1O7SA

High resolution structure of siglec-7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
121
structure length
112
Chain Sequence
b'KDYSLTMQSSVTVQEGMCVHVRCSFSYPVTDSDPVHGYWFRAKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIALIC ACID BINDING IG-LIKE LECTIN 7
publication title High Resolution Structures of Siglec-7 - Insights Into Ligand Specificity in the Siglec Family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 28
structure length 112
sequence length 121
ec nomenclature
pdb deposition date 2002-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1o7sA00
1ZWIA 4WI3A 5FIEA 1UWGH 3P0VH 1ZHLB 1WC7B 8CGTA 3HUJF 2VXTH 4Y4FA 2OMBA 1GGBL 5EDXA 2A77L 1BQSA 5EIIB 2DJSA 2CUMA 4YHNB 5GISL 1A7OH 5J3HD 1J86A 3NTCL 1CG9A 4LGPB 2DQCH 2BNQE 4KAQL 4NRXA 5DJ0B 4LNRA 4PJEB 2FJFA 1CVSC 4HZLA 5I76A 4QRRB 2NY6C 3D3VD 1FL6B 2YR3A 4WDIB 1HZHL 1FZJB 3IJYB 3H0TB 3MV9A 2QQLL 1AE6H 4XB7A 2XTLA 3VFTB 5IROC 3LS5L 4Y8DC 4YDJA 2C4FU 4F15B 1YEHL 4M7JH 2YPVH 3NZ8A 4WHDA 3KDMB 3D3VE 4MA3A 5FK9A 1DQMH 3UBXG 4RGND 3SDDB 2ZSWB 1QHPA 4RFOH 5E08L 3CFIC 5C08B 3S5LB 1AD9B 1SHMA 2EE2A 1SY6A 1KJ3H 3QI9A 4MYWB 4X80H 3FRPG 4P2QE 3N1PC 1OARH 3KYKL 4DKDC 2F74B 4RNRA 1U42A 1K85A 1LK2B 2E8ZA 3SGDI 2DYPB 1HQ4A 3VXSD 1ZVSA 4PGBB 4RGNE 5HHMD 1CIDA 2B39A 5FO8A 1X5AA 2IPTH 2MOVA 5ERWA 1DP0A 4Y4HC 3C5ZC 4BUGA 2LVEA 1L0XA 1TJGH 1MCSA 3U4EA 4ELKB 1FVDA 1QQDB 1UH2A 5T1DH 1JV5A 2F8VA 2F58L 4R7DB 2AQ3A 1XF2B 1F4YH 1S8DB 3UMTA 3VXSE 3FRUB 5HHME 4GKZB 4F2MA 2KQMA 4PJIE 2Z91A 3BI9X 3PHOB 2J8OA 3QHFH 3MOBL 1UJ3A 4K3DL 1EK3A 4QHUA 4Y1AB 3BKJL 4UOJA 1IAKB 1KG0B 4Y5XA 4OLXL 3QNZA 1I1AB 1Q72H 2IBZY 5C0DA 4C83B 4YBLC 2Z31C 5HYJD 3GMOB 4FQXD 3HI5L 4M8QA 3IKCA 5FCUH 5H94B 2YMXL 4JG0L 2IC2A 3BUTA 5HVWA 3PGDB 1ZLWH 1FBIH 4WHTB 1JRHH 2BVOA 4CVXB 5E5MB 4OIIH 5GZND 4I0PD 3DVFA 5CJQL 5IGXH 3VXRD 4PRIB 2VE6B 1ZHNB 3DX6A 5CP7A 5HYJE 1TZIB 2J8UF 3MROA 4PJHA 3LKSB 2BSTB 1UA6L 2ICWA 2XWTA 3GSNB 4N9OB 1IJ9A 3WS6C 2UWEB 1NLBH 3V6OE 1ED3A 3C8KA 3DXAD 2FEDD 3HPLA 2E6PA 4UIKH 2OM5A 1S7UB 5GGUB 4UZGA 1U58A 2R1YB 3CVHL 3VXRE 3QDJE 3QWOA 1FFNA 4EN3C 3PV6A 2DDQH 1X4YA 4AENB 5HJ3A 4PJGF 1JGUH 2F9BT 3QCVL 1N6QL 3WNKA 5IB3A 4G5ZH 1OHQA 3EO0A 2I9LA 3MLWL 4KKAD 3BEWB 3DXAE 5ITBH 1KCVL 4JE4B 5JXEA 4GMSL 1P6AB 5DTFA 5I8CB 4G9FB 4XP1H 4KQ4L 3NOIA 3QJFB 5C0BB 2F54B 4FP8H 4QHLB 3DPBA 2NZ9C 4NIKB 4HUNB 4I13B 4JR9H 4I48B 5I1KH 1HKFA 5GGSY 1WAAE 4HUUA 3EYSH 5JLZA 3CXDL 4G80A 4JDZB 5C0JA 2VITB 3LRGA 43CAA 5ACZB 4NUJA 2F8OA 3QT2A 3BIAX 5JDSB 4OLUH 4HC1H 4XBPA 5JW5A 4YWGH 3L3DA 5HHXL 1JGEA 4MJ5A 3QUYB 1G7MA 5KJRL 3WIIH 3FT4A 3L5XL 4UT9L 1UH3A 2Y72A 1LP9F 4PRAB 3NIDF 1X5HA 1FNAA 4YHML 1BWWA 4Q9RL 5A2FA 2NY3D 4F58H 4Y2DD 5FGBC 1G9MC 4Y19E 2X40A 3KPTA 3HG1B 1OSZA 1JHTA 1AQDA 2NTFB 2VSCA 4F7TA 1EGJH 4OGAC 4PR5B 4XPFL 3WFZA 4YIQB 2C3VA 1UCBH 4F9PA 4OZIB 3NH7L 4ZNEA 4YXKH 4N8CH 2NY0D 2D7OA 3TO2B 3PWNA 4G9DB 1H0DB 4S2SA 1OT1A 4NNPH 5FFLA 1ZLSL 4OGXL 3IAPA 1DN0A 1HXYA 1XAUA 2LABA 4YHOL 2XTJC 1VGKA 4NKDB 3ZDXF 3HE7C 4UIMB 2CDEA 35C8L 3R06A 4X9IA 4KK9D 4LQFH 4R0LA 4HSQA 1U8KA 4MX7B 4NNXB 1OT2A 4XRCB 2P5EB 4UDTA 7FABL 3QDGA 2FB4L 1FLRH 4BFEA 1X6LA 1XIWC 3O11B 3CUPB 3SE3C 4ESKA 4QCIA 3NCMA 4J3TA 3ARYA 5FYKH 4NQCE 1ZT7B 3MUZ1 4G8GB 1FFRA 43C9B 5C71A 4H5SA 1IGML 5TQ0H 5ACLA 2NW2A 1CLOH 3HTLX 1PSKL 5DQ9B 3FFCB 4HUWA 5SWQA 2PYEA 1M71A 5JW3H 1S9WB 4R2GB 2QQNH 3U4AA 3CK0L 4RISL 1DQLL 1FH5H 2YA2A 4Q2ZA 1ZT1A 5JZ7C 1TDQA 2Y23A 3HLAA 3BMVA 2JCCF 4HIXL 2ICEB 1MCPH 1KV3A 1Z0NA 2EDKA 2PW1B 3MJ9L 5E5RB 3CXHJ 3ARGD 4FG6C 3MZTA 2H26A 2KZ1B 4YGAB 2EEBA 3KLDA 4XGZB 1TVBB 3F7VB 4TVPH 5L2KB 3O45B 2ITCA 4WCYH 4HFUL 2ZOKB 4LDOB 2M26A 4PY7B 3FCTA 3OJ2C 2YD1A 4DTGL 4OLYH 3L7FB 1P84J 3J8F7 2FWOA 1JNHB 3UBXA 3KGRA 3FONA 3TP4A 1G0YR 3RL2A 1EO8L 4QRTA 2OL3A 1I7UB 4XPGL 4QRPD 3FRPA 4CJ0A 1MLBA 5DK0B 4JFFB 3TF7C 3EJZD 4F7PA 2OJEB 1S9KC 3S96A 4PRNB 1BP3B 2N56A 4KTDL 1D5ZA 2PCPB 2V2WA 3JV6B 5M95B 1VGEL 4J6RL 3VXTA 5F89B 2NX5D 2O26U 3JV4A 3QCUL 1VKXB 1E4XI 3GSUA 2P44B 1Z5LA 4QRPE 4URTB 3L3KB 5EO9A 4LAQH 2X89D 2X4UB 4X7TA 5F70A 3GZKA 1NANH 2WWKT 5DVOA 3KPOA 2NX5E 3G6JA 1RIUL 2MPAL 1KPUB 4ZFGH 4YUEL 1UZ8A 4ZXBD 4ODTL 1QRKA 3M07A 4ONGL 2Y5TA 2VWEE 4GW4B 1LEGA 3VXUA 4KRPC 1D6VL 4F7MB 3IDGB 3QULA 1QSVA 3TNNA 3EO1A 1DZBA 3DGGB 4LLWB 4GXUN 4NOBA 3RGVC 3O3BA 4RAVA 5IHUL 5IG7A 1FSKC 1A4KB 3WEXB 5E6IC 5KSBA 5IROA 3IT8D 2XXCB 2XZQL 4ZUUB 4O02H 4J3SA 4K55A 1GVIA 2LU4A 4J2XA 1T7XA 1WIPA 2VISB 1B6UA 4JHAH 3VFMA 4S1DD 2X1XR 3CIQA 4WWKC 2YUXA 2X2YA 4N5UA 3ROOA 3RWHB 1IC7L 4NO0D 5C0RL 4Q6IB 5E2TH 4CBPA 1RUKH 4AEFA 2Y6SC 1HSAA 4MDJB 2FECL 2OP4L 2WQ8A 4LK4A 3K80A 5EZOL 5EC2B 5IB1A 1YEKL 2D3VA 1UVQB 1UWXH 1HKLL 4I9WD 4Y4HA 3C5ZA 1FNEA 2CIIA 5GGVL 4NZRL 1AGFB 4PB9H 4X4YB 3GGWB 4H88L 4M9PA 3ROLB 1N59B 3ARVA 3MRPA 1IGJA 3UPAA 3Q48A 1J0KA 5CJXC 1JZ4A 5CEYA 4Z76B 4YHLL 4GKNB 2BVQB 4YH6A 2A6KA 5B38G 4I9WE 1DBKL 4I3RH 5EOQL 3TV3L 3G6DH 5A2IH 5A3ID 8FABB 4QF1B 4OF6A 4ORGA 4RDQG 4HC1A 1REIA 5T1MB 2X9XA 5F7WC 4Z7NF 2Z31A 4U0QB 2Z8SA 2YKLH 5KN5A 3QEUA 4FZEL 4DN4L 3MJ7A 3VWJA 4XP9L 4C54A 4RWYH 