S98A 4RGNE 1ZXQA 3LPFA 3MACL 2IADB 1CXIA 9CGTA 1M1SA 1J1XL 1NSNH 5C0CD 5ERWA 5IP4A 4H20L 4L29B 5MEPB 1IZJA 4GBXA 4ZQKA 3C08L 4UBDC 1D5IH 1CIUA 1DBKL 3BZ4A 3FFCB 5TJWK 1ITCA 5IVNA 1ZHLA 2BRRH 5MEOB 1BVKB 2OZ4A 1OWWA 1KB5L 5KSAC 4NN7C 2FBJL 5DMGC 4XHJC 1CBVL 3T0AA 3B2VL 4Q58C 4PS4L 2E7HA 3DIFB 3KNBA 4FA8A 4CMMB 3RQ3A 4JO1H 1RZKL 4XHJD 2VL5B 3D9AH 2EE6A 1LO5A 1GAFL 2FECL 3RL2A 2VDOL 3P9LB 2PN5A 2AJUH 1U8QB 2D9CA 2ZCKH 5IBLC 3GI9L 2RCSH 3QG6B 3DX6B 1MHEB 3T3PE 3PQYB 3KJ6H 1HKFA 2D0GA 4JFEA 1SYVA 2X7LA 3ARWA 1YEHL 2Y6SD 1XF1A 2R69H 3TVMB 4PJIF 4FQLH 3VGEA 2NXYB 5GRZA 4Z77B 2V5YA 4UT7H 5JPNB 4OIIH 3H3BC 3V4PL 1HH9B 3LQMA 5DHXB 1D9KC 1BJMA 3NCJL 1G9NH 5FYLD 3VXRA 1N0LA 1F00I 4CVZA 1DN0A 3BRGC 2CR3A 3BW9A 3GK8H 2EDWA 3UTQA 5EC2B 4X4XB 2R0LL 3DSNA 3IKKA 3QEGL 4JKKA 1DE4A 2HN7A 5IKCB 3ZDYE 5DJ6A 2DQGL 4KROB 4B7IA 3GB7B 4Q9BA 4U6VH 3ZLQC 4PS4H 3I75B 3O6MH 1EMTL 1NC4A 4YNYB 3OJDB 5I15L 4Y19B 1KCUL 2ORBL 4KK5D 4KHXH 1HHIA 5DR5H 4U1KB 4NC0B 4F3FB 3L3OA 5JR1H 2W0LA 1J88A 1H8OA 4DN3L 1T1ZA 3DUSA 3MJ6A 3HC0B 5DLMH 3TF7C 3MREA 5C71A 4JG0L 2NY6D 1NFDA 5BOPA 3DI3B 3RTQA 1A3RH 1EAPB 3DV4B 2F8XC 2Z8WC 1FL3A 5FYJL 3BZ4B 3ARGB 5F1OB 2JIXA 5GRYA 5MI0B 3N0PB 3P0VL 3BGMB 4LF3B 4DVBB 2UUDK 3KYNB 2R1YB 2C3WA 4UI2A 3JV6A 3ARFB 4AM0B 5KG9A 4MGXA 3ELAT 1YMMD 3KYOB 3WNLA 1N5AA 2B4CC 2BSRA 3RGVA 5FK9B 4Z78A 4JLRA 3DUSB 1H5BA 4U0RC 2VKXA 2YOCA 5BXFB 1F6AB 5I17A 3SPVA 1W8OA 3QO1A 2R2EA 4ZPTB 4WUUD 5HXMA 4G9FA 5ESAA 1ONQB 4JO2H 1OQOA 3RIAK 4W4NA 4OCYH 3W0WA 3TIDA 2APFA 2V2WA 3VJ6B 3KXFE 1H5BC 2VZTA 3QXVA 1FO0B 3CAFA 4BK5A 5I8CB 4LSPL 2AJYH 2DBLH 1I7RA 3AS3A 3L95A 4PJFA 2P8LB 3BGFB 4X4XA 4MQ7A 5JIIA 1RUMH 3D39A 1YY8B 3MUGB 1TVHB 5DJ0B 3MTRA 1FBIL 4I2XA 3S4SA 3QBTB 3EJZC 5IEHB 3GI8H 1CL7H 1WBZB 4BJLA 1PZUB 5IHBA 1TTUA 2A77H 1FAIL 3UJJH 3K0WA 4R2GC 4RFOL 5DDHA 5GS1A 5GSVB 3SKOA 3GIZH 1MREH 4OFDA 6FABH 5FGCE 4NKIH 1X5XA 2MHAA 2VDRL 4HKXA 4M9OA 4MSWB 2WP3T 1KELL 3QG6A 3GKZA 5BRZE 4H26A 5L0QB 5I1DB 3Q0HA 2W07A 3WO4B 2FLRT 4P59H 1CICD 4XAKE 4U2YA 4K2UH 1F11B 4Z76A 1CDYA 3TT3H 25C8L 5A40E 4ZS7L 5HHME 2AABL 1U95B 1CD0A 2R2BB 3V4PH 1D5ZA 4B50A 5E94A 2EDKA 2APVA 2E7CA 3KPSE 3B8YA 4GXUM 3IF1B 2IBZY 1FGNL 3S88L 1BBDH 4L8BA 1D6VL 2VISB 3RVTC 3TA3C 1EEZB 5J57B 4F80A 5FFLA 3G6AA 1JNHB 3FJTA 1CGVA 5IB2B 5DGQA 2JE8A 1UZ8A 4X7EC 4WUKH 4Z0XB 1YN7A 3SDCC 1VB9A 3V6FB 7CGTA 5FYJE 3HRZB 3FB6B 1OAQL 4NCDA 3MRRA 4O2EB 4HUWA 4MMXC 3FO2B 1CDUA 3W39B 1AGBA 1EBPA 2AEWA 1K8DB 1UJ3A 5INCB 3NIDF 4P2OC 1JWSB 4HFUH 1UZ8B 3VXPA 4XCEB 4KJQD 2XIDA 1MIMH 1F3JA 1Y6MR 3T1FB 2WBJD 3E0GA 3CX2A 4HIEB 3BI9X 3R1GL 5AG9A 3S35H 4XAKD 5BZDA 1JYXA 4OSUL 4M7KH 3K2UL 3U1SH 5KAQG 5IT2H 1ZANL 1UYWL 2HT3C 32C2B 4EI5A 3QUMH 1O7VA 4YHML 4NUJB 3GRWA 1FNFA 2CPCA 1L0XA 1FLRH 1G7HB 5SWSD 4UNVA 3LOWA 2DD8H 4JZNA 3HA0A 1U0QA 3TZVC 1Z9OA 3TFKD 3NCYS 3HE6C 3EOTH 4NO2B 1ZLVH 2NR6D 3GJFA 3NFSL 1QD0A 1FVDA 3ESUF 3IFPB 5IG7A 4NO5A 1A5FL 4JRYA 4K07A 2IAMC 5KSAD 2K7QA 3HMXA 2I5YL 3DURB 4PJHE 4M5YH 3BD4A 5D2NA 1FN4A 1MIEH 4JFQA 4NO0B 4BA8A 3KR3H 5EFIA 5HPOA 1FVDB 3MRGA 4NQED 4UNTA 2DIBA 2HLAA 