2VIRA 1LK3L 1IEBB 1H8SA 2LAAA 3H42L 4PJCF 2AJXL 3NZHH 4LEXL 1GL4B 3TZVC 4JVUA 3MRHB 3GSWB 5DJCB 4EQ3A 3TCXA 4LCWA 3MR9B 2O5XL 4WFFD 4FQLL 1AKJD 3RWJA 2R0KL 3SDCC 3WS6A 1H3TA 3DV4A 5I17A 1A21A 3O2VH 1H5BA 6CGTA 5I30H 3DETD 4QHMB 1XGTB 5L8LB 2FJGA 4DN3H 5E7BA 2A6IB 1YEGH 3QUML 2I27N 5FUOL 5T3ZD 4P5MA 3SDYH 3WFDH 5J1SC 2V2XB 1OGAB 2YXFA 1GGIH 3I2CH 4BA8A 1MRFL 2Q8BL 3AB0B 5F3BA 4WFFE 1OP9A 2P24A 5TH2A 3DSFH 3O9WD 4LSTL 3WJJC 1JGDA 3UJJL 5DRNA 3EYQD 5HYEA 3FO0H 4MQXD 1J1PH 1IKNC 5T3ZE 3IFPB 3RA7H 3RVXD 2DMKA 3FQTB 2HTLC 1R5WB 1U8IA 2XQYG 2D0HA 3WUWG 2G9HA 2Z93B 4OCRH 5L0QB 3QUXC 4NKOB 3HZVB 5GRVL 5T5FH 3JWOL 5D72H 3DOSA 1Z9SA 5E1AB 2MKWA 4WWID 2ATPA 3PWPA 1RUAH 2W9EL 3PGCA 4X6CA 4XNYH 4IOIB 1GAFL 1VHPA 3DUUA 1WCBA 1ZLWK 4AIZB 4IRSB 3U48A 5MP6L 4LP4A 3FKUS 2VZ1A 4AM0B 3OG4B 4MJ6B 3B43A 4XP5H 1BVKB 5FGBA 3MC0A 2IAMC 2ZG2A 4TSBL 2YUZA 4Z78A 1MFDL 5AG8A 4LLVA 5D2LF 3VGFA 2Z8VC 1GH7A 4PBXA 3ECBA 4ZUWB 1CLYL 2A73A 1RZ8B 3FQWB 2R1WA 2VXQH 5DJXA 5AD0A 4U6VL 5DEFB 2ZOLB 4OZFG 4XHQA 1RZGB 4JEGB 1RU9H 5TE7L 1DSFL 1I75A 3WHXB 4Y5VC 3HE7A 1N4XL 5SWZA 5KZCB 4TTDD 4R96B 1G84A 1KOAA 5IR1B 5JIIA 5INDB 1UXWB 5JQ6H 1YC7A 3CFBA 4BUHA 4UAOC 2DQIL 1WFTA 4PJDE 3SGEI 4UOW0 3BP5B 1ZK9A 4K3EL 3FHAA 5E8EB 2PYED 1C1EL 2V5MA 1MREH 1XIWA 2IH3A 3SE3A 1A6TB 3B5TA 2AABL 4PJAE 1UXSB 1IQDB 5C09A 5F1NB 4K94C 3V5HB 1J5OL 5JPNB 1UM4H 4HAGA 3THML 1JWMB 1GIGH 1MJJA 3MLYL 5DRXB 2PYEE 5I0DA 5FYLH 1INEL 3C60C 1KB9K 3DYPA 2NTSP 4JM2D 4WV1C 1T0NB 4XHJC 4K3HA 4PJXF 3QISA 5EU4B 4MNGA 2VL4A 4OM0L 1M6OA 5FDYA 3C2SA 3T2NH 5IQ9A 4PJFF 3EYFB 5JORA 1E6JH 5A16B 2GKIA 4X6DE 4JFZH 1S3KH 4QOKD 5FV2A 2V5RA 1A6ZA 1AR1D 3WJLA 4UOW1 2ADIA 4CN4A 3KNBB 3BDBA 5LVEA 3ET9F 4C56D 1BFVH 4H26A 2ADJB 1BIIA 3ULUH 1IAIM 4E41B 1A7QL 2EDTA 1G9EA 1QA9B 4LCUA 4QOKE 1BVZA 2X9WA 1RI8A 1I8MA 1S9XB 4IJ3C 5I8EB 2GK0A 4L3CB 1P4IH 4HLZG 4DGIL 1WBZB 1RV6X 4P23D 5IIEA 3BGFB 2DTMH 2HH0H 2WUBH 4C56E 1CLZH 3OKNB 4JY4A 1EX0A 4JRXB 2DQUL 3JUYA 3PIQB 1NGZB 2EIZA 4ZQKB 4NKIH 5HVHB 1UG9A 3P30H 4GS7C 4WU5B 2ZWLT 3IFOB 2R0LH 4K94H 3QUMB 1FNFA 1S7TB 5D1QB 3A67H 4OZGE 5ESVB 3SPVA 5B38A 4KROC 1QSFD 5CJ5A 3AAZB 1OAYL 3IFLH 3BH9B 4NHUB 3DO3A 1FL3B 2IQ9H 4CN6A 2MQ3A 1RVFH 2VLKD 3T3MF 1AJ7L 2VERN 2UZIH 3SQOH 2NXZB 3DTXA 4E9LA 1WJ3A 4HPOL 5EU6A 4KPHL 3BAEH 1IM3A 1IAIH 1QSFE 5DURB 1SJXA 3RGVA 1B88A 3T08A 1WEJL 3EOTL 5ADPL 5KOMC 3U7AA 2VLKE 4TUOA 2EC9U 2D0FA 4KMTH 2BFVH 3STBA 1CN4A 1JN6A 2R9HD 5D7IA 3CNKA 1J05B 5AUMA 3UROR 3QQ4B 4HX1B 4YGVA 1OAQL 2JIXA 3PWLA 2OTPA 5FA3A 2YHGA 4NZJA 5JUEH 4JPWH 5I15L 3F58H 4OIBA 4POUB 5IMOB 1OTSD 1HE7A 3BJLA 2F53B 2V5TA 2EDDA 1V05A 3D0VA 4ZS7H 2DMBA 2GTZB 3SOBH 2OTWB 3UTZA 3UJIH 4DGYL 4GUPA 5JPMA 2GSGA 3WV0A 1AHWB 4O51B 2HJKA 1A9EA 5IMLA 5KSAC 2Q76B 1G1YA 3LQAH 3SE9L 2CPCA 4EXPX 1MI5D 3C08H 2V17L 4P3WA 1U3ZA 3WUWA 4JFQB 1EERB 1MAKA 3D18B 5D1XC 2JJSC 4WHCA 3FAXA 2FH6A 3ARFB 4CAGA 1LO2L 5CJXA 3ZKND 1AGBB 2HJLA 3NN8A 3VWJD 1HI6A 1YMMB 1LEKB 4DVRL 4W6WB 3LD8C 1MI5E 3HA0A 3G5YA 4NJAH 1F58L 1F45A 1W72L 5I66A 4P46D 1FG2B 4M7ZC 1I4FB 5D7JD 2R4RH 1T0MB 1I3GH 1U36A 3PQYA 5IMKA 1IAOA 1JHLL 1MFCH 2M8XA 4JGJA 1P1ZB 2G60L 4BQ6A 4XBGA 3T4YB 2YBRA 3LH2H 4Z0XA 1WTGT 4QXUL 3GMPA 5D2NB 2PYFA 3UJTH 4U1SB 4L4VA 3SCMC 3S34H 2DS4A 4GRWF 4OZFA 2BVPA 1ADQL 3RWEA 1BEYL 2YPLD 1CGWA 1SEQL 1W0WA 4JO3L 3BXNA 3SDCA 1HH9A 4UQ2B 2FIRT 3RIFF 4H20L 2CKNA 2EDJA 5KVDL 2HLAA 4HAFA 1E27A 2P7TA 4PJHF 3EFFA 3N1FC 5TF0A 1V7NL 1AC6A 4OJFL 4FQCL 3P9LB 4U1IB 1QYGL 1U41A 4CRPA 3EO9L 3D48R 1UB6B 5DWUH 3EBAA 1UWXK 2YPLE 2JKXA 2FYYB 3BRFA 5IFJA 5FYJH 3TWCH 4MQ7B 3SJVB 1FDLL 5EB9A 3QHZH 3EOBA 4DUXA 3LKRB 4JN2A 4F3FB 1KXQE 1IKNA 4ODHL 2AJZB 1OCWH 4ZTPL 5MENA 3KXFD 2V2TA 5IUSA 1LO0H 4GQ9H 1A0QL 1T0PB 4PBWD 5FYKE 4IRJC 5DT1H 3QUXA 3E2HB 5FDWA 3S37L 4IHOA 2FHCA 3QH3A 1NJ9A 2WLZA 1FZMA 4PJ8B 5HGDB 3MRCB 4IS6B 3C5JB 4ZS6C 1D5BB 5I8OH 2DRUA 1TJHL 2CLVA 5CKGA 4JKLA 4LCIL 5EWIL 4LPYA 3KXFE 4AIXA 4ODVL 3BPOB 1YN7B 3WIFA 2AS5M 3DO7A 4QT5B 1DJSA 1KCUH 3BN9C 4JGMA 2B7DT 4XP4H 3V7AE 4RBPH 1QTYT 1WZ1L 5A2KH 5DRZB 2IAMA 4HGMA 3KPRD 1OAUL 5IVXA 2HKHH 4Q0XH 4PGZA 3GSXB 4LSUH 1RHHB 5HD8C 4TVPE 2W65B 1A7BA 1KCRL 1SBSH 3AVEA 3PDOA 1RUML 3ILPA 4CU6A 5AYUH 3RAJL 1S7VB 3DMMB 4FFZH 1CXHA 3BGMB 1BOYA 1CTNA 1NBQA 3KPRE 4Y5VA 3H9HB 3TIDA 5LXGH 4Y16C 4DEPC 1OTUC 2KPNA 1VEPA 2V9TA 3ZKXB 4BM7A 3W82A 5AG9A 2EZ0D 4RX4D 1UZ6E 1VB9A 2OK0H 1UM5H 2HFFB 5TF1H 1JPSL 1IGFH 2CO6B 5H35B 4ZSOB 3BJ91 1KB5L 2MHAB 4PRDA 1R5IB 4F15C 1KGCD 2XQYK 3L3IA 3CFCL 4KZDH 2Z92B 4LKXA 5K93A 3C9NA 3DBXA 4TOYL 2BJMH 2XZCL 3CDGA 5IWLA 2VH5H 2VLLB 3SDDC 4YPGB 4ZPTB 1DQDH 3FT2A 4UTBL 1ZE3C 2Q7NA 3E6HB 4XCYB 1S78D 1M7DA 4PUBH 2HYMA 3SKNB 1ZSDB 1RZJC 1KGCE 2HN7B 4F37K 3RWGA 3BZ4B 4JLRB 5DMGC 1JRHI 1U8QB 4WV1A 3I02B 2HT2C 5KANI 2DQGL 1A1OA 3MACL 5EZIL 3SE8H 3RZCA 2CH8A 2GJZB 4NJ9L 3QEGH 4KKCC 1R3HA 1ZEAL 4MNGE 5IHBA 3VW3L 1RZIA 1Q0XL 4PGDA 1ZTXH 4NM8H 4P5KA 5E2UH 3MLTB 3FB7A 5HHQB 1GXEA 2B4CL 3O3DA 1CE1L 4YXLH 3VDCA 4APQD 1ZT4A 1W72B 4ORZC 3OZ9L 3VXMB 2BMKB 1OAKH 4FQIH 3WS3A 1X5KA 3ZDZE 1CU4H 1NGXB 3MV7B 5IV2A 4GLRH 