1OVZA 1QSVA 4N0FA 2QQQA 2DDQL 1RZ7L 3FQUB 3AM8C 2DLTA 4N8PA 4WI9A 1QLRA 2QQNL 5H8DA 3LKPA 4JFFB 4F57H 3BGFC 3QSKB 2JELH 3OMZA 4UIMB 3VGBA 3D0LB 3FTGA 2OM5A 3D18B 1FCGA 2C4FT 1T1YA 1IAKB 4JRXA 5C6TL 5CKAA 3E3QE 3CMGA 2DLIA 2A9NL 4BUGA 4C57C 4X9IA 4N5UA 1A4KB 4Z7UA 5ESAB 2BJMH 2UV3A 1IM3B 3JTTB 4PJFE 1VPOH 3BWUC 1KJVA 1MHCB 5TDOB 4ZS6D 4P3CL 3DYOA 3I3BA 1EUUA 1KENH 4N0UB 2ZKHL 2ARJA 2YEZA 2G5RA 4JRWA 1SM3H 4Z7UF 3VXSA 1R0AL 3RY6A 5SWZE 4S1QL 1G7IB 2GYSA 1WVZA 1T20A 1D6EA 2RJMA 4WI6A 2HFTA 4CDGC 2F58H 2VB5A 4CADB 3JUZA 3BP5B 5F9JA 3F12B 4LLDA 4RMWA 4HMEA 3EO1B 2H2PD 2ICWJ 4RX4A 1E6OL 5DA4A 5BS0E 1S7UB 1NCAH 2XWBB 2EEDA 3WFCH 5CGYC 5M94B 2WW8A 3DYMA 4Y89A 2HJLB 5TGBA 5FHBH 1Q0XL 3NBNA 4U1JB 2EDLA 4XXCA 1EV2E 4QHLA 2C3GA 1OGAD 4RFNB 1CDBA 1ACYH 4P9HL 3MOBH 3C6LA 1CGWA 2Z8VC 4JHWL 4ZDHA 2IEPA 3VGAB 4G8FB 2Y7QB 5DURD 1FZKB 2FB4H 3PGDB 1WIUA 1GZPB 3EO9H 4UTBL 1WF5A 4YWGL 5HHXH 2AJZA 3RDTC 1NUDA 3ZHKA 3ZKXC 2R0KL 5I76B 2DB8A 4GRLB 4XH2B 1RZ8B 1XR8A 1NSNL 3X11B 2ADJA 3TCXA 4PRPD 4XP9H 1KLGB 2D4DA 2GJ6A 1A1MB 4P23D 2VDOH 1J1OL 4ZO7A 1N8ZB 1N5YH 2PO6D 4FQHB 1G6RH 5FO9B 4KJYA 4HJGB 1DN0B 3QUZB 4DEPB 5C3LD 1JRHH 4UIKL 2P44B 3LN9A 3TZVA 2X9YA 4MCYA 3QUML 3L95B 1BZ7A 2GJ6D 4HX1A 4LSPH 1KN2H 2P5WA 3GSUB 1RUML 2IH1B 4FFYH 1Q94B 5E7BA 3EOAB 3D3VB 3C60C 4Y5VC 1P4BL 1DBMH 5TE7L 1MPAH 1P2CA 1J0IA 1SYVB 3PIQB 4GAGH 1CTOA 4M4PA 4BQ8A 2XA3A 1AFVH 4H0HB 4N0YH 1MFBL 2R2EB 3OX8B 3OTTA 1DR9A 3TWCH 1KG0B 4Y2OA 4ZUWB 1AY1L 3CFEA 4X8JA 4KTDH 2BNQE 3C5SA 1X7QA 3D6GA 5DUPL 3LH2H 3TESA 3KYNA 4WW2F 1Y6NR 4HK0B 4WU7B 5IFAH 3ECBA 1NFDE 5K9KB 4FQXA 3RKPA 3PJSA 4LCYB 5SV4A 3HUJF 2NY1D 25C8H 4PJAF 3O3EB 3UTSE 3SGKA 3GUTA 4YDJA 5LBSH 3MV9B 4KI5F 4X7TA 3O81A 4QTIL 1L0QA 2GW5A 3GSOA 3RZCC 3I85A 4G8GE 1T6VN 5I1GH 3PDOB 4YHYB 2HJFB 1HDMA 3E6FB 1A6ZA 1BEYH 1PQZA 4YBLB 1IEBB 1JP5A 4G7VH 4YO0B 5K9JH 3PWLB 5ICXA 3SDAC 5GGUA 4OLUL 3C8DA 3X11A 3H42H 5HJ3B 5EOQH 3ARUA 2FH8A 3GGWB 3AGVA 4ZFZB 4OZIB 2P4AB 3GMRB 1R3KB 5DZOA 4X0KA 5I1CH 2AGJL 3EJJX 1EERB 3GSRA 3V7AG 1B2WL 1GGTA 4WIQA 3RDTB 1F2XK 4P2QA 1QSEE 4PREA 2A6IB 3PWLA 4LKXB 1FL6B 1GOHA 2B1HL 3O4LA 3QIBA 4NN5B 4WJ5B 4K9EL 3QDJE 1NUNB 4X8XA 3VWJA 3FFCE 1HCFX 2FR4A 5BRZB 5DHVB 2DL9A 3VXRB 3DMMB 5IOPA 4PJ5E 1BFOA 5CD5C 4PG2C 2CSPA 4OBRA 1RK0B 2B5IB 4L4VB 2NY4B 1LD9A 3PGFH 2AK4D 5HGDB 4EOWL 2VOTA 3V6OE 1KB5B 3IDGB 4YE4L 4Q9QH 4GAYB 1LO3H 4JN2A 5CMAA 1RIUL 4LGRB 5F7HA 3MX0A 5SWSB 5GZND 3QFDB 2W92A 1J0JA 2ZSWB 4YXHH 3HE6D 5D7JA 1JFQL 2VDMH 4JFOA 2AK4A 5C09B 4NNYB 1EIBA 1VKXB 1H0DB 3C5ZC 1ZVHA 4LPXA 2QSVA 5C09A 2XG4A 3QRFM 2VC2L 4PJ8C 4F7PB 1B2WH 5EBLA 1SQ2N 5D72L 4JB9L 3KPSA 3PWVA 3MJ9A 3VXUA 2CKBA 2V9TA 3ARBA 3FTGB 2FIKB 1BAFH 3BDYH 1SEQL 3L3KB 1IAIL 1BQHA 4GS7C 5GGQH 1L6ZA 3VD3A 3FT2A 3KYMA 3ZSTA 4M3JA 4JFFA 1T1XB 1BIHA 2BHZA 1A1NA 1Q8MA 2GUOB 2ZWLT 6CGTA 1NLDL 2Z8RA 1LEKA 1RZGB 1YQVL 5JOFA 5GXBB 4I5BB 2FR4B 4FFYL 3LEYL 3G04B 3QDJB 1SMAA 1MHHB 4LFHD 1ZV5A 1IAII 4LKXA 4EN3A 3L3DB 1MLBB 1R3IH 4R7NA 1KCSL 4ZS7H 4U1LA 4RMRA 4ZD3L 3G6JF 1YPZA 4P5TA 3HZVA 2ITDB 2EIZA 4KDTA 4ZUVB 4PJCE 2UZIH 4ZFZA 