3G9AB 3CFKB 3WD5L 2GUOA 3T8XA 1N8ZA 4D9QD 1A14H 5SX5H 3QO1B 2YEZA 1JK8A 4M5ZL 5CGYC 2FO4B 3V5KA 1IQWL 3ULVF 1ZLUH 4HG4J 1QNZL 2BNQB 3C6SB 3RBSA 3REVA 4UILH 1FGNL 3FB6A 5I1AA 1CFNA 3LCYA 3L5IA 4YX2L 2P5WD 5EG6C 5IB4A 3NFSH 1MJ7H 4PREB 4D9QE 4Q74A 1XGYH 3KR3H 4M62L 1P5UA 3MLRL 1YNLH 2R29L 3QDMA 4U7SA 3FTGB 3KYNA 1U8MB 3BVNA 5KBNC 1WBXA 2V5SA 3S5LG 5JR1L 1HOCA 3MXWL 5HVGB 5K9QG 2AEIT 3D3VB 2P5WE 3EJYD 4UT6L 4XCNB 2AGJL 3DLQR 3G6JF 3B9EA 3OXSA 3QIBD 3LVEA 1IVLA 4HUVB 3E3QE 4ZFZA 2KH2B 4TQEL 4P57B 2VDLH 3OMZA 2VZOA 1NFDA 1KUMA 4KDWA 3MRLB 5CSZB 5DD3H 1MQKL 3O6KH 2I5YH 2VXUL 4RGNB 4ENEC 2EYSA 3S9DB 2VDQH 2WWMC 3CH1A 3MCLL 3BKCH 3BP7B 1A6AB 4KY1H 1RZKL 5ILTL 2VDPH 1GPOH 2EDFA 2VLJD 3ILQC 4WJ5A 4LSRH 2QR0B 3O6LL 1OAXH 4ZDHB 1CL7L 5KSBF 3N9GH 2OQJB 4FRWA 1GRWA 4HMCA 5HHPB 4YHPA 4PJIB 4DK6A 2XIDA 4KV5F 3GMQA 4GW5B 3RWCA 4NWTH 2J12B 5DJZA 2CDFB 3OX8A 3QJHA 4XH2B 2J6EA 1AY1L 1Y18B 3SN6N 3HAEG 1XF5A 5F21B 3S3SA 3IS0X 5KSAA 5E7FA 5DMYA 1QEWB 2J8HA 2H2SC 1JHKH 3GSNH 4HEME 4ETYA 3IETA 3NCJH 3P77A 2RHEA 3VG0H 3O4LD 3WNMA 1KEGH 1Q9LB 1UADC 3HC0B 4MJ2A 5D1XA 2JJSA 2P8PA 1A3LL 3SO5A 4FQXB 1PKQE 4MCZA 2YC1B 3VCLA 3PQYD 1DCLA 1QFWM 5EU5A 1FFOA 4F7EA 5BRZA 4P4KD 1UQSB 4X8XA 5BQ7A 4U6HA 2ADFL 3DURB 1J1OL 1HXMB 4KVCH 1F02I 4ODBD 3NBNA 4XVJH 3L3GB 1AP2A 1R3KA 5DUBB 2MFNA 2R2BA 1OPGL 4GBXD 1OP5H 5TE4H 3PQYE 4WNQB 1MCEA 2BOBB 2ITDA 4WUUD 2E9BA 5EZLB 3FB5A 4R2GC 3BKML 3SCMA 1KC5H 3M1BA 4MA7L 4FQHA 2IQAB 4LGRB 3KLSA 5BXFB 4R3SB 4OGYL 3STZA 3BP4B 3QWRA 1EMTH 4TPRH 4WUUE 2WANA 2Q86A 2CXKA 4YDIH 4YHIA 1OF2A 1JI2A 1N3NB 4KRNA 4M8VA 1UYWL 4JFXB 4GMTL 4AJ0A 1G9NC 2A77H 3VFNB 1NANI 4FXGB 4J3VA 4X98B 1SJHB 4K8RL 3UZQA 5GISH 3MYJB 3DROB 1NUFA 1SEBB 1SQ2N 4OV5B 1EAPA 3BP6B 1KYOK 5F88A 2R1XA 3LN4B 4ETQB 2NXYC 4FOMA 4M43H 5D70H 1HZHH 2ZCLL 3T3PF 1CDHA 1HQRA 2QQLH 3BN3B 3SDXA 1I8IB 4UDUB 2LFGA 4L8BB 3BD3A 3OPZL 4MS8D 3K2UH 1T03H 2BY1A 3LS5H 3V6BR 3NGBB 4NQDA 1B0RB 1YEHH 1KPRB 3UTQA 3OKMB 1F4AA 3HHRB 4Y2DB 5EU3B 2PETA 3DV6A 3UTTD 2D31B 3TESA 5FYLE 5DJAA 4J3OC 1CYGA 4FQ2L 5E08H 2J5LC 4UV4L 5I75C 1I7ZA 2PO6D 4X6CF 3KYKH 4NO2A 4UT7H 2VSDA 1ZHLA 1WC7A 1F6AB 5D71L 3UTTE 2YA1A 3LS4L 5IB5B 2IH1B 4XC3H 2A83B 5ESAB 1RAMA 5IVXE 1I3RB 5EIIA 4Y4KB 4YHNA 4OM1L 3ZL4L 4K7PX 2XG4A 1HILB 1JGLL 2GYSA 4X7EC 4LHUG 5DJ0A 1T66C 4PJEA 2F58H 1YECH 1MIEH 5HDBE 4QRRA 4Y16A 1RZFL 4WDIA 3ULUE 2ZKHH 1FZJA 2E9JA 2X44D 3IJYA 3WLWC 5FXCH 5DUPH 4RGMC 3VFTA 3MOBH 4Y88A 1Q1JL 4K3DH 4M3KB 4GRLB 3BKJH 2XPGA 3K3QA 3RUGF 1HIML 5KVEL 4OLXH 2Q1EA 2VKXA 4H0GA 3KDMA 3HI5H 3OHXB 7CGTA 5MEPB 2DLTA 2QADD 1C7SA 2YMXH 3JXAA 4JG0H 3SDDA 3GB7B 5AEAA 2ZSWA 1NCAL 5CZXD 6FABL 1VEOA 4Z7VB 5I71B 2NW3B 3ZMRA 3JVGC 5C08A 3S5LA 3MNWB 1AD9A 3O6ML 5LAXB 3RZCD 2JJVA 3ZTNH 3ME0A 4P2RD 2GFBB 2F74A 3BX7C 2QJDA 5D7SL 5M94B 1DL7L 5E00B 3IJHB 2BRRL 5ADOL 4PIRF 2DYPA 4PGBA 2OR9L 4M1CD 4N0CD 5DD0H 3QRGL 3T65B 3B4NA 1ODAA 2R56L 4ELKA 1JUFB 3CPLB 3VWKD 3CVHH 3ZYOA 2JK5B 4XWOC 1FNGB 1GOFA 4R7DA 4HK0B 2WBWB 3NIFE 3TT1L 1E28B 3IAQA 1XF2A 4QRPB 4WTXA 1S8DA 2HFTA 2XV6B 3FRUA 1N6QH 4GKZA 2NY5L 1W0VB 1RZ7L 3MLWH 3H3BC 4KK6C 15C8H 2FDBP 2H32B 3W11C 4OF0A 2FL5B 1KCVH 4H0IA 1XR9B 1IAKA 4GMSH 1CFVL 1U8OB 5C0NC 2NX5B 5FUCE 1I1AA 3KPQB 5GIRB 4C83A 2P8MB 4KQ4H 3ARDD 3GMOA 3MFFB 3QIUD 5H94A 2FHFA 3PJSB 3PGDA 4NFBA 1SJEB 5CBAB 4CVXA 3CXDH 3PL6B 5IW1A 1NGWB 4Z7WA 5TJWK 3HAEA 3IDUA 3CMOH 3T0AA 4PRIA 5DC9B 2LVCA 3P4OB 5HHXH 1ZHNA 3QDMD 1TZIA 3JWDL 2XWJB 4ZXBB 5KJRH 1NPUA 1RK1B 3IRPX 4UT9H 3LKSA 2BSTA 2HTKD 5GJTL 3WXWL 4HXAL 3S88L 3GSNA 2UWEA 5GRJL 3VU2A 5JW4M 4HWEL 1S7UA 5GGUA 3HZKA 4MNQD 2R1YA 3VFGL 2AEQL 3IDXL 4Z95H 3VFSB 1EH9A 1HCVA 3QDME 2MQCA 4XPFH 4MXWL 3Q5OA 4AENA 3EYVB 4WI5A 3NH7H 2OSLB 1ONQA 1JTOA 2ERJB 1KJMB 1AH1A 2HKFL 3EDEA 3NPZB 4OKDA 4OGXH 4RAHA 5F9WC 1ZLSH 3BEWA 4YHOH 5F6HI 1K4DA 4PY8J 4RDQF 1D5MB 1I9RL 2DI7A 1RK0B 2VXSL 1DLHB 35C8H 5I8CA 2GSIB 4G9FA 1KIQB 3RPKA 3MJGX 3QJFA 2F54A 4PGEB 5L0QC 4P4RB 5DD5L 1K4CB 4JDZA 4NO0B 2XT1B 2VITA 2FB4H 4YDVB 4MJID 3CX5K 5JOFB 5JDSA 1CBVL 2HRPH 1BFOB 5CSBA 1JCKA 2Z4QB 4J4PC 1BBDL 3KPNB 1BMGA 1FVEB 3PGFL 3OWEA 1QRND 1IGMH 4IRSC 5GRYA 1PSKH 2GY5A 5D7IF 3HI1B 4PRAA 1H3PL 3AM8C 1JE6A 5FYJD 1NMAH 4M61B 4YXHL 2QHRL 4G7YL 4MJIE 4RISH 2DQJH 1DQLH 3HG1A 4QXGL 4OCWL 2NTFA 3A6CL 3P4LA 4J3UA 4PR5A 3WL9B 4HIXH 4DZ8B 1QRNE 4WGWB 4YIQA 1H9VA 4OZIA 4IRZL 3BZFB 3TO2A 1MCOL 4G9DA 1H0DA 4LGSB 3MJ9H 1XGPB 5DLML 5F7YC 3TBTB 5FYJE 3VXOB 1NC2D 1AGEB 2NY1D 3TT3L 4MMZC 3MRBB 3ARBD 3MREB 4NKDA 4EI5D 3P4NB 4UIMA 4WHYH 1CDCA 2DIAA 1S7RB 4MDIB 4X6BB 3C87A 1CE6B 4HJ0C 4MX7A 4NNXA 4XRCA 2XXMB 5E70A 1T1XB 5D1ZD 1IRAY 4NZTL 4LKCA 1ES0B 1EO8H 1LO5B 1TQBC 5TFSL 2AXFA 4XPGH 2ZNXA 3O11A 3CUPA 3IF1B 1ZT7A 4G8GA 3U36B 5I6XB 4HBQA 3WFHB 43C9A 4RMVA 2QBWA 2J2ZA 1V8HA 4KTDH 4KKLD 2DM7A 5DQ9A 5F3HB 1DR9A 1AKJB 1VGEH 2VUOA 4J6RH 3EDKA 1S9WA 4Z7OF 5CIPB 4HIHA 5F97E 1NGQL 4M93B 3ZT6A 3K1KC 1UWEL 4LHUA 3ELAT 1JYNA 3C2AH 1E4KC 2R15A 1ETZB 4WO4B 3RVUC 1VERA 1QBAA 2PW1A 3V6ZA 3O9WB 4FQ1L 3CZFB 5IFAL 5HGBB 5DA4A 4OFIA 4NRZB 4KKBD 1NFIA 1RIUH 2MPAH 2QQKL 2RB8A 3TBVB 