2Y4SA 4O9HL 1NCBH 1CG9A 4LCWB 3LMJH 4LSRH 3ULUD 2J8UF 5CD3B 1QKZL 3TLRA 3GMQB 1A9EB 1QRNE 1M05B 4HLJA 3T0EA 2YD8A 4JZOB 3IVKA 4ZUSA 4OZ4A 3ULVD 3KLHD 4CNIB 5E24E 3F6LA 4M61A 4XVSH 3EYUL 4QCIA 1EJOL 3U4EB 5CWSA 5I1HH 2VDQL 3MRKA 5DEFB 4FQIH 5C0CB 1NEZG 4G8IA 3LKOA 2VDNL 3W5MA 3K2UH 3B2VH 3U1SL 4JY4B 2VN4A 5DEGB 2BSTA 1FFNB 1KCLA 3ZDXE 4HGMA 5DTFB 1X5LA 2A1WL 2JCCF 1AE6L 3RIFF 4HZLB 1H3PH 2VXUL 3VFSB 4H5SB 2AXFA 4PRNA 1YECL 4FFZL 3MRIA 4JO3L 1INQA 4C56D 1JF6A 5BJTB 4KK6D 3MBEB 1E4KC 1C5CH 1JGDA 1WT5A 1NUGA 4NQDE 2QHRL 3C2AL 1S7TA 4I5BA 5CP7B 4PYHA 4QTHB 1EO8L 1YN7B 2DQUL 2AI0L 4LSRL 1A6TB 4XPBL 3BMWA 2XN9B 5KS9F 1A1NB 1PG7L 5T33H 3QHZH 4WTZA 4UT9H 2GK0A 3WL9B 2QADC 1R5IB 5I1LA 5ITBL 2QR0A 2DWEA 4HEPG 3VXUB 4KHTH 4WFFE 2W60B 2CIKA 1HHHA 2ITCB 3VWKC 3QEGH 2O5YL 2CH8A 3LS5H 3T8XB 1QLRB 3MRDA 2J1KA 4Q6IC 4WENB 5ICYB 1MJ8L 1C16B 1LP9E 4X99A 2OTWA 5EU5B 4DFHA 2N4IA 1IBGL 3EYFB 1IGYB 1CE1H 5GGVH 1G9ML 1N8ZA 3SGEI 3NIGE 5C8JB 3LEXB 3MSPA 4ZXBD 4RAUA 2HA1A 2VJXA 4YC2B 4LP4A 2YPKA 1FNEB 5D1XA 4LLYB 5JDSB 4I3SL 5IMLA 1KGCD 3QO0A 3QIWA 4M8QA 3X3FL 4UQ2B 3IFNL 1OTTC 4TVSa 2VDML 4XWGH 2D0FA 4FQJL 1QFUH 1KNOA 1KCRL 1I8IB 1R3JB 1A6UH 1C1EL 5GSVA 1R5WA 3TBSA 5E8DL 2Y72A 4XC1H 2NW2B 3QPXH 4P3CH 1WFOA 4U7SA 3DVNA 4N8VG 2CK0H 4JM2B 2FDBP 4PJIE 4JFDE 1KCVL 1F6LL 3EYQC 4YEEA 1CXHA 4O51B 4YAQA 3X17A 4OZ4B 4PJCF 3OAUL 2OQJB 3ZKQD 3VWJB 3MGAA 1QLEL 3TJEL 3ES6A 1ZWIB 5IV2A 5IWLA 5IUSA 1EBAA 2GSGB 1BBJB 2VH5H 3TH4T 2VQ1A 1T0PB 3ARDA 1EJ6A 1R5VA 4PD4K 3WN5B 5C08E 3L3HB 4Y4FD 4NZUL 5JHDD 3PL6B 1OL0A 4XWOC 4KDTC 4DUVA 2D7OA 3TO4B 3QCUH 3N1PC 5HHVL 5MERB 1AJ7H 3U2SA 1BEYL 3RNQB 1WZKA 3QO1B 5EOQL 5IT2L 4PRPB 1AGEA 5FO7B 4YXLH 3OKLA 5DK3A 2HJFA 5D8JL 3MJ7B 3EO0B 5J13C 1GL4B 3QXTA 3LS4H 4E9LA 4XC1L 4OCXH 5DUBA 1RHFA 2JTDA 1I1AD 4XB7A 3MYJA 2WM0A 3AXLA 2OJEB 5DMYA 1YEDA 1JUFB 3RP1A 1WIPA 2R0WH 4YC2C 4JFDD 4JY6A 1ZLWK 3PWJB 2E9JA 2VERN 4FFVC 4JANA 3UP1A 2IFFL 2P5WD 2WIIA 5FKPB 2AQ1A 3UDWA 3STZA 5FO8B 1TJHH 2RIKA 2SEBB 3VFGH 1J12A 1JWMA 5GGTL 1A7NL 3MREB 1NAKL 3BYTA 4KK5C 3RRQA 3NA9L 35C8H 1HQ4A 2XNAA 2ZCLL 4LP5A 1QACA 4MD0A 5CCKH 3RWEB 2R8SH 1ZTXL 3LQZB 1RZ7H 5JHDE 3VD5A 2VLKB 5EOCH 1B3JA 1T7WA 3QNYA 4C59B 3KLAB 3PIQA 4ODSH 2BVOA 5GZNC 4LDLB 4YNYA 3W9DB 4PY8J 4UTAH 1AIFB 1MEXL 1BIIA 2V9QA 5I0ZA 1GPOL 3NIGF 4QYOB 2DQCL 4MJ2A 2AV7A 2ENSA 3V4UH 4XPBH 4WDIA 3CFDB 1U6AL 3LVEA 3CMOH 4HXBH 4KPHH 1JYNA 2EDQA 4X6FA 4TSCH 5INDB 5F89A 3K4AA 3ILQC 2JK5B 4HS6A 4MQTB 5F97E 1XAUA 1HZHL 4QHUA 5AZ2H 3KJ4B 5D7LD 3ILQD 4MJ5B 1TZGL 1JNLH 3RDTA 1INEL 1FO0A 4GSDL 3QAZC 4LSDA 2MTPA 3U6RB 1I9JH 1XR8B 3DO3A 4D0CA 1IQWH 4OZIA 5C0GA 2BC4B 3O45A 3LKQB 4BFBD 1SY6A 1F3JB 1QYGL 2F53D 4UB0H 4XCEA 3PQYA 3FB7A 1JYWA 1CS6A 4BFIA 5LXGH 1ONQA 2AEIT 4OF5A 1NGXA 4NUGL 2VLJE 2Y1VA 3GJEA 1DVFC 3ARVA 3PXHA 2NY5H 5FDYA 5IROC 5EIIA 4ZD3H 1ZS8B 1G7PB 1E4XL 3MODL 1H5BB 3OF6A 2HLFC 1CIDA 4NQVA 5KANG 4GBXC 1AD9B 2QADB 2ZUTA 3C5JB 1R6VA 4GMTL 4ACPA 4HUXA 5GS2H 4BSWB 5C92A 2J8UE 3Q5TA 2AKRB 3SEPA 2X4OB 4X98B 4NNPL 1L7IL 3CMOL 4HXBL 4KPHL 3WLBA 3UBXI 2IANE 1U41A 4HWBA 1J11A 4X4YB 4KDWA 3H3PH 4CADA 1U3HA 1UEYA 2EZ0D 3DV4A 3UBXB 1XGYL 4KAQL 1F8TH 1NGQL 4KUCD 5FECA 3OBAA 4JKPH 3Q6GL 3I6LE 4Z76B 1W72L 2DQEL 4RAVA 2HVJA 2DLGA 4WU5B 5F9WB 5I1DA 4ZODA 4R4FH 3KS0H 5HYJE 1X4YA 1YUHA 2EKJA 1AC0A 3CSBA 4OB5L 1K2DA 1SJHB 1Z3GL 2GTZB 1JRHL 1DQLL 2NY5L 2GTWB 4ZOCA 5TFSH 4N8CL 1N64L 3D48R 1G7JB 2I9LB 4MA1C 4TNVF 3OKMB 4N90D 4YPGA 3UPRA 1G0YR 1OAKH 5I1AB 3JSSA 3VFPA 2VL4A 2XQBH 4OLXH 3MLRH 3VRJA 2C7UA 2I60H 3RVTD 5KZCB 4X7DC 5DK2B 5IQ9B 4P2QE 4L8SC 3RWIA 1CDHA 3QHFL 1Z5LA 2R0WL 5DD5H 3R8QA 1JFQH 5FYLH 1FFRA 4EJ1C 4JB9H 5D96C 4QGTA 3UTOA 2GJ6B 1FZMA 3QEUB 4TRPH 2OL3H 3H6JA 1OPGL 3H3KA 5IVZA 2BOCB 4XI5C 3A67L 4M6OH 4U1SA 3SJVE 1PAMA 4A2LA 2R15A 3VJ6A 2ZCLH 1G9MH 5DS8B 2QEJA 3VH8B 3KPQB 4KTEL 5I73B 4AIOA 2YD5A 3BQUD 3V0VB 4Q9CA 1OAXL 4E0RA 4NDMB 4G6KH 3EIFA 3LEYH 4NWTL 1XF2B 4KVNL 4D2NA 3BZEA 3C6LB 3RUGB 4Y16C 4N8VB 3TPUB 1LO5B 5J89A 4JZJB 1F58L 3BP4A 5DQ9B 1KCSH 2F74B 2VXVH 1UYWH 4OFYA 3P11L 5C0FA 1U8MA 5FKPA 1IC4H 1YMMA 4OLVH 3GKWL 4P57A 2CLVB 4V1DE 3HPJB 1M4KA 1JTPA 5CSZA 4IHOA 3W82A 3UYRL 1QQDB 4GUPA 5ERWB 2VITA 1S9WA 3IJSB 5IJVA 4Z7NF 3M8OH 3NIDE 2F9BT 3QR2A 3K81A 1WTLA 4DOHB 1NMCC 3VXPB 3RTQB 4AY0A 3C5JA 1FVCB 1RULH 4JY5H 4LSTH 1CLZH 3T65A 3VGAC 5FCUL 2EKSB 2Z31A 3MFFA 4PJIA 4M5YL 5IMOB 3BKYH 5D5MF 3VI3E 1XR9B 1FFOA 2J6EH 1G9EA 1AGFB 3VG0H 5CZVH 2ICEA 2XI9A 1KULA 4CN1A 1U3YA 4X6CF 3MLPA 1Z9MA 2J8OA 4X7CC 4MNHB 4PR5A 3JV4A 1EJOH 2DQIH 3LRHA 2CJUL 4Z6AT 3IKCA 1R5VB 2DM4A 2IALB 4UIMA 2IBZX 3B8SA 3RPIA 3ZE0F 5HVFB 1OAYL 2LAAA 3T2OA 3MNWB 3CH1A 4QKXB 2DIJA 5EBMA 3QFJD 4K9EC 3MRQB 4GRMA 3EOYG 1RUKL 1F11A 3BOVA 5FOJA 3VD9A 1IC5H 4L3EB 1GIGH 3M8OL 3O3UN 3VRIA 1KF9B 2R4SH 2HH0L 4MX7B 1P6FA 4OQTH 4G9DA 5C70A 4JQVA 4KTYA 4TVPE 4N0YL 2VNCA 1KTDA 5IFJA 2AI0H 3A6BL 3U36A 5DSCB 4ODHH 5J12B 2Q8AL 2BVOB 5F8RC 1MJUH 1U8NA 1ITBB 3V9FA 1BF2A 1DANU 4G9DB 2LU7A 4J1UB 1Z3GH 4YHNA 4L3CA 2R8SL 5CJXA 5TF0A 4HIJA 1U8OB 1ZVSA 4PJ8A 1TVHA 4CMMA 2FL5A 4R90H 1JPTH 2D7MA 4N0UE 5LGHL 1BD2E 1MHPH 3MRDB 4NQDA 5EN2A 2X4NB 3BXNA 3FQWA 3TNNA 1OD9A 3ARBD 3D87B 4NUJA 4D9QE 4FABH 3QRGL 5E08H 3CVIH 2DF3A 4RMSA 5HI4C 2AJXH 4UQ3B 1UWGH 4MAYC 1OHQA 2HG5A 1FPTH 1G1CA 5KS9A 4OGXL 5FM4A 3RUGF 1AXTL 4NQCB 5E1HB 3CSYB 3VU2A 4O02H 2E7MA 2Y06H 1H15B 5A43C 1JHLH 3N1MC 1F6FB 5C08A 4ERSL 1HXYB 4LCUA 1S7TB 5CP7A 5E99H 4PUBH 2VABA 4O2EA 4EN3C 4M1CC 3AVEA 2W1NA 5D2LE 3LPGA 3T2NH 4Z0XA 1XF4B 3QDMB 5ENWB 5GGRB 3TBWA 2XWJA 3VWKD 5E7FA 3JV6B 3BZDA 4X4ZA 4DAGH 5IB2A 1WCBB 5TQ2L 4FFWD 4FP8H 1AQDB 4EUPH 3U9PH 2KBGA 2W9LA 3D69B 5DVLA 3OKNB 5LAXA 4DGVH 2FWOB 2ZZUT 1XGQA 5E5RB 2X1QA 4ISVA 1H3GA 2R2HB 4KC3B 1ZHKB 5J9PB 3RAJH 4PJDB 5FB8A 1TETH 4ZXBC 2AJSH 2FECI 3F65A 5C0FB 1KTLA 5DJAB 4MXVF 1MWAH 3B9AA 4KH2A 3C8KA 1D5XA 4L8SB 3NVQA 3CVHL 3GO1L 2PXYB 2FL5B 4XPTH 3HC0A 3SY0A 1E4XI 3DVNB 3CXDL 5DURB 5ADPH 5FXCH 3UJTL 1BQLH 3BWAB 3LN5B 2DM7A 1EO8H 2DQUH 3OAZK 1LDPL 1D7FA 1ORQA 3O9WA 1K9TA 4KUZL 5MENB 4ZUTB 3V5KA 3FFCD 3ULVE 1WBZA 3QEUA 2NY1C 3MRBB 5D72H 1KTKE 1AGCA 5C8JA 1CFBA 4XAWH 1MVUB 3U30C 2M2DA 5D7KE 5FGSA 5L2KA 3RZCD 4LMQI 4G43B 