4YUEH 4XGZA 3VRJB 2N4IA 1TVBA 1VPOL 4ODTH 3F7VA 1LO4L 3Q3GA 1WQVT 3O45A 1YUHB 4ONGH 1D9KC 1RMFL 4KTYA 3BRDA 5BV7L 2ZOKA 4PY7A 2XN9D 4ZOBA 3I6GB 4OD2B 1D6VH 3L7FA 5DVKA 1G6RL 4N0UB 1JNHA 4P9HL 4U0RC 4MCYB 3DNKA 1Q9KB 1JNLL 5E9DA 5LGHL 2XOTA 1YY8B 3VDBA 1I7UA 5IVZB 4RA0C 1EVUA 5DK0A 4NP4L 1M1SA 1YPZB 4N5EC 1OY3B 4LNVA 2DICA 5IHUH 3H3KA 2VAAB 2XN9E 4PRNA 4U33A 1HHGB 3WIHL 4FFWC 1J0IA 2XZQH 3JV6A 3SDXE 3RNQB 3BGFC 4P5TD 5F89A 2HMIC 4RMSA 4U1GB 1VKXA 1IAII 2E7BA 4LCCB 4TNWK 4BSVB 3L3KA 3VD5A 1F4WL 3F12B 1CR9L 1OP5K 1IC7H 5C0RH 2YD3A 4PJ7F 5D1QC 4JFED 4PJDB 2OP4H 2EEAA 5EZOH 4UI2A 3H3PH 2IF7A 5JIHA 2O61B 1KPUA 2EXYC 4LF3B 1WIUA 4OQTL 3U2SB 1YEKH 1CK0L 1MVUB 1GHFH 4KHXL 4PTUB 1JYVA 2AJVL 4M9OA 2E9WA 1HKLH 4JFPB 2OX5A 4PJAB 5F1IB 2A0LD 1TJIL 5GGVH 3TYFB 4NZRH 5J11B 3ZTJG 4F7MA 3KLHC 4H88H 4JFEE 1S9YB 1X5FA 4DVBB 2NXZC 3DGGA 4CL7A 1EEUA 4PG9B 3BRGC 2E3VA 4ODWB 2WBJB 4L1DA 1GZQB 3BPNB 4YEFA 1FQ9C 2LE9A 3MA9L 4YHLH 1U92B 2RJMA 1DBKH 1A4KA 4XVUD 5EOQH 3TV3H 3WEXA 3ORJA 4NCC1 1NUGA 1T21B 4ZUUA 3E0GA 4WIQA 2ADGB 4K9EC 4Q7DA 4BQ8A 5IJKC 3Q6GL 2VISA 4FZEH 4MAUL 4WTZG 4X6DB 4DN4H 5JHLL 3U79A 4JM2B 2WIMA 5DVMA 3EUUA 4GG6E 3JVGA 4MAYC 4HGWB 3RWHA 4Q6IA 4OFKA 1LK3H 4N1HB 3UPCA 4KUCD 5DFWH 5DO2C 3H42H 5INCB 2AJXH 1OWWA 4MDJA 4LEXH 12E8L 3WFBL 1NC4D 3SKJH 1F4HA 5EC2A 4BQ9A 5IF0B 1U3HB 1HN1A 1UVQA 2O5XH 1AHWC 4FQLH 2R0KH 1X4XA 1NCUA 3D5OF 5E03A 4BFIB 3GI9L 1AGFA 2RCSL 3K0WA 3QUMH 4X4YA 3GGWA 1CCZA 5FUOH 5EA0L 1ZGLB 4C56B 3ROLA 1N59A 4PGCB 4Y1AD 5C70A 2ORBH 4ZUTB 4KWUA 4UMGA 3HUJB 1MRFH 1I1AD 2Q8BH 5FGRA 3ZE2F 3RKPA 5KVFL 4GKNA 2BVQA 3MRNB 2X7LA 1FGVL 4CW1B 3C8DA 2UY7A 4QF1A 5C3LD 4P23B 8FABA 1ZGLP 1J10A 3TFKC 1PG7W 5HPOA 4NN6B 5T1MA 1UH4A 4Y1AE 3DIFB 5CLWA 4OZGB 1T5WB 4DZBA 4QY8A 2NY2C 4LSQL 3ZKMC 2SEBB 3LHPL 4HT1L 1NBYB 4PB0L 5CINL 2ZNWA 4NOFA 3FN3A 4DQOH 1T1YB 4PG2C 5CD3A 1IEBA 3O2DL 5F1SA 2AEPL 3FOMB 1MRCL 3F6IA 4KZEL 1T04B 4RAUB 3MRHA 1NMCB 3S3PA 2VQ1B 3GSWA 5DJCA 1QSFB 2Y36L 3MR9A 1N64L 3V9FA 5MP6H 1JNJA 2LU3A 4OLVL 4IDLA 4OZ4B 1AD0B 5E94B 3TBYA 4U6XB 3RQ3A 1R3LA 1XGTA 4X9FA 2NMSA 2VLKB 4TSBH 2A6IA 5DSCB 5B21A 4WI7A 1MFDH 2P1YA 1OGAA 2V2XA 5BV7B 4ZFFB 5E2WL 3QEHB 4G9FD 3GRWA 3VXPA 3ARRA 4O2EB 5C0BD 1TXKA 1GC1L 4U6VH 4FQQA 2QKIA 5TE7H 1DSFH 4D9LL 1N4XH 3O3UN 3IFPA 2D7TL 1TIUA 2K9UA 4WW2F 3VGAB 3FQTA 1AGCB 3VRLE 4FHBD 3EDJA 4MD0A 2OI9C 4EJ1C 1R5WA 5IKCB 1EO7A 4G9FE 1NFDF 2H45A 2Z93A 3PXJA 3QUYD 2W9DL 3RHWK 4J8RB 5A1AA 4KGLA 4W6XB 5C0BE 2F54E 3OAUH 3E2HC 3MV8B 4K3EH 4U2ZA 4PJ8C 5E1AA 5BCAA 1C1EH 3RRQA 4K23L 5F7EL 3TO4C 4J4PA 2X4PA 3BPOC 1OB1B 2AABH 1MCIA 4IOIA 5E5UB 2ZSVB 4AIZA 4IRSA 1P4LB 1FHGA 1PFCA 1J5OH 4AM0A 3THMH 1P4BL 1V3JA 1MCCA 2AXGB 1BVKA 3MLYH 3LPGA 4NRYB 1MI5B 1A64A 5FHAL 3EFDL 1TITA 1HSBB 3P73B 3HFML 2J8UB 2C9AA 1AIFB 4FXLA 3VGEA 4ZUWA 2CLZB 1OTTC 1RZ8A 4OM0H 1OQXA 1WFNA 3FQWA 1DQTA 3HPJB 3OAZH 4OZIE 2ZOLA 2P5ED 4OD3L 1RZGA 2P49B 3VH8B 1LDSA 4JHWH 2GHWB 1PY4A 4P46B 5GZOC 1YJDC 3QQ9D 5D7JB 4R96A 1KTLA 4C59B 5BVPL 4GAJL 5IR1A 5INDA 3M45A 3WO4B 1UXWA 1GYAA 4QRSB 4LRIA 3S4SB 2ZCHL 2N1KA 3BP5A 2P5EE 3FFCD 3QPXL 2AP2A 5E8EA 1INDL 1A7QH 4Q9QL 5DHYB 3V4PH 1N7ML 4OT1L 5EUKB 3MJ8B 3TVMC 2D9CA 4ONFL 1UXSA 3FN0L 5B3JF 1IQDA 2YPLB 4EN3D 5F1NA 4OF8A 3V5HA 4DGIH 4G8GE 4C57C 2EDNA 3FB8B 4CUCA 1JWMA 3H7BB 3OG6B 4GLRI 3FFCE 5DRXA 1MOEA 2DQUH 1BOGB 1KXVC 2VL5B 3FOLB 5ICZA 4YFLF 1CXFA 3UZEA 4HWZB 3BQUB 4YC2C 5L2KD 5C0AD 3QXAB 2J88L 3D1MC 5EU4A 2D9QB 1LP9B 3ZDYF 1RFDL 1DEEB 3ZHDA 3L6FB 1K6QL 2AI0H 1TFHA 3EYFA 3CGTA 2WUCH 3V5DB 5A16A 3R1GL 3KXFB 5CUSL 1D9KA 3ES6B 1OAYH 5L2KE 5C0AE 5ACMA 1BLNB 4JFFD 4OTXL 1OVZA 3BZEB 2FNBA 4WTZA 1VDGA 3KNBA 5C92A 2FEEI 1AJ7H 3X17A 4R90H 1JWUB 2ADJA 4HPOH 1J88A 5CZVL 1UACL 4KPHH 5DR5L 3WFCH 1IGCL 1BAFL 3UTSB 1EEYB 1QA9A 3GBNL 4NO5A 4EXKA 1XCQA 1S9XA 2O93L 3EOTH 5I8EA 3RKDC 5ADPH 4FFVD 4JFFE 3QIWB 1L0QA 3LKQA 2KUTA 1U2CA 2BNUB 3W5NA 3OKNA 4IOFD 3T04D 4H8WL 4TRPL 1S7WB 3KPRB 5F7HA 4WRLA 3PIQA 1NGZA 3AREC 1OAQH 4G8EB 2RBLA 1YNKL 3KPSA 1YYLL 4WY7L 5I15H 3NFNB 4NYLB 4WU5A 2RAMA 1F42A 3IFOA 4P9ML 1NCWL 5J3HC 3LEXA 1R0AL 1J8HD 1S7TA 5D1QA 4JREB 2VR5A 1EAJA 4HH9B 4IMLB 5ESVA 1PQZB 1DQQB 5I1IL 3AAZA 3O6FD 3AXLB 2BY0A 4OCNC 4AEHL 3BH9A 3EGSB 3SE9H 3VI3E 4PTTA 4LHQB 5DMKB 1FL3A 1XH3A 1NCDL 2VKWA 4NN7B 1J8HE 2V17H 5J8OA 1EFQA 5J13B 1QBML 4S1SL 5DGQA 1Z2KA 1LO2H 4PJEF 3ZE1F 4RGNC 1CICB 4DVRH 1FZKB 4M1GL 4PBVC 4JPIB 1F58H 1W72H 4R4ND 2EECA 3HNSL 1HYSD 5IJKA 5HI3D 3E6FB 1J05A 2ZUQC 4HV8B 4U6TA 3QQ4A 1HDMB 5HHOB 4HX1A 1I1YB 1JHLH 4LVOB 2G60H 3MLUL 3LMJH 2DWEA 5IMOA 4QXUH 2VLMD 4JPVL 2F53A 3KPLA 1WGOA 1A9BA 3BOVA 2GTZA 2CRYA 4QGTA 1ZVHA 2OTWA 3CFDB 1BEYH 3OKDA 1SEQH 4JO3H 4BSWB 1AHWA 2MNUA 4O51A 4M00A 1JBJA 4H20H 5KVDH 2Q76A 4CMHC 2KZWA 4CN1A 4APQB 2APBA 3JTSA 5GS1C 1A7PL 3X3FH 4FABL 1V7NH 4KHTL 4OJFH 3F7YB 1QFHA 4FQCH 2VLME 4U7KA 1QYGH 3OKKB 4JFQA 4BH8B 4UINH 5E24E 5E8PB 3H9SD 4G6KL 3D18A 3QG7L 3OGOE 4BH7B 4FQXC 3ARFA 2I60L 1AGBA 4XI5C 2MWCA 1FDLH 4L9LB 1NFKA 1YMMA 1LEKA 3V6OC 5CZKA 3HR6A 5GZNC 3BGAA 3MRGB 1AR2A 4I0PC 4ODHH 4X5WB 4ZTPH 1FG2A 3OV6A 