4OD3L 4TSBH 1OAZH 1T4KA 1ZHBB 3HB3C 4WWKD 4X6BB 3VFVB 5GGVL 5D1QC 4TQEL 1CU4H 1AGDA 3LV3A 4WO4B 1HSAB 3H0TB 4OZGB 3ULSA 5D7LA 2X6MA 3HNTH 2G9HA 2VLME 2H9GA 2EDBA 1ULVA 1JNJA 3V6OA 3E1F1 4WWKA 4JPWH 1ZGLB 1P4IH 5L2JA 2IPUK 3A6CL 3DX6A 4JVWA 4QTHA 1U3JA 1MUJB 4TVPD 1XGRA 3DRQA 2L4OA 5D4QA 3BFOA 2HTLD 1IEAA 2XKNA 2C1PB 4J3SA 1W0WB 4NKDA 5FK9A 1G9MC 1BFTA 2W9EH 2PTVA 3QQ9D 2DL2A 3QUYA 4PD4J 4XBGB 4HJJL 3QI9D 4LSVH 3GZKA 3ZHDA 1ZHLB 5DMIL 5F9OL 4Y19E 3AREB 4JO4H 5EPMB 3TJEH 5BRZD 3EYVB 3KG5A 3OXRA 1LNUA 4G6FB 1B4RA 3DX8A 4JQXC 1KJ2H 5HGDA 1J8KA 5C0CA 4Y16D 5SX4H 4NIKB 2F53E 1U8MB 3EDDA 1F58H 4X5LA 4EOWH 5HBBA 1BWWA 5LKNA 4IMKC 3W5NA 4ODWA 4R2GB 5F7WC 1D6VH 2D3VA 1NC2A 5CLTA 3TPUA 5B8CC 1C12B 1ZS8A 5EA0H 1DEEB 4RFEB 2YMXL 2Y06L 2J4WL 2GHWB 2HTKD 4BFIB 4PV8B 1UKQA 4OKVA 2BOBA 1M7IB 5ISZB 3RFZC 4NNPH 3ZTNH 1IQDB 2Z4QA 3MLVL 4IIQB 1RQ5A 3P0VH 1CZ8L 1CFQB 4UT6H 1KLUA 5LVEA 5C7XL 1K8IA 3WSQH 5JQ6H 4KZEL 2DQIL 3L7FB 5HI3C 2BRRL 1I85A 3QDHA 5T3ZD 5E5MA 3V5DB 2HRLA 3TM6A 1T2JA 4CVZB 1QSFB 3O3AA 1QRNA 4TTDD 2BMKB 3MXVL 3FRUB 3WCYA 1G9NC 1I3RA 4HT1H 5C09E 1YYML 4X4MA 3MRPA 5C07B 4W6XB 3VFPB 1YQVH 2FIKA 1I4FA 2YA1A 2ICWB 5DHVH 4HG4J 1AR1D 1BQSA 1CL7I 5IB1A 3VWJC 1PD6A 4ODSL 4U6XA 1MCNA 1NCDH 5JOPD 1OP9A 3HMXL 1DVFA 1A7PH 1FO0H 2LAGB 4PY8I 3MZGB 5T5FL 2Z91B 1JF1B 1UB5A 1X5HA 5C0EB 4ZUWA 4QRRA 4RCAA 5E2JA 1XGRB 3DRQB 4OF0A 5K59E 3WXWH 3SCMB 4NP4H 5J11B 4EEEA 3U46B 4TPRH 4HWBL 2E27L 1A7RL 1ES0A 4WHDA 3BHBB 3PWUA 4P2RE 1DVFB 1JWMB 4HPYH 5C0ND 5A3ID 3GK8L 4YIQA 5EUKB 1I3GL 3RNKA 1JE6A 1HSBA 3NCCB 4BQBA 4LVHC 1FORH 4LLAA 5AWNH 4NUGH 2ICWI 2EDXA 4APQD 4LFHG 5B39A 1MOEA 4QF1B 2FGZA 4I18B 1ZHBA 2P8PA 1KXTB 3EDKA 3FCTB 5C0JB 1AKJA 4MJIB 1B0GB 4E41E 1X44A 3O2WH 2F54E 3GKWH 4XVJH 3DSFH 1JHTA 1PW3A 5C9JB 4IIQC 1NCTA 3RX8A 5ACZA 1UWGL 4O02L 3WD5H 3ZYJA 1QG3A 5IW3A 1UZ6E 2XFXA 1YQ2A 4GRWB 5GGSA 3WJJC 3HC3H 4M1DH 1F4WL 1E27B 4N1CA 3FONB 3ZDYF 4C4KT 4NZRH 1TITA 3QNZA 3RU8H 3P0GB 3FN3A 1MI5A 2HKFH 2VQ1B 1IGIH 1DJSA 4OCXL 2VE6A 3SGDH 2H1PH 1AXSA 4MNQE 4RGOL 3VXMD 3BKYL 2AJVL 1QOKA 3E6FA 3RKDD 2WWKO 2CKBH 2G75A 2BSED 4JM2A 2NY4C 1QSFD 4QRTA 3IRPX 2JKXA 4AZ8A 5FB8B 4WUUB 5CUSL 2NY4D 4OF7A 4LBEB 1K5NB 5CZKA 4QYOA 4F33B 1W0VA 1BGXH 1QO3A 3O2DL 3P9MB 2XRAL 4ONHB 4D9QD 2X4SB 3GDBA 3BPOC 4YR6A 1TQCB 4U6TA 4MWFA 3HI6H 4HULB 1YN6B 4KK8C 3CVHH 3GO1H 2GSIA 1MCOL 1I8KA 2FYYA 3LQZA 3CXDH 3FRPA 5CKGA 5TDPB 5JW4N 3SOBL 5IMMA 1OPGH 4ZYKA 3JTSA 4ZFGL 4L9LA 3MROA 1SMOA 2P46B 3IDIB 5E1AA 3C6SA 2NNAA 1FNSH 1IAMA 5DD5L 3FQXB 3G9AB 2Y36H 5IB5B 5JO5B 2B1HH 1KCVH 3EFDL 3PP3H 4FQ2L 1UGNA 2VAJA 3QPQC 1MIEL 1V3JA 5KS9B 2XY1A 1MRDL 2E5EA 4RQQA 2FEDD 2OTUB 2DWDA 2OP4L 4XAWL 2A6JA 2BRQA 5EN2B 2X4PB 1TJGH 4B5EA 2AABH 4OD3H 5FGBC 5DQJB 5HYJD 5F1SA 2NMSA 3HB3D 1P6AB 4P5TC 3NAAH 2BCKA 2W91A 3CX5J 4I77H 5ISZE 1P4BH 5CJ5A 2D4FA 4PJBA 4XPFL 1WTGT 4P4KD 5IBUG 5GRVL 3VDCA 5MERA 1FO0L 3T0ED 4HIHB 1YYLH 2G2RB 3ROOB 3PL6A 5GGSY 1DFBL 3IETA 1MNUL 2AJZB 2QBWA 4JPWL 1CTNA 5IBTL 4ONHA 2WQ8A 1SJEA 4HWBH 3REVB 4WFGD 4U1HB 3MV9E 4LU5L 3NCYP 4G8IB 4JQIL 4QXGL 1A7BA 1TTGA 