1I4FA 5BOPA 4F7CB 3MRKB 4NQVB 1EHLL 1DTUA 1A0QH 5B22A 2A6DB 2P5WB 4LMQE 3FMGL 1FC2D 1P1ZA 3S37H 5ECJE 1N2RB 4QHNB 3T4YA 1MVFA 5T5NG 4FTVB 4PG2A 2Z8RA 2FEDC 3L5WA 4LCIH 5EWIH 3MRFB 2A1WL 3RP1A 4ODVH 3BT2L 3OGCB 3GO1L 4Z7WF 1HHIB 5J6HB 1TMCB 4X9BA 1X5ZA 1OP3H 1FP5A 2F5AL 1F6FB 2B1AL 1L6ZA 3GM0A 3QAZC 4NKMA 1TZGH 4UQ2A 3QIBB 4UNUA 1WZ1H 2DLFH 3DRTB 2Q87A 4DAGL 3IDJB 2CO7B 3MX0A 2B0SL 4KKAC 1YA5A 4F33B 1ORQB 1OAUH 2HT3D 3P9LA 4U1IA 2UWEF 5E6ID 1BX2B 1LILA 2YD7A 3CVIL 1XMWA 1DBAL 4ODUA 1U3YA 1UB6A 1KCRH 5DZNA 1B0GB 2BNRB 2FYYA 1PJ9A 5CMAB 1RUMH 4Y2OA 2IBZX 3RAJH 3DVNB 4MQ7A 3TBWB 3SJVA 5GS3A 5GGTA 3UCRA 1MHPL 3LKRA 4OD1L 4F3FA 2VLJB 2WIIB 1CD9B 3X3GL 1VCAA 2AJZA 1FLTX 2H2PD 3GDBA 1T22B 1KIRB 4RFNB 1A1NB 5DJ2B 1IC5L 1JPSH 5I1EH 1DQJA 4O5LL 1X7QA 1KB5H 4XNXL 4PJ8A 3MRCA 2NY3C 3CFCH 4IS6A 4Z7UA 4KTEL 3C5JA 4Y2DC 1D5BA 2GITB 3V2AR 3RY4A 3S98A 1N5AA 4TOYH 2XZCH 2XNAB 4QKXB 4QT5A 3VFRB 4UTBH 2GEEA 3EJJX 1PKQB 2Z9TA 4K07A 2NY0C 1SYVB 1A6UL 4GKSA 3O4LB 2DAVA 1VACB 1V3MA 3GSXA 3VD7A 1PG7L 4HCRA 1D7FA 1RHHA 3MACH 5EZIH 2W65A 1XR8A 4J1UB 4KK9C 5KZCD 5HYSB 2DB8A 3H8NA 3N06B 4EUPH 4NJ9H 2ICES 1ZEAH 3O8XD 1C5BH 3DMMA 4QXTB 4CVZB 3VW3H 4RMWA 3BGMA 1Q0XH 3H9HA 1XF3B 3QNYB 2B4CH 1G7HA 2ZCKL 5AAWA 1U6AL 3UPRB 2HFFA 2XQBL 5H35A 3A6OA 4GBXB 3B9VA 3AMKA 3HI6L 3NAAH 4ZSOA 3TNMB 1D5IL 1KLUB 2MHAA 1R5IA 4XPHH 3QNXB 2Z92A 4MA8H 4JY6B 3MRDB 3OR7B 4YJZL 1GGTA 3WD5H 3AU1B 4ZD3L 1DVFD 2VLLA 5AZ2L 3TVMA 4YPGA 1AO7D 4ZPTA 5I71C 4M5ZH 3E6HA 3GMNB 1H8OA 3P40A 4XCYA 1IQWH 2X4TB 5F7FA 5I19L 1QNZH 2B8OT 3SKNA 1ZSDA 1FGNH 3ARGC 2HN7A 3QFJA 3H9ZA 3BZ4A 4D9RD 1M7IB 4JLRA 4YX2H 1QPPA 1FYTD 3V0WL 1U8QA 3ESVF 1E4WL 3I02A 2A74B 2UVFA 5CFHA 1AO7E 5MHSD 5DS8B 3F5WB 4M62H 4ZMAT 5HXMA 1S5HA 2GJZA 2R4SL 2R29H 4PJ5D 1A6WH 4NPYB 3K81A 5JR1H 3MXWH 4D9RE 2Q6WB 3MLTA 1FYTE 3B9KB 4UT6H 4OZHE 2AGJH 5HHQA 4RIRA 5D2LB 4E41D 1SY6L 1I9JL 3MRIB 3EJZC 3VFWA 5IHZA 1TETL 1UGNA 2DBLL 3OAZK 2WP3T 4XCEB 5IT2L 3CC5B 4PS4L 3VXMA 4PJ5E 4X6EA 4OFDA 2BMKA 1PZ5B 2FGZA 4Y5YC 2YD4A 1NGXA 1CGSL 3UTTB 2NNAB 3CFKA 1MQKH 4JRXD 2VXUH 4E41E 2VC2L 1VSCA 3QO1A 3WNNA 5LGJB 2VWEC 4OKVB 1RZKH 5EUOE 5ILTH 2FO4A 3BUYB 4KJWD 2PO6B 5KW9L 4L3AA 2BNQA 3C6SA 3O6LH 3T0DA 2DWDB 5C6TL 3MCG1 3AS1A 3WHE0 1MCKA 4ZXBC 4PV8A 4JRXE 4DGVL 1HNGA 2M1KA 1BJ1J 2VXVL 4YZFF 4HMEA 2CKBL 4K2UL 4EI6B 3VD4A 2W60B 1UC6A 1U8MA 3RIAK 4UV7L 1WISA 5CEZL 1Z9MA 1QHOA 1AY1H 3D3VA 4XCNA 1CFTB 4OSUH 2ERJC 5F7DB 2AXJA 2ARJQ 4PJXB 4UNVA 2CRZA 4HUVA 4POYA 3QFDB 2BC4B 3SBWC 5KVGL 2EH7H 4ZYKB 4P57A 4I2XE 4L8DB 5H8DA 5HGAB 2N7BA 1A3LH 4PJFB 3R0NA 3ZE0E 5CSZA 5EOCJ 2OJZL 4S1DC 5AZEH 3T0ED 2QADB 5HBBA 4R6UA 3GFUA 1O0VA 2HVJB 3BP7A 1A6AA 2DLEA 3S35H 2H32H 2HG5B 1BM3H 3MUGB 3MODH 2ADFH 1J1OH 2QR0A 4P2RB 4ZDHA 4LARL 1NBZB 2HFEB 4WGVB 4UTAH 2OQJA 2GT9A 3ALXA 4C4KT 3QHTC 1MAJA 3T0EE 1OPGH 3VXSA 5HHPA 1DUZB 1IM9B 2B5IB 2JE8A 2MCPL 4PJ9B 4PJIA 4Y8AA 1HINL 1U8PB 3BKMH 4LASL 4N0YL 4XMPL 3VWKB 2ZUUA 2YK1L 2F53E 1UJ3C 4MA7H 1W0YT 1T80A 2CDFA 1DFBL 3PABB 2CGRH 3IXAB 3ARFD 1QEWA 5C0GB 4KK8D 5GS1A 4KI5D 4WVRA 4MD4B 5A3IC 1YMMD 3F8UB 1N0XL 4LOUD 1HK6A 3O3EB 1Q9LA 1UYWH 2YPKB 2X09A 3HC0A 4MB3A 4RQQB 1FJ1B 4PJBF 3ARDB 4FQXA 4K8RH 3QIUB 5TPWL 4U3CA 2OYPA 3EZJB 3HC3L 4GT7A 1BQLL 5EZJB 4ZUVB 4LPTA 4LVNB 2VDML 4L4JA 4XPTL 3V6OA 4KI5E 2KBGA 1UQSA 4I0PA 4OFYD 3Q1SL 1YMME 4XNQB 3DURA 3VXRA 1HXMA 1DDHB 2ZCLH 4QO1A 4YFDB 3VI4F 3L3GA 5DJYA 1MWAB 5I6XC 5DUBA 1MPAH 3B2UD 3JTTA 2CMRL 4G6AD 4AYFA 1WBYB 2BOBA 1PBYA 4XX1E 3GMRB 1GZPB 3DXAA 3DETC 2VDRL 4MNQB 3MV9B 1FIGL 4M93C 5B39B 4YQXL 3GBML 4FQ2H 5D2NE 2IQAA 2ESVB 1QBLL 1G7QB 5BXFA 3TJEL 3O9WC 1WAAA 3BP4A 2CQVA 4AQ1B 3SJVD 3S97C 1N3NA 3EYQC 5D71H 3RPIB 4XNZC 3LS4H 4MQXC 3B5GA 1NEZB 4JFXA 5ENWB 3RVXC 3VFNA 4FXGA 4X98A 1SJHA 4OM1H 4HS6B 2FECI 3MYJA 3DROA 5HDLA 1SEBA 4OV5A 4JFHE 1JGLH 1UWGL 5CLTA 5JOPD 1WITA 3BP6A 5DDHB 4HZAA 3D2UD 4FS0A 3LN4A 2LV4A 4C4KO 4ETQA 3SJVE 4LPVA 4MJIB 2CUIA 1FCGA 1RZFH 1ZOXA 5IFHL 4RRPG 1B4JL 3UP1A 1QRNB 5GS0L 5D6DC 1I8IA 2DJUA 2HFGL 4UDUA 3BHBA 1JIBA 4L8BA 3RJQB 4CNIB 4JFOA 1V7ML 1Q1JH 2AK4B 5JOPE 2CXGA 1HIMH 2VO5A 2ZPKH 5B8CC 5KVEH 1JZ6A 1KPRA 2IGFH 3OKMA 5GSRB 4Y2DA 5EU3A 4F2MB 4N68A 5JOEA 4LSSH 1KF9B 4P2OB 1AE6L 2D31A 3TM6A 1NCAH 6FABH 1S9VB 3ZSSA 2CKBB 4ZOAA 5TE6L 3O6MH 5LWYL 4LSVL 4GAGL 2DIJA 1A1MB 4M8QB 2OL3L 3RVVD 5F9JB 1GGUA 1NC2B 4DKFH 1DL7H 2BRRH 5ADOH 3DMMD 1F6AA 5I9QC 1EZVY 4EI5B 3ULVL 5IB5A 1FL5B 2IH1A 5GSVB 2A83A 5ESAA 2OR9H 5T3ZH 1KJ3L 4GRWB 3QRGH 4LDEB 4NKQB 4TTDC 1I3RA 1OP3K 3TPUB 5BJTB 3GSVA 2QEJA 4Y4KA 2FJHB 3GSRA 2BRQA 3INUL 2R56H 1HILA 5J11C 1ITBB 5D1ZB 1NQBA 4HKXB 4N8VB 3G08A 3SKUD 4KDVA 3U9UB 4WFHD 3HPLB 1ZLVK 3BPNC 1U58B 1NLDL 2NY5H 1OM3L 5D96B 1RZ7H 3OB0H 4JAMB 3G9VA 3AFLA 4GRLA 1CFVH 4K7PL 5HJ3B 1F4YL 1L9MA 2X41A 3O3AB 2DI8A 3OHXA 3OKYA 3BIKA 1BD2D 5MEPA 3CZJA 2AK1L 4LU5H 3I85A 3GB7A 4JM2C 1ACZA 1OQOA 3QO0B 2WZPD 3IDNB 4Z7VA 3MNWA 1Q72L 1J0YA 4OF7A 5LAXA 4D0BB 1WIOA 4HFWA 4A6YB 3KYMB 3P2TA 2GFBA 1NCBL 4OCXL 3DUHA 5E00A 4BZ1L 3IJHA 4PP2B 3JWDH 1JRHL 1BD2E 4G80B 2I07A 3T65A 3RTQD 5GJTH 3WXWH 4HXAH 3S88H 3ZYZA 3TLRA 1CDYA 2AXHA 4NWUL 5GRJH 5JW5B 1AR1C 4BFBD 2PTVA 5C9KA 5CJOL 5DQJB 3VFGH 3IDXH 1X5YA 2AJYL 2JK5A 3VXMD 1NAMB 1FNGA 4HK0A 4MXWH 3Q0HA 4QRPA 5GHWH 3D6GA 4DW2H 3UYOD 2HKFH 3MV7D 1JWSB 2QTEA 2FH8A 1W0VA 1OSZB 2Z8WC 4JKMA 4LLDB 3VA2C 2H32A 4YO0B 3VD3A 1PYWB 1XR9A 4P23C 2VXSH 3M17A 1ZGLM 1U8OA 4NN6C 2NX5A 1HEZB 3KPQA 1BECA 1JGUL 5GIRA 3VXME 2P8MA 1KSRA 3MFFA 1DN0B 1HXYB 3PV7A 5ALBH 1IGTB 1VGKB 5LBSL 3PJSA 3MV7E 1YEEL 5CBAA 5DD5H 3NMEA 4XNXH 2X89A 1NGWA 4NQEB 2ENSA 3IS1X 5FKAB 1CBVH 4R0LB 5EC1A 4JFEB 1H15B 2WW8A 1BBDH 3P4OA 4JY5L 1ZA6B 3PGFH 1NMCC 3WSQL 1I9IL 2XWJA 4ZXBA 1RK1A 4U6YB 1EFXD 5LGKA 5EULV 3BYYA 4YXHH 3OSKA 2QHRH 4NNYB 4O2CB 4G7YH 3FQUA 4NQSA 4U05A 4X8JB 3BE1H 4QXGH 4OCWH 5IB2B 5DFVD 3WIIL 3O4OB 2VABB 3VFSA 3A6CH 4JO4L 3MNZB 2J3SA 5SWQB 3EYVA 5DC4B 2OSLA 2PKDA 4IRZH 1KJMA 4KQ3H 1MCOH 5IOPB 5DLMH 4GG6B 4HXBL 1CDGA 5C0IA 3TT3H 1D5MA 5D8JL 3HLAB 3SBWA 2DQTL 1DLHA 2VOTA 2GSIA 3VGAC 3G5VB 1KIQA 2P48B 4NC2B 2R9HC 5I74C 4JQIL 4HKJB 4AIOA 2H26B 3K4ZA 4PGEA 4J12A 5MERA 5E0QA 2KDGA 4NZTH 3QUKA 1K4CA 4NO0A 2EDWA 4YDVA 5TFSH 1KPVB 1OTSC 1MLCB 5JOFA 5I1LA 4D0CB 1BFOA 2Z4QA 1NC4B 3BO8B 1FVEA 1YEFL 4OAWB 4H0HB 4XC1L 2GAZB 3K8KA 5E2JA 5D5ME 3SGKC 3HI1A 5L88L 4I4WB 4M61A 5FYKL 4KJPD 2DBJA 5F7LB 4F7PB 3QQ3B 1NGQH 2GJ6B 3FAWA 1UWEH 1D5ZB 2ZG3A 3N85H 2B20A 3WL9A 5DVLA 4DZ8A 4LLUB 3GBLA 2C5DC 4NQXB 1KJ2A 3BZFA 1XGPA 4BFGA 3TBTA 1FH5L 3ZKNC 5IFAH 4RRPA 3F7QA 2W0PA 3VWJC 2D4FA 3VXOA 1ORSB 4XAKD 1AGEA 4ONOA 2Y07L 4BZYA 3MREA 4PD4K 3P4NA 1JPGB 1LO4H 2XYCA 4FXKB 4P46C 1MCPL 5GGRB 2R2CA 1RMFH 3JWNC 5D7JC 4ZFOB 5BV7H 1S7RA 4MDIA 2WV3A 2NQCA 3KJ4C 4X6BA 1DBBL 4M7LH 5KANG 3WO4C 4IEFB 4QNPE 1G9ML 4TULL 1T1XA 4P9HH 3ALWA 1UZ8B 4TVPL 1ES0A 4KUZH 1T4KB 1JNLH 5LGHH 4XAKE 1LO5A 4KJYB 2YD6A 5CWSB 3L7EB 1H5BC 3VMPA 5KS9F 4NP4H 3IF1A 4M3JA 5B3NA 3U36A 3EO1B 3WFHA 3TCLB 5BMFL 3WIHH 1AKJA 5F9AC 3R0MA 1A7RL 5C7XH 3P0YL 1T2XA 3RDTD 4JRYB 5CIPA 3MRQB 4JJHA 1F4WH 4QXWA 1CR9H 5FF6B 4Z7QE 4Y0GA 5J57B 4WO4A 5KG9B 3O9WA 1QKZL 3CZFA 4HHAA 5HGBA 1WWWX 4JDTH 4LAQL 4X4XA 4OQTH 3ROOB 3VRJA 1CK0H 2AJVH 1YUHA 1H3XA 2O5ZL 2XKNB 5A43C 1SMOA 3OJMB 1F8TL 3I6GA 4OD2A 3PHSA 1T2QL 4G42A 4X7SL 3WUZA 1YY8A 3RZWA 4EIZC 2EO1A 2WQRA 2CDGB 5FYKU 1JI1A 2HLFC 3MA9H 1QUNA 5D6DA 3TBSB 2VAAA 4HQQL 5E6ZA 4JKWA 4O2FB 2QV2A 4RMQA 1TQCC 3UXFA 4NZUL 3RNQA 5B8CA 4X5LA 1DBJL 3N1GC 2JELL 1MCDA 3Q6GH 1RIHL 4MAUH 4PRPB 4G3YL 4BSVA 2MQ0A 3QXWA 4Z7UF 3F12A 1GOGA 3FQRB 1ULVA 4NZDA 5JMRA 5ANMB 2YA0A 2CK2A 4KKNA 4X4ZA 2NZIA 4Y4KD 4MD5B 4KFZC 2WAHA 1XGUB 2ID5A 2ZUYA 4JREC 4PJDA 12E8H 3WFBH 2AJUH 3MJ7B 3U46B 5DYOB 2O61A 4LF3A 3U2SA 4O9HH 4PTUA 4JFPA 4PJAA 5F1IA 2EZ0C 1MJ8L 4LVEA 3TYFA 3GI9H 2RCSH 4KRLB 5EA0H 1FAKT 1S9YA 4LCWB 5J13C 1FC1A 2JB5L 4PRHB 3QUZD 4GRLD 3EHBD 4OLWL 5EFIB 2QQQA 4N0RA 4PG9A 4ODWA 5I17B 5AAMA 2JB6B 1GZQA 1X5GA 1NGYA 3QXVA 2FJGB 5MI0B 5KVFH 1U92A 4P5MB 1FGVH 4J3XA 4EN3B 1T21A 4JB9L 1S78C 2ADGA 1MHEA 1F3DH 2AJSH 5GGRY 1PAMA 2FATL 3V7AG 4QYOB 4X6DA 4OCMC 3RI5F 4HT1H 4JM2A 5CINH 4LVOC 4XB8A 5C0AB 1CIUA 2ZG1A 4HGWA 1ZANL 4Z7VE 4ELMF 3O2DH 3DWTA 2AEPH 5INCA 3WXVL 1MRCH 3O0RL 1JGVL 4KZEH 3WJLC 4TUKL 1CT8B 4D3CL 2Y36H 1U3HA 1EUUA 4OLVH 4ZOCA 4QOKA 3WCYA 1IEAA 3PWPB 1Q8MA 4APQC 4BFIA 3QZWB 3LEYL 1ZGLA 4R26L 1AFVH 4C56A 4PGCA 4ZUTA 4LLYB 4B50A 1I1FB 2IAND 4YAQB 5FO9B 3HUJA 5F6HJ 3I3DA 4C55A 1RIVL 5IBLD 1GC1H 1YEGL 5IHLB 2R0ZL 4L9LC 3MRNA 2IJ0C 3SDYL 3WFDL 1U91B 2V9RA 4P23A 2AKRB 4D9LH 3PL6D 2D7TH 3W0WD 3S36X 3DIFA 2FX8L 3CVHB 4OZGA 1T5WA 3DSFL 2IANE 5AD0B 1SM3H 3GHBL 1P9MC 2XTJB 2SEBA 1BBJB 1A2YB 1NBYA 2W9DH 3OB0K 3NABH 3P0GB 3HE7B 1J1PL 1R5VA 5HYQB 3NPSB 3T09A 3M8OH 1JZ2A 1J1XL 3E3QC 1J8HB 4K23H 3BDYL 5F7EH 3RUGB 3FOMA 4YBQD 2HVKB 3CFBB 4RAUA 4MA1B 2I25N 5F1KC 5I18H 4V2CB 5IBUG 5BW7C 4JG1L 3VGBA 2EIDA 1QSFA 1S7QB 5ISZD 3EJYC 1ERNA 1ZA3B 2E27L 3MMEB 4K8RD 4OZ4A 1D3CA 5FOBB 1X4ZA 3O6FB 4IIQC 1AD0A 1XIWB 3QIBC 1P4BH 3KPPB 4NHCL 4U6XA 4IDJH 4GAYB 1XCTB 5FM8A 2VLKA 5FHAH 1ACYL 3EFDH 2ENYA 5DSCA 5CBEB 4Q6YA 2V7HB 3HFMH 5I2IB 4HS3B 4GAFB 3DYMA 4DFIA 3QEHA 4P3DB 4MGXA 4WI4A 5ISZE 2R0WH 4G6FD 4L3EB 3SGJC 3SY0B 4KMQA 1BFSA 4OD3H 1Q94B 5GGQL 1WUNT 3SKMB 4HIJA 5C0CD 1AGCA 3V8OA 5BVPH 3LV3B 2VXQL 4GAJH 4HIEB 4RGOH 3LDBC 3WIHA 2X4OB 1RU9L 3QDAA 4FMKA 2MMXA 4J8RA 4QEGA 5JDJA 5T5NF 4JRWA 3N0PB 5DMJB 2ZCHH 5BOZG 1JFQL 1PLGL 2PW2A 2W38A 1MCQA 2WINA 5C07D 4Q9QH 1N7MH 5C0CE 4WENB 1B6DA 2ADIB 1OB1A 4NBZB 4ONFH 2ZZUT 5ETUB 2ZSVA 5KSUA 3SGKA 4H26B 5FKPB 4DK3A 1MREL 5TDPB 1MEXH 5H37H 2AXGA 3HS0B 4NRYA 1MI5A 4MSWB 4ONHB 2C1OB 2GK0B 5E99L 1HSBA 4PJIF 3P73A 3H9SB 2J8UA 3PWUB 1AIFA 1GIGL 1A8JH 2ED8A 1C5DB 2J88H 3NIGE 4ZG1A 3C09C 3W81A 2X4SB 1RFDH 4OCLC 2EIZB 3HPJA 5FYLL 3WE6B 1NSNL 2DD8H 4V2BA 4JPKL 2BSRB 4P4KC 5D9SB 4P46A 3R1GH 5CUSH 4DWHA 5K59E 5HHVL 5D7JA 3I9GL 2L4OA 5IK3B 1JZ8A 5D6CB 4X4MA 2UZYB 1EGJA 1E6OL 4OTXH 1HNFA 4QRSA 2IADB 3RWIA 5B38B 4GBXC 1L7IL 3S4SA 4CDHA 2IALB 1MRDL 3GIVA 2XRAL 4YBHA 5JNYB 2IEPA 1UACH 5DR5H 1IGCH 5DHYA 4KRPB 3GBNH 5DMIH 5EUKA 3AY4C 2P45B 3MA7B 3DTXB 4UB0L 2YPLA 3FB8A 1NEUA 4EZMA 2XKUA 