2NX5B 4U7KA 4N1HB 4G9FD 5D1QB 4QRTB 4O5LH 3VXME 3M45A 3CK0H 2Z92A 5ANMA 5FYJD 1F97A 1QR4A 3D3VD 3HAEG 4KKLC 1KTLB 1G0XA 4NQSB 2DJ4A 3KDMA 1M05A 4JRYE 4HFWB 1C5DA 4KKLD 4XP1L 2ZUUA 4PJGA 3T4AB 2EICA 3SO3B 1XGQB 1P4LB 1FJ1A 4Z7UE 1UM6H 5J7CC 4KZDL 4PR5B 4XVJL 1GRWA 5D7IF 5EO1A 4XBEL 3SCMD 2CUHA 2R1WA 4R8WH 1LO0L 5EU4B 5F1IA 3FO2A 5I71C 4MNQA 5GGRY 3RVVC 4U49A 5LGJA 3CUPA 3MPCA 3BUTA 5CBAB 1J10A 5HI4D 3QXAA 4P0DA 1MCSA 1IJ9A 2BCKB 3MCLL 4O9HH 1I7TB 3W0WD 4TUOA 1AKJB 4MJIA 1MY5A 3KXFA 4XVUD 3T8XA 5GGVY 4NKMA 1YEGL 3R06B 3RWHB 3CSYA 1ZLSL 4ZPVA 1RMFH 4G6ML 4WHCA 2VZ1A 4NO3A 3RBGA 3NGBC 4TN9A 1PYWB 2EYRA 1NAMB 1J05B 3IFLL 1HWHB 1N5YL 1TLKA 3CFCL 3S6CA 4LQFL 4DN4L 1ERNA 3BP7A 2CR6A 5JXEC 3HNVH 3MRCB 1GJIA 5TE4H 4MA3A 1HHGB 4LHJB 3ZE1F 1YYMH 1O0VA 2P1YA 4DGYH 3KS0J 1WUNT 4YQXL 3PG2A 4RBPK 2VXUH 4YHPB 2ZSWA 1A7PL 2VLLB 2AXFB 4JFFE 3S36L 4MWFB 1B0WA 4DZBB 5FAAA 2BVUA 4TOYL 1GXEA 1MSPA 1FYHB 1FIGL 1T7VA 2Q8BL 3IDGA 3CXHJ 2Q6WA 5KVEH 2ICWA 1GGIL 3MMEA 2NY7H 3GBML 2I07B 1CICA 4BSJA 4WTXA 4HUVB 3MRKB 4CN4A 4Y1AB 4OLEA 3MV11 1IRAY 2GAZA 3IFOA 4PLOB 2AXHA 2H32A 3RY6C 5AWNL 2I26N 4KMTL 5JW3L 3L7FA 2EEBA 2R0ZH 1RIHH 2E8ZA 4PJAE 3R0NA 3SBWC 1IKFL 1NANH 3GMQA 5B8CA 2YD6A 5I19H 1S5IH 2D7PA 1XMWA 4EI5D 3GHBH 2XY2A 3MV7B 4Q74A 2D7NA 3DX7B 5IW6B 3SE4A 5C08D 5C07E 3CPLB 2ICEB 3FO9A 4XPGL 4PRIA 1X4XA 1MLBA 4BH7A 5HYIA 3V6OC 3W39A 3ROLA 4W6YB 4Y5XB 3S36H 5E00B 1UKSA 3RWCA 4G7VL 4QRPA 1QFUL 3MUZ1 1NGZB 1A6ZB 1T89C 1B0GA 4OLUH 1OAKL 1N59A 3JWOL 1TQBC 1M6OB 4BKLA 5MHSD 1HN1A 3KPTA 2OK0L 2YXFA 3JXAA 2WNGA 3L7EA 5H94A 3RZCB 2AGJH 4LCCA 3BGMA 1QSEB 1RJCA 4LVNC 1GC1C 3ZDZE 5I8OH 2ZOLA 1I7ZA 2HKFL 1S7QB 4TUJA 1MH5A 3SGJC 4H8WL 5BVPL 2FB4L 4MZ3A 1QFWH 3PWVB 4XI5D 1KUMA 5FYLL 1JGLL 3ECBB 3ISWA 3RTQC 43CAB 2YK1L 1KPRA 3BEVA 3RKDC 1G6RL 4JDZB 1LK2A 4FQIL 1OSPL 4R97C 1FVEB 4LLMB 3QUYB 2P5ED 4MD5A 1YEIL 3BHBA 3PWUB 3THMH 3GIVA 4WEBL 1S7WB 5I8EA 5BW7C 2AXGB 4XP9L 4E5XA 5K9QI 5CAYB 3QUKA 2FJFA 1MCDA 3C60B 3V8OA 1CR9H 1KG0A 1NJ9A 3U9UB 1QEWA 3WFBH 1SY6H 5F7UA 5DMKB 2EO9A 1BECA 3PUCA 1WC7B 2BP3A 3IJYB 5CP3H 3P73A 3MLUH 2FZ3B 5DS8A 3VH8A 5D2LA 1GC1L 3EDFA 4MVBD 1G7LB 1YEKL 4ZSOB 5D5ME 2CRZA 3L6FA 3I02A 4WFEE 2P5WB 3WUWA 1T03L 1MFEH 4PLJC 1CGXA 4J3WA 2EXYD 5FUZH 5I1EH 2BVPB 1FCCA 1VFBA 1G7QA 1UH4A 3V0WH 1JPSL 1BFOB 3FO0L 2CIIB 2QV2A 1IGCH 5DC0A 5DJ0A 4WY7L 2V5TA 4GAGL 5CJXC 2LFGA 4ALAH 4Y4FB 1DDHA 3H7LA 1I85C 1B4JH 1QFWL 4HD9A 3TN0A 1VGKA 3NCMA 5HDQL 1KLUB 1OM3L 4OZFH 1CXKA 3QG7L 3B6SB 4HLZH 4GKSA 3AROA 3HI1A 2A6IA 1RULL 2Z4QB 3MGOA 4GW4B 3VG9B 4FXKB 2B2XH 3TVMA 2KUTA 1T7ZA 1DQTA 2NY5C 3D2UA 3D9AL 5E6IC 2HMID 1KENL 3V7AE 4HLZG 3TN0D 2OJZL 3OKEA 3IJYA 3LN5A 5CILH 3ARRA 1PKOA 2WWKT 5EZLB 2V5RA 1HILA 1J1PH 1TJIH 4LAQH 3DUUB 1Y18A 4LLWB 4EBQL 4XPFH 2B1AL 1MNUH 3BN9D 5GIRA 1MWAA 1S9XA 3WJJA 4YDVB 1OF2A 4NC1E 2NY3C 3BN9C 1LK2B 5DJAA 3MUY1 1T03H 3MRHA 4PRAA 2DQDH 4KU1A 4JY6B 1ND0B 3CK0L 4FTVA 2ZOLB 1M71B 5HYSG 4FQXB 1FZJA 4KMTH 5D5MB 3SGKC 4JKWA 1AQDA 15C8L 3MBXL 1NC2D 3G08A 1CT8B 4OI9A 4L4JA 1U8IB 3QH3A 3ZTJH 3GSVB 4AIXA 3HAEH 3MLVH 4K3EL 