1F00I 3H7BA 4WO4D 4YHYB 4H8WH 3RGVB 4BQBA 1Z6JT 1BOGA 2VL5A 3FOLA 4QHKI 5E6IB 4HWZA 1YNKH 1YYMH 1Z9OA 4KMLB 3UZVB 1YYLH 5JXAH 1WLHA 1NMBL 1J7VR 2DTML 3QXAA 2HH0L 3MBXL 1CLZL 4GJTB 3CSGA 1JN6B 1NCWH 4P9MH 1LP9A 1R0AH 2EICA 1YEJL 4WWKB 1DEEA 3L6FA 1QSEB 4PP1D 2BHZA 1AI1L 3V5DA 1BGXL 5I1IH 1WAAF 2FIKB 4TSAL 3KXFA 2Q8AH 4JHBA 5EIVA 3ES6A 4K94L 2R0LL 4WW1B 2EDHA 5C2UB 3LY6A 3HE6D 1BLNA 4LRNL 1NCDH 2MCG1 1MJUL 4P3CH 1QBMH 1KYOJ 1ZV5A 4S1SH 4N0UE 4ZAKD 2AQ1A 1A7NL 3UTSA 3TA3D 1EEYA 3P11L 1WWBX 1MF2L 4I0CC 3I50H 2X1WL 1YPZE 3O2DA 4M1GH 3SEPA 3QIWA 1L6XA 4JZNA 2PO6C 3DJ9A 3HNSH 5DQDL 3B8YA 1S7WA 3BH8B 3KPRA 4YHKH 4S11A 1HI6B 4G8EA 4L8CB 3ULUC 3TH2T 4K3JH 1PVHA 4JKPL 4CU7A 3NFNA 4NYLA 1Y0LB 4JPVH 4OCYH 4U1KB 3GEWB 3O8XB 1CGXA 3TC9A 2R2EB 4IMLA 5JUEL 1BPVA 3TEUA 1YN6B 3F58L 1DQQA 1DANU 1FIEA 1N6UA 2ZJSL 5JW4N 1EEZB 4ACPA 1MAML 5KSVB 2WBJD 3AXLA 1FNSL 4WTWA 4RX4A 2PYFB 3EGSA 3FO9B 3TZVB 4FABH 1A7PH 5IWLC 4KHTH 1URLA 4OZFB 3RU8L 3DX9B 3UJIL 3ARQA 5FHBL 4G6KH 4EDWL 5E6YA 3QG7H 2X4NB 4AZ8A 2BZDA 1G6VK 5K9OA 4NO3B 1DVFB 4OFPA 1AO7B 5CZXC 1FZOB 5JHDD 2PXYD 1FZKA 4HUXB 1NL0L 4JPIA 3J7HA 3KWWB 3MLXL 3ARWA 1IFHL 3RZCC 1P7QB 1P7KB 3DRQA 2DQDL 3PDDA 2XA3A 2FX7L 3E6FA 1EHLH 4HV8A 5HHOA 1FYTB 1I1YA 4H1LB 3FMGH 2BP3A 4OZHB 4S1RL 4N0CC 1U3HD 1JZ3A 4LIQL 5JHDE 3OB8A 5FECB 1J0ZA 4RZCB 1A6PA 4PJ5B 3MLSL 5E4EC 2A1WH 2ZUXA 1KEML 3VWKC 3BT2H 2F19L 3GO1H 3VXNB 5FUCC 1MFCL 5DJDB 4IHOB 3CFDA 1F97A 4M6AA 1FZMB 3K74B 2B1AH 3OJVC 3FFDB 2CLVB 2Z35B 2UVEA 4DAGH 4OI8A 4JCMA 3UJTL 1NCCL 2B0SH 5M7QA 3K2MC 4APQA 4KJQD 1CI5A 5EUOB 3F7YA 3DO7B 4PJ7B 3OKKA 4BH8A 1S7SB 2KL6A 4MXVE 1F13A 5E8PA 3CVIH 4MXQD 1K5NB 1DBAH 2ARJB 3ARDC 4BH7A 3QIUC 2IAMB 2MSPA 4UU9B 5F44A 5CS7A 3HUJE 1JTTA 4L9LA 4OD1H 4PLOB 3MRGA 3LQAC 3OKOB 3X3GH 3ARPA 4X5WA 2J6EL 4XBEL 4F7CA 1CXEA 3MRKA 2OTUB 3D85D 1P9MA 4OCSL 2A6DA 3ZKQD 3PDGA 2P5WA 5GS2D 3CFJB 3X13B 2BSSB 4O5LH 4Y5VB 1OLZA 1N2RA 2HTKC 4QHNA 1OCWL 4OQ1A 1QFOA 1Y6KR 2BOCA 2R2HB 3NCCB 4FTVA 2K3TA 3ZZ1A 4QWWD 4KTEH 3MLZL 5J12C 4M7LT 1D6EB 4NDMB 1B4RA 5BS0D 4I2XB 2DTSA 3MRFA 1AQKL 4PYHA 3VRIB 5IEHB 2ED7A 5BW7A 1HHIA 5EPMB 5J6HA 3CX2A 1HWHB 1GGYA 1QP1A 5HGGS 3SDAD 3OKEB 4FZ8L 4IIQA 5I8OL 4JZOB 3QIBA 3DBXB 3DRTA 3IDJA 5TQ2L 2P47B 1ORQA 5IVOA 1RULL 4EKXA 3NCYP 1KCUL 1BX2A 5HPMB 1DE4B 5DI8B 4W6YB 4G7VL 1A5FL 1B0GA 2BNRA 3T0EB 2RFXA 5CMAA 3BSZL 3SGJA 1QR1A 1I7RA 3C60B 3TBWA 3NACL 3GNML 1PW3A 5AYQA 4ALAL 3GK8L 4DOHE 5DUML 3MV8D 2VLJA 2WIIA 3KYOB 3S3JA 4CMMB 3JV0A 5AYUL 1T22A 1KIRA 1A1NA 1U6AH 5DJ2A 4CVWA 3CSPA 2XQBH 1IGYB 1B0WA 3REWA 1D5IH 3LB6D 4YLQT 1MNUH 1A02N 3P9MB 1N26A 2GITA 3MV8E 1I1CA 3CX5J 2EIEA 1UM5L 4ZD3H 1ZT4B 1OW0C 5AZ2H 2XNAA 3VFRA 5CD5D 2IFFL 1MWAH 3QCTL 1PKQA 4ERSL 3U0TB 1SYVA 5I19H 4IMKA 5EBLB 5GGVY 3CLFL 5A40E 5BZDB 3PHQB 1V3KA 2NY1C 2FX9L 4V1DD 4Z0BH 3V0WH 3O4LA 5DVNA 4X0KB 3ARBC 4EI5C 1VACA 3D39B 1E4WH 3V5KB 1VFMA 5IJVB 1K8DB 4IOSD 5FYJU 3V4VH 2J8UE 4NN5B 2R4SH 1UCTA 2NY2D 5B39G 2Y25A 1LWRA 5D1ZC 3ZKMD 4CVZA 4QXTA 3IRZA 5IB4B 1I8LC 4YK4B 4P4KA 2NY4D 4V1DE 1XF3A 3QNYA 3D87B 4W70A 2E7MA 2ED9A 4DJMA 4LCYB 1T1ZB 1SY6H 1I9JH 2P8LB 1MFBL 5D96C 1G7LA 4BKLB 3KYNB 1TETH 2UV3A 2DBLH 1U8LB 1WBXB 5IT2H 2GIYA 4KKLC 5KTEL 1HOCB 4GBXA 1NEZG 4X4ME 4NM8L 3TNMA 4PJGE 1KLUA 3AUVA 1OWRM 4WUUA 1JPFB 3QNXA 1CGSH 4JY6A 3MRDA 3OR7A 4Z77B 4WW2B 2NYYD 3AU1A 4OLZH 4AG4L 3AY4A 1WK0A 1X5IA 3B2VL 3BFOA 5DHXB 5DJ8B 4M6ML 3GMNA 3BQUD 4M6OL 5SWSB 5D93C 5KW9H 2BCKB 2X4TA 3DGCR 3W2DL 2IWGA 2BVYA 5FOJA 3CFEB 1C5CL 4KKBC 5C6TH 2PNDA 5ELIA 1W8OA 3RBGA 3CH1B 1M7IA 2BHYA 3I75A 2A74A 2DL9A 4DGVH 1C12A 4XT1C 2VXVH 5DS8A 3F5WA 1UM6L 2CKBH 2XA8H 2OLDA 5I73C 3D9AL 5CP3H 4EDXA 3D2UB 4NPYA 1CLCA 1LP9E 3LQZA 4UV7H 3NIDE 1QO3A 1Q9OB 3NFSL 5CEZH 2Q6WA 1X44A 2ZUSA 3RWFA 3GJFB 1PG7X 4MQTB 4LPWA 5D2LA 2FSEA 3MRIA 4GRWH 1QVOB 3UTSD 3MSPA 4CADA 2LU7A 1RZJL 4XAWL 3B3IB 4XCEA 3CC5A 2R8SL 5KVGH 3QPQD 2HT4D 3QIWD 5BVJB 1PZ5A 3O41B 4RFEB 4P5TC 2F5BL 1WWCA 4XNUH 4BQCA 4NFCA 2AV1B 2HJFB 2OJZH 1G7JB 2MTPA 2NNAA 3UTTA 4XNMB 4B53A 1V3LA 3U6RB 3ZDXE 1LE9A 4N8VG 4KC3B 4MWFB 3UTSE 5LGJA 4MMXC 4OKVA 5D1XB 3BUYA 2PO6A 5CGTA 2WNGA 1QFUL 3DI3B 1UEMA 3GMLB 4LARH 3VGHA 2DWDA 2I5YL 3NCBB 3P4MA 4Z5RB 4NFDA 5C9JB 3LD8B 2Q7YB 2IPKA 2XFXB 3GIZL 2YD2A 2MCPH 2VZ3A 2BDNL 2W59A 2A0LC 1FPTL 2CJUL 2W0KA 3IXTB 4EI6A 4EQ2A 4R97B 4XMLL 1HINH 2W60A 3N9GL 4LASH 1G7IB 4A6YH 4N0YH 4XMPH 1PX3A 2YK1H 3O4OC 1RQ5A 2GY7B 1DFBH 4PJDF 5EBMB 4ZODA 1CFTA 5F7DA 4PJXA 3UYPA 2NR6D 3M1BB 2JCCE 4FQHB 3QFDA 4XVUC 3Q6FB 4MVBD 2BC4A 1CICD 1N0XH 4PJAF 4ZYKA 5T1KD 2DMCA 3HC4H 4POZD 5HGAA 4PJFA 4K3GA 3TN0D 1NAMH 1HHHA 5TPWH 1BD2B 5ALCL 3HC3H 4YHIB 1ZS8B 4J7RA 4Z18A 5HHOD 1BQLH 2GQHA 2HVJA 1KEGL 4XP6L 4XPTH 4XCFL 3UYRL 5L6YL 2HG5A 3B5HA 1KN2L 3Q1SH 4QRUB 3MUGA 2DKUA 3LKNB 1YDPB 3LAFA 4P2RA 4PLKD 3L1OL 1NBZA 2HFEA 2R23A 1TENA 2CMRH 1DUZA 1L0YA 5FAAA 3MOAL 5HHOE 3CCHB 3RTQB 1X6NA 1SYSB 4HDIB 4PJ9A 5T3XL 3HCVB 4X6DF 3O2WH 4KRMB 4JM2F 3VG9B 2VDRH 2Q20A 4LSDA 1U0QA 3CAFA 4IRJB 3VWKA 2C26A 5I1HL 3KPMB 4YQXH 3E8UL 1DBML 1TNMA 1I1AC 1QBLH 3WFEL 3PABA 1CF8L 1ZHBB 