1E28B 1KACB 2V7NA 1L9MA 12E8L 1Y18B 3GSNH 4W4OA 1AGEB 1AD0B 5EZOL 1J1OH 5IR1A 2GK2A 4XBEH 4X6EB 1U3HD 3GMOB 2L7JA 5EO0B 3B3IB 3ZTJG 5A16A 1VGEL 3VXRD 4KKAD 3FQNA 1B0RA 1NCWH 5KSUA 4DN3H 2JJUA 4NQCA 2YZ8A 1PG7W 4Z7WE 4GRLC 5ACLA 4YXHL 2HAZA 3MO1B 2BK8A 3O3DB 4GKSB 4S0TD 3O2DH 2DI8A 3SBWA 4QHUB 1RVFL 1LO3L 5HTSA 3QFJB 1WFUA 2VC2H 1G7MB 1FFQA 5L2KB 3WIFB 2D31B 1Q1JL 2X42A 5DI8A 1BFVH 2Z9TA 3FB5A 4PGZA 4X7SL 4WI7A 3EFFA 2HRPL 4NSKA 4GQPH 3N1FC 5FA3A 4O00A 1YEJL 4S1SL 4D0DA 3WUWB 3L3JA 1JJUA 3LCYA 1HQRA 2NXZD 4I4WA 2ZSVB 4M5ZL 2FO4A 1JPFA 4HHAB 5D6DC 2H6PA 4IJ3B 1RV6X 4JFHD 5ACMA 2N7AA 2MNUA 2VLKA 4HSQA 2J6EA 4LLYA 4WHYH 1D9KA 1WAAA 2M26A 5AAMA 4PP2A 4PRHA 4PJEA 2XXCB 4NO2A 4UDUB 4RDQG 3VXRE 4PJHF 1B88A 3I6GA 4QXTB 4CBPA 3JV0A 5D1ZD 1FIGH 1NLBH 5KN5A 3MRCA 5C0AB 5HDBF 4YFLF 3D5OF 4JM2C 5GJTL 5HGBB 5I74B 3STZB 4AEIL 5J06A 1AHWC 2IF7A 1WZ1L 4UINH 4LLVB 3O41B 2A6DB 4OZHE 1EGJA 3WS3B 4MB5A 4PJHA 3EO1A 2FWOA 1SBBA 3S34H 4L29A 2CRMA 3OR6A 1JUFA 2EYRB 1BFVL 4ZO8A 4BZ2H 1KIQB 1IGFH 5GRXG 3F7YB 3LRGA 5E2TL 3S37H 2E9BA 3W9EA 4K3HA 4LCWD 3T1FA 4OFVA 4ZO9A 1PY4A 4PB9L 1DLFL 2CKBL 4S2SB 5I16A 4U2ZA 2LABA 2VKWA 4LU5H 4IMKA 4WVRA 4JFDB 5TDNB 1JPST 3ZMRA 1E28A 1CI5A 2AJVH 3GHEH 4MA8L 3T0DA 4PRIB 2DTSA 1HINH 5DC4B 1X6NA 5EO1B 5ALCH 5GS0D 1N6UA 5KJRL 1EEZA 4I0PA 3L9RB 2FX7H 3QDGA 3MV7A 5D1QD 3CSPA 3HFML 2NY2B 5DEZA 1NL0L 3QUYC 4WV1A 5JLZA 3NABL 5E4EC 5T1LA 1DBBH 3SE4C 4HF5H 1FNGB 3SOBH 1ZWIA 1OLLA 3SGEH 1PGRB 3KDMB 4UU9B 3MCLH 4BFGA 5HY9B 3K4DA 1ZAGA 3QXDA 2W0FA 5DQ9A 4RIRB 1RURH 1SVZA 1MVFA 4XXDA 3L1OL 5D1QA 3WNNA 4ZAKA 4FQ2H 2HLAB 4J1UA 1V5JA 5FHAH 2QJDA 3F7RA 4U1HA 4EVNA 1KJ2A 1FH5H 3MMEB 2Y23A 3IXAB 2P24A 4XXCC 2EIZB 2P5EB 4I4WB 3AUVA 4HIHA 4U1LB 4YLQT 5KW9H 1FG2B 1KTDB 3PWPA 3IFLH 5IVZB 2YRZA 4P2OB 1NAMH 4KHTL 2X70A 3DV6A 2FRGP 3BN3B 4Q7DA 1OD7A 4YHKH 5IFHL 3EKCA 3NACH 1T2QH 2ATPA 3U0PB 5HVGB 3QXDB 1UWXH 3PGCB 3HKFA 1DBJH 1U2HA 4LHUG 1QPXA 4P99A 3NN8B 1VFAB 4J4PC 2XYCA 1RUQL 1LHZA 2AERT 4MAUH 2F54B 2BVPA 4U0QB 5GHWL 4WCYH 1YC7A 1PDKA 1Z6JT 4YQXH 2IPTL 3LKNB 4KJPD 5AUMB 3B5GA 4PLJD 3L9RA 1G7JA 2VLMD 3VA2C 4PJBE 3TT1L 1U8PA 2F53B 1CL7L 4UDTA 4NZTL 3M07A 2DLFH 2GY5A 5JHDA 5EO0A 2H8PB 3IDIA 1YUHB 4LSQH 1QEWB 4U31A 5T5NF 4M02A 3HZMB 1IGTB 1JGVH 4PRBB 3MFFB 4PJIB 4BQ9A 4DCQB 4FQPA 5BXFA 5I17B 5TDNA 3UEZA 2EH7L 5JQHC 3T65B 1S5IL 1TZGH 3F7VA 5I15H 1MJUL 4JFOB 5ALBL 3QWRA 2YSSA 3CVHB 1XEDA 4Z7NE 4P9MH 1ODAA 5DJDA 3V52L 4JN2B 5CMAB 4CVWA 2MOVA 4PGEB 3OR6B 1A6PA 4A6YA 5L7XH 4TUJB 4LRNH 3P9WB 2PYFA 4M4RA 3V6BR 1IARB 5JDJA 1JHKH 3IB4A 3UMTA 2AK4E 1VADB 3AFLA 4Y2DC 2JLLA 4P57B 5IVXA 2CGRL 5E2VL 3ULVL 4PRAB 3QRGH 5E08L 2VDKL 2K7PA 3BKML 2NY3D 5JW5A 1S8DB 1FPTL 1GZQB 4NPYA 2RHEA 4JZJA 2VYRE 3JZ7A 5FYJH 4LLWA 1MAKA 2AV1B 1AXSB 3RWCB 2F5BH 3ZKMC 2HJKB 3T4YB 3S5LA 1IM9A 3V79C 4Y4HB 3Q6FA 5A1AA 5AD0A 1HYSD 4LNVA 4X0KB 2YC1A 1VEMA 4G8EA 2WWMC 4JDVA 2O61B 2BY0A 2Z35B 2PYEB 4IRJA 1S5HB 2DI7A 3VXSD 3U6RA 3QA3B 4NGHL 4OTXH 3DO7B 1C8PA 1U8LB 4P23B 35C8L 2HN7B 2ZCHH 5IEHA 3QIWD 3B9KD 5ALCL 1Z9SA 4OZFB 1IL1A 1F45A 1JBJA 4JRYD 4P4RB 