4R4FL 3EAKA 3DV6B 1PDKA 3PWVB 3TJEH 5DD6B 4JANB 5C0GA 3NVQA 3GKZA 4MD4A 4XPBL 2W92A 4S10A 2AJ3B 5IQ7L 3O3EA 1Z9LA 1NDMB 4AMKL 2X70B 5D7LD 4RQQA 3ARDA 4PLJD 3QIUA 2OR7A 4JFDB 4B5EA 1EMTL 5CEXB 4YDIL 1MHCB 2PN5A 3ARED 5EZJA 4ZUVA 1YQVL 3BPLB 2GCYB 4XCCL 4YNYB 3MLVL 3IDYB 3QQNA 4FTVD 3JUZA 4XNQA 5FEBA 3VE0B 4MHHI 1YZZA 5IFHH 1DDHA 1NGPH 5D7LE 2EDOA 1EUTA 3HR5B 3OR6B 1B4JH 5GGSB 2QHLA 1MWAA 5GS0H 2HFGH 1QFWL 2EYRB 3KYAA 1V7MH 1EFXB 1MFEL 4M43L 4OZGF 1WBYA 4Y16B 4DEPB 5D70L 5KAQG 3CSBA 3FO2B 3GMRA 1GZPA 4S0SD 4AEIH 4MNQA 3FJTA 4FTVE 1ZVYA 3MNVB 5B39A 1T03L 1H8NA 3K2UL 4P2QD 2XPGB 4M02A 1TCRB 2R69L 3EYOB 5ICYB 5DGRA 5TE6H 2ESVA 3STLB 1AXSB 5LWYH 4LSVH 4GAGH 3U9PH 1G7QA 4ZNCD 3U7WL 2OL3H 2BNRD 1Q9WB 1UKTA 3RPIA 1T6WA 3ULVH 4I5BB 1NEZA 1RURL 1KJVB 3U4BL 5ENWA 3IJSA 4F9LC 4HS6A 3INUH 5F93C 4UT7L 1LE5B 5D5MB 3KHQA 3QUYC 5DDHA 2BNRE 3L3JB 1GGCL 1RSFA 4OI9A 4XC3L 3X12B 3A0OA 4PV9A 5TDOA 4MJIA 4YR6B 1CFQB 5J1AB 2VLJE 1NLDH 1IBGL 1OM3H 1L4IA 4P2CG 3SE4C 1QRNA 3VFOB 3F65A 1BREA 4S1QL 5HI5D 4CNIA 1P7HL 4FQJL 1YECL 2AK4A 3MGAA 1MIEL 4K7PH 1GSMA 4JO2L 4NT6B 5GSRA 2ZKHL 5SV4A 1M05A 5CCKL 1G9NL 1JPTH 4P2OA 5DUPL 1U8HB 2AK1H 4EOWL 4M6NL 1OW0A 2GTWB 3PF2A 1S9VA 1XFPA 4MZ2A 3EKCA 3Q2CA 4LLMB 1R24B 5C0EB 2EDQA 4Z7NE 2CKBA 4O58L 2P46B 5ICXB 5CJ8A 5CP3A 1A1MA 4UQ3B 5F9JA 1NCBH 1NC2A 4OCXH 1AGDA 1KB5B 4XI5D 1RJLB 4BZ1H 2I24N 3ARBA 4ODXB 4EI5A 1FL5A 5GSVA 4PJCE 4NBYB 5IW1B 4Z7WB 4KK5D 3O4LE 3QQ9C 1ND0B 3HAEB 4R8WL 3TPUA 3LOWA 3ZTNL 3QDHA 4MQSB 4NWUH 4WEMB 5BJTA 2FJHA 3QDJD 4X7FC 3T1FA 5CJOH 3LN5B 4HBCH 5D1ZA 4HKXA 2AJYH 4N8VA 1I8LA 3LPWA 5DD0L 5EORL 1B90A 1OLLA 1MCFA 4EBQL 3DECA 3U9UA 3TPKA 5J0BA 3HZKB 5MI0C 4NQUA 3RVTD 2XKSA 5FM4A 4JAMA 2DJ4A 4YDLB 4G6JL 4XMKL 2QSCL 1XZ0B 4EUPB 1AXTL 1BZ9B 1ONQB 3TYGL 3O3AA 5DXWA 3RDTB 2DLHA 5HDOA 2FLBT 2VDOL 15C8L 4LBEB 3C6LD 1K4DB 1MUJB 5LBSH 3ZYIA 4HKZB 4HJGB 3QO0A 3IDNA 1YEEH 1TTUA 1GGBH 3RY6C 4F8QA 2Y5EA 4XTRD 3V7MA 4D0BA 2FZ3B 4A6YA 3KYMA 1T83A 3NTCH 4JY5H 1EXUB 4EVNB 1CDBA 4N0FB 3WSQH 4KAQH 4PP2A 1I9IH 4Y19D 3RY5A 1KLGB 3D69B 3UAJD 1FG9C 3B9KD 3G5XB 1T89C 3QG6A 3CMOL 4ZTOL 2XN9A 2EXWD 3L95B 5T1LB 3MBED 5DQJA 4XZUB 3PWJB 4JO4H 1NAMA 2EE9A 3K8LA 1DANT 2D7PA 2P43B 1MH5B 3OTTA 2YD5A 3FQNA 1HHKB 4LFHD 5F6IB 1JWSA 1NUNB 4U1JB 5DK2B 4HXBH 1UB5B 4L4TB 4LLDA 3KJ6L 5D2LE 2W9LA 4YO0A 4Z95L 4FFVC 5D8JH 1PYWA 5EU7E 4U3HA 2DQTH 4H25B 4P5TA 3WO3B 1HEZA 4IOFC 1FO0L 5T33L 4LEOB 5I0ZA 5I1CL 4JQIH 4YEEA 4DCQB 1A3QA 1IGTA 1T5XB 5HGHB 2DF3A 2BX5A 3NPSC 4HS8L 4NQCD 4NQEA 3VFVB 5FKAA 4AK1A 4JFEA 1H15A 4HUKB 1ZA6A 4MA1C 1YEFH 2P4AB 4XC1H 5C8JB 4LKCB 4KXZH 4U6YA 2AXFB 1FL6A 3O6FC 5L88H 2HRPL 2CK0L 3VJ6B 4WFGD 2YS4A 4NNYA 4O2CA 2C4XA 5A2LH 3H0TA 3L3OB 5L7XL 4LAJH 4X8JA 1UZ6F 5IB2A 2VABA 3QUZB 3R8QA 3MNZA 1KN4L 2EYTB 1NMAL 2LAGB 1P5VA 4HIHB 5IOPA 2DQJL 2G2RB 4GG6A 4WFGE 3FO1B 3UO1L 4LHUB 4XVSL 1FCCA 2Y07H 4PJXE 3EYUL 3TJHD 2WLYA 4R4NC 2LTQB 1FFPB 4I3SL 5J9PB 4Q6IC 1HYSC 3ZYJA 4HWBL 3X14B 5CJQH 3G5VA 2PR4L 2A2QT 5AWNL 5HI3C 3V6ZB 3QZWG 1DBBH 4HKJA 4YDKL 5B4MD 1NFIB 4PJFE 3W5MA 1LK2A 1G9MH 4TULH 4ISVB 1WFUA 4NSKB 4LSPL 3Q3GB 4HIIB 1B2WL 1UA6H 1IM9D 3RIFK 1KPVA 4N9GB 4PJ9D 1MLCA 5F9OL 4JVWA 4RBPK 1MY5A 4D0CA 2A9ML 3BISA 3HMXL 1NC4A 3GRWL 3BO8A 1QACA 4OAWA 1QQDA 4P2RE 2GAZA 3WKML 5BMFH 3S8WA 2NXYB 5E9DB 2AV7B 5JA9A 3VFPB 4I4WA 2VRAA 2DQEL 1A7RH 1J9CT 3QCVH 5I1GL 3P0YH 1OD7A 1QSZA 2VDNL 4U1HB 3QQ3A 2GJ6A 3PHOA 4MLSA 3GM8A 3H2WA 3T4AB 4Y1AA 5I1DB 1KG0A 2EEDA 4NBXB 2IANB 3QA3B 4LLUA 3RNKB 4NQXA 4EEEA 2H8PB 3ZDZF 1QKZH 4MNHB 4I18B 2C1PB 1ORSA 2FRGP 3W9DB 4WHTA 4Y4FD 1KIPB 1JYXA 2J5LB 1I85C 3C2AL 5I75B 5E5MA 1JPGA 4FXKA 3W0WB 3NA9L 2IFGA 5GGRA 4FA8A 4F57L 2J4WL 2O5ZH 4ZFOA 1HHJB 5DRWB 5IM7B 5TDNB 1F90L 1H3WM 1K2DB 4XVTL 1F8TH 2XY1A 2VE6A 2DLGA 2DQHL 3ABZA 1T2QH 1G0DA 2OZ4L 1SMAA 2IPUG 3L5XH 4X7SH 1T4KA 1LNUB 4XWGL 5EBGA 4YHMH 3WYRA 3BW9B 4Q9RH 1MCWW 4KJYA 5EOTB 1VEMA 2YRLA 3L7EA 2X10A 5CWSA 3T3ME 3MV9D 1YY9D 4HQQH 2H9GB 3TCLA 5ISZB 5IEKB 3FT3B 4NZUH 1U2HA 2ESVD 3GSOB 3AB0C 2Y06L 1DBJH 4YHYC 2AW2A 2JELH 1RIHH 5DEZA 4JRYA 3MRQA 5JMOC 1YNTB 2HT3C 4G3YH 4RGMB 3OJDB 3V0VB 4MNQE 3MV9E 1KTKE 4L5FL 5FF6A 5CHNB 3QI9D 3F6LA 2B2XL 4OGZA 4G6FB 5KG9A 1VFBB 2E6QA 1FRGL 1H3GA 5C0BA 2ESVE 5IW6B 4QHLA 3MXVL 4I48A 5DHVB 3G6AB 5ABDE 3Q5YA 3BD4A 7FABH 5C0CB 2Y7QB 5ACZA 2H2PC 2V7NB 2H3NB 4F9LA 2XKNA 2VB5A 1MJ8H 3H3PL 1QLEL 1R3IL 1VA9A 4N90D 3QUYA 1I3UA 5SX5K 2F8XC 1FO0B 1GHFL 2JB5H 3UEZA 2AK4D 2A9NL 4CDGC 4OLWH 3ARTA 4NM4L 4Y89A 5C07B 1ZLUK 2CDGA 3CK0H 1FFQA 4PJBB 3SE4A 4P2OD 1YEIL 3HB3D 3TBSA 3CSYB 3BESR 2CRMA 1JYWA 1MCLA 4N90E 4O2FA 5F72S 4JB9H 1RY7B 5EO0B 1C08B 2AK4E 2APFA 2FATH 3IGAB 2X7LB 5CEZD 2VLRB 4PRPA 5HI4D 3NFPB 3FQRA 2EDBA 4OBRA 4GW1B 5ANMA 1ZANH 3I6LD 4HFUH 4ZUSB 5MEOB 3WXVH 2PTTB 4DZBB 4MD5A 4QY8B 3O0RH 1XGUA 3FZUD 1JGVH 4TUKH 2O5YL 2CR6A 2WWKO 3QEQB 4DTGH 3O8XC 2P5EA 5DYOA 3U46A 4WHYG 5JO5B 4D3CH 4D8PB 4LRIC 1CXLA 3H6JA 5CEZE 2BVUA 2YRZA 4CKVX 5CD3B 3WNLA 2FHBA 3H9YA 4P59L 4GRWE 3I6LE 3SKJL 4F37F 3LEYH 2ARWA 2YWZA 3CLEL 1NAKL 1EVTC 4R26H 5ID1B 4PRHA 3FFCA 3BEVB