1KEMH 2HYMA 5T3ZE 1I1FB 5CZXC 1YY8A 5F96H 5BO1H 4PJGF 1BAFL 3IFOB 2JJTA 2OP4H 2A6JB 4L3EE 1WQVT 4F15B 3LKRA 4G8GD 3VRJB 1T5WA 2DWDB 4MB3A 1OGAA 4UV4L 2EDEA 4ZNEE 3G5ZB 1QVOA 4F7TB 1QBLH 3M1BB 2B39A 4TVPH 4JHWH 4XGZA 1U92B 2C5DC 3B9KB 4G8GA 4FQLL 3HNSH 5GISH 3C5ZB 5DZNA 1EA9C 3PQYD 5IMMB 1UFUA 2IGFH 2Y07H 4S1SH 1QSED 2FYYB 1KJMB 4L4VE 3OPZL 2BZDA 4OGAC 1CFSA 2PW1A 3KR3L 3UBXA 3BSZL 4L8CB 2UY7A 4RGOH 1FZOA 1R3LB 1I8LA 3ARXA 2XTJE 1QVOB 1FG9C 2UZXB 4X4YA 5C0BD 2NX5D 1OAZL 1C7SA 5EU6D 1P1ZA 3VA6A 3Q5OA 4LLUA 1S9VB 5EB9A 4PG9A 5EBGA 4YDKH 4P46B 3KXFB 1AD9A 3QUZA 2BNQB 2VDLL 1LDSA 3RHWF 4XMKL 5BRZA 4OT1H 3UBXG 3SE3A 3SJVA 2DJSA 1W72A 1VERA 1XIWC 1DBML 2ZJSH 4MNQB 2G5BA 5EU4A 2VE6B 1XGUB 4JVPA 4RX4D 4F3FA 3HI5L 3QCUL 5HHVH 4F7CA 4HKBA 1FNAA 4Y0GA 3ZL4H 1AH1A 4IDJL 2X89D 1R3KA 4RMTA 4OKVB 3FMGL 3NIFE 1CXLA 4XNXL 3I75A 3KHQA 4WUKL 1QRND 4JKPL 3S9DB 1RD6A 1FL5B 3MCG1 5CP3A 3VXTB 1A3QA 3T2NL 4G8FA 1J5OL 4OZIF 3ZYIA 4HS6B 3U4BL 3LSOB 3HMWH 3WFDH 1GZQA 3RWGB 2BNQA 1L6XA 3UC0H 4NFBA 4NKOB 2FBJH 5EU3B 4KKCD 1B6DA 1VCAA 1GC1H 3TP4A 1HIML 2WK2A 3GMMA 4HF5L 4KKCC 5IK3B 4EKXA 3I84A 1A14L 3DX8B 1MCEA 3SDDC 1WT5C 1ZHNB 2HT2D 3MLUL 2X7LB 2PW1B 3L5XL 1WK0A 4DZBA 3NFSH 2R69L 3HCVA 3X3FH 3MBED 1EZVY 3QAZB 1KJMA 1YDPA 1YJDL 4I9WD 1HE7A 2JCCE 2WIMA 3B5TA 3ZE0E 4RAUB 1NJ9B 3EDEA 3U9UA 2FD6H 4MLSA 1ZA3A 3MOQA 3O11A 5FHAL 2IH3A 4EI6A 1D9KD 1Y0LA 1D5MB 5C0CE 4OTXL 1TCRA 1FVEA 1BJ8A 4WWKB 3AS2A 3ILPA 4JCLA 1V7ML 5KVFL 2XACC 1NKRA 2NY6B 2WIIB 4ODVH 5K33A 1IC5L 3FN9A 1TIUA 2CIKB 1E4KA 2V5SA 3PWJA 3BPNC 3GI8L 1IFHL 4TSCL 2Q7YA 3QIUA 4YGAB 1RZIA 5E95B 1EHNA 3QEQD 4U6VL 3AXLB 4NO3B 4EUPG 2WBKA 4QOKE 1WBXB 3F58H 4MCYB 4F15C 3IS1X 1HIMH 2BMKA 3FQXA 5F7FA 5B22A 3S5LG 1MFDL 2PO6B 1Q9OA 4U1MA 2J88L 3SQOH 2OJZH 4AQOA 3PP4H 1A14H 5F1KC 2VLJD 3JBG7 3MA9H 5F3BB 3FKUS 2KZ1B 3NFNA 4WNQA 4YZFE 5F88A 3CU1A 4PBXA 2EDYA 4HS8L 2NQCA 2Z31C 5DT1L 5E2UH 4CUCA 1IQDA 1G1YA 3O4LD 3VXMA 4HUMB 4M00A 4LSSH 2VXVL 2B0SL 4KK9D 1OP3H 1OY3B 5B21A 1ORQB 1I75A 3O9WB 4PV8A 1IMHC 4JRYB 5DO2D 4NQXB 4XP6H 2UVFA 3UYRH 3LKOB 5E0QA 2OK0H 3HR5B 1P84K 4PJGB 4HIIB 3DBXA 4ESKA 5ID0A 5EOTA 4S1DC 1OSZB 4L4TE 2CLRB 3QDME 3KAAA 5D9SA 5EBWB 5SX4I 3VFTB 1PSKH 3VFRB 4C4KO 2PXYA 3P2TA 5FM5M 2O93L 1MJ7L 4CU7A 1WAAF 3OKDB 1G7HA 1U91A 1XGPA 4PJEF 5JW5B 3O2DA 5IHZB 3KPLA 2A73B 5JPMB 1QRKA 5EC1B 1DQJB 3T0EB 1HWGB 4HIXL 1Q9LA 1FYTB 3HG1B 4Y8AA 3DBXB 4ISVB 4HIIA 4EUPB 5FUOL 1KIPA 2E7BA 3IDUA 3G5VA 3GHEL 4MA8H 1CG9B 1NANI 3OXRB 4DGYL 3CLEL 3QUXA 4JFXB 1NCWL 5EO9A 4P5TB 1TTFA 2FO1A 2VLLA 4LIQL 1XF4A 3QDMA 4NRZB 1JGEA 3KPSD 4WW2A 5CEXB 4YWGH 1KSRA 3ZKMD 3T3PF 1MHHA 3CX5K 1GGBH 3RA7L 4HCRL 5D1XC 1BQLL 1MUJA 5IVOA 4NZRL 3Q5YA 4HAGA 4YHZH 4PRHE 3FAWA 3FT3B 1FV1B 1UXSB 2P7TA 4IS6B 3FFDA 2D9QB 1RZJC 4Q6IA 5E4EB 4OV6F 3V0WL 1P69B 5MENE 3HE6A 4YHIA 5D7JD 4XHQA 3T0XA 1T22B 3QQ4B 2R4SL 4JR9H 1RJLB 5JQ6L 4HKJA 4KZEH 5BMFH 2DWEB 1F02I 4KRPD 4EI5C 4BSVB 5EZIL 3MUJA 4FZ8L 4P4KA 5IB5A 4ZPVB 5I73C 4M5ZH 3NACL 5EBLB 4BFEA 3SDXF 1EGJH 4NJ9L 2R2BA 5CBEA 3WKML 3NCFB 5GJTH 4JAMB 1AO7A 5C0AA